3C63A

Tetrameric cytochrome cb562 (k34/h59/d62/h63/h73/a74/h77) assembly stabilized by interprotein zinc coordination
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
106
structure length
106
Chain Sequence
ADLEDNMETLNDNLKVIEKADNAAQVKDALTKMKAAALDAQKATPPKLEDKSPDSPEMHDFDHGFDILVGQIHAALHLANEGKVKEAQAAAEQLKTTCNACHQKYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Soluble cytochrome b562
publication title Metal-mediated self-assembly of protein superstructures: influence of secondary interactions on protein oligomerization and aggregation.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Electron transport
total genus 44
structure length 106
sequence length 106
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07361 Cytochrom_B562 Cytochrome b562
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 3c63A00
3QW1A 2YKZA 4CIPA 4ULVA 1YYJA 5JSLA 1CGNA 2XLHA 5B3IA 2YLDA 2YL0A 5JT4A 4JEBA 256BA 3U8PA 3TOMA 4IB4A 1RCPA 3M4CA 3HNLA 1JAFA 4U9EA 4JEAA 2XLDA 2XLEA 2J8WA 4IAQA 3C62A 3NMKA 5JLIA 2XLVA 2BC5A 3QVZA 1CPRA 3DE8A 1YYXA 5JUAA 4IARA 4N4WA 1QQ3A 5JP7A 1LM3B 2YL7A 1APCA 2YLIA 3ZQYA 2CCYA 2XM4A 5JRAA 4CJOA 1BBHA 1CGOA 3M79A 4CDYA 2J9BA 1QPUA 3NMIA 3HNKA 4JKVA 3QVYA 4NC3A 5JS5A 1MQVA 5JVEA 4D4XA 4N6HA 3L1MA 3DE9A 4CDVA 2XL8A 1YZCA 2YL3A 1GQAA 3NMJA 5AGFA 1E85A 4WGZA 3ZWIA 1NBBA 3HNIA 2XL6A 3FOPA 3FOOA 4WGYA 2XLOA 3C63A 2QLAA 3ZTZA 4JE9A 1E84A 1EKYA 3ZTMA 1E83A 1E86A 3M4BA 4U9DA 1A7VA 3IQ5A 3QW0A 3M15A 4CDAA 2YL1A 4D4NA 1S05A 1CPQA 2YLGA 3VRCA 3ZQVA 2XM0A 3HNJA 4CJGA 4EIYA 1M6TA 2XLWA 1YZAA 3TOLA 3IQ6A 2XLMA 4L6RA 4CX9A 4ER9A
chains in the Genus database with same CATH superfamily
3QW1A 1H6GA 1HMOA 2J7PA 1I4ZA 4FWVA 4JJGA 3VYWA 4DVYP 3ASNC 3TD7A 5T1DB 5DVWA 1OCZC 2V26A 5CI8A 2AU5A 2P6VA 2YVKA 4JW1A 2GDCA 2OOCA 2A68F 3PCVA 1VYIA 3U8PA 3TOMA 3CSKA 3LLKA 4IB4A 3JRTA 5L0JA 2MWQA 4EWCA 1JAFA 2H7OA 4E0HA 4C7OB 2PFDA 2ZXWC 3NKDA 1C02A 1KU2A 2NUTB 2HJ3A 4JCZA 5GPGB 3NRHA 2R7OA 3G50A 4Z9IA 2EPKX 4CS7A 1ZZPA 4KNVA 3DAFA 3ZSUA 3NMKA 1OXBA 2FGYA 2LP4A 4J7YA 3U2LA 3EPVA 3E9VA 3QZCA 2HSQA 1WTYA 4JURI 4K0DA 1PV3A 4N06A 4IAOA 1LI5A 2EILC 3QVZA 3DE8A 4MVOA 3RF3A 2H7VC 1YYXA 2CYDA 5B1BC 1T5OA 4N4WA 1KTMA 2YL7A 3ZQYA 2Y69C 4P9FA 1BDJB 2A0BA 3IHUA 4MTGA 1CGOA 2ZD9A 4RDAA 4YT4A 3EH2A 4CDYA 3TULA 2R7UA 2J9BA 1QPUA 4PR9A 2QE9A 3U5SA 4GQHA 4NTFA 3V7OA 2R7WA 5DLJA 1FTSA 2PP4A 3HNKA 3G4XA 1HW2A 4PFOA 3AQBA 4JVSA 1R4TA 2CW0F 1M2VB 2L81A 3QVYA 1V54C 4IJJA 1U89A 4NC3A 2R7TA 3GWLA 1WWPA 3Q6NA 1QZXA 2YZSA 2XXAB 3DI5A 3RQGA 3L1MA 1QSPA 4MTOA 1J8YF 2J9VA 2HFIA 2XL8A 3H2VA 1AUEA 2WB7A 1OCRC 5COFA 1ZU4A 3EHNA 3GEEA 4AL0A 2YRFA 1Z7Qc 3K33A 4BPMA 3S90A 5KYXA 2IM8A 5DS4A 2R03A 3LS1A 2LD6A 1ZHZA 5FCLA 4NY3A 5B3SC 3OWTA 3E70C 4MNDA 4Q5SF 2J0XA 3ATPA 4OINF 4YJWA 1MMAA 2H8AA 2RSEB 2Y3DA 3PMRA 2EIMC 3EH1A 5E2QA 1L7CA 3KYIA 3LNMB 3C63A 3J06A 3O10A 1Q0MA 3S0XA 2R7VA 3RVYA 4MVMA 3T6BA 3Q6MA 1BR2A 1V74B 2H7BA 1VYKA 3EG9B 4NQFA 1E84A 3K1IA 4PJLA 1YARO 3B29A 1FMVA 2XL4A 3GANA 2M64A 3JZ0A 3S84A 2IXNA 1E83A 5EK0A 3O39A 3M4BA 3WG7C 1JR8A 2GAQA 5HSWA 4LLEA 3QW0A 4X0RA 1TKNA 3NYJA 1LI7A 1MMGA 5A69A 2HJMA 2HMQA 3FAJA 1SF8A 3VM6A 1SMYF 4NTAA 1S05A 1OKKD 3L0IA 3VRCA 4MTFA 1D0XA 1D0YA 2JX0A 5KYYB 1QLEC 4ZLCA 1H9TA 1TQGA 5L0DA 4J30B 4NTBA 4G7HF 3C8GB 5L0IA 2OJED 4O6NA 3U3FA 3ABMC 1YA9A 2NUPA 3EJNA 3RW0A 3TOLA 3R7CA 1LPEA 2KC3A 4L6RA 1ZHXA 2Q9BA 1ZYRF 3GORA 3MLGA 3DJNB 2WVQA 2RD9A 3K6BA 3SXMA 2P7VA 4J7TA 1HY5A 1OR3A 2I15A 2E87A 1HW1A 2YKZA 2ZXPA 3S28A 4P9TA 3T6JA 4ULVA 3JCUQ 2X51A 1Q0KA 2PX3A 1I5NA 1CGNA 2HSBA 2NPUA 3EFOB 4BJ6A 4EHPA 2KGOA 1SZIA 4BJ6C 4YT2A 5F5HA 1Q0DA 4ANJA 3U0CA 3DAGA 3DM9B 3POVA 2A0UA 4MW8A 4EBKA 4AL1A 3SZRA 1ZHTA 2ETSA 4GEHA 4U5CE 4JJFA 2ASRA 3KMIA 3NYLA 4JC7A 2EIKC 4XEVA 4U9EA 2A69F 5KYUA 2R05A 5D91A 2OQMA 1M2OA 3DXJF 3MBGA 3RKOF 3X1OA 2W9YA 2Q9CA 3OA1A 4IAQA 4LLCA 1RMVA 3S27A 1WN0A 3TK0A 2XS1A 4DXWA 1H9GA 1EA8A 2IOQA 2BC5A 3MYFA 4OD4A 5E3AA 5F5FA 4E17A 4YWQA 1Z5ZA 3KKBA 4AE4A 4A4AA 2IYLD 1LM3B 3CQZA 1APCA 2P1AA 5JP7A 2IXOA 3JYHA 4G7OF 2LFDA 5EGYA 4OIOF 2B0JA 4BJ1A 1TWAA 4YT8A 2R7RA 4G7ZF 1MNEA 5L0CA 2IXPA 1LS1A 2HMZA 1RXQA 1ZHWA 2VASA 1Z6AA 3HLZA 1HE9A 2DYRC 4E0IA 2M4EA 5TJ5E 1TR2A 3BEHA 2HV7A 3AGTA 4RBNA 3UMHA 3ZG1A 3QMKA 2I8BA 2KYHA 4N6HA 4O79A 4D4XA 2PNOA 3W4YA 3DE9A 5DQZA 2ZPAA 2R7SA 3K1HA 3SXYA 3JSZA 1YZCA 2D4UA 2YL3A 4PJNA 4PK4A 4OIPF 3W8IA 1GQAA 4EBJA 5EHHA 2JD3A 3MX3A 2F22A 4WGZA 2VB6A 1ORJA 3LESA 3L34A 5A6KA 5FZTA 1QKRA 3C18A 3TQOA 3L8IA 3HKKA 4QDLA 4LACB 2XL6A 3FOPA 4XTKA 3RQFA 4BG0A 1ZHYA 2HKVA 4FAPB 3X2QC 1ZW3A 1RKCA 2Q3TA 2Y3HA 2YWAA 1DOVA 3DWWA 1FNTc 2EIJC 4ONSA 5BQGA 1OCOC 1U0BB 1JPNA 2YQYA 1LVKA 1O3UA 4YN0B 4JRZA 2O9XA 3ZTZA 1OW6A 3ZVRA 2PBEA 2QY9A 2OEXA 3UGOA 2A6EF 2NG1A 2AVKA 2Q4FA 3AOUA 4R32A 3NYMA 4U5HA 2VC9A 2GFHA 3T6GB 4DRHB 1ZVZA 2L7AA 5KYNA 3LEOA 3US6A 1AEPA 4U5GA 1O5HA 1Y6DA 4LERA 1C17M 1OW8A 1R5ID 1M57C 1LKXA 1B68A 4U9DA 5CI9A 1CGME 5A6BD 2YL1A 1WATA 2QTVA 3JTLO 1RKEA 3VAYA 4Q7CA 4W8PA 4CIHA 1I4YA 1T6IA 3DD7A 2LSEA 4BEMJ 1FAPB 2KK1A 2EPNA 3GEHA 3C8ZA 4XEKA 3S9OA 2UUIA 3JSEO 2EINC 2LQGA 1LE4A 3JT1A 4BJ5A 5KYXB 1Z23A 4EUKB 3K66A 1SR2A 2OEVA 4BJ5C 3RQEA 1YZAA 2FAPB 2GA0A 1D0ZA 1WOLA 2DYSC 4CS9A 3C8GD 3UNGC 4CX9A 3GWNA 2L9JA 1ZU5A 4XQ1A 1NFNA 3WHNA 2HV6A 2MHRA 3N0TA 3W8HA 3K1IC 1YDIA 3KPHA 2G3KA 3U2MA 1XZQA 1TWGA 2PX0A 4P6IC 1VK5A 1O87A 3HTKC 4JTAB 4MVUA 4U5BE 3EGXA 2NSGA 1MMDA 3U8VA 5B3IA 2NSFA 2YL0A 1GGQA 5JT4A 2W45A 256BA 2CGEA 2LK4A 1FFHA 3HJCA 3Q7LA 2KNHA 4JEBA 4YL3A 2X0CA 4Q4ZF 2Q9AA 1VTMP 1F1MA 1PD1A 1V55C 2OG2A 3HNLA 3KYJA 2L6GA 3I5PA 3M4CA 4I3MA 3U3BA 3UR3C 2UUHA 3ABLC 1G4WR 4MS2A 2MYSA 4CBEA 3H2UA 1EI7A 2JPUA 2C03A 1NFOA 3B0VC 1G4US 1D1CA 2XLEA 4E7ZA 2J9UA 2DGJA 3AG2C 1XWJA 2CNWD 1T6UA 3C62A 3DKAA 4IWBA 4Z9HA 3T9OA 4PACA 3TJ5A 3VF0A 4PJMA 2ZXRA 2WL8A 1IW7F 3B0PA 4MVSA 1N1CA 1CPRA 5JLIA 4MW3A 1TFOB 5JUAA 4W8KA 4LDRA 3C7JA 4HFKB 2GWWA 1A7EA 1UG7A 4E7SA 2B0HA 1VLTA 1HE1A 1WASA 2L6HA 2NUPB 2YLIA 3FMSA 2XM4A 3LEVA 1IZMA 3RIPA 4IRUA 2CDQA 3N2ZB 1V4AA 1BBHA 2OJQA 3CEXA 3M79A 4XPWA 4MVRA 3NDBB 4BEJA 1JPJA 5BQIA 1M56C 5L3QA 4HEAJ 3SXKA 4J32B 4I44A 1TFKB 2J7PD 4I1OB 5CIVA 1ORSC 1NSGB 1SYQA 3O55A 4JKVA 1NU9C 3CZ6A 1JOGA 5JS5A 2BE5F 3IQTA 4AX2A 1JMWA 1MQVA 4JCHA 4DRIB 5BUOA 5JVEA 2W4MA 1OKKA 3DZAA 5L0FA 3BRJA 4QI2A 1ORYA 2P0NA 4CDVA 5DQTA 3NMJA 5KYUB 3NG1A 1YVIA 3FHDA 5COMA 1T01A 1ZW2A 2KSFA 3TJ6A 1OCCC 2PF4E 3DM5A 5E3CA 1NBBA 4JZAA 4C3BA 4XPYA 4FX5A 1RJ9A 3DMDA 4WGYA 2WVOA 3N24A 3B9QA 3DJUB 5L0GA 3EGDA 2J46A 5A6AA 1JRAA 4Z9JA 3LLIA 5F28E 5KYWA 2XLOA 4AE4B 2XS8A 1J8MF 2VCBA 4MVQA 4YT5A 4DBRA 3U9MA 2WZFA 3V5ZA 1L3PA 3LAYA 4XLNF 1ST6A 2EPMX 3EGDB 4E18A 2QLAA 4G78A 3LNRA 1YAUO 4HFFB 3WAQA 4C3DA 1EKYA 4O6YA 3ZTMA 2VH3A 1VB5A 3FVYA 1VLSA 1E86A 4AK9A 1Y4CA 3S29A 5K0IA 3UMIA 4C7OA 5L3VA 2XSEA 3GM1A 3M15A 2NUTA 4QI0A 4CDAA 2V3CC 4N6CA 2A1DD 3K7DA 4DBQA 2J45A 2AWCA 4CS8A 2EPLX 3UGPA 1LIHA 4IGGA 2LFFA 2LIGA 2VCCA 4JIOA 4CS8C 2Z15A 4K1OA 2IBFA 1Z3IX 2G62A 3HNJA 4HE8D 4ZLDA 4KBLA 4OD5A 3V5YA 3V5XA 4U5EE 5T3WA 4M63A 2XLWA 4U5FE 3IQ6A 3M1CB 5E33A 2Q7RA 3EHMA 2KQ9A 1E2XA 2XLMA 3ABKC 3IEEA 3IPMO 2R7XA 2BL2A 4JTCB 4MVZA 1T6QA 3QTHA 4NCQA 4ER9A 3ASOC 2OKUA 1PD0A 3B71A 4CIPA 1FR0A 1D1AA 1YYJA 2KJGA 1NG1A 1PCXA 5JSLA 5A6JA 2TMVP 2XLHA 2YLDA 1M2VA 4O7GA 4K7BA 1TWCA 3ITFA 4O6MA 1Z63A 4LDQA 1H7IA 2XXAA 1RCPA 5IY5C 3AG1C 3EQLF 1Q0FA 5AC4A 1U6HA 5D92A 3GODA 1W2WA 2R02A 1RKEB 2HUJA 3JYYA 3LUTB 4JEAA 2XLDA 4OIRF 4EKWA 3SNHA 1EQ1A 1A0BA 1D1BA 2J8WA 4YL1A 3U9JA 1FMWA 3KH2A 4CSAA 4H4KC 2XLVA 1G8XA 1VMAA 2QUPA 1GM5A 5L0HA 4CSAC 1A41A 3WODF 4CS9C 2Y39A 1VOMA 5DS5A 1K05A 3ZC4A 1OR2A 3A9CA 4IARA 3AGUA 1QQ3A 2DB4A 2L6FA 3JRMO 1OXKA 1YLMA 1MMNA 2CCYA 2WZGA 5JRAA 1MNDA 4JTDB 1TWHA 2R7QA 3ECSA 4H54A 3EZIA 4C3EA 4CJOA 2J9WA 5BQHA 4DOZA 2DI3A 3AJMA 2C04A 1XZPA 3LJBA 3EG9A 3AG4C 4YK5A 5COGA 2KW3C 4WABA 4XLPF 3A11A 3W2WA 1HMDA 2ICWG 2R25A 3NMIA 4EBBA 1K04A 2D5RB 3AQCA 1LE2A 1K40A 2Q00A 1UFBA 5A6BA 3EGXB 3F47A 3MYIA 2FFHA 1LS4A 4PFPA 1G5ZA 4U5DE 4B6IA 2W4BA 2WVNA 4RD9A 2Y3GA 3LS0A 3KL4A 1KNYA 3W2VA 4OIQF 4F4BA 4G0HA 1Q0GA 2OU6A 3R2PA 4BJTA 2P61A 1NLXA 3EZHA 5AGFA 1E85A 3PDMP 3I4UA 1AVOB 3H65A 1OW7A 5KYYA 2G3VA 4KC9A 3ZWIA 3HNIA 2EPOA 3C8GA 3IQCA 4KI2A 3FOOA 4PJJA 4DRJB 4DVZA 1C03A 2HZ8A 3T4RA 3UMKA 3ZDLA 4DJ9A 3SXZA 1WGWA 3AG3C 1BR1A 3ZIBA 3SP1A 2J0WA 2Y3BA 3GM2A 4A2NB 3I5QA 4MQ9F 1BR4A 4LDKA 3EFOA 2WZLA 5B1AC 2IXMA 2YEVA 3NKEA 3OEOA 2QNLA 4JE9A 3PHF2 3FDQA 1YJGA 4XEFA 3L8JA 1S7ZA 1NZEA 2AP3A 4FESA 3O6XA 1A7VA 1NU7D 1YA7O 3IQ5A 3FAPB 5AC5A 4XWJA 2CNWA 3FXHA 1FFTC 2XRHA 3GEIA 4D4NA 2AWYA 1A7DA 4GYTA 4KNWA 2ZXOA 3F46A 1CPQA 3RH3A 1T9KA 1QVXA 1GS9A 2HS5A 2YLGA 4WJ0A 3ZQVA 3CAXA 2LCHA 3SEOA 2XM0A 3RYLA 5T3TA 4UDVA 2R9RB 2YHSA 3B0UX 4CJGA 4EIYA 5HV9A 5DS6A 3MFNA 1M6TA 1DOWA 3Q7GA 4YL0A 1RJ9B 3RFYA 2A6HF 2OCCC 3GM3A 4XPXA 5KYWB 2VCAA 1BZ4A 1OQCA 3SYNA 4ULWA 3RVZA 4I1MA 3G4ZA
chains in the Genus database with same CATH topology
3QW1A 2YKZA 4CIPA 4ULVA 1YYJA 5JSLA 1CGNA 2XLHA 5B3IA 2YLDA 2YL0A 5JT4A 4JEBA 256BA 3U8PA 3TOMA 4IB4A 1RCPA 3M4CA 3HNLA 1JAFA 4U9EA 4JEAA 2XLDA 2XLEA 2J8WA 4IAQA 3C62A 3NMKA 5JLIA 2XLVA 2BC5A 3QVZA 1CPRA 3DE8A 1YYXA 5JUAA 4IARA 4N4WA 1QQ3A 5JP7A 1LM3B 2YL7A 1APCA 2YLIA 3ZQYA 2CCYA 2XM4A 5JRAA 4CJOA 1BBHA 1CGOA 3M79A 4CDYA 2J9BA 1QPUA 3NMIA 3HNKA 4JKVA 3QVYA 4NC3A 5JS5A 1MQVA 5JVEA 4D4XA 4N6HA 3L1MA 3DE9A 4CDVA 2XL8A 1YZCA 2YL3A 1GQAA 3NMJA 5AGFA 1E85A 4WGZA 3ZWIA 1NBBA 3HNIA 2XL6A 3FOPA 3FOOA 4WGYA 2XLOA 3C63A 2QLAA 3ZTZA 4JE9A 1E84A 1EKYA 3ZTMA 1E83A 1E86A 3M4BA 4U9DA 1A7VA 3IQ5A 3QW0A 3M15A 4CDAA 2YL1A 4D4NA 1S05A 1CPQA 2YLGA 3VRCA 3ZQVA 2XM0A 3HNJA 4CJGA 4EIYA 1M6TA 2XLWA 1YZAA 3TOLA 3IQ6A 2XLMA 4L6RA 4CX9A 4ER9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QW1 A;  2YKZ A;  4CIP A;  4ULV A;  1YYJ A;  5JSL A;  1CGN A;  2XLH A;  5B3I A;  2YLD A;  2YL0 A;  5JT4 A;  4JEB A;  256B A;  3U8P A;  3TOM A;  4IB4 A;  1RCP A;  3M4C A;  3HNL A;  1JAF A;  4U9E A;  4JEA A;  2XLD A;  2XLE A;  2J8W A;  4IAQ A;  3C62 A;  3NMK A;  5JLI A;  2XLV A;  2BC5 A;  3QVZ A;  1CPR A;  3DE8 A;  1YYX A;  5JUA A;  4IAR A;  4N4W A;  1QQ3 A;  5JP7 A;  1LM3 B;  2YL7 A;  1APC A;  2YLI A;  3ZQY A;  2CCY A;  2XM4 A;  5JRA A;  4CJO A;  1BBH A;  1CGO A;  3M79 A;  4CDY A;  2J9B A;  1QPU A;  3NMI A;  3HNK A;  4JKV A;  3QVY A;  4NC3 A;  5JS5 A;  1MQV A;  5JVE A;  4D4X A;  4N6H A;  3L1M A;  3DE9 A;  4CDV A;  2XL8 A;  1YZC A;  2YL3 A;  1GQA A;  3NMJ A;  5AGF A;  1E85 A;  4WGZ A;  3ZWI A;  1NBB A;  3HNI A;  2XL6 A;  3FOP A;  3FOO A;  4WGY A;  2XLO A;  3C63 A;  2QLA A;  3ZTZ A;  4JE9 A;  1E84 A;  1EKY A;  3ZTM A;  1E83 A;  1E86 A;  3M4B A;  4U9D A;  1A7V A;  3IQ5 A;  3QW0 A;  3M15 A;  4CDA A;  2YL1 A;  4D4N A;  1S05 A;  1CPQ A;  2YLG A;  3VRC A;  3ZQV A;  2XM0 A;  3HNJ A;  4CJG A;  4EIY A;  1M6T A;  2XLW A;  1YZA A;  3TOL A;  3IQ6 A;  2XLM A;  4L6R A;  4CX9 A;  4ER9 A; 
#chains in the Genus database with same CATH topology
 3QW1 A;  1H6G A;  1HMO A;  2J7P A;  1I4Z A;  4FWV A;  4JJG A;  3VYW A;  4DVY P;  3ASN C;  3TD7 A;  5T1D B;  5DVW A;  1OCZ C;  2V26 A;  5CI8 A;  2AU5 A;  2P6V A;  2YVK A;  4JW1 A;  2GDC A;  2OOC A;  2A68 F;  3PCV A;  1VYI A;  3U8P A;  3TOM A;  3CSK A;  3LLK A;  4IB4 A;  3JRT A;  5L0J A;  2MWQ A;  4EWC A;  1JAF A;  2H7O A;  4E0H A;  4C7O B;  2PFD A;  2ZXW C;  3NKD A;  1C02 A;  1KU2 A;  2NUT B;  2HJ3 A;  4JCZ A;  5GPG B;  3NRH A;  2R7O A;  3G50 A;  4Z9I A;  2EPK X;  4CS7 A;  1ZZP A;  4KNV A;  3DAF A;  3ZSU A;  3NMK A;  1OXB A;  2FGY A;  2LP4 A;  4J7Y A;  3U2L A;  3EPV A;  3E9V A;  3QZC A;  2HSQ A;  1WTY A;  4JUR I;  4K0D A;  1PV3 A;  4N06 A;  4IAO A;  1LI5 A;  2EIL C;  3QVZ A;  3DE8 A;  4MVO A;  3RF3 A;  2H7V C;  1YYX A;  2CYD A;  5B1B C;  1T5O A;  4N4W A;  1KTM A;  2YL7 A;  3ZQY A;  2Y69 C;  4P9F A;  1BDJ B;  2A0B A;  3IHU A;  4MTG A;  1CGO A;  2ZD9 A;  4RDA A;  4YT4 A;  3EH2 A;  4CDY A;  3TUL A;  2R7U A;  2J9B A;  1QPU A;  4PR9 A;  2QE9 A;  3U5S A;  4GQH A;  4NTF A;  3V7O A;  2R7W A;  5DLJ A;  1FTS A;  2PP4 A;  3HNK A;  3G4X A;  1HW2 A;  4PFO A;  3AQB A;  4JVS A;  1R4T A;  2CW0 F;  1M2V B;  2L81 A;  3QVY A;  1V54 C;  4IJJ A;  1U89 A;  4NC3 A;  2R7T A;  3GWL A;  1WWP A;  3Q6N A;  1QZX A;  2YZS A;  2XXA B;  3DI5 A;  3RQG A;  3L1M A;  1QSP A;  4MTO A;  1J8Y F;  2J9V A;  2HFI A;  2XL8 A;  3H2V A;  1AUE A;  2WB7 A;  1OCR C;  5COF A;  1ZU4 A;  3EHN A;  3GEE A;  4AL0 A;  2YRF A;  1Z7Q c;  3K33 A;  4BPM A;  3S90 A;  5KYX A;  2IM8 A;  5DS4 A;  2R03 A;  3LS1 A;  2LD6 A;  1ZHZ A;  5FCL A;  4NY3 A;  5B3S C;  3OWT A;  3E70 C;  4MND A;  4Q5S F;  2J0X A;  3ATP A;  4OIN F;  4YJW A;  1MMA A;  2H8A A;  2RSE B;  2Y3D A;  3PMR A;  2EIM C;  3EH1 A;  5E2Q A;  1L7C A;  3KYI A;  3LNM B;  3C63 A;  3J06 A;  3O10 A;  1Q0M A;  3S0X A;  2R7V A;  3RVY A;  4MVM A;  3T6B A;  3Q6M A;  1BR2 A;  1V74 B;  2H7B A;  1VYK A;  3EG9 B;  4NQF A;  1E84 A;  3K1I A;  4PJL A;  1YAR O;  3B29 A;  1FMV A;  2XL4 A;  3GAN A;  2M64 A;  3JZ0 A;  3S84 A;  2IXN A;  1E83 A;  5EK0 A;  3O39 A;  3M4B A;  3WG7 C;  1JR8 A;  2GAQ A;  5HSW A;  4LLE A;  3QW0 A;  4X0R A;  1TKN A;  3NYJ A;  1LI7 A;  1MMG A;  5A69 A;  2HJM A;  2HMQ A;  3FAJ A;  1SF8 A;  3VM6 A;  1SMY F;  4NTA A;  1S05 A;  1OKK D;  3L0I A;  3VRC A;  4MTF A;  1D0X A;  1D0Y A;  2JX0 A;  5KYY B;  1QLE C;  4ZLC A;  1H9T A;  1TQG A;  5L0D A;  4J30 B;  4NTB A;  4G7H F;  3C8G B;  5L0I A;  2OJE D;  4O6N A;  3U3F A;  3ABM C;  1YA9 A;  2NUP A;  3EJN A;  3RW0 A;  3TOL A;  3R7C A;  1LPE A;  2KC3 A;  4L6R A;  1ZHX A;  2Q9B A;  1ZYR F;  3GOR A;  3MLG A;  3DJN B;  2WVQ A;  2RD9 A;  3K6B A;  3SXM A;  2P7V A;  4J7T A;  1HY5 A;  1OR3 A;  2I15 A;  2E87 A;  1HW1 A;  2YKZ A;  2ZXP A;  3S28 A;  4P9T A;  3T6J A;  4ULV A;  3JCU Q;  2X51 A;  1Q0K A;  2PX3 A;  1I5N A;  1CGN A;  2HSB A;  2NPU A;  3EFO B;  4BJ6 A;  4EHP A;  2KGO A;  1SZI A;  4BJ6 C;  4YT2 A;  5F5H A;  1Q0D A;  4ANJ A;  3U0C A;  3DAG A;  3DM9 B;  3POV A;  2A0U A;  4MW8 A;  4EBK A;  4AL1 A;  3SZR A;  1ZHT A;  2ETS A;  4GEH A;  4U5C E;  4JJF A;  2ASR A;  3KMI A;  3NYL A;  4JC7 A;  2EIK C;  4XEV A;  4U9E A;  2A69 F;  5KYU A;  2R05 A;  5D91 A;  2OQM A;  1M2O A;  3DXJ F;  3MBG A;  3RKO F;  3X1O A;  2W9Y A;  2Q9C A;  3OA1 A;  4IAQ A;  4LLC A;  1RMV A;  3S27 A;  1WN0 A;  3TK0 A;  2XS1 A;  4DXW A;  1H9G A;  1EA8 A;  2IOQ A;  2BC5 A;  3MYF A;  4OD4 A;  5E3A A;  5F5F A;  4E17 A;  4YWQ A;  1Z5Z A;  3KKB A;  4AE4 A;  4A4A A;  2IYL D;  1LM3 B;  3CQZ A;  1APC A;  2P1A A;  5JP7 A;  2IXO A;  3JYH A;  4G7O F;  2LFD A;  5EGY A;  4OIO F;  2B0J A;  4BJ1 A;  1TWA A;  4YT8 A;  2R7R A;  4G7Z F;  1MNE A;  5L0C A;  2IXP A;  1LS1 A;  2HMZ A;  1RXQ A;  1ZHW A;  2VAS A;  1Z6A A;  3HLZ A;  1HE9 A;  2DYR C;  4E0I A;  2M4E A;  5TJ5 E;  1TR2 A;  3BEH A;  2HV7 A;  3AGT A;  4RBN A;  3UMH A;  3ZG1 A;  3QMK A;  2I8B A;  2KYH A;  4N6H A;  4O79 A;  4D4X A;  2PNO A;  3W4Y A;  3DE9 A;  5DQZ A;  2ZPA A;  2R7S A;  3K1H A;  3SXY A;  3JSZ A;  1YZC A;  2D4U A;  2YL3 A;  4PJN A;  4PK4 A;  4OIP F;  3W8I A;  1GQA A;  4EBJ A;  5EHH A;  2JD3 A;  3MX3 A;  2F22 A;  4WGZ A;  2VB6 A;  1ORJ A;  3LES A;  3L34 A;  5A6K A;  5FZT A;  1QKR A;  3C18 A;  3TQO A;  3L8I A;  3HKK A;  4QDL A;  4LAC B;  2XL6 A;  3FOP A;  4XTK A;  3RQF A;  4BG0 A;  1ZHY A;  2HKV A;  4FAP B;  3X2Q C;  1ZW3 A;  1RKC A;  2Q3T A;  2Y3H A;  2YWA A;  1DOV A;  3DWW A;  1FNT c;  2EIJ C;  4ONS A;  5BQG A;  1OCO C;  1U0B B;  1JPN A;  2YQY A;  1LVK A;  1O3U A;  4YN0 B;  4JRZ A;  2O9X A;  3ZTZ A;  1OW6 A;  3ZVR A;  2PBE A;  2QY9 A;  2OEX A;  3UGO A;  2A6E F;  2NG1 A;  2AVK A;  2Q4F A;  3AOU A;  4R32 A;  3NYM A;  4U5H A;  2VC9 A;  2GFH A;  3T6G B;  4DRH B;  1ZVZ A;  2L7A A;  5KYN A;  3LEO A;  3US6 A;  1AEP A;  4U5G A;  1O5H A;  1Y6D A;  4LER A;  1C17 M;  1OW8 A;  1R5I D;  1M57 C;  1LKX A;  1B68 A;  4U9D A;  5CI9 A;  1CGM E;  5A6B D;  2YL1 A;  1WAT A;  2QTV A;  3JTL O;  1RKE A;  3VAY A;  4Q7C A;  4W8P A;  4CIH A;  1I4Y A;  1T6I A;  3DD7 A;  2LSE A;  4BEM J;  1FAP B;  2KK1 A;  2EPN A;  3GEH A;  3C8Z A;  4XEK A;  3S9O A;  2UUI A;  3JSE O;  2EIN C;  2LQG A;  1LE4 A;  3JT1 A;  4BJ5 A;  5KYX B;  1Z23 A;  4EUK B;  3K66 A;  1SR2 A;  2OEV A;  4BJ5 C;  3RQE A;  1YZA A;  2FAP B;  2GA0 A;  1D0Z A;  1WOL A;  2DYS C;  4CS9 A;  3C8G D;  3UNG C;  4CX9 A;  3GWN A;  2L9J A;  1ZU5 A;  4XQ1 A;  1NFN A;  3WHN A;  2HV6 A;  2MHR A;  3N0T A;  3W8H A;  3K1I C;  1YDI A;  3KPH A;  2G3K A;  3U2M A;  1XZQ A;  1TWG A;  2PX0 A;  4P6I C;  1VK5 A;  1O87 A;  3HTK C;  4JTA B;  4MVU A;  4U5B E;  3EGX A;  2NSG A;  1MMD A;  3U8V A;  5B3I A;  2NSF A;  2YL0 A;  1GGQ A;  5JT4 A;  2W45 A;  256B A;  2CGE A;  2LK4 A;  1FFH A;  3HJC A;  3Q7L A;  2KNH A;  4JEB A;  4YL3 A;  2X0C A;  4Q4Z F;  2Q9A A;  1VTM P;  1F1M A;  1PD1 A;  1V55 C;  2OG2 A;  3HNL A;  3KYJ A;  2L6G A;  3I5P A;  3M4C A;  4I3M A;  3U3B A;  3UR3 C;  2UUH A;  3ABL C;  1G4W R;  4MS2 A;  2MYS A;  4CBE A;  3H2U A;  1EI7 A;  2JPU A;  2C03 A;  1NFO A;  3B0V C;  1G4U S;  1D1C A;  2XLE A;  4E7Z A;  2J9U A;  2DGJ A;  3AG2 C;  1XWJ A;  2CNW D;  1T6U A;  3C62 A;  3DKA A;  4IWB A;  4Z9H A;  3T9O A;  4PAC A;  3TJ5 A;  3VF0 A;  4PJM A;  2ZXR A;  2WL8 A;  1IW7 F;  3B0P A;  4MVS A;  1N1C A;  1CPR A;  5JLI A;  4MW3 A;  1TFO B;  5JUA A;  4W8K A;  4LDR A;  3C7J A;  4HFK B;  2GWW A;  1A7E A;  1UG7 A;  4E7S A;  2B0H A;  1VLT A;  1HE1 A;  1WAS A;  2L6H A;  2NUP B;  2YLI A;  3FMS A;  2XM4 A;  3LEV A;  1IZM A;  3RIP A;  4IRU A;  2CDQ A;  3N2Z B;  1V4A A;  1BBH A;  2OJQ A;  3CEX A;  3M79 A;  4XPW A;  4MVR A;  3NDB B;  4BEJ A;  1JPJ A;  5BQI A;  1M56 C;  5L3Q A;  4HEA J;  3SXK A;  4J32 B;  4I44 A;  1TFK B;  2J7P D;  4I1O B;  5CIV A;  1ORS C;  1NSG B;  1SYQ A;  3O55 A;  4JKV A;  1NU9 C;  3CZ6 A;  1JOG A;  5JS5 A;  2BE5 F;  3IQT A;  4AX2 A;  1JMW A;  1MQV A;  4JCH A;  4DRI B;  5BUO A;  5JVE A;  2W4M A;  1OKK A;  3DZA A;  5L0F A;  3BRJ A;  4QI2 A;  1ORY A;  2P0N A;  4CDV A;  5DQT A;  3NMJ A;  5KYU B;  3NG1 A;  1YVI A;  3FHD A;  5COM A;  1T01 A;  1ZW2 A;  2KSF A;  3TJ6 A;  1OCC C;  2PF4 E;  3DM5 A;  5E3C A;  1NBB A;  4JZA A;  4C3B A;  4XPY A;  4FX5 A;  1RJ9 A;  3DMD A;  4WGY A;  2WVO A;  3N24 A;  3B9Q A;  3DJU B;  5L0G A;  3EGD A;  2J46 A;  5A6A A;  1JRA A;  4Z9J A;  3LLI A;  5F28 E;  5KYW A;  2XLO A;  4AE4 B;  2XS8 A;  1J8M F;  2VCB A;  4MVQ A;  4YT5 A;  4DBR A;  3U9M A;  2WZF A;  3V5Z A;  1L3P A;  3LAY A;  4XLN F;  1ST6 A;  2EPM X;  3EGD B;  4E18 A;  2QLA A;  4G78 A;  3LNR A;  1YAU O;  4HFF B;  3WAQ A;  4C3D A;  1EKY A;  4O6Y A;  3ZTM A;  2VH3 A;  1VB5 A;  3FVY A;  1VLS A;  1E86 A;  4AK9 A;  1Y4C A;  3S29 A;  5K0I A;  3UMI A;  4C7O A;  5L3V A;  2XSE A;  3GM1 A;  3M15 A;  2NUT A;  4QI0 A;  4CDA A;  2V3C C;  4N6C A;  2A1D D;  3K7D A;  4DBQ A;  2J45 A;  2AWC A;  4CS8 A;  2EPL X;  3UGP A;  1LIH A;  4IGG A;  2LFF A;  2LIG A;  2VCC A;  4JIO A;  4CS8 C;  2Z15 A;  4K1O A;  2IBF A;  1Z3I X;  2G62 A;  3HNJ A;  4HE8 D;  4ZLD A;  4KBL A;  4OD5 A;  3V5Y A;  3V5X A;  4U5E E;  5T3W A;  4M63 A;  2XLW A;  4U5F E;  3IQ6 A;  3M1C B;  5E33 A;  2Q7R A;  3EHM A;  2KQ9 A;  1E2X A;  2XLM A;  3ABK C;  3IEE A;  3IPM O;  2R7X A;  2BL2 A;  4JTC B;  4MVZ A;  1T6Q A;  3QTH A;  4NCQ A;  4ER9 A;  3ASO C;  2OKU A;  1PD0 A;  3B71 A;  4CIP A;  1FR0 A;  1D1A A;  1YYJ A;  2KJG A;  1NG1 A;  1PCX A;  5JSL A;  5A6J A;  2TMV P;  2XLH A;  2YLD A;  1M2V A;  4O7G A;  4K7B A;  1TWC A;  3ITF A;  4O6M A;  1Z63 A;  4LDQ A;  1H7I A;  2XXA A;  1RCP A;  5IY5 C;  3AG1 C;  3EQL F;  1Q0F A;  5AC4 A;  1U6H A;  5D92 A;  3GOD A;  1W2W A;  2R02 A;  1RKE B;  2HUJ A;  3JYY A;  3LUT B;  4JEA A;  2XLD A;  4OIR F;  4EKW A;  3SNH A;  1EQ1 A;  1A0B A;  1D1B A;  2J8W A;  4YL1 A;  3U9J A;  1FMW A;  3KH2 A;  4CSA A;  4H4K C;  2XLV A;  1G8X A;  1VMA A;  2QUP A;  1GM5 A;  5L0H A;  4CSA C;  1A41 A;  3WOD F;  4CS9 C;  2Y39 A;  1VOM A;  5DS5 A;  1K05 A;  3ZC4 A;  1OR2 A;  3A9C A;  4IAR A;  3AGU A;  1QQ3 A;  2DB4 A;  2L6F A;  3JRM O;  1OXK A;  1YLM A;  1MMN A;  2CCY A;  2WZG A;  5JRA A;  1MND A;  4JTD B;  1TWH A;  2R7Q A;  3ECS A;  4H54 A;  3EZI A;  4C3E A;  4CJO A;  2J9W A;  5BQH A;  4DOZ A;  2DI3 A;  3AJM A;  2C04 A;  1XZP A;  3LJB A;  3EG9 A;  3AG4 C;  4YK5 A;  5COG A;  2KW3 C;  4WAB A;  4XLP F;  3A11 A;  3W2W A;  1HMD A;  2ICW G;  2R25 A;  3NMI A;  4EBB A;  1K04 A;  2D5R B;  3AQC A;  1LE2 A;  1K40 A;  2Q00 A;  1UFB A;  5A6B A;  3EGX B;  3F47 A;  3MYI A;  2FFH A;  1LS4 A;  4PFP A;  1G5Z A;  4U5D E;  4B6I A;  2W4B A;  2WVN A;  4RD9 A;  2Y3G A;  3LS0 A;  3KL4 A;  1KNY A;  3W2V A;  4OIQ F;  4F4B A;  4G0H A;  1Q0G A;  2OU6 A;  3R2P A;  4BJT A;  2P61 A;  1NLX A;  3EZH A;  5AGF A;  1E85 A;  3PDM P;  3I4U A;  1AVO B;  3H65 A;  1OW7 A;  5KYY A;  2G3V A;  4KC9 A;  3ZWI A;  3HNI A;  2EPO A;  3C8G A;  3IQC A;  4KI2 A;  3FOO A;  4PJJ A;  4DRJ B;  4DVZ A;  1C03 A;  2HZ8 A;  3T4R A;  3UMK A;  3ZDL A;  4DJ9 A;  3SXZ A;  1WGW A;  3AG3 C;  1BR1 A;  3ZIB A;  3SP1 A;  2J0W A;  2Y3B A;  3GM2 A;  4A2N B;  3I5Q A;  4MQ9 F;  1BR4 A;  4LDK A;  3EFO A;  2WZL A;  5B1A C;  2IXM A;  2YEV A;  3NKE A;  3OEO A;  2QNL A;  4JE9 A;  3PHF 2;  3FDQ A;  1YJG A;  4XEF A;  3L8J A;  1S7Z A;  1NZE A;  2AP3 A;  4FES A;  3O6X A;  1A7V A;  1NU7 D;  1YA7 O;  3IQ5 A;  3FAP B;  5AC5 A;  4XWJ A;  2CNW A;  3FXH A;  1FFT C;  2XRH A;  3GEI A;  4D4N A;  2AWY A;  1A7D A;  4GYT A;  4KNW A;  2ZXO A;  3F46 A;  1CPQ A;  3RH3 A;  1T9K A;  1QVX A;  1GS9 A;  2HS5 A;  2YLG A;  4WJ0 A;  3ZQV A;  3CAX A;  2LCH A;  3SEO A;  2XM0 A;  3RYL A;  5T3T A;  4UDV A;  2R9R B;  2YHS A;  3B0U X;  4CJG A;  4EIY A;  5HV9 A;  5DS6 A;  3MFN A;  1M6T A;  1DOW A;  3Q7G A;  4YL0 A;  1RJ9 B;  3RFY A;  2A6H F;  2OCC C;  3GM3 A;  4XPX A;  5KYW B;  2VCA A;  1BZ4 A;  1OQC A;  3SYN A;  4ULW A;  3RVZ A;  4I1M A;  3G4Z A; 
#chains in the Genus database with same CATH homology
 3QW1 A;  2YKZ A;  4CIP A;  4ULV A;  1YYJ A;  5JSL A;  1CGN A;  2XLH A;  5B3I A;  2YLD A;  2YL0 A;  5JT4 A;  4JEB A;  256B A;  3U8P A;  3TOM A;  4IB4 A;  1RCP A;  3M4C A;  3HNL A;  1JAF A;  4U9E A;  4JEA A;  2XLD A;  2XLE A;  2J8W A;  4IAQ A;  3C62 A;  3NMK A;  5JLI A;  2XLV A;  2BC5 A;  3QVZ A;  1CPR A;  3DE8 A;  1YYX A;  5JUA A;  4IAR A;  4N4W A;  1QQ3 A;  5JP7 A;  1LM3 B;  2YL7 A;  1APC A;  2YLI A;  3ZQY A;  2CCY A;  2XM4 A;  5JRA A;  4CJO A;  1BBH A;  1CGO A;  3M79 A;  4CDY A;  2J9B A;  1QPU A;  3NMI A;  3HNK A;  4JKV A;  3QVY A;  4NC3 A;  5JS5 A;  1MQV A;  5JVE A;  4D4X A;  4N6H A;  3L1M A;  3DE9 A;  4CDV A;  2XL8 A;  1YZC A;  2YL3 A;  1GQA A;  3NMJ A;  5AGF A;  1E85 A;  4WGZ A;  3ZWI A;  1NBB A;  3HNI A;  2XL6 A;  3FOP A;  3FOO A;  4WGY A;  2XLO A;  3C63 A;  2QLA A;  3ZTZ A;  4JE9 A;  1E84 A;  1EKY A;  3ZTM A;  1E83 A;  1E86 A;  3M4B A;  4U9D A;  1A7V A;  3IQ5 A;  3QW0 A;  3M15 A;  4CDA A;  2YL1 A;  4D4N A;  1S05 A;  1CPQ A;  2YLG A;  3VRC A;  3ZQV A;  2XM0 A;  3HNJ A;  4CJG A;  4EIY A;  1M6T A;  2XLW A;  1YZA A;  3TOL A;  3IQ6 A;  2XLM A;  4L6R A;  4CX9 A;  4ER9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...