3C63A

Tetrameric cytochrome cb562 (k34/h59/d62/h63/h73/a74/h77) assembly stabilized by interprotein zinc coordination
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
106
structure length
106
Chain Sequence
ADLEDNMETLNDNLKVIEKADNAAQVKDALTKMKAAALDAQKATPPKLEDKSPDSPEMHDFDHGFDILVGQIHAALHLANEGKVKEAQAAAEQLKTTCNACHQKYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords Soluble cytochrome b562
publication title Metal-mediated self-assembly of protein superstructures: influence of secondary interactions on protein oligomerization and aggregation.
pubmed doi rcsb
source organism Escherichia coli
total genus 44
structure length 106
sequence length 106
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07361 Cytochrom_B562 Cytochrome b562
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 3c63A00
1BBHA 4IAQA 4IARA 4CDYA 1QPUA 3ZQYA 4CJOA 4JEAA 4L6RA 1YYJA 5JS5A 2YL0A 3TOMA 3DE8A 5JSLA 1JAFA 3ZQVA 3C63A 1E83A 2J9BA 4NC3A 3NMJA 3HNKA 5JVEA 4U9EA 4JE9A 4D4XA 3QVYA 3FOOA 1APCA 3IQ6A 1MQVA 3VRCA 3NMIA 2XLWA 3U8PA 1M6TA 1S05A 2YLGA 4CDVA 3M4CA 2XLOA 4ULVA 4CIPA 4N4WA 1QQ3A 1CGOA 1YZCA 3M15A 4JEBA 5JRAA 4IB4A 1E85A 3HNJA 3ZWIA 5B3IA 1E86A 2BC5A 2J8WA 2YL7A 4CX9A 2XLHA 2XM0A 1RCPA 4D4NA 4CJGA 5AGFA 3TOLA 2XLMA 1NBBA 3NMKA 3FOPA 3HNLA 1CPQA 4WGZA 5JLIA 4N6HA 2XLDA 256BA 4ER9A 4WGYA 1CPRA 1A7VA 2YKZA 2XLVA 3QW0A 2YL1A 1EKYA 2YLIA 3C62A 5JUAA 2YLDA 1LM3B 3IQ5A 3M4BA 3QVZA 4U9DA 3HNIA 4CDAA 2YL3A 2XM4A 1YYXA 1CGNA 2CCYA 2XL8A 2XLEA 5JT4A 3L1MA 4JKVA 3M79A 1GQAA 4EIYA 2XL6A 5JP7A 2QLAA 3ZTZA 1E84A 3DE9A 3ZTMA 3QW1A 1YZAA
chains in the Genus database with same CATH superfamily
1T6QA 3K1IC 3SP1A 3AGTA 2AVKA 1U89A 3MFNA 4JZAA 2MYSA 2P7VA 1ZU5A 1LI5A 2WZLA 1ZVZA 4H54A 2EINC 1OCRC 1FMWA 1ZYRF 4Z9HA 4QI0A 3N2ZB 4BG0A 1C02A 2JX0A 4HE8D 4YL1A 1Z6AA 3ZQYA 4C7OA 3Q6NA 4XPXA 2ICWG 1IW7F 3O39A 1DOWA 3KH2A 3G4ZA 1ST6A 3N24A 3DJUB 4PJLA 5KYWA 5BUOA 5KYYB 2NPUA 2AWCA 1A41A 4MS2A 4LERA 3LNRA 4CS9C 1RJ9A 2Y3BA 4KNWA 3O10A 3ZQVA 1K05A 3K1HA 2OU6A 4U5GA 1HE1A 2OQMA 3DAGA 3FAPB 4ZLCA 3C8GD 2L6GA 1J8YF 4Q7CA 4I3MA 4U9EA 2O9XA 4EBJA 2ZXPA 1R4TA 1G4WR 1TWAA 3FXHA 1B68A 3NRHA 4O6NA 1V55C 4PFOA 1L7CA 3B0PA 1KNYA 3UMIA 5E33A 1KU2A 1FFHA 2AU5A 2EPMX 2Z15A 4XWJA 1MQVA 3VRCA 2YLGA 4XPWA 4LLEA 4ULVA 2XLOA 4OD4A 1WATA 1YARO 3SXYA 1DOVA 3FAJA 4MNDA 1OW7A 3DJNB 3X1OA 1QSPA 1FR0A 1MMAA 1BDJB 4YL0A 3WODF 4IB4A 3TD7A 3HNJA 2XS1A 3S29A 3LAYA 1LIHA 2BC5A 4DRIB 3VAYA 5BQIA 3LJBA 2OOCA 5AC5A 4CX9A 1RKCA 3CSKA 1XWJA 2J45A 2MWQA 3OWTA 1FNTc 4U5HA 3W8HA 4CS8C 1NSGB 3S28A 4XLPF 3WHNA 1PD1A 2PX0A 5COFA 1QZXA 3RF3A 1GGQA 4G78A 4DBQA 1HMDA 3U2MA 4EKWA 2LP4A 1Z5ZA 2QE9A 2WZGA 3S84A 4AE4A 1WWPA 3SYNA 4F4BA 3BEHA 4NTBA 1OXBA 1V54C 4NCQA 4OIRF 2DI3A 3SZRA 3ZDLA 4WGZA 3RQGA 4J30B 2CDQA 1TFOB 2XLDA 5DVWA 4YT4A 5KYUB 4ER9A 1LI7A 2CYDA 4P9TA 1TFKB 1WTYA 1EKYA 2P1AA 4LDRA 1U6HA 1MNDA 2RSEB 2WVQA 2YLIA 1JRAA 1VYKA 2VASA 4IRUA 4N06A 3SXKA 1WASA 2XXAB 3DD7A 3S27A 3C8ZA 2W4BA 3QVZA 1M2VA 3TQOA 3HNIA 2Y69C 1E2XA 3ZVRA 3ABMC 3QZCA 2JPUA 2XM4A 3ABKC 4JIOA 3GEEA 2J7PA 4YK5A 4JKVA 1RKEA 1D1AA 2EPOA 3H2VA 2LCHA 5T1DB 2R9RB 1R5ID 3T6GB 1ORJA 5F5FA 3AG4C 2ZXOA 2NUTA 3A9CA 2P61A 3GM3A 4LACB 4YJWA 4DJ9A 4EWCA 3DE9A 1FAPB 2VB6A 4YT2A 2OG2A 3H2UA 1E83A 1Q0DA 1A0BA 1BBHA 2W45A 1D0YA 3EG9B 3V5YA 2Q9AA 3MYIA 4JTCB 4R32A 4IAQA 5EK0A 2KC3A 2R7VA 3U9MA 1I4ZA 5KYNA 3WG7C 4HFKB 5L0CA 2R05A 2R03A 4IARA 4IAOA 5L0IA 2R7XA 2H7VC 1SZIA 1PV3A 2CNWA 3LLKA 5HSWA 4FAPB 2BL2A 2OJED 2VCBA 5KYXB 1OQCA 3EJNA 2YL0A 4PJNA 1T01A 3K1IA 1D0ZA 1NLXA 1I5NA 3E9VA 3TOMA 2LD6A 4QI2A 5AC4A 1SYQA 5JSLA 1Z63A 5EHHA 3I5QA 3MX3A 3Q7LA 2YEVA 2LQGA 1JAFA 5IY5C 4P6IC 3UNGC 2J9BA 2XS8A 4NC3A 4CIHA 2HUJA 3HNKA 4C7OB 4EBBA 1C17M 4E17A 3B0UX 2YWAA 3L0IA 2XSEA 3KKBA 4IWBA 2R7TA 5F28E 3MBGA 1TR2A 5KYWB 3HTKC 2IOQA 3PCVA 3FOOA 5CI8A 1WOLA 2Y39A 3RQEA 4G7ZF 1YLMA 3ASOC 4WJ0A 4AL1A 1FTSA 3KPHA 3LS0A 4CS9A 1ORSC 2DYSC 2XLWA 1RJ9B 4W8PA 3UGOA 1M56C 2QY9A 2OJQA 3ABLC 3M4CA 4JJFA 4CDVA 4N4WA 2HJMA 4JJGA 3ZIBA 3Q6MA 4O7GA 1CGOA 1SR2A 3NKDA 5A6BA 5JRAA 5L0DA 3ZSUA 5BQHA 1E85A 2IYLD 2PFDA 2QNLA 4NTAA 4DRHB 4EBKA 3B29A 1T9KA 1H9GA 1VYIA 1ZHZA 2J8WA 2AP3A 3L8JA 4BJ6A 3C8GA 2CGEA 2E87A 5A69A 1ORYA 3EGXB 1YA7O 4JVSA 3UGPA 3F46A 3LNMB 3RVZA 4OIPF 4FX5A 3KMIA 3UMKA 3U9JA 2GFHA 3E70C 1RCPA 4BJ6C 2IXOA 1YAUO 1TWHA 2P0NA 4D4NA 3S90A 3FVYA 3EGXA 3SEOA 2FFHA 4ONSA 1NZEA 4I44A 4CDYA 1VLTA 4BJTA 1C03A 1QKRA 3FOPA 2KYHA 3F47A 3NMKA 4XQ1A 1NG1A 4MVSA 5F5HA 5JLIA 1TKNA 4JW1A 3VYWA 4CS8A 1NU9C 3HKKA 4J32B 4Q4ZF 5EGYA 2D4UA 3NYMA 1CPRA 5HV9A 1A7VA 2YKZA 2XLVA 1RMVA 3QW0A 3J06A 3DXJF 3TJ5A 1BZ4A 3O55A 3CAXA 4CSAA 2EIMC 2QTVA 2L6HA 1T5OA 2HV7A 3IQ5A 2BE5F 2WVOA 4U9DA 1V4AA 4AE4B 5B3SC 1LE4A 1K04A 1ZHYA 3EZIA 4JTAB 2YL3A 3EH1A 3X2QC 2OCCC 2ZPAA 1CGNA 1GS9A 1ZHWA 2CCYA 2LK4A 4O6YA 3K7DA 4J7TA 4CSAC 2A68F 2HMQA 2NSGA 1TWGA 4GEHA 1GQAA 3L8IA 2B0HA 4MW8A 5E3CA 3T4RA 1Y4CA 3GEHA 2G3KA 3ZC4A 1O3UA 5DQZA 3NDBB 1MMNA 4KC9A 1H6GA 4E0HA 1Q0KA 2J9WA 1HW1A 2WL8A 3EFOA 2OEXA 1YZAA 1PD0A 1M2VB 4JURI 4FESA 3W2VA 1A7DA 5TJ5E 4U5CE 3POVA 4E0IA 4PACA 1YA9A 4EHPA 2UUIA 4WABA 3CQZA 4BJ5A 2VCCA 2HSQA 3DZAA 4DRJB 2UUHA 4PR9A 1QLEC 4CBEA 1M57C 1QPUA 2J9UA 1RKEB 1YJGA 1W2WA 2DB4A 3EZHA 5COMA 1D1CA 1Q0FA 2GA0A 3T9OA 4JEAA 3SXZA 2NUTB 2Q9CA 4M63A 1LVKA 3SXMA 3Q7GA 4AL0A 3K33A 3T6BA 4BJ5C 4E7ZA 3GANA 2Y3DA 2KJGA 1Z7Qc 5GPGB 2A69F 4BPMA 4Z9JA 2W4MA 4Q5SF 3DE8A 1WGWA 5E3AA 2JD3A 4U5FE 4YWQA 3RYLA 3VM6A 4B6IA 5L3VA 1Z23A 1OKKA 3BRJA 4RDAA 4ULWA 3GORA 2KW3C 3C63A 2YQYA 2J9VA 4LLCA 2H8AA 5A6JA 4UDVA 3IHUA 1KTMA 3RVYA 4H4KC 2LFDA 1VOMA 2ZXWC 2CW0F 1LE2A 2V26A 3EHMA 3T6JA 1HW2A 5JVEA 4K7BA 4JE9A 3H65A 4NTFA 3AQBA 1RXQA 2NUPA 5CIVA 3MLGA 5L3QA 3B71A 3ZG1A 1O87A 2IXNA 2LSEA 3R2PA 5D92A 2H7BA 1APCA 2Q9BA 3DAFA 3IQ6A 1O5HA 2W9YA 1OCOC 3NMIA 3U3FA 2J7PD 1M6TA 1S7ZA 2WB7A 5COGA 2R02A 2YHSA 2HV6A 5L0FA 1V74B 1VB5A 2FGYA 1QQ3A 2J0XA 3K66A 2EPLX 2HMZA 2IM8A 2L6FA 1FFTC 2PP4A 2EIKC 2GWWA 1Y6DA 4JCZA 4XPYA 3RFYA 3FDQA 4K0DA 2GAQA 3TK0A 1JMWA 3TJ6A 4E7SA 1E86A 4U5EE 3NG1A 4XEKA 2EIJC 3RKOF 4KI2A 4JC7A 3VF0A 2A0BA 1M2OA 2HSBA 4YN0B 5DS4A 3U3BA 2HS5A 3US6A 4PK4A 4LDKA 3HJCA 1G5ZA 3PMRA 3R7CA 5L0GA 1ZHTA 3W2WA 2CNWD 1YDIA 4AK9A 3EH2A 3V5ZA 2Q4FA 4U5DE 4PJMA 4YL3A 4OIQF 1NFNA 4CJGA 2ETSA 4FWVA 3DM5A 1D1BA 3EPVA 4MVMA 5T3WA 3GWNA 4MTGA 3GM1A 5L0JA 1H9TA 3U0CA 2XLMA 3AJMA 3V7OA 3KYIA 3C8GB 2ZD9A 3HNLA 4K1OA 3K6BA 5T3TA 1PCXA 2C04A 1TWCA 3GODA 3AOUA 3KYJA 2J46A 256BA 4WGYA 3EQLF 2Q00A 2A6EF 4RBNA 2R7RA 2Q7RA 3EGDA 4GYTA 5A6AA 3TULA 1OXKA 4I1OB 1WN0A 3AG3C 4DVZA 2A6HF 2YLDA 3NYJA 4HFFB 4U5BE 4MVUA 3S9OA 3U8VA 1I4YA 2ZXRA 1YYXA 3GWLA 4MVOA 3PDMP 2XL8A 1VLSA 2XLEA 3JRTA 2WZFA 3LEVA 4JTDB 2YZSA 4W8KA 5A6KA 3L1MA 3NKEA 4GQHA 2X51A 3JYYA 4MTFA 4OIOF 2DYRC 4A4AA 2I15A 2G62A 3DM9B 1OW8A 3LS1A 5A6BD 1K40A 3JSZA 2HZ8A 2KSFA 3RIPA 2R7WA 2QLAA 3N0TA 2X0CA 3CZ6A 1E84A 2EILC 3ZTMA 1HY5A 3JCUQ 1UG7A 4A2NB 1ZHXA 1JR8A 4C3EA 5KYYA 1JPJA 3NYLA 4XEFA 2PF4E 3U5SA 4DOZA 1D0XA 3EHNA 4DBRA 1J8MF 2J0WA 3OEOA 3LLIA 2R7SA 3JYHA 2B0JA 2R7QA 1LPEA 1MMDA 2PBEA 1XZQA 3C18A 3JZ0A 1UFBA 2Y3GA 2EPNA 1AUEA 1EA8A 3DKAA 5FCLA 2OKUA 5K0IA 3GM2A 4MVQA 4CJOA 3JTLO 3ASNC 3M1CB 4L6RA 4CS7A 1AEPA 3ITFA 3IPMO 1YYJA 3EFOB 2C03A 2RD9A 5JS5A 2P6VA 4KNVA 2M64A 2H7OA 3SNHA 1MNEA 3ECSA 2R7OA 4HEAJ 1LS1A 2YRFA 2KGOA 4JCHA 4JRZA 1NU7D 2EPKX 4XTKA 4OINF 4BEMJ 1VK5A 2F22A 5B1AC 1IZMA 2KNHA 5FZTA 3IQTA 3NMJA 4ZLDA 1L3PA 2LIGA 4C3DA 3JRMO 1HE9A 1TQGA 3FMSA 3MYFA 4D4XA 2HKVA 3IEEA 2XRHA 3QVYA 4RD9A 4XEVA 1OCCC 3RH3A 2HJ3A 2DGJA 2PX3A 1FMVA 1EI7A 3GEIA 4NY3A 5CI9A 3IQCA 3LESA 3DMDA 1U0BB 2R7UA 4I1MA 4PJJA 1VMAA 2M4EA 3U8PA 1BR2A 1S05A 1A7EA 2IBFA 4X0RA 4CIPA 2YVKA 2R25A 2LFFA 3B9QA 3G50A 1LKXA 1JPNA 2FAPB 1G8XA 2G3VA 1JOGA 1YZCA 2WVNA 3AQCA 3M15A 4JEBA 4MVRA 4OD5A 5D91A 4AX2A 4BEJA 1G4US 3ZWIA 4N6CA 2A1DD 1ZU4A 3HLZA 5BQGA 5DQTA 5B3IA 2V3CC 2AWYA 2HFIA 2ASRA 2NUPB 2YL7A 3UMHA 1T6IA 3DI5A 3CEXA 3UR3C 4E18A 4EUKB 4KBLA 1AVOB 2I8BA 5DS6A 1Z3IX 5KYUA 3RW0A 3ATPA 1SMYF 2XLHA 2XM0A 3QTHA 1H7IA 1EQ1A 1ZW2A 3V5XA 2VC9A 4O79A 3QMKA 3LUTB 2NG1A 3KL4A 4G7HF 1XZPA 3LEOA 4IJJA 3U2LA 3W4YA 1CGME 2XXAA 5AGFA 3FHDA 3TOLA 1N1CA 3AGUA 2L9JA 4YT5A 4DXWA 1MMGA 1NBBA 1NFOA 1Q0MA 2MHRA 1CPQA 2KQ9A 1Q0GA 3AG1C 3PHF2 1ZZPA 1T6UA 2PNOA 1OCZC 1VTMP 4N6HA 4ANJA 1OKKD 2D5RB 2Y3HA 4BJ1A 5L0HA 2VH3A 4O6MA 2IXMA 3C7JA 3JSEO 1OR2A 2YL1A 4G0HA 4MW3A 2TMVP 2XL4A 1SF8A 4P9FA 2GDCA 1QVXA 3C62A 4DVYP 4YT8A 4C3BA 3OA1A 4J7YA 3DWWA 5JUAA 2IXPA 1HMOA 1LM3B 3S0XA 3JT1A 3M4BA 4XLNF 3EG9A 1ZW3A 2OEVA 2L81A 4CDAA 2NSFA 3B0VC 1LS4A 4MTOA 4MVZA 4QDLA 1GM5A 4LDQA 3I5PA 4NQFA 2L7AA 1OR3A 3G4XA 1OW6A 4PFPA 5JT4A 2KK1A 3M79A 3W8IA 2QUPA 2VCAA 5DS5A 4G7OF 4Z9IA 3RQFA 3L34A 3O6XA 5E2QA 5B1BC 4EIYA 2Q3TA 2XL6A 3EGDB 5JP7A 3WAQA 1F1MA 4IGGA 1BR1A 5DLJA 3A11A 2A0UA 3ZTZA 5KYXA 1YVIA 1BR4A 3I4UA 3AG2C 3QW1A 4MQ9F
chains in the Genus database with same CATH topology
1BBHA 4IAQA 4IARA 4CDYA 1QPUA 3ZQYA 4CJOA 4JEAA 4L6RA 1YYJA 5JS5A 2YL0A 3TOMA 3DE8A 5JSLA 1JAFA 3ZQVA 3C63A 1E83A 2J9BA 4NC3A 3NMJA 3HNKA 5JVEA 4U9EA 4JE9A 4D4XA 3QVYA 3FOOA 1APCA 3IQ6A 1MQVA 3VRCA 3NMIA 2XLWA 3U8PA 1M6TA 1S05A 2YLGA 4CDVA 3M4CA 2XLOA 4ULVA 4CIPA 4N4WA 1QQ3A 1CGOA 1YZCA 3M15A 4JEBA 5JRAA 4IB4A 1E85A 3HNJA 3ZWIA 5B3IA 1E86A 2BC5A 2J8WA 2YL7A 4CX9A 2XLHA 2XM0A 1RCPA 4D4NA 4CJGA 5AGFA 3TOLA 2XLMA 1NBBA 3NMKA 3FOPA 3HNLA 1CPQA 4WGZA 5JLIA 4N6HA 2XLDA 256BA 4ER9A 4WGYA 1CPRA 1A7VA 2YKZA 2XLVA 3QW0A 2YL1A 1EKYA 2YLIA 3C62A 5JUAA 2YLDA 1LM3B 3IQ5A 3M4BA 3QVZA 4U9DA 3HNIA 4CDAA 2YL3A 2XM4A 1YYXA 1CGNA 2CCYA 2XL8A 2XLEA 5JT4A 3L1MA 4JKVA 3M79A 1GQAA 4EIYA 2XL6A 5JP7A 2QLAA 3ZTZA 1E84A 3DE9A 3ZTMA 3QW1A 1YZAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BBH A;  4IAQ A;  4IAR A;  4CDY A;  1QPU A;  3ZQY A;  4CJO A;  4JEA A;  4L6R A;  1YYJ A;  5JS5 A;  2YL0 A;  3TOM A;  3DE8 A;  5JSL A;  1JAF A;  3ZQV A;  3C63 A;  1E83 A;  2J9B A;  4NC3 A;  3NMJ A;  3HNK A;  5JVE A;  4U9E A;  4JE9 A;  4D4X A;  3QVY A;  3FOO A;  1APC A;  3IQ6 A;  1MQV A;  3VRC A;  3NMI A;  2XLW A;  3U8P A;  1M6T A;  1S05 A;  2YLG A;  4CDV A;  3M4C A;  2XLO A;  4ULV A;  4CIP A;  4N4W A;  1QQ3 A;  1CGO A;  1YZC A;  3M15 A;  4JEB A;  5JRA A;  4IB4 A;  1E85 A;  3HNJ A;  3ZWI A;  5B3I A;  1E86 A;  2BC5 A;  2J8W A;  2YL7 A;  4CX9 A;  2XLH A;  2XM0 A;  1RCP A;  4D4N A;  4CJG A;  5AGF A;  3TOL A;  2XLM A;  1NBB A;  3NMK A;  3FOP A;  3HNL A;  1CPQ A;  4WGZ A;  5JLI A;  4N6H A;  2XLD A;  256B A;  4ER9 A;  4WGY A;  1CPR A;  1A7V A;  2YKZ A;  2XLV A;  3QW0 A;  2YL1 A;  1EKY A;  2YLI A;  3C62 A;  5JUA A;  2YLD A;  1LM3 B;  3IQ5 A;  3M4B A;  3QVZ A;  4U9D A;  3HNI A;  4CDA A;  2YL3 A;  2XM4 A;  1YYX A;  1CGN A;  2CCY A;  2XL8 A;  2XLE A;  5JT4 A;  3L1M A;  4JKV A;  3M79 A;  1GQA A;  4EIY A;  2XL6 A;  5JP7 A;  2QLA A;  3ZTZ A;  1E84 A;  3DE9 A;  3ZTM A;  3QW1 A;  1YZA A; 
#chains in the Genus database with same CATH topology
 1T6Q A;  3K1I C;  3SP1 A;  3AGT A;  2AVK A;  1U89 A;  3MFN A;  4JZA A;  2MYS A;  2P7V A;  1ZU5 A;  1LI5 A;  2WZL A;  1ZVZ A;  4H54 A;  2EIN C;  1OCR C;  1FMW A;  1ZYR F;  4Z9H A;  4QI0 A;  3N2Z B;  4BG0 A;  1C02 A;  2JX0 A;  4HE8 D;  4YL1 A;  1Z6A A;  3ZQY A;  4C7O A;  3Q6N A;  4XPX A;  2ICW G;  1IW7 F;  3O39 A;  1DOW A;  3KH2 A;  3G4Z A;  1ST6 A;  3N24 A;  3DJU B;  4PJL A;  5KYW A;  5BUO A;  5KYY B;  2NPU A;  2AWC A;  1A41 A;  4MS2 A;  4LER A;  3LNR A;  4CS9 C;  1RJ9 A;  2Y3B A;  4KNW A;  3O10 A;  3ZQV A;  1K05 A;  3K1H A;  2OU6 A;  4U5G A;  1HE1 A;  2OQM A;  3DAG A;  3FAP B;  4ZLC A;  3C8G D;  2L6G A;  1J8Y F;  4Q7C A;  4I3M A;  4U9E A;  2O9X A;  4EBJ A;  2ZXP A;  1R4T A;  1G4W R;  1TWA A;  3FXH A;  1B68 A;  3NRH A;  4O6N A;  1V55 C;  4PFO A;  1L7C A;  3B0P A;  1KNY A;  3UMI A;  5E33 A;  1KU2 A;  1FFH A;  2AU5 A;  2EPM X;  2Z15 A;  4XWJ A;  1MQV A;  3VRC A;  2YLG A;  4XPW A;  4LLE A;  4ULV A;  2XLO A;  4OD4 A;  1WAT A;  1YAR O;  3SXY A;  1DOV A;  3FAJ A;  4MND A;  1OW7 A;  3DJN B;  3X1O A;  1QSP A;  1FR0 A;  1MMA A;  1BDJ B;  4YL0 A;  3WOD F;  4IB4 A;  3TD7 A;  3HNJ A;  2XS1 A;  3S29 A;  3LAY A;  1LIH A;  2BC5 A;  4DRI B;  3VAY A;  5BQI A;  3LJB A;  2OOC A;  5AC5 A;  4CX9 A;  1RKC A;  3CSK A;  1XWJ A;  2J45 A;  2MWQ A;  3OWT A;  1FNT c;  4U5H A;  3W8H A;  4CS8 C;  1NSG B;  3S28 A;  4XLP F;  3WHN A;  1PD1 A;  2PX0 A;  5COF A;  1QZX A;  3RF3 A;  1GGQ A;  4G78 A;  4DBQ A;  1HMD A;  3U2M A;  4EKW A;  2LP4 A;  1Z5Z A;  2QE9 A;  2WZG A;  3S84 A;  4AE4 A;  1WWP A;  3SYN A;  4F4B A;  3BEH A;  4NTB A;  1OXB A;  1V54 C;  4NCQ A;  4OIR F;  2DI3 A;  3SZR A;  3ZDL A;  4WGZ A;  3RQG A;  4J30 B;  2CDQ A;  1TFO B;  2XLD A;  5DVW A;  4YT4 A;  5KYU B;  4ER9 A;  1LI7 A;  2CYD A;  4P9T A;  1TFK B;  1WTY A;  1EKY A;  2P1A A;  4LDR A;  1U6H A;  1MND A;  2RSE B;  2WVQ A;  2YLI A;  1JRA A;  1VYK A;  2VAS A;  4IRU A;  4N06 A;  3SXK A;  1WAS A;  2XXA B;  3DD7 A;  3S27 A;  3C8Z A;  2W4B A;  3QVZ A;  1M2V A;  3TQO A;  3HNI A;  2Y69 C;  1E2X A;  3ZVR A;  3ABM C;  3QZC A;  2JPU A;  2XM4 A;  3ABK C;  4JIO A;  3GEE A;  2J7P A;  4YK5 A;  4JKV A;  1RKE A;  1D1A A;  2EPO A;  3H2V A;  2LCH A;  5T1D B;  2R9R B;  1R5I D;  3T6G B;  1ORJ A;  5F5F A;  3AG4 C;  2ZXO A;  2NUT A;  3A9C A;  2P61 A;  3GM3 A;  4LAC B;  4YJW A;  4DJ9 A;  4EWC A;  3DE9 A;  1FAP B;  2VB6 A;  4YT2 A;  2OG2 A;  3H2U A;  1E83 A;  1Q0D A;  1A0B A;  1BBH A;  2W45 A;  1D0Y A;  3EG9 B;  3V5Y A;  2Q9A A;  3MYI A;  4JTC B;  4R32 A;  4IAQ A;  5EK0 A;  2KC3 A;  2R7V A;  3U9M A;  1I4Z A;  5KYN A;  3WG7 C;  4HFK B;  5L0C A;  2R05 A;  2R03 A;  4IAR A;  4IAO A;  5L0I A;  2R7X A;  2H7V C;  1SZI A;  1PV3 A;  2CNW A;  3LLK A;  5HSW A;  4FAP B;  2BL2 A;  2OJE D;  2VCB A;  5KYX B;  1OQC A;  3EJN A;  2YL0 A;  4PJN A;  1T01 A;  3K1I A;  1D0Z A;  1NLX A;  1I5N A;  3E9V A;  3TOM A;  2LD6 A;  4QI2 A;  5AC4 A;  1SYQ A;  5JSL A;  1Z63 A;  5EHH A;  3I5Q A;  3MX3 A;  3Q7L A;  2YEV A;  2LQG A;  1JAF A;  5IY5 C;  4P6I C;  3UNG C;  2J9B A;  2XS8 A;  4NC3 A;  4CIH A;  2HUJ A;  3HNK A;  4C7O B;  4EBB A;  1C17 M;  4E17 A;  3B0U X;  2YWA A;  3L0I A;  2XSE A;  3KKB A;  4IWB A;  2R7T A;  5F28 E;  3MBG A;  1TR2 A;  5KYW B;  3HTK C;  2IOQ A;  3PCV A;  3FOO A;  5CI8 A;  1WOL A;  2Y39 A;  3RQE A;  4G7Z F;  1YLM A;  3ASO C;  4WJ0 A;  4AL1 A;  1FTS A;  3KPH A;  3LS0 A;  4CS9 A;  1ORS C;  2DYS C;  2XLW A;  1RJ9 B;  4W8P A;  3UGO A;  1M56 C;  2QY9 A;  2OJQ A;  3ABL C;  3M4C A;  4JJF A;  4CDV A;  4N4W A;  2HJM A;  4JJG A;  3ZIB A;  3Q6M A;  4O7G A;  1CGO A;  1SR2 A;  3NKD A;  5A6B A;  5JRA A;  5L0D A;  3ZSU A;  5BQH A;  1E85 A;  2IYL D;  2PFD A;  2QNL A;  4NTA A;  4DRH B;  4EBK A;  3B29 A;  1T9K A;  1H9G A;  1VYI A;  1ZHZ A;  2J8W A;  2AP3 A;  3L8J A;  4BJ6 A;  3C8G A;  2CGE A;  2E87 A;  5A69 A;  1ORY A;  3EGX B;  1YA7 O;  4JVS A;  3UGP A;  3F46 A;  3LNM B;  3RVZ A;  4OIP F;  4FX5 A;  3KMI A;  3UMK A;  3U9J A;  2GFH A;  3E70 C;  1RCP A;  4BJ6 C;  2IXO A;  1YAU O;  1TWH A;  2P0N A;  4D4N A;  3S90 A;  3FVY A;  3EGX A;  3SEO A;  2FFH A;  4ONS A;  1NZE A;  4I44 A;  4CDY A;  1VLT A;  4BJT A;  1C03 A;  1QKR A;  3FOP A;  2KYH A;  3F47 A;  3NMK A;  4XQ1 A;  1NG1 A;  4MVS A;  5F5H A;  5JLI A;  1TKN A;  4JW1 A;  3VYW A;  4CS8 A;  1NU9 C;  3HKK A;  4J32 B;  4Q4Z F;  5EGY A;  2D4U A;  3NYM A;  1CPR A;  5HV9 A;  1A7V A;  2YKZ A;  2XLV A;  1RMV A;  3QW0 A;  3J06 A;  3DXJ F;  3TJ5 A;  1BZ4 A;  3O55 A;  3CAX A;  4CSA A;  2EIM C;  2QTV A;  2L6H A;  1T5O A;  2HV7 A;  3IQ5 A;  2BE5 F;  2WVO A;  4U9D A;  1V4A A;  4AE4 B;  5B3S C;  1LE4 A;  1K04 A;  1ZHY A;  3EZI A;  4JTA B;  2YL3 A;  3EH1 A;  3X2Q C;  2OCC C;  2ZPA A;  1CGN A;  1GS9 A;  1ZHW A;  2CCY A;  2LK4 A;  4O6Y A;  3K7D A;  4J7T A;  4CSA C;  2A68 F;  2HMQ A;  2NSG A;  1TWG A;  4GEH A;  1GQA A;  3L8I A;  2B0H A;  4MW8 A;  5E3C A;  3T4R A;  1Y4C A;  3GEH A;  2G3K A;  3ZC4 A;  1O3U A;  5DQZ A;  3NDB B;  1MMN A;  4KC9 A;  1H6G A;  4E0H A;  1Q0K A;  2J9W A;  1HW1 A;  2WL8 A;  3EFO A;  2OEX A;  1YZA A;  1PD0 A;  1M2V B;  4JUR I;  4FES A;  3W2V A;  1A7D A;  5TJ5 E;  4U5C E;  3POV A;  4E0I A;  4PAC A;  1YA9 A;  4EHP A;  2UUI A;  4WAB A;  3CQZ A;  4BJ5 A;  2VCC A;  2HSQ A;  3DZA A;  4DRJ B;  2UUH A;  4PR9 A;  1QLE C;  4CBE A;  1M57 C;  1QPU A;  2J9U A;  1RKE B;  1YJG A;  1W2W A;  2DB4 A;  3EZH A;  5COM A;  1D1C A;  1Q0F A;  2GA0 A;  3T9O A;  4JEA A;  3SXZ A;  2NUT B;  2Q9C A;  4M63 A;  1LVK A;  3SXM A;  3Q7G A;  4AL0 A;  3K33 A;  3T6B A;  4BJ5 C;  4E7Z A;  3GAN A;  2Y3D A;  2KJG A;  1Z7Q c;  5GPG B;  2A69 F;  4BPM A;  4Z9J A;  2W4M A;  4Q5S F;  3DE8 A;  1WGW A;  5E3A A;  2JD3 A;  4U5F E;  4YWQ A;  3RYL A;  3VM6 A;  4B6I A;  5L3V A;  1Z23 A;  1OKK A;  3BRJ A;  4RDA A;  4ULW A;  3GOR A;  2KW3 C;  3C63 A;  2YQY A;  2J9V A;  4LLC A;  2H8A A;  5A6J A;  4UDV A;  3IHU A;  1KTM A;  3RVY A;  4H4K C;  2LFD A;  1VOM A;  2ZXW C;  2CW0 F;  1LE2 A;  2V26 A;  3EHM A;  3T6J A;  1HW2 A;  5JVE A;  4K7B A;  4JE9 A;  3H65 A;  4NTF A;  3AQB A;  1RXQ A;  2NUP A;  5CIV A;  3MLG A;  5L3Q A;  3B71 A;  3ZG1 A;  1O87 A;  2IXN A;  2LSE A;  3R2P A;  5D92 A;  2H7B A;  1APC A;  2Q9B A;  3DAF A;  3IQ6 A;  1O5H A;  2W9Y A;  1OCO C;  3NMI A;  3U3F A;  2J7P D;  1M6T A;  1S7Z A;  2WB7 A;  5COG A;  2R02 A;  2YHS A;  2HV6 A;  5L0F A;  1V74 B;  1VB5 A;  2FGY A;  1QQ3 A;  2J0X A;  3K66 A;  2EPL X;  2HMZ A;  2IM8 A;  2L6F A;  1FFT C;  2PP4 A;  2EIK C;  2GWW A;  1Y6D A;  4JCZ A;  4XPY A;  3RFY A;  3FDQ A;  4K0D A;  2GAQ A;  3TK0 A;  1JMW A;  3TJ6 A;  4E7S A;  1E86 A;  4U5E E;  3NG1 A;  4XEK A;  2EIJ C;  3RKO F;  4KI2 A;  4JC7 A;  3VF0 A;  2A0B A;  1M2O A;  2HSB A;  4YN0 B;  5DS4 A;  3U3B A;  2HS5 A;  3US6 A;  4PK4 A;  4LDK A;  3HJC A;  1G5Z A;  3PMR A;  3R7C A;  5L0G A;  1ZHT A;  3W2W A;  2CNW D;  1YDI A;  4AK9 A;  3EH2 A;  3V5Z A;  2Q4F A;  4U5D E;  4PJM A;  4YL3 A;  4OIQ F;  1NFN A;  4CJG A;  2ETS A;  4FWV A;  3DM5 A;  1D1B A;  3EPV A;  4MVM A;  5T3W A;  3GWN A;  4MTG A;  3GM1 A;  5L0J A;  1H9T A;  3U0C A;  2XLM A;  3AJM A;  3V7O A;  3KYI A;  3C8G B;  2ZD9 A;  3HNL A;  4K1O A;  3K6B A;  5T3T A;  1PCX A;  2C04 A;  1TWC A;  3GOD A;  3AOU A;  3KYJ A;  2J46 A;  256B A;  4WGY A;  3EQL F;  2Q00 A;  2A6E F;  4RBN A;  2R7R A;  2Q7R A;  3EGD A;  4GYT A;  5A6A A;  3TUL A;  1OXK A;  4I1O B;  1WN0 A;  3AG3 C;  4DVZ A;  2A6H F;  2YLD A;  3NYJ A;  4HFF B;  4U5B E;  4MVU A;  3S9O A;  3U8V A;  1I4Y A;  2ZXR A;  1YYX A;  3GWL A;  4MVO A;  3PDM P;  2XL8 A;  1VLS A;  2XLE A;  3JRT A;  2WZF A;  3LEV A;  4JTD B;  2YZS A;  4W8K A;  5A6K A;  3L1M A;  3NKE A;  4GQH A;  2X51 A;  3JYY A;  4MTF A;  4OIO F;  2DYR C;  4A4A A;  2I15 A;  2G62 A;  3DM9 B;  1OW8 A;  3LS1 A;  5A6B D;  1K40 A;  3JSZ A;  2HZ8 A;  2KSF A;  3RIP A;  2R7W A;  2QLA A;  3N0T A;  2X0C A;  3CZ6 A;  1E84 A;  2EIL C;  3ZTM A;  1HY5 A;  3JCU Q;  1UG7 A;  4A2N B;  1ZHX A;  1JR8 A;  4C3E A;  5KYY A;  1JPJ A;  3NYL A;  4XEF A;  2PF4 E;  3U5S A;  4DOZ A;  1D0X A;  3EHN A;  4DBR A;  1J8M F;  2J0W A;  3OEO A;  3LLI A;  2R7S A;  3JYH A;  2B0J A;  2R7Q A;  1LPE A;  1MMD A;  2PBE A;  1XZQ A;  3C18 A;  3JZ0 A;  1UFB A;  2Y3G A;  2EPN A;  1AUE A;  1EA8 A;  3DKA A;  5FCL A;  2OKU A;  5K0I A;  3GM2 A;  4MVQ A;  4CJO A;  3JTL O;  3ASN C;  3M1C B;  4L6R A;  4CS7 A;  1AEP A;  3ITF A;  3IPM O;  1YYJ A;  3EFO B;  2C03 A;  2RD9 A;  5JS5 A;  2P6V A;  4KNV A;  2M64 A;  2H7O A;  3SNH A;  1MNE A;  3ECS A;  2R7O A;  4HEA J;  1LS1 A;  2YRF A;  2KGO A;  4JCH A;  4JRZ A;  1NU7 D;  2EPK X;  4XTK A;  4OIN F;  4BEM J;  1VK5 A;  2F22 A;  5B1A C;  1IZM A;  2KNH A;  5FZT A;  3IQT A;  3NMJ A;  4ZLD A;  1L3P A;  2LIG A;  4C3D A;  3JRM O;  1HE9 A;  1TQG A;  3FMS A;  3MYF A;  4D4X A;  2HKV A;  3IEE A;  2XRH A;  3QVY A;  4RD9 A;  4XEV A;  1OCC C;  3RH3 A;  2HJ3 A;  2DGJ A;  2PX3 A;  1FMV A;  1EI7 A;  3GEI A;  4NY3 A;  5CI9 A;  3IQC A;  3LES A;  3DMD A;  1U0B B;  2R7U A;  4I1M A;  4PJJ A;  1VMA A;  2M4E A;  3U8P A;  1BR2 A;  1S05 A;  1A7E A;  2IBF A;  4X0R A;  4CIP A;  2YVK A;  2R25 A;  2LFF A;  3B9Q A;  3G50 A;  1LKX A;  1JPN A;  2FAP B;  1G8X A;  2G3V A;  1JOG A;  1YZC A;  2WVN A;  3AQC A;  3M15 A;  4JEB A;  4MVR A;  4OD5 A;  5D91 A;  4AX2 A;  4BEJ A;  1G4U S;  3ZWI A;  4N6C A;  2A1D D;  1ZU4 A;  3HLZ A;  5BQG A;  5DQT A;  5B3I A;  2V3C C;  2AWY A;  2HFI A;  2ASR A;  2NUP B;  2YL7 A;  3UMH A;  1T6I A;  3DI5 A;  3CEX A;  3UR3 C;  4E18 A;  4EUK B;  4KBL A;  1AVO B;  2I8B A;  5DS6 A;  1Z3I X;  5KYU A;  3RW0 A;  3ATP A;  1SMY F;  2XLH A;  2XM0 A;  3QTH A;  1H7I A;  1EQ1 A;  1ZW2 A;  3V5X A;  2VC9 A;  4O79 A;  3QMK A;  3LUT B;  2NG1 A;  3KL4 A;  4G7H F;  1XZP A;  3LEO A;  4IJJ A;  3U2L A;  3W4Y A;  1CGM E;  2XXA A;  5AGF A;  3FHD A;  3TOL A;  1N1C A;  3AGU A;  2L9J A;  4YT5 A;  4DXW A;  1MMG A;  1NBB A;  1NFO A;  1Q0M A;  2MHR A;  1CPQ A;  2KQ9 A;  1Q0G A;  3AG1 C;  3PHF 2;  1ZZP A;  1T6U A;  2PNO A;  1OCZ C;  1VTM P;  4N6H A;  4ANJ A;  1OKK D;  2D5R B;  2Y3H A;  4BJ1 A;  5L0H A;  2VH3 A;  4O6M A;  2IXM A;  3C7J A;  3JSE O;  1OR2 A;  2YL1 A;  4G0H A;  4MW3 A;  2TMV P;  2XL4 A;  1SF8 A;  4P9F A;  2GDC A;  1QVX A;  3C62 A;  4DVY P;  4YT8 A;  4C3B A;  3OA1 A;  4J7Y A;  3DWW A;  5JUA A;  2IXP A;  1HMO A;  1LM3 B;  3S0X A;  3JT1 A;  3M4B A;  4XLN F;  3EG9 A;  1ZW3 A;  2OEV A;  2L81 A;  4CDA A;  2NSF A;  3B0V C;  1LS4 A;  4MTO A;  4MVZ A;  4QDL A;  1GM5 A;  4LDQ A;  3I5P A;  4NQF A;  2L7A A;  1OR3 A;  3G4X A;  1OW6 A;  4PFP A;  5JT4 A;  2KK1 A;  3M79 A;  3W8I A;  2QUP A;  2VCA A;  5DS5 A;  4G7O F;  4Z9I A;  3RQF A;  3L34 A;  3O6X A;  5E2Q A;  5B1B C;  4EIY A;  2Q3T A;  2XL6 A;  3EGD B;  5JP7 A;  3WAQ A;  1F1M A;  4IGG A;  1BR1 A;  5DLJ A;  3A11 A;  2A0U A;  3ZTZ A;  5KYX A;  1YVI A;  1BR4 A;  3I4U A;  3AG2 C;  3QW1 A;  4MQ9 F; 
#chains in the Genus database with same CATH homology
 1BBH A;  4IAQ A;  4IAR A;  4CDY A;  1QPU A;  3ZQY A;  4CJO A;  4JEA A;  4L6R A;  1YYJ A;  5JS5 A;  2YL0 A;  3TOM A;  3DE8 A;  5JSL A;  1JAF A;  3ZQV A;  3C63 A;  1E83 A;  2J9B A;  4NC3 A;  3NMJ A;  3HNK A;  5JVE A;  4U9E A;  4JE9 A;  4D4X A;  3QVY A;  3FOO A;  1APC A;  3IQ6 A;  1MQV A;  3VRC A;  3NMI A;  2XLW A;  3U8P A;  1M6T A;  1S05 A;  2YLG A;  4CDV A;  3M4C A;  2XLO A;  4ULV A;  4CIP A;  4N4W A;  1QQ3 A;  1CGO A;  1YZC A;  3M15 A;  4JEB A;  5JRA A;  4IB4 A;  1E85 A;  3HNJ A;  3ZWI A;  5B3I A;  1E86 A;  2BC5 A;  2J8W A;  2YL7 A;  4CX9 A;  2XLH A;  2XM0 A;  1RCP A;  4D4N A;  4CJG A;  5AGF A;  3TOL A;  2XLM A;  1NBB A;  3NMK A;  3FOP A;  3HNL A;  1CPQ A;  4WGZ A;  5JLI A;  4N6H A;  2XLD A;  256B A;  4ER9 A;  4WGY A;  1CPR A;  1A7V A;  2YKZ A;  2XLV A;  3QW0 A;  2YL1 A;  1EKY A;  2YLI A;  3C62 A;  5JUA A;  2YLD A;  1LM3 B;  3IQ5 A;  3M4B A;  3QVZ A;  4U9D A;  3HNI A;  4CDA A;  2YL3 A;  2XM4 A;  1YYX A;  1CGN A;  2CCY A;  2XL8 A;  2XLE A;  5JT4 A;  3L1M A;  4JKV A;  3M79 A;  1GQA A;  4EIY A;  2XL6 A;  5JP7 A;  2QLA A;  3ZTZ A;  1E84 A;  3DE9 A;  3ZTM A;  3QW1 A;  1YZA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...