3C63A

Tetrameric cytochrome cb562 (k34/h59/d62/h63/h73/a74/h77) assembly stabilized by interprotein zinc coordination
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
106
structure length
106
Chain Sequence
b'ADLEDNMETLNDNLKVIEKADNAAQVKDALTKMKAAALDAQKATPPKLEDKSPDSPEMHDFDHGFDILVGQIHAALHLANEGKVKEAQAAAEQLKTTCNACHQKYR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Soluble cytochrome b562
publication title Metal-mediated self-assembly of protein superstructures: influence of secondary interactions on protein oligomerization and aggregation.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Electron transport
total genus 44
structure length 106
sequence length 106
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07361 Cytochrom_B562 Cytochrome b562
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 3c63A00
5B3IA 1M6TA 4CDVA 2YL7A 5JSLA 5JP7A 4JEAA 3ZQVA 5JRAA 3IQ6A 2YL1A 3C62A 3NMJA 4IB4A 1LM3B 4U9EA 4ER9A 2XL6A 3C63A 4EIYA 1YYJA 4WGZA 1CPRA 3HNLA 3DE8A 1APCA 3M79A 4CDAA 3TOMA 2YKZA 4IARA 3VRCA 2J9BA 4CJGA 2XLHA 1E83A 3ZTMA 4NC3A 4JE9A 1CPQA 1QPUA 1RCPA 4WGYA 4ULVA 3QW0A 1YYXA 4L6RA 2YL0A 4CX9A 2XLVA 1MQVA 3FOPA 1GQAA 2YL3A 2XLMA 5JVEA 1JAFA 1E84A 3NMIA 2XLEA 1CGOA 3HNJA 2CCYA 1QQ3A 2XLDA 2XM0A 3M4BA 5JLIA 2XLWA 3HNKA 3IQ5A 3TOLA 5JS5A 1E85A 1NBBA 1S05A 3QVYA 3FOOA 3QW1A 3ZQYA 4D4NA 4U9DA 4D4XA 4IAQA 3NMKA 2YLIA 4N4WA 3QVZA 5JT4A 5JUAA 1BBHA 2BC5A 2XLOA 3ZWIA 1YZCA 2XM4A 2J8WA 2YLDA 4JEBA 4JKVA 4CIPA 3M15A 5AGFA 3U8PA 3M4CA 4N6HA 3L1MA 2YLGA 3ZTZA 3HNIA 256BA 4CDYA 3DE9A 4CJOA 2XL8A 2QLAA 1CGNA 1E86A 1EKYA 1YZAA 1A7VA
chains in the Genus database with same CATH superfamily
4HEAJ 4IGGA 5AC5A 3B29A 4HFKB 3T6BA 5B3IA 1AUEA 1YA7O 3KKBA 2EPLX 2WVQA 3JRTA 5DS5A 1K40A 2J0XA 1VB5A 1TFKB 1RJ9B 5JRAA 2LFDA 3K1IC 5DS4A 3VF0A 5A6JA 4HE8D 3I5PA 4UDVA 2CNWD 4Q5SF 4U9EA 1VMAA 2P1AA 5BQIA 2Q9BA 4G7ZF 3C63A 4XLPF 1LIHA 1D0YA 3LS0A 2LFFA 5GPGB 3S90A 2NUTB 2Q9AA 1YYJA 5E2QA 1M2OA 3VYWA 4WABA 1ORSC 2JX0A 1LI5A 1ZU4A 3NYLA 4JC7A 2L81A 4MVOA 4C3DA 3LESA 3LNRA 1TWAA 3Q7GA 3ZG1A 4CJGA 4DRJB 4EBKA 1D1AA 1OCCC 5A6BA 5L0CA 1NFOA 1N1CA 1ORYA 5HSWA 2EPMX 3FHDA 3NDBB 2P7VA 2NSGA 3ZTMA 3UGOA 2OQMA 4G0HA 1MMNA 5L3VA 2Y3HA 1QPUA 4JCHA 4YL1A 2L6FA 4ULVA 3QW0A 1YYXA 2R7OA 4L6RA 2HJMA 2CGEA 4CX9A 2J9UA 2Q3TA 3NRHA 4EBBA 3JYHA 1EQ1A 1HE1A 1NZEA 3SZRA 3JYYA 5KYWA 2VCBA 2KNHA 4YL3A 3NMIA 2J9VA 2EIJC 3EZHA 2MWQA 5KYYB 2C04A 4MVSA 4XTKA 2NPUA 4IWBA 2RD9A 4XEKA 2OKUA 2R7RA 2KK1A 4N6CA 4ONSA 4U5BE 2XM0A 3L8JA 1NU7D 1T6QA 4CS8A 3DJNB 1C03A 3S29A 1ORJA 3CZ6A 2ZXPA 4JURI 3V5YA 5KYUB 2Q4FA 3IPMO 2ZD9A 4K7BA 4U5GA 4BJ5A 3DZAA 5JLIA 1XZPA 1KNYA 1YVIA 3IEEA 2CDQA 2NG1A 2MYSA 2NUPB 3HNKA 3IQ5A 4C3EA 2W45A 3JTLO 3TOLA 2KW3C 2YQYA 3RFYA 3AOUA 1TWCA 2GFHA 4J30B 3K1IA 2HFIA 1QKRA 4MW8A 4XPYA 4EKWA 5A6KA 4RDAA 4K1OA 3VAYA 3FOOA 1MMDA 1Y4CA 1V4AA 2WVNA 3LNMB 3QW1A 3ZQYA 4D4NA 4H4KC 4A2NB 3G4ZA 2BE5F 1MNDA 2YLIA 1K05A 3ASOC 4N4WA 4Z9HA 3W2VA 2J7PA 3ZVRA 1XWJA 5BQHA 1CGME 4BG0A 2ETSA 4PFPA 5JT4A 5JUAA 3RQFA 3FDQA 2R7UA 2HUJA 2XLOA 1IZMA 2PBEA 1AVOB 1HY5A 4U5FE 3TD7A 2R7SA 1G5ZA 1YZCA 2XM4A 4DJ9A 1NU9C 4O79A 5FCLA 4E7SA 1QLEC 3PCVA 3M15A 4GQHA 2A0UA 5T3TA 3WODF 4CIPA 3NYMA 3U8PA 3OA1A 2R7WA 4OD4A 2AVKA 3JSEO 3L1MA 3ZTZA 3GM2A 2YZSA 3EFOB 4BPMA 3DE9A 4C7OA 1M57C 4CJOA 1RMVA 1U89A 1A41A 3N24A 2QLAA 2KSFA 2L6HA 2C03A 4MTFA 2P61A 3B71A 4Z9IA 3UGPA 2Y39A 2R7TA 3MFNA 1G4WR 3SEOA 4XPXA 2LCHA 3ASNC 1D0XA 1YZAA 4LDKA 3US6A 3JSZA 2F22A 1SMYF 1A7VA 1D1CA 2R7QA 3GEHA 4MVRA 1PD1A 4IJJA 1LE4A 1ZHXA 2WVOA 3EZIA 3PDMP 4RD9A 2PFDA 4KBLA 2YL7A 1PV3A 1UFBA 4JEAA 4DXWA 4YT2A 2D5RB 4DRHB 4JTAB 3EH2A 3PMRA 3DM9B 2QNLA 3DAGA 2IXNA 4DVZA 3C62A 4IB4A 4PJLA 1Z23A 1FMWA 3KPHA 4ER9A 2X51A 2XS8A 2J46A 3B0UX 1FR0A 4ANJA 1E2XA 3ABLC 3GM3A 4WGZA 2PX0A 5EGYA 2Y3BA 3HNLA 1K04A 2OU6A 4I3MA 3RF3A 2DB4A 2G3VA 3DE8A 2FGYA 3EG9A 4W8KA 1Q0FA 2M4EA 3HLZA 3L34A 5D92A 4ZLDA 4CDAA 4E7ZA 3GEIA 1YA9A 2W4BA 4GYTA 2AWCA 4OIOF 2YKZA 4MNDA 3VRCA 1RKEB 2J9BA 2ZXOA 4E0HA 4MVQA 3HKKA 2XXAA 1M56C 2GDCA 1F1MA 3RKOF 1OKKD 4PFOA 3TQOA 4EHPA 4J32B 4E18A 2YEVA 5CI9A 4YT4A 1FAPB 3EJNA 4NC3A 2QY9A 4O6YA 2UUIA 4JE9A 1GGQA 3W8IA 3S27A 1CPQA 3QTHA 3BRJA 4XLNF 1D1BA 4P9FA 4B6IA 3BEHA 4PK4A 3FOPA 3WG7C 1GQAA 2I8BA 4A4AA 4YWQA 3HTKC 3AGTA 4AE4A 3C8GA 4CSAC 1UG7A 1FTSA 2HKVA 3DXJF 1JAFA 3MLGA 1A7EA 1E84A 2B0HA 3EG9B 2XS1A 4BJ6C 1FFTC 2A6HF 3SXMA 2Q7RA 1FNTc 1VOMA 4OIRF 4EBJA 4W8PA 1WATA 2PNOA 1QQ3A 2XLDA 2OJED 2XXAB 2CYDA 3EQLF 2JD3A 2Q9CA 1VYIA 5L0FA 3H2VA 1H9GA 2R25A 2XSEA 4MW3A 2HSQA 3AQBA 4NTFA 1EA8A 5BUOA 2HS5A 3QMKA 5B3SC 1GS9A 2B0JA 1AEPA 2E87A 3ZC4A 1LS1A 2P6VA 1YLMA 4JTCB 4MTOA 2IYLD 3GWLA 4YL0A 5F5HA 4JVSA 3TJ6A 1E85A 2VB6A 3TULA 3SYNA 1T01A 2LD6A 1RKCA 3Q6MA 3C18A 1OQCA 3M1CB 2LSEA 4KC9A 5DQTA 4I1MA 1WTYA 3W2WA 5KYXB 1PCXA 2FAPB 3DKAA 1U0BB 3L0IA 4LDRA 5EHHA 2AWYA 2A1DD 1Z5ZA 2HSBA 3AG2C 2G3KA 5L3QA 1LVKA 1OW8A 3RIPA 1V74B 4OIPF 3DI5A 3SXZA 3J06A 1RXQA 2L7AA 1BR2A 1T9KA 2CW0F 2VCCA 2XL4A 4JJFA 4LACB 4MVUA 4XPWA 3U8VA 3A9CA 2J8WA 3E70C 1JR8A 4FESA 1QZXA 3U2MA 2A6EF 3EH1A 2HZ8A 2WL8A 5DQZA 3U0CA 4LLCA 2J9WA 3F46A 3LEVA 3DJUB 4G78A 1TQGA 4NCQA 3S84A 3K6BA 1C02A 2YLGA 4JZAA 4CDYA 1A7DA 1LE2A 1OW6A 1Z7Qc 2H7BA 3S9OA 1J8YF 1HMOA 1T6UA 1TWHA 5KYWB 3UMKA 2LIGA 2FFHA 4F4BA 2ASRA 2Z15A 3ZDLA 4CSAA 1E86A 1VTMP 1LI7A 2EPNA 2UUHA 4Z9JA 1Y6DA 3E9VA 3EHNA 4BJ6A 3DWWA 1M6TA 3G50A 3UR3C 4BEJA 4PJNA 4CDVA 2OJQA 3DMDA 2PX3A 2YWAA 4PR9A 1SF8A 5JP7A 5JSLA 4YT5A 4OINF 4AX2A 5DLJA 4G7HF 5L0GA 2OCCC 3ZQVA 3IQ6A 1HE9A 1QSPA 4H54A 2EIMC 4AK9A 4JJGA 3U9JA 1PD0A 5A69A 3GODA 1S7ZA 2YVKA 3HJCA 4OIQF 3DM5A 1HW2A 4U5HA 4BJTA 5T1DB 2DYSC 2QE9A 1OCZC 1M2VA 4ULWA 2NSFA 4CS9C 3M79A 2L6GA 3K7DA 1O3UA 4YK5A 2EIKC 2HJ3A 4X0RA 2XRHA 3AGUA 2OG2A 2R9RB 1IW7F 2LP4A 4GEHA 1DOVA 4AL1A 3O10A 1E83A 3SNHA 2L9JA 1ZW3A 4I1OB 2MHRA 4LLEA 4N06A 2VASA 1JPJA 1YJGA 1MMGA 3FMSA 3L8IA 4OD5A 3K33A 3T6GB 3TJ5A 1VK5A 3U3BA 3VM6A 1T6IA 4NQFA 3SP1A 2J0WA 3LLIA 2XLVA 1HMDA 1MQVA 1U6HA 2YL3A 3K66A 3SXKA 5L0JA 1ST6A 1A0BA 5JVEA 3U3FA 3FAPB 2H7OA 3EHMA 3EPVA 3O6XA 3QZCA 4C7OB 3GWNA 1Q0DA 1YAUO 3C7JA 3UNGC 1WASA 3GEEA 2CCYA 2GWWA 2Y69C 3O55A 3MX3A 1FMVA 1OCOC 2VH3A 4FWVA 3ABMC 3U2LA 2HV7A 3K1HA 1H9TA 2GA0A 1R4TA 1I5NA 1TKNA 3EGDA 4KNWA 1QVXA 3PHF2 4BJ1A 4NTBA 1RJ9A 2A68F 2DYRC 3AG4C 4QDLA 1J8MF 1OW7A 3TK0A 2Q00A 2OEXA 4P9TA 4J7TA 1VLTA 2XLWA 3CEXA 1H6GA 2YRFA 2HV6A 1ZHTA 4CS7A 3H65A 3LS1A 3N2ZB 1TR2A 2NUTA 3V7OA 5E33A 3W8HA 5JS5A 4XEFA 4PJJA 2WZFA 2KJGA 3QVYA 1I4ZA 1WWPA 1MNEA 5F5FA 4E17A 5A6BD 4M63A 3NMKA 2X0CA 4O6NA 1OXKA 3ECSA 3CSKA 5E3AA 1I4YA 3FVYA 2LQGA 1KU2A 3QVZA 4CS9A 2HMZA 1NLXA 2QTVA 2PF4E 3KYJA 5K0IA 1B68A 1BBHA 2BC5A 3EGDB 4K0DA 1SR2A 2IXOA 1OKKA 3RVYA 4CBEA 2GAQA 2HMQA 4WJ0A 4DVYP 3EGXA 4O6MA 4ZLCA 3WHNA 1OXBA 2WZLA 4HFFB 4Q7CA 3IQTA 4JKVA 1ZU5A 1ZVZA 2O9XA 2YHSA 2IBFA 4IAOA 3RVZA 2KYHA 1SZIA 4QI2A 5COFA 5COGA 2CNWA 1Z6AA 5F28E 4BEMJ 4AE4B 3C8GB 3IHUA 5KYYA 3V5ZA 1V55C 3U9MA 1CGNA 1OR2A 3NYJA 1MMAA 1LS4A 3Q7LA 4PJMA 3NG1A 1EKYA 5L0DA 5L0HA 4IRUA 3UMIA 3KH2A 2Y3GA 4FX5A 1ZHYA 3R7CA 1TWGA 4E0IA 2I15A 3DD7A 4XEVA 2QUPA 2WZGA 3Q6NA 3U5SA 5KYUA 2V26A 2H7VC 2BL2A 1VYKA 2IXPA 4U5EE 3NKDA 2VCAA 3EGXB 2NUPA 3S28A 2YL1A 3NMJA 3JCUQ 3I5QA 1LM3B 3JZ0A 1ZHZA 2M64A 2RSEB 2A69F 2XL6A 2R05A 5FZTA 2LK4A 5COMA 4EIYA 3KL4A 3T4RA 3JT1A 2W9YA 3RYLA 1XZQA 1CPRA 4JW1A 1D0ZA 1O87A 1JPNA 1T5OA 1WN0A 3LUTB 1R5ID 4DOZA 5B1AC 1APCA 2J7PD 1LKXA 2KGOA 2ZPAA 3SXYA 5HV9A 2IM8A 2J45A 5IY5C 3B0VC 3TOMA 4IARA 4JTDB 4CIHA 2XLHA 1G8XA 3LAYA 4DRIB 5CI8A 3ZIBA 3O39A 4DBQA 3N0TA 1WGWA 4J7YA 1WOLA 1NFNA 4C3BA 3AG3C 5DS6A 5CIVA 3POVA 3UMHA 5KYNA 3MBGA 1KTMA 2R7XA 1NSGB 3GORA 1VLSA 1EI7A 4YT8A 4KI2A 4XQ1A 1RCPA 3MYIA 4WGYA 2G62A 3ABKC 1OR3A 4I44A 1G4US 3DAFA 2YL0A 1O5HA 2JPUA 5T3WA 3X1OA 3EFOA 2Y3DA 3KYIA 2XLMA 3IQCA 3I4UA 4MQ9F 1FFHA 1JOGA 2OEVA 5EK0A 1Z63A 1NG1A 4G7OF 5B1BC 2R02A 4NY3A 4MS2A 1V54C 2XLEA 3ITFA 1CGOA 2IOQA 1BR4A 3FAJA 3HNJA 5DVWA 2DGJA 2AP3A 3G4XA 4Q4ZF 3A11A 3B0PA 1OCRC 3AJMA 3T9OA 3MYFA 1Z3IX 2EPKX 4JIOA 2WB7A 4U5DE 2P0NA 1BDJB 1Q0KA 3M4BA 3WAQA 2DI3A 1SYQA 2ZXWC 2W4MA 5A6AA 3T6JA 1ZHWA 3CAXA 4R32A 4EUKB 5TJ5E 4AL0A 1Q0MA 1LPEA 2D4UA 3S0XA 5KYXA 3KMIA 1C17M 1TFOB 4LDQA 1NBBA 3AG1C 1S05A 3LJBA 3OEOA 1YDIA 4JRZA 5BQGA 1Q0GA 1DOWA 1JRAA 5AC4A 1L3PA 4XWJA 3NKEA 5E3CA 4U9DA 3GANA 1M2VB 4D4XA 3GM1A 1RKEA 4IAQA 3C8ZA 2V3CC 1BR1A 1ZW2A 1ZZPA 2KQ9A 1BZ4A 2PP4A 2ZXRA 3RW0A 5L0IA 3RQGA 4RBNA 2EPOA 4DBRA 4MVZA 2EILC 4FAPB 4O7GA 3CQZA 4LERA 4P6IC 3AQCA 3H2UA 4MVMA 3ZWIA 2YLDA 3W4YA 4KNVA 3V5XA 4JEBA 1L7CA 3ATPA 1HW1A 3RH3A 3B9QA 2VC9A 3JRMO 3C8GD 3R2PA 2A0BA 3LEOA 3M4CA 5AGFA 4YN0B 2H8AA 4JCZA 4N6HA 4YJWA 3X2QC 1ZYRF 2IXMA 2EINC 3HNIA 256BA 2R03A 4NTAA 3ZSUA 1W2WA 2KC3A 2OOCA 5D91A 2XL8A 2R7VA 4EWCA 4MTGA 4QI0A 1H7IA 3RQEA 2AU5A 1JMWA 4CS8C 3LLKA 2ICWG 1YARO 3F47A 2TMVP 4U5CE 3OWTA 3FXHA 4BJ5C 1GM5A 4PACA
chains in the Genus database with same CATH topology
5B3IA 1M6TA 4CDVA 2YL7A 5JSLA 5JP7A 4JEAA 3ZQVA 5JRAA 3IQ6A 2YL1A 3C62A 3NMJA 4IB4A 1LM3B 4U9EA 4ER9A 2XL6A 3C63A 4EIYA 1YYJA 4WGZA 1CPRA 3HNLA 3DE8A 1APCA 3M79A 4CDAA 3TOMA 2YKZA 4IARA 3VRCA 2J9BA 4CJGA 2XLHA 1E83A 3ZTMA 4NC3A 4JE9A 1CPQA 1QPUA 1RCPA 4WGYA 4ULVA 3QW0A 1YYXA 4L6RA 2YL0A 4CX9A 2XLVA 1MQVA 3FOPA 1GQAA 2YL3A 2XLMA 5JVEA 1JAFA 1E84A 3NMIA 2XLEA 1CGOA 3HNJA 2CCYA 1QQ3A 2XLDA 2XM0A 3M4BA 5JLIA 2XLWA 3HNKA 3IQ5A 3TOLA 5JS5A 1E85A 1NBBA 1S05A 3QVYA 3FOOA 3QW1A 3ZQYA 4D4NA 4U9DA 4D4XA 4IAQA 3NMKA 2YLIA 4N4WA 3QVZA 5JT4A 5JUAA 1BBHA 2BC5A 2XLOA 3ZWIA 1YZCA 2XM4A 2J8WA 2YLDA 4JEBA 4JKVA 4CIPA 3M15A 5AGFA 3U8PA 3M4CA 4N6HA 3L1MA 2YLGA 3ZTZA 3HNIA 256BA 4CDYA 3DE9A 4CJOA 2XL8A 2QLAA 1CGNA 1E86A 1EKYA 1YZAA 1A7VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B3I A;  1M6T A;  4CDV A;  2YL7 A;  5JSL A;  5JP7 A;  4JEA A;  3ZQV A;  5JRA A;  3IQ6 A;  2YL1 A;  3C62 A;  3NMJ A;  4IB4 A;  1LM3 B;  4U9E A;  4ER9 A;  2XL6 A;  3C63 A;  4EIY A;  1YYJ A;  4WGZ A;  1CPR A;  3HNL A;  3DE8 A;  1APC A;  3M79 A;  4CDA A;  3TOM A;  2YKZ A;  4IAR A;  3VRC A;  2J9B A;  4CJG A;  2XLH A;  1E83 A;  3ZTM A;  4NC3 A;  4JE9 A;  1CPQ A;  1QPU A;  1RCP A;  4WGY A;  4ULV A;  3QW0 A;  1YYX A;  4L6R A;  2YL0 A;  4CX9 A;  2XLV A;  1MQV A;  3FOP A;  1GQA A;  2YL3 A;  2XLM A;  5JVE A;  1JAF A;  1E84 A;  3NMI A;  2XLE A;  1CGO A;  3HNJ A;  2CCY A;  1QQ3 A;  2XLD A;  2XM0 A;  3M4B A;  5JLI A;  2XLW A;  3HNK A;  3IQ5 A;  3TOL A;  5JS5 A;  1E85 A;  1NBB A;  1S05 A;  3QVY A;  3FOO A;  3QW1 A;  3ZQY A;  4D4N A;  4U9D A;  4D4X A;  4IAQ A;  3NMK A;  2YLI A;  4N4W A;  3QVZ A;  5JT4 A;  5JUA A;  1BBH A;  2BC5 A;  2XLO A;  3ZWI A;  1YZC A;  2XM4 A;  2J8W A;  2YLD A;  4JEB A;  4JKV A;  4CIP A;  3M15 A;  5AGF A;  3U8P A;  3M4C A;  4N6H A;  3L1M A;  2YLG A;  3ZTZ A;  3HNI A;  256B A;  4CDY A;  3DE9 A;  4CJO A;  2XL8 A;  2QLA A;  1CGN A;  1E86 A;  1EKY A;  1YZA A;  1A7V A; 
#chains in the Genus database with same CATH topology
 4HEA J;  4IGG A;  5AC5 A;  3B29 A;  4HFK B;  3T6B A;  5B3I A;  1AUE A;  1YA7 O;  3KKB A;  2EPL X;  2WVQ A;  3JRT A;  5DS5 A;  1K40 A;  2J0X A;  1VB5 A;  1TFK B;  1RJ9 B;  5JRA A;  2LFD A;  3K1I C;  5DS4 A;  3VF0 A;  5A6J A;  4HE8 D;  3I5P A;  4UDV A;  2CNW D;  4Q5S F;  4U9E A;  1VMA A;  2P1A A;  5BQI A;  2Q9B A;  4G7Z F;  3C63 A;  4XLP F;  1LIH A;  1D0Y A;  3LS0 A;  2LFF A;  5GPG B;  3S90 A;  2NUT B;  2Q9A A;  1YYJ A;  5E2Q A;  1M2O A;  3VYW A;  4WAB A;  1ORS C;  2JX0 A;  1LI5 A;  1ZU4 A;  3NYL A;  4JC7 A;  2L81 A;  4MVO A;  4C3D A;  3LES A;  3LNR A;  1TWA A;  3Q7G A;  3ZG1 A;  4CJG A;  4DRJ B;  4EBK A;  1D1A A;  1OCC C;  5A6B A;  5L0C A;  1NFO A;  1N1C A;  1ORY A;  5HSW A;  2EPM X;  3FHD A;  3NDB B;  2P7V A;  2NSG A;  3ZTM A;  3UGO A;  2OQM A;  4G0H A;  1MMN A;  5L3V A;  2Y3H A;  1QPU A;  4JCH A;  4YL1 A;  2L6F A;  4ULV A;  3QW0 A;  1YYX A;  2R7O A;  4L6R A;  2HJM A;  2CGE A;  4CX9 A;  2J9U A;  2Q3T A;  3NRH A;  4EBB A;  3JYH A;  1EQ1 A;  1HE1 A;  1NZE A;  3SZR A;  3JYY A;  5KYW A;  2VCB A;  2KNH A;  4YL3 A;  3NMI A;  2J9V A;  2EIJ C;  3EZH A;  2MWQ A;  5KYY B;  2C04 A;  4MVS A;  4XTK A;  2NPU A;  4IWB A;  2RD9 A;  4XEK A;  2OKU A;  2R7R A;  2KK1 A;  4N6C A;  4ONS A;  4U5B E;  2XM0 A;  3L8J A;  1NU7 D;  1T6Q A;  4CS8 A;  3DJN B;  1C03 A;  3S29 A;  1ORJ A;  3CZ6 A;  2ZXP A;  4JUR I;  3V5Y A;  5KYU B;  2Q4F A;  3IPM O;  2ZD9 A;  4K7B A;  4U5G A;  4BJ5 A;  3DZA A;  5JLI A;  1XZP A;  1KNY A;  1YVI A;  3IEE A;  2CDQ A;  2NG1 A;  2MYS A;  2NUP B;  3HNK A;  3IQ5 A;  4C3E A;  2W45 A;  3JTL O;  3TOL A;  2KW3 C;  2YQY A;  3RFY A;  3AOU A;  1TWC A;  2GFH A;  4J30 B;  3K1I A;  2HFI A;  1QKR A;  4MW8 A;  4XPY A;  4EKW A;  5A6K A;  4RDA A;  4K1O A;  3VAY A;  3FOO A;  1MMD A;  1Y4C A;  1V4A A;  2WVN A;  3LNM B;  3QW1 A;  3ZQY A;  4D4N A;  4H4K C;  4A2N B;  3G4Z A;  2BE5 F;  1MND A;  2YLI A;  1K05 A;  3ASO C;  4N4W A;  4Z9H A;  3W2V A;  2J7P A;  3ZVR A;  1XWJ A;  5BQH A;  1CGM E;  4BG0 A;  2ETS A;  4PFP A;  5JT4 A;  5JUA A;  3RQF A;  3FDQ A;  2R7U A;  2HUJ A;  2XLO A;  1IZM A;  2PBE A;  1AVO B;  1HY5 A;  4U5F E;  3TD7 A;  2R7S A;  1G5Z A;  1YZC A;  2XM4 A;  4DJ9 A;  1NU9 C;  4O79 A;  5FCL A;  4E7S A;  1QLE C;  3PCV A;  3M15 A;  4GQH A;  2A0U A;  5T3T A;  3WOD F;  4CIP A;  3NYM A;  3U8P A;  3OA1 A;  2R7W A;  4OD4 A;  2AVK A;  3JSE O;  3L1M A;  3ZTZ A;  3GM2 A;  2YZS A;  3EFO B;  4BPM A;  3DE9 A;  4C7O A;  1M57 C;  4CJO A;  1RMV A;  1U89 A;  1A41 A;  3N24 A;  2QLA A;  2KSF A;  2L6H A;  2C03 A;  4MTF A;  2P61 A;  3B71 A;  4Z9I A;  3UGP A;  2Y39 A;  2R7T A;  3MFN A;  1G4W R;  3SEO A;  4XPX A;  2LCH A;  3ASN C;  1D0X A;  1YZA A;  4LDK A;  3US6 A;  3JSZ A;  2F22 A;  1SMY F;  1A7V A;  1D1C A;  2R7Q A;  3GEH A;  4MVR A;  1PD1 A;  4IJJ A;  1LE4 A;  1ZHX A;  2WVO A;  3EZI A;  3PDM P;  4RD9 A;  2PFD A;  4KBL A;  2YL7 A;  1PV3 A;  1UFB A;  4JEA A;  4DXW A;  4YT2 A;  2D5R B;  4DRH B;  4JTA B;  3EH2 A;  3PMR A;  3DM9 B;  2QNL A;  3DAG A;  2IXN A;  4DVZ A;  3C62 A;  4IB4 A;  4PJL A;  1Z23 A;  1FMW A;  3KPH A;  4ER9 A;  2X51 A;  2XS8 A;  2J46 A;  3B0U X;  1FR0 A;  4ANJ A;  1E2X A;  3ABL C;  3GM3 A;  4WGZ A;  2PX0 A;  5EGY A;  2Y3B A;  3HNL A;  1K04 A;  2OU6 A;  4I3M A;  3RF3 A;  2DB4 A;  2G3V A;  3DE8 A;  2FGY A;  3EG9 A;  4W8K A;  1Q0F A;  2M4E A;  3HLZ A;  3L34 A;  5D92 A;  4ZLD A;  4CDA A;  4E7Z A;  3GEI A;  1YA9 A;  2W4B A;  4GYT A;  2AWC A;  4OIO F;  2YKZ A;  4MND A;  3VRC A;  1RKE B;  2J9B A;  2ZXO A;  4E0H A;  4MVQ A;  3HKK A;  2XXA A;  1M56 C;  2GDC A;  1F1M A;  3RKO F;  1OKK D;  4PFO A;  3TQO A;  4EHP A;  4J32 B;  4E18 A;  2YEV A;  5CI9 A;  4YT4 A;  1FAP B;  3EJN A;  4NC3 A;  2QY9 A;  4O6Y A;  2UUI A;  4JE9 A;  1GGQ A;  3W8I A;  3S27 A;  1CPQ A;  3QTH A;  3BRJ A;  4XLN F;  1D1B A;  4P9F A;  4B6I A;  3BEH A;  4PK4 A;  3FOP A;  3WG7 C;  1GQA A;  2I8B A;  4A4A A;  4YWQ A;  3HTK C;  3AGT A;  4AE4 A;  3C8G A;  4CSA C;  1UG7 A;  1FTS A;  2HKV A;  3DXJ F;  1JAF A;  3MLG A;  1A7E A;  1E84 A;  2B0H A;  3EG9 B;  2XS1 A;  4BJ6 C;  1FFT C;  2A6H F;  3SXM A;  2Q7R A;  1FNT c;  1VOM A;  4OIR F;  4EBJ A;  4W8P A;  1WAT A;  2PNO A;  1QQ3 A;  2XLD A;  2OJE D;  2XXA B;  2CYD A;  3EQL F;  2JD3 A;  2Q9C A;  1VYI A;  5L0F A;  3H2V A;  1H9G A;  2R25 A;  2XSE A;  4MW3 A;  2HSQ A;  3AQB A;  4NTF A;  1EA8 A;  5BUO A;  2HS5 A;  3QMK A;  5B3S C;  1GS9 A;  2B0J A;  1AEP A;  2E87 A;  3ZC4 A;  1LS1 A;  2P6V A;  1YLM A;  4JTC B;  4MTO A;  2IYL D;  3GWL A;  4YL0 A;  5F5H A;  4JVS A;  3TJ6 A;  1E85 A;  2VB6 A;  3TUL A;  3SYN A;  1T01 A;  2LD6 A;  1RKC A;  3Q6M A;  3C18 A;  1OQC A;  3M1C B;  2LSE A;  4KC9 A;  5DQT A;  4I1M A;  1WTY A;  3W2W A;  5KYX B;  1PCX A;  2FAP B;  3DKA A;  1U0B B;  3L0I A;  4LDR A;  5EHH A;  2AWY A;  2A1D D;  1Z5Z A;  2HSB A;  3AG2 C;  2G3K A;  5L3Q A;  1LVK A;  1OW8 A;  3RIP A;  1V74 B;  4OIP F;  3DI5 A;  3SXZ A;  3J06 A;  1RXQ A;  2L7A A;  1BR2 A;  1T9K A;  2CW0 F;  2VCC A;  2XL4 A;  4JJF A;  4LAC B;  4MVU A;  4XPW A;  3U8V A;  3A9C A;  2J8W A;  3E70 C;  1JR8 A;  4FES A;  1QZX A;  3U2M A;  2A6E F;  3EH1 A;  2HZ8 A;  2WL8 A;  5DQZ A;  3U0C A;  4LLC A;  2J9W A;  3F46 A;  3LEV A;  3DJU B;  4G78 A;  1TQG A;  4NCQ A;  3S84 A;  3K6B A;  1C02 A;  2YLG A;  4JZA A;  4CDY A;  1A7D A;  1LE2 A;  1OW6 A;  1Z7Q c;  2H7B A;  3S9O A;  1J8Y F;  1HMO A;  1T6U A;  1TWH A;  5KYW B;  3UMK A;  2LIG A;  2FFH A;  4F4B A;  2ASR A;  2Z15 A;  3ZDL A;  4CSA A;  1E86 A;  1VTM P;  1LI7 A;  2EPN A;  2UUH A;  4Z9J A;  1Y6D A;  3E9V A;  3EHN A;  4BJ6 A;  3DWW A;  1M6T A;  3G50 A;  3UR3 C;  4BEJ A;  4PJN A;  4CDV A;  2OJQ A;  3DMD A;  2PX3 A;  2YWA A;  4PR9 A;  1SF8 A;  5JP7 A;  5JSL A;  4YT5 A;  4OIN F;  4AX2 A;  5DLJ A;  4G7H F;  5L0G A;  2OCC C;  3ZQV A;  3IQ6 A;  1HE9 A;  1QSP A;  4H54 A;  2EIM C;  4AK9 A;  4JJG A;  3U9J A;  1PD0 A;  5A69 A;  3GOD A;  1S7Z A;  2YVK A;  3HJC A;  4OIQ F;  3DM5 A;  1HW2 A;  4U5H A;  4BJT A;  5T1D B;  2DYS C;  2QE9 A;  1OCZ C;  1M2V A;  4ULW A;  2NSF A;  4CS9 C;  3M79 A;  2L6G A;  3K7D A;  1O3U A;  4YK5 A;  2EIK C;  2HJ3 A;  4X0R A;  2XRH A;  3AGU A;  2OG2 A;  2R9R B;  1IW7 F;  2LP4 A;  4GEH A;  1DOV A;  4AL1 A;  3O10 A;  1E83 A;  3SNH A;  2L9J A;  1ZW3 A;  4I1O B;  2MHR A;  4LLE A;  4N06 A;  2VAS A;  1JPJ A;  1YJG A;  1MMG A;  3FMS A;  3L8I A;  4OD5 A;  3K33 A;  3T6G B;  3TJ5 A;  1VK5 A;  3U3B A;  3VM6 A;  1T6I A;  4NQF A;  3SP1 A;  2J0W A;  3LLI A;  2XLV A;  1HMD A;  1MQV A;  1U6H A;  2YL3 A;  3K66 A;  3SXK A;  5L0J A;  1ST6 A;  1A0B A;  5JVE A;  3U3F A;  3FAP B;  2H7O A;  3EHM A;  3EPV A;  3O6X A;  3QZC A;  4C7O B;  3GWN A;  1Q0D A;  1YAU O;  3C7J A;  3UNG C;  1WAS A;  3GEE A;  2CCY A;  2GWW A;  2Y69 C;  3O55 A;  3MX3 A;  1FMV A;  1OCO C;  2VH3 A;  4FWV A;  3ABM C;  3U2L A;  2HV7 A;  3K1H A;  1H9T A;  2GA0 A;  1R4T A;  1I5N A;  1TKN A;  3EGD A;  4KNW A;  1QVX A;  3PHF 2;  4BJ1 A;  4NTB A;  1RJ9 A;  2A68 F;  2DYR C;  3AG4 C;  4QDL A;  1J8M F;  1OW7 A;  3TK0 A;  2Q00 A;  2OEX A;  4P9T A;  4J7T A;  1VLT A;  2XLW A;  3CEX A;  1H6G A;  2YRF A;  2HV6 A;  1ZHT A;  4CS7 A;  3H65 A;  3LS1 A;  3N2Z B;  1TR2 A;  2NUT A;  3V7O A;  5E33 A;  3W8H A;  5JS5 A;  4XEF A;  4PJJ A;  2WZF A;  2KJG A;  3QVY A;  1I4Z A;  1WWP A;  1MNE A;  5F5F A;  4E17 A;  5A6B D;  4M63 A;  3NMK A;  2X0C A;  4O6N A;  1OXK A;  3ECS A;  3CSK A;  5E3A A;  1I4Y A;  3FVY A;  2LQG A;  1KU2 A;  3QVZ A;  4CS9 A;  2HMZ A;  1NLX A;  2QTV A;  2PF4 E;  3KYJ A;  5K0I A;  1B68 A;  1BBH A;  2BC5 A;  3EGD B;  4K0D A;  1SR2 A;  2IXO A;  1OKK A;  3RVY A;  4CBE A;  2GAQ A;  2HMQ A;  4WJ0 A;  4DVY P;  3EGX A;  4O6M A;  4ZLC A;  3WHN A;  1OXB A;  2WZL A;  4HFF B;  4Q7C A;  3IQT A;  4JKV A;  1ZU5 A;  1ZVZ A;  2O9X A;  2YHS A;  2IBF A;  4IAO A;  3RVZ A;  2KYH A;  1SZI A;  4QI2 A;  5COF A;  5COG A;  2CNW A;  1Z6A A;  5F28 E;  4BEM J;  4AE4 B;  3C8G B;  3IHU A;  5KYY A;  3V5Z A;  1V55 C;  3U9M A;  1CGN A;  1OR2 A;  3NYJ A;  1MMA A;  1LS4 A;  3Q7L A;  4PJM A;  3NG1 A;  1EKY A;  5L0D A;  5L0H A;  4IRU A;  3UMI A;  3KH2 A;  2Y3G A;  4FX5 A;  1ZHY A;  3R7C A;  1TWG A;  4E0I A;  2I15 A;  3DD7 A;  4XEV A;  2QUP A;  2WZG A;  3Q6N A;  3U5S A;  5KYU A;  2V26 A;  2H7V C;  2BL2 A;  1VYK A;  2IXP A;  4U5E E;  3NKD A;  2VCA A;  3EGX B;  2NUP A;  3S28 A;  2YL1 A;  3NMJ A;  3JCU Q;  3I5Q A;  1LM3 B;  3JZ0 A;  1ZHZ A;  2M64 A;  2RSE B;  2A69 F;  2XL6 A;  2R05 A;  5FZT A;  2LK4 A;  5COM A;  4EIY A;  3KL4 A;  3T4R A;  3JT1 A;  2W9Y A;  3RYL A;  1XZQ A;  1CPR A;  4JW1 A;  1D0Z A;  1O87 A;  1JPN A;  1T5O A;  1WN0 A;  3LUT B;  1R5I D;  4DOZ A;  5B1A C;  1APC A;  2J7P D;  1LKX A;  2KGO A;  2ZPA A;  3SXY A;  5HV9 A;  2IM8 A;  2J45 A;  5IY5 C;  3B0V C;  3TOM A;  4IAR A;  4JTD B;  4CIH A;  2XLH A;  1G8X A;  3LAY A;  4DRI B;  5CI8 A;  3ZIB A;  3O39 A;  4DBQ A;  3N0T A;  1WGW A;  4J7Y A;  1WOL A;  1NFN A;  4C3B A;  3AG3 C;  5DS6 A;  5CIV A;  3POV A;  3UMH A;  5KYN A;  3MBG A;  1KTM A;  2R7X A;  1NSG B;  3GOR A;  1VLS A;  1EI7 A;  4YT8 A;  4KI2 A;  4XQ1 A;  1RCP A;  3MYI A;  4WGY A;  2G62 A;  3ABK C;  1OR3 A;  4I44 A;  1G4U S;  3DAF A;  2YL0 A;  1O5H A;  2JPU A;  5T3W A;  3X1O A;  3EFO A;  2Y3D A;  3KYI A;  2XLM A;  3IQC A;  3I4U A;  4MQ9 F;  1FFH A;  1JOG A;  2OEV A;  5EK0 A;  1Z63 A;  1NG1 A;  4G7O F;  5B1B C;  2R02 A;  4NY3 A;  4MS2 A;  1V54 C;  2XLE A;  3ITF A;  1CGO A;  2IOQ A;  1BR4 A;  3FAJ A;  3HNJ A;  5DVW A;  2DGJ A;  2AP3 A;  3G4X A;  4Q4Z F;  3A11 A;  3B0P A;  1OCR C;  3AJM A;  3T9O A;  3MYF A;  1Z3I X;  2EPK X;  4JIO A;  2WB7 A;  4U5D E;  2P0N A;  1BDJ B;  1Q0K A;  3M4B A;  3WAQ A;  2DI3 A;  1SYQ A;  2ZXW C;  2W4M A;  5A6A A;  3T6J A;  1ZHW A;  3CAX A;  4R32 A;  4EUK B;  5TJ5 E;  4AL0 A;  1Q0M A;  1LPE A;  2D4U A;  3S0X A;  5KYX A;  3KMI A;  1C17 M;  1TFO B;  4LDQ A;  1NBB A;  3AG1 C;  1S05 A;  3LJB A;  3OEO A;  1YDI A;  4JRZ A;  5BQG A;  1Q0G A;  1DOW A;  1JRA A;  5AC4 A;  1L3P A;  4XWJ A;  3NKE A;  5E3C A;  4U9D A;  3GAN A;  1M2V B;  4D4X A;  3GM1 A;  1RKE A;  4IAQ A;  3C8Z A;  2V3C C;  1BR1 A;  1ZW2 A;  1ZZP A;  2KQ9 A;  1BZ4 A;  2PP4 A;  2ZXR A;  3RW0 A;  5L0I A;  3RQG A;  4RBN A;  2EPO A;  4DBR A;  4MVZ A;  2EIL C;  4FAP B;  4O7G A;  3CQZ A;  4LER A;  4P6I C;  3AQC A;  3H2U A;  4MVM A;  3ZWI A;  2YLD A;  3W4Y A;  4KNV A;  3V5X A;  4JEB A;  1L7C A;  3ATP A;  1HW1 A;  3RH3 A;  3B9Q A;  2VC9 A;  3JRM O;  3C8G D;  3R2P A;  2A0B A;  3LEO A;  3M4C A;  5AGF A;  4YN0 B;  2H8A A;  4JCZ A;  4N6H A;  4YJW A;  3X2Q C;  1ZYR F;  2IXM A;  2EIN C;  3HNI A;  256B A;  2R03 A;  4NTA A;  3ZSU A;  1W2W A;  2KC3 A;  2OOC A;  5D91 A;  2XL8 A;  2R7V A;  4EWC A;  4MTG A;  4QI0 A;  1H7I A;  3RQE A;  2AU5 A;  1JMW A;  4CS8 C;  3LLK A;  2ICW G;  1YAR O;  3F47 A;  2TMV P;  4U5C E;  3OWT A;  3FXH A;  4BJ5 C;  1GM5 A;  4PAC A; 
#chains in the Genus database with same CATH homology
 5B3I A;  1M6T A;  4CDV A;  2YL7 A;  5JSL A;  5JP7 A;  4JEA A;  3ZQV A;  5JRA A;  3IQ6 A;  2YL1 A;  3C62 A;  3NMJ A;  4IB4 A;  1LM3 B;  4U9E A;  4ER9 A;  2XL6 A;  3C63 A;  4EIY A;  1YYJ A;  4WGZ A;  1CPR A;  3HNL A;  3DE8 A;  1APC A;  3M79 A;  4CDA A;  3TOM A;  2YKZ A;  4IAR A;  3VRC A;  2J9B A;  4CJG A;  2XLH A;  1E83 A;  3ZTM A;  4NC3 A;  4JE9 A;  1CPQ A;  1QPU A;  1RCP A;  4WGY A;  4ULV A;  3QW0 A;  1YYX A;  4L6R A;  2YL0 A;  4CX9 A;  2XLV A;  1MQV A;  3FOP A;  1GQA A;  2YL3 A;  2XLM A;  5JVE A;  1JAF A;  1E84 A;  3NMI A;  2XLE A;  1CGO A;  3HNJ A;  2CCY A;  1QQ3 A;  2XLD A;  2XM0 A;  3M4B A;  5JLI A;  2XLW A;  3HNK A;  3IQ5 A;  3TOL A;  5JS5 A;  1E85 A;  1NBB A;  1S05 A;  3QVY A;  3FOO A;  3QW1 A;  3ZQY A;  4D4N A;  4U9D A;  4D4X A;  4IAQ A;  3NMK A;  2YLI A;  4N4W A;  3QVZ A;  5JT4 A;  5JUA A;  1BBH A;  2BC5 A;  2XLO A;  3ZWI A;  1YZC A;  2XM4 A;  2J8W A;  2YLD A;  4JEB A;  4JKV A;  4CIP A;  3M15 A;  5AGF A;  3U8P A;  3M4C A;  4N6H A;  3L1M A;  2YLG A;  3ZTZ A;  3HNI A;  256B A;  4CDY A;  3DE9 A;  4CJO A;  2XL8 A;  2QLA A;  1CGN A;  1E86 A;  1EKY A;  1YZA A;  1A7V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...