1SR2A

Solution structure of the escherichia coli yojn histidine-phosphotransferase (hpt) domain
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
116
structure length
116
Chain Sequence
MQEAVLQLIEVQLAQEEVTESPLGGDENAQLHASGYYALFVDTVPDDVKRLYTEAATSDFAALAQTAHRLKGVFAMLNLVPGKQLCETLEHLIREKDVPGIEKYISDIDSYVKSLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Putative sensor-like histidine kinase yojN
publication title Solution Structure of the Escherichia coli YojN Histidine-phosphotransferase Domain and its Interaction with Cognate Phosphoryl Receiver Domains
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 37
structure length 116
sequence length 116
ec nomenclature ec 2.7.3.-:
pdb deposition date 2004-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01627 Hpt Hpt domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.160 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) HPT domain 1sr2A00
1YVIA 1QSPA 2OOCA 1BDJB 4PACA 3U3BA 4G78A 1C02A 1A0BA 1I5NA 2A0BA 1WN0A 1SR2A 2R25A 3IQTA 3US6A 1OXKA 1FR0A 2LCHA 2LD6A 1C03A 3MYFA 1TQGA 3KYIA 2LP4A 3KYJA 4EUKB 1Y6DA 1OXBA 2Q4FA
chains in the Genus database with same CATH superfamily
3UGPA 4PFPA 2OU6A 1OQCA 1GM5A 2QE9A 3GORA 4U5HA 3NG1A 3U2LA 2VCCA 3C62A 1BDJB 5DS5A 4LERA 2R7QA 1UG7A 4ER9A 1QVXA 2BC5A 4ONSA 3HKKA 2J9VA 1EA8A 1I5NA 1LVKA 2J9BA 3LESA 3SXMA 3ZTZA 1JPJA 1BR4A 1ST6A 1ZHWA 2M4EA 2HJ3A 2KYHA 3TOMA 4CDVA 3C8GD 3VM6A 4CBEA 1VYKA 1M2OA 4JVSA 3EHNA 3IQ6A 1M56C 2IYLD 1Q0MA 3IQCA 5JLIA 3I5PA 4OIPF 2OKUA 2WVOA 1CPQA 4ZLCA 1VLSA 4C3DA 2H7BA 4K1OA 3J06A 4KC9A 2EIKC 4JTCB 4U5FE 1XZQA 3SEOA 3UR3C 3JTLO 1S7ZA 2R7VA 2R03A 2ZXPA 3F46A 1C17M 1ZHTA 5L0JA 4CIPA 1M6TA 3UMHA 3DM9B 2WL8A 2VC9A 3B71A 3FAJA 3M1CB 3BEHA 4LLCA 2A0BA 2EPNA 5L3QA 1TKNA 4PJLA 5KYWA 2V3CC 3AQCA 2QUPA 2NSGA 4F4BA 3T6JA 1G4WR 5KYYA 5L0IA 4IARA 2LCHA 3KYIA 2XXAA 1I4YA 3PMRA 1MQVA 5K0IA 2R7SA 3U8VA 5L0FA 4BJ5C 3B0PA 3HLZA 3KYJA 4DBQA 1MMDA 4QI0A 5JUAA 4EBJA 4CS8C 3QZCA 3DAGA 1VTMP 2Y3DA 3LS1A 4JURI 5BQHA 1H9TA 3GWLA 4JCHA 1KU2A 5KYUA 5AGFA 1YZAA 3SXYA 3RVYA 4D4XA 2ASRA 5JVEA 2HJMA 3C18A 1QSPA 5B3SC 2H7OA 3NKDA 2J7PD 2IOQA 1APCA 1CPRA 1OCRC 4U5BE 2R7TA 2Q00A 1K05A 5JS5A 4PK4A 1K40A 3IPMO 3O39A 4G7OF 4RBNA 4JJGA 4XTKA 2G62A 2RSEB 5B1AC 3LEOA 5AC5A 2J7PA 2AWYA 2L9JA 1TQGA 3G4XA 3M4BA 2CW0F 4O6YA 3LUTB 3RFYA 4FAPB 3JYYA 2A6HF 4CX9A 3VF0A 2R7WA 3CSKA 5HV9A 5JP7A 2R7RA 1ORSC 1FAPB 1FFHA 3U5SA 1HW2A 2R7UA 3AG4C 1WGWA 2CDQA 4O6MA 4X0RA 4YN0B 1BR1A 1N1CA 1HE1A 5KYWB 3EG9A 3EH2A 2ICWG 5COFA 2HMQA 3ZSUA 4Q4ZF 4XEVA 3UNGC 3JT1A 5KYYB 1C02A 2R9RB 1ZHZA 3AGUA 2WZLA 4AX2A 4NC3A 4AE4A 2XXAB 3VAYA 1MNEA 1Z63A 4WABA 4N4WA 2YHSA 4W8PA 5T3WA 4MVZA 3C8ZA 3I4UA 2KW3C 3US6A 3L8JA 3DXJF 2F22A 2YZSA 1SF8A 2JPUA 4L6RA 1TFKB 2DI3A 1YYJA 1YYXA 5KYUB 2OJED 3QW0A 2KNHA 2JX0A 2EIMC 3S9OA 3ZVRA 4JW1A 3LAYA 1F1MA 2YL7A 4J7TA 3LNMB 2D4UA 2PF4E 4MTFA 3TJ6A 4BJ1A 2Q9BA 2M64A 3H65A 2P1AA 5EHHA 2WB7A 3PDMP 2VB6A 1B68A 1M2VA 2FFHA 2C04A 3U3BA 2R05A 2YLGA 1V55C 3SYNA 1WWPA 3RIPA 4ULVA 1KTMA 3GM3A 5TJ5E 2IXMA 4A2NB 3NKEA 1Q0DA 1DOVA 4CS9A 2NSFA 3AOUA 4YT5A 4Z9JA 3U8PA 4IAQA 1JMWA 2OJQA 2Q3TA 5L0CA 3I5QA 5GPGB 1LM3B 1NFNA 1YJGA 2YL0A 3EZIA 3RQGA 3X2QC 2VCAA 2J45A 3K7DA 4O79A 4XQ1A 3RH3A 1ZU5A 3SNHA 3S0XA 1ZHXA 2R7XA 3CEXA 2GWWA 4DRIB 1FMVA 3AQBA 1U89A 3FHDA 3DM5A 4MS2A 2D5RB 2OQMA 3EG9B 1ZHYA 3K1IC 3AG3C 4ANJA 3AG1C 3C7JA 1MNDA 2LQGA 5FCLA 4CJGA 1RXQA 1WATA 2J9WA 4FWVA 2A6EF 5COMA 5D92A 1OW6A 4AE4B 1DOWA 4DRHB 1ZYRF 2P0NA 3L1MA 2DB4A 1MMGA 1JAFA 1UFBA 2I15A 1VLTA 1WN0A 5L0HA 1T6IA 1MMAA 4J32B 2HKVA 1TWAA 2HSBA 2J8WA 3LS0A 4RDAA 4ULWA 3RKOF 4JTAB 3ZIBA 5B3IA 5JRAA 1ZW3A 4HFKB 5JT4A 3FOPA 3UGOA 1OW8A 3FXHA 2QLAA 4PJJA 2IXOA 5CI9A 1A7VA 2WVQA 1TR2A 4A4AA 4NTAA 1A7DA 2AU5A 3GEIA 1OR2A 2YLDA 1HMDA 1LIHA 2X0CA 3ZG1A 1M2VB 1A7EA 3WODF 3ZWIA 1YVIA 4P9FA 3W2WA 4E17A 1J8MF 1ZW2A 4I1MA 3ASNC 4CDYA 1EI7A 2KGOA 1D1CA 1OW7A 4U9DA 4C3EA 3MLGA 4MW3A 2A68F 2HV6A 2W45A 1FFTC 3GEEA 5F5FA 1MMNA 3V5ZA 3FOOA 1RKEB 1A0BA 4YT4A 1YA9A 4U5DE 5E3AA 1RJ9A 2HFIA 3BRJA 2L81A 4BG0A 1TWCA 4BJ5A 3M15A 4EIYA 2H7VC 3IQTA 1TWGA 1NBBA 3U9JA 3NRHA 3KH2A 2BE5F 3CQZA 4E0HA 1O87A 1V4AA 1VK5A 1YARO 2B0JA 3CZ6A 4IAOA 4NQFA 5E3CA 3W8IA 2EIJC 1D1AA 3G4ZA 4QDLA 4JE9A 5A6KA 1LE2A 4MNDA 4DJ9A 2Y69C 3DJUB 4MVSA 4PR9A 3GWNA 3DAFA 2OCCC 2YL1A 2O9XA 3JYHA 1YDIA 2YLIA 5A6AA 4DVYP 2HS5A 3AG2C 4PACA 3MFNA 3QMKA 3O10A 1A41A 3DE8A 1PCXA 3GANA 4EBBA 4LDKA 3R2PA 5BUOA 4MQ9F 4LACB 4HE8D 3OA1A 4I1OB 3H2UA 4QI2A 5JSLA 1D0YA 4EBKA 1U0BB 4CSAA 1OCOC 3MYFA 4MW8A 3RW0A 4XEFA 3U2MA 3NDBB 2Y3BA 2LK4A 3MX3A 3V5XA 1BR2A 4CJOA 1GS9A 1NSGB 2YEVA 5DQTA 4I3MA 1Y6DA 1OXBA 3DE9A 3VRCA 4YT2A 2L6HA 2QNLA 3LEVA 1V74B 3HNKA 2Y39A 1WTYA 4DBRA 4FX5A 3W2VA 5A6BD 1H6GA 2IXNA 3JSZA 4OIRF 2TMVP 2XLVA 3LLKA 2NUPA 1FTSA 4YWQA 1Z5ZA 2P61A 1QPUA 2R25A 2WZGA 1OCCC 4XPWA 4PJMA 1SZIA 3B9QA 2KC3A 4WJ0A 3JSEO 5F5HA 4FESA 1C03A 4C7OA 2Z15A 3EQLF 4P6IC 5D91A 5A6BA 4IJJA 2GDCA 3B0VC 1QLEC 1Z6AA 3U9MA 4HEAJ 2A0UA 4AL0A 1OCZC 5EK0A 2YKZA 2PX3A 4I44A 4PFOA 4BPMA 1NZEA 3CAXA 2MWQA 4XPYA 4JIOA 3R7CA 4G7HF 5T1DB 1D1BA 1NU9C 3K66A 2IM8A 2ZD9A 1TWHA 2OEVA 2E87A 3DWWA 1RMVA 4BJ6C 1Q0FA 5HSWA 3UMIA 1RCPA 3EGXA 3E9VA 4IGGA 5B1BC 3L8IA 2UUHA 3RYLA 3ZQYA 4Q7CA 5DLJA 3N0TA 5L3VA 1T6UA 3L34A 3TD7A 2NUTA 2EPKX 1NLXA 4IRUA 2QTVA 2ZXOA 2Q9AA 3K1IA 4MVUA 4OINF 4JJFA 5AC4A 1E83A 3ITFA 4CIHA 5F28E 4JTDB 3GODA 1PD0A 4XLPF 1FR0A 4WGYA 2I8BA 1NU7D 1M57C 4KBLA 3EJNA 2VH3A 5COGA 3RVZA 2HV7A 1WASA 2MYSA 2XLWA 1CGOA 3W4YA 3WHNA 5A6JA 4GEHA 4MTOA 2CCYA 2J9UA 4EKWA 3E70C 3GM2A 1TFOB 5E33A 3IHUA 3S90A 1CGNA 1QQ3A 4YK5A 3HNJA 1G5ZA 4B6IA 1VMAA 2NUPB 2CGEA 3KMIA 4H4KC 3M79A 1OKKA 1OR3A 2OOCA 2Y3HA 4GQHA 4G78A 3AJMA 2EPMX 4MVMA 3A9CA 3L0IA 3Q7GA 2P7VA 4XPXA 2B0HA 4XLNF 1G4US 2KQ9A 2DYSC 4LDRA 1SR2A 3DJNB 2A69F 4JZAA 3X1OA 4JEAA 4MVOA 3TOLA 2XSEA 2VCBA 3EHMA 5CIVA 3KKBA 2C03A 5FZTA 4BEMJ 1LS4A 4LLEA 4ZLDA 4OD5A 4NY3A 4N6CA 4JRZA 2L6FA 4CS9C 1E86A 2LFFA 3DD7A 4RD9A 1FMWA 3HNIA 1JR8A 1O5HA 4NTFA 4H54A 2KSFA 3NMKA 4D4NA 4E7SA 2LFDA 3AGTA 3HJCA 3N24A 4K0DA 5L0DA 2XLMA 1LKXA 4HFFB 5EGYA 4MVRA 5DQZA 5IY5C 3EGXB 1AUEA 2DGJA 3SP1A 4CS7A 1T5OA 3SXKA 3HNLA 5CI8A 3QVZA 1Q0KA 4BEJA 3DZAA 3TK0A 4OIQF 2NUTB 2XLDA 3S28A 3TQOA 4YT8A 2XRHA 5KYNA 3W8HA 3T6GB 3VYWA 2XL6A 1VOMA 1S05A 3JCUQ 3GEHA 4G0HA 1H9GA 3M4CA 3JRTA 1JOGA 3SZRA 3TJ5A 2H8AA 4MTGA 3ZQVA 4NTBA 4AL1A 3K1HA 3PCVA 5DS6A 4W8KA 1QZXA 1R5ID 1VB5A 2PNOA 3GM1A 4CS8A 3DI5A 2HMZA 4EHPA 2DYRC 3NMIA 4YJWA 3ZC4A 1L3PA 2YL3A 1JPNA 2XS8A 3T9OA 1HW1A 4U5GA 4WGZA 3NMJA 1KNYA 3C8GA 2R7OA 3ASOC 2ZXWC 1E85A 4XEKA 4YL0A 4G7ZF 1BZ4A 3RF3A 3Q7LA 3QVYA 1QKRA 1I4ZA 1IZMA 2JD3A 4IB4A 2X51A 2EPOA 3LJBA 3RQFA 3OEOA 3UMKA 2EILC 3JZ0A 2V26A 3B0UX 5KYXA 3ZTMA 3QTHA 3ABLC 2YRFA 1XWJA 2FGYA 3S84A 1J8YF 1IW7F 2AVKA 2LIGA 2XL4A 2NPUA 1CGME 2XL8A 1T9KA 3LLIA 1PV3A 1YZCA 2BL2A 2J46A 3G50A 1PD1A 1G8XA 3N2ZB 1BBHA 4U5EE 1HY5A 1U6HA 2ZPAA 3K33A 3NYLA 4J30B 1Y4CA 3S27A 2LP4A 4AK9A 4IWBA 4N06A 1W2WA 2YQYA 4EWCA 2HUJA 2WZFA 1LS1A 2EINC 1EQ1A 2XM0A 2LD6A 4DRJB 3HTKC 3PHF2 2VASA 4O7GA 2HZ8A 4GYTA 1O3UA 4JEBA 2EPLX 3WG7C 1RJ9B 256BA 1FNTc 2CYDA 3POVA 1R4TA 2G3VA 3NYJA 4Z9HA 1WOLA 3EFOA 5A69A 4OIOF 1YAUO 3F47A 3FMSA 4P9TA 4YL1A 4C3BA 4E7ZA 4OD4A 5DS4A 3RQEA 2PFDA 2KJGA 2AWCA 1VYIA 3EGDA 3T4RA 1NG1A 1OXKA 2G3KA 2IBFA 4N6HA 1AVOB 3C8GB 3ZDLA 4UDVA 3IEEA 4JCZA 2Q9CA 1L7CA 2Y3GA 2A1DD 5E2QA 3NYMA 2L6GA 4MVQA 1T01A 1ZU4A 2W4MA 1LI5A 1YLMA 2W9YA 3EH1A 4BJTA 4Z9IA 4BJ6A 4CSAC 2XS1A 4KNWA 2W4BA 4CDAA 1ZZPA 2WVNA 4J7YA 3WAQA 1ORYA 3EZHA 5KYXB 4XWJA 3KPHA 4DOZA 4E18A 3ECSA 3JRMO 2PBEA 1Q0GA 3IQ5A 1ORJA 5T3TA 1JRAA 3H2VA 1RKCA 2UUIA 1T6QA 4M63A 2R02A 3TULA 2CNWD 1D0ZA 3U0CA 3U3FA 2PP4A 3OWTA 1EKYA 2LSEA 2MHRA 2PX0A 3B29A 4DXWA 3ABKC 1YA7O 4U9EA 4YL3A 1HE9A 4KI2A 4K7BA 3V5YA 2YVKA 5BQIA 3O6XA 3Q6MA 1GQAA 1OKKD 2NG1A 2ZXRA 2CNWA 2OG2A 4EUKB 4JKVA 2L7AA 1GGQA 3DKAA 2P6VA 5DVWA 3EPVA 5L0GA 2J0XA 3MBGA 3Q6NA 4PJNA 2YWAA 3EFOB 3QW1A 1SMYF 1Z23A 1ZVZA 2XM4A 1V54C 3K6BA 2XLEA 3ATPA 4U5CE 2Q7RA 3T6BA 4Q5SF 3ABMC 1K04A 3LNRA 4KNVA 4LDQA 1LI7A 1H7IA 3FDQA 3EGDB 1NFOA 3A11A 3KL4A 1E84A 2AP3A 3FAPB 3C63A 3MYIA 3O55A 5BQGA 4R32A 1XZPA 2QY9A 4C7OB 3SXZA 1SYQA 2GAQA 1RKEA 2FAPB 2HSQA 2J0WA 3V7OA 1HMOA 1LPEA 2IXPA 1Z7Qc 4NCQA 2RD9A 2GA0A 2KK1A 2XLHA 3S29A 1AEPA 2OEXA 2GFHA 2ETSA 1Z3IX 3FVYA 4O6NA 4JC7A 4DVZA 3DMDA 1E2XA 4E0IA 2XLOA 2Q4FA 1D0XA 1LE4A
chains in the Genus database with same CATH topology
1YVIA 1QSPA 2OOCA 1BDJB 4PACA 3U3BA 4G78A 1C02A 1A0BA 1I5NA 2A0BA 1WN0A 1SR2A 2R25A 3IQTA 3US6A 1OXKA 1FR0A 2LCHA 2LD6A 1C03A 3MYFA 1TQGA 3KYIA 2LP4A 3KYJA 4EUKB 1Y6DA 1OXBA 2Q4FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YVI A;  1QSP A;  2OOC A;  1BDJ B;  4PAC A;  3U3B A;  4G78 A;  1C02 A;  1A0B A;  1I5N A;  2A0B A;  1WN0 A;  1SR2 A;  2R25 A;  3IQT A;  3US6 A;  1OXK A;  1FR0 A;  2LCH A;  2LD6 A;  1C03 A;  3MYF A;  1TQG A;  3KYI A;  2LP4 A;  3KYJ A;  4EUK B;  1Y6D A;  1OXB A;  2Q4F A; 
#chains in the Genus database with same CATH topology
 3UGP A;  4PFP A;  2OU6 A;  1OQC A;  1GM5 A;  2QE9 A;  3GOR A;  4U5H A;  3NG1 A;  3U2L A;  2VCC A;  3C62 A;  1BDJ B;  5DS5 A;  4LER A;  2R7Q A;  1UG7 A;  4ER9 A;  1QVX A;  2BC5 A;  4ONS A;  3HKK A;  2J9V A;  1EA8 A;  1I5N A;  1LVK A;  2J9B A;  3LES A;  3SXM A;  3ZTZ A;  1JPJ A;  1BR4 A;  1ST6 A;  1ZHW A;  2M4E A;  2HJ3 A;  2KYH A;  3TOM A;  4CDV A;  3C8G D;  3VM6 A;  4CBE A;  1VYK A;  1M2O A;  4JVS A;  3EHN A;  3IQ6 A;  1M56 C;  2IYL D;  1Q0M A;  3IQC A;  5JLI A;  3I5P A;  4OIP F;  2OKU A;  2WVO A;  1CPQ A;  4ZLC A;  1VLS A;  4C3D A;  2H7B A;  4K1O A;  3J06 A;  4KC9 A;  2EIK C;  4JTC B;  4U5F E;  1XZQ A;  3SEO A;  3UR3 C;  3JTL O;  1S7Z A;  2R7V A;  2R03 A;  2ZXP A;  3F46 A;  1C17 M;  1ZHT A;  5L0J A;  4CIP A;  1M6T A;  3UMH A;  3DM9 B;  2WL8 A;  2VC9 A;  3B71 A;  3FAJ A;  3M1C B;  3BEH A;  4LLC A;  2A0B A;  2EPN A;  5L3Q A;  1TKN A;  4PJL A;  5KYW A;  2V3C C;  3AQC A;  2QUP A;  2NSG A;  4F4B A;  3T6J A;  1G4W R;  5KYY A;  5L0I A;  4IAR A;  2LCH A;  3KYI A;  2XXA A;  1I4Y A;  3PMR A;  1MQV A;  5K0I A;  2R7S A;  3U8V A;  5L0F A;  4BJ5 C;  3B0P A;  3HLZ A;  3KYJ A;  4DBQ A;  1MMD A;  4QI0 A;  5JUA A;  4EBJ A;  4CS8 C;  3QZC A;  3DAG A;  1VTM P;  2Y3D A;  3LS1 A;  4JUR I;  5BQH A;  1H9T A;  3GWL A;  4JCH A;  1KU2 A;  5KYU A;  5AGF A;  1YZA A;  3SXY A;  3RVY A;  4D4X A;  2ASR A;  5JVE A;  2HJM A;  3C18 A;  1QSP A;  5B3S C;  2H7O A;  3NKD A;  2J7P D;  2IOQ A;  1APC A;  1CPR A;  1OCR C;  4U5B E;  2R7T A;  2Q00 A;  1K05 A;  5JS5 A;  4PK4 A;  1K40 A;  3IPM O;  3O39 A;  4G7O F;  4RBN A;  4JJG A;  4XTK A;  2G62 A;  2RSE B;  5B1A C;  3LEO A;  5AC5 A;  2J7P A;  2AWY A;  2L9J A;  1TQG A;  3G4X A;  3M4B A;  2CW0 F;  4O6Y A;  3LUT B;  3RFY A;  4FAP B;  3JYY A;  2A6H F;  4CX9 A;  3VF0 A;  2R7W A;  3CSK A;  5HV9 A;  5JP7 A;  2R7R A;  1ORS C;  1FAP B;  1FFH A;  3U5S A;  1HW2 A;  2R7U A;  3AG4 C;  1WGW A;  2CDQ A;  4O6M A;  4X0R A;  4YN0 B;  1BR1 A;  1N1C A;  1HE1 A;  5KYW B;  3EG9 A;  3EH2 A;  2ICW G;  5COF A;  2HMQ A;  3ZSU A;  4Q4Z F;  4XEV A;  3UNG C;  3JT1 A;  5KYY B;  1C02 A;  2R9R B;  1ZHZ A;  3AGU A;  2WZL A;  4AX2 A;  4NC3 A;  4AE4 A;  2XXA B;  3VAY A;  1MNE A;  1Z63 A;  4WAB A;  4N4W A;  2YHS A;  4W8P A;  5T3W A;  4MVZ A;  3C8Z A;  3I4U A;  2KW3 C;  3US6 A;  3L8J A;  3DXJ F;  2F22 A;  2YZS A;  1SF8 A;  2JPU A;  4L6R A;  1TFK B;  2DI3 A;  1YYJ A;  1YYX A;  5KYU B;  2OJE D;  3QW0 A;  2KNH A;  2JX0 A;  2EIM C;  3S9O A;  3ZVR A;  4JW1 A;  3LAY A;  1F1M A;  2YL7 A;  4J7T A;  3LNM B;  2D4U A;  2PF4 E;  4MTF A;  3TJ6 A;  4BJ1 A;  2Q9B A;  2M64 A;  3H65 A;  2P1A A;  5EHH A;  2WB7 A;  3PDM P;  2VB6 A;  1B68 A;  1M2V A;  2FFH A;  2C04 A;  3U3B A;  2R05 A;  2YLG A;  1V55 C;  3SYN A;  1WWP A;  3RIP A;  4ULV A;  1KTM A;  3GM3 A;  5TJ5 E;  2IXM A;  4A2N B;  3NKE A;  1Q0D A;  1DOV A;  4CS9 A;  2NSF A;  3AOU A;  4YT5 A;  4Z9J A;  3U8P A;  4IAQ A;  1JMW A;  2OJQ A;  2Q3T A;  5L0C A;  3I5Q A;  5GPG B;  1LM3 B;  1NFN A;  1YJG A;  2YL0 A;  3EZI A;  3RQG A;  3X2Q C;  2VCA A;  2J45 A;  3K7D A;  4O79 A;  4XQ1 A;  3RH3 A;  1ZU5 A;  3SNH A;  3S0X A;  1ZHX A;  2R7X A;  3CEX A;  2GWW A;  4DRI B;  1FMV A;  3AQB A;  1U89 A;  3FHD A;  3DM5 A;  4MS2 A;  2D5R B;  2OQM A;  3EG9 B;  1ZHY A;  3K1I C;  3AG3 C;  4ANJ A;  3AG1 C;  3C7J A;  1MND A;  2LQG A;  5FCL A;  4CJG A;  1RXQ A;  1WAT A;  2J9W A;  4FWV A;  2A6E F;  5COM A;  5D92 A;  1OW6 A;  4AE4 B;  1DOW A;  4DRH B;  1ZYR F;  2P0N A;  3L1M A;  2DB4 A;  1MMG A;  1JAF A;  1UFB A;  2I15 A;  1VLT A;  1WN0 A;  5L0H A;  1T6I A;  1MMA A;  4J32 B;  2HKV A;  1TWA A;  2HSB A;  2J8W A;  3LS0 A;  4RDA A;  4ULW A;  3RKO F;  4JTA B;  3ZIB A;  5B3I A;  5JRA A;  1ZW3 A;  4HFK B;  5JT4 A;  3FOP A;  3UGO A;  1OW8 A;  3FXH A;  2QLA A;  4PJJ A;  2IXO A;  5CI9 A;  1A7V A;  2WVQ A;  1TR2 A;  4A4A A;  4NTA A;  1A7D A;  2AU5 A;  3GEI A;  1OR2 A;  2YLD A;  1HMD A;  1LIH A;  2X0C A;  3ZG1 A;  1M2V B;  1A7E A;  3WOD F;  3ZWI A;  1YVI A;  4P9F A;  3W2W A;  4E17 A;  1J8M F;  1ZW2 A;  4I1M A;  3ASN C;  4CDY A;  1EI7 A;  2KGO A;  1D1C A;  1OW7 A;  4U9D A;  4C3E A;  3MLG A;  4MW3 A;  2A68 F;  2HV6 A;  2W45 A;  1FFT C;  3GEE A;  5F5F A;  1MMN A;  3V5Z A;  3FOO A;  1RKE B;  1A0B A;  4YT4 A;  1YA9 A;  4U5D E;  5E3A A;  1RJ9 A;  2HFI A;  3BRJ A;  2L81 A;  4BG0 A;  1TWC A;  4BJ5 A;  3M15 A;  4EIY A;  2H7V C;  3IQT A;  1TWG A;  1NBB A;  3U9J A;  3NRH A;  3KH2 A;  2BE5 F;  3CQZ A;  4E0H A;  1O87 A;  1V4A A;  1VK5 A;  1YAR O;  2B0J A;  3CZ6 A;  4IAO A;  4NQF A;  5E3C A;  3W8I A;  2EIJ C;  1D1A A;  3G4Z A;  4QDL A;  4JE9 A;  5A6K A;  1LE2 A;  4MND A;  4DJ9 A;  2Y69 C;  3DJU B;  4MVS A;  4PR9 A;  3GWN A;  3DAF A;  2OCC C;  2YL1 A;  2O9X A;  3JYH A;  1YDI A;  2YLI A;  5A6A A;  4DVY P;  2HS5 A;  3AG2 C;  4PAC A;  3MFN A;  3QMK A;  3O10 A;  1A41 A;  3DE8 A;  1PCX A;  3GAN A;  4EBB A;  4LDK A;  3R2P A;  5BUO A;  4MQ9 F;  4LAC B;  4HE8 D;  3OA1 A;  4I1O B;  3H2U A;  4QI2 A;  5JSL A;  1D0Y A;  4EBK A;  1U0B B;  4CSA A;  1OCO C;  3MYF A;  4MW8 A;  3RW0 A;  4XEF A;  3U2M A;  3NDB B;  2Y3B A;  2LK4 A;  3MX3 A;  3V5X A;  1BR2 A;  4CJO A;  1GS9 A;  1NSG B;  2YEV A;  5DQT A;  4I3M A;  1Y6D A;  1OXB A;  3DE9 A;  3VRC A;  4YT2 A;  2L6H A;  2QNL A;  3LEV A;  1V74 B;  3HNK A;  2Y39 A;  1WTY A;  4DBR A;  4FX5 A;  3W2V A;  5A6B D;  1H6G A;  2IXN A;  3JSZ A;  4OIR F;  2TMV P;  2XLV A;  3LLK A;  2NUP A;  1FTS A;  4YWQ A;  1Z5Z A;  2P61 A;  1QPU A;  2R25 A;  2WZG A;  1OCC C;  4XPW A;  4PJM A;  1SZI A;  3B9Q A;  2KC3 A;  4WJ0 A;  3JSE O;  5F5H A;  4FES A;  1C03 A;  4C7O A;  2Z15 A;  3EQL F;  4P6I C;  5D91 A;  5A6B A;  4IJJ A;  2GDC A;  3B0V C;  1QLE C;  1Z6A A;  3U9M A;  4HEA J;  2A0U A;  4AL0 A;  1OCZ C;  5EK0 A;  2YKZ A;  2PX3 A;  4I44 A;  4PFO A;  4BPM A;  1NZE A;  3CAX A;  2MWQ A;  4XPY A;  4JIO A;  3R7C A;  4G7H F;  5T1D B;  1D1B A;  1NU9 C;  3K66 A;  2IM8 A;  2ZD9 A;  1TWH A;  2OEV A;  2E87 A;  3DWW A;  1RMV A;  4BJ6 C;  1Q0F A;  5HSW A;  3UMI A;  1RCP A;  3EGX A;  3E9V A;  4IGG A;  5B1B C;  3L8I A;  2UUH A;  3RYL A;  3ZQY A;  4Q7C A;  5DLJ A;  3N0T A;  5L3V A;  1T6U A;  3L34 A;  3TD7 A;  2NUT A;  2EPK X;  1NLX A;  4IRU A;  2QTV A;  2ZXO A;  2Q9A A;  3K1I A;  4MVU A;  4OIN F;  4JJF A;  5AC4 A;  1E83 A;  3ITF A;  4CIH A;  5F28 E;  4JTD B;  3GOD A;  1PD0 A;  4XLP F;  1FR0 A;  4WGY A;  2I8B A;  1NU7 D;  1M57 C;  4KBL A;  3EJN A;  2VH3 A;  5COG A;  3RVZ A;  2HV7 A;  1WAS A;  2MYS A;  2XLW A;  1CGO A;  3W4Y A;  3WHN A;  5A6J A;  4GEH A;  4MTO A;  2CCY A;  2J9U A;  4EKW A;  3E70 C;  3GM2 A;  1TFO B;  5E33 A;  3IHU A;  3S90 A;  1CGN A;  1QQ3 A;  4YK5 A;  3HNJ A;  1G5Z A;  4B6I A;  1VMA A;  2NUP B;  2CGE A;  3KMI A;  4H4K C;  3M79 A;  1OKK A;  1OR3 A;  2OOC A;  2Y3H A;  4GQH A;  4G78 A;  3AJM A;  2EPM X;  4MVM A;  3A9C A;  3L0I A;  3Q7G A;  2P7V A;  4XPX A;  2B0H A;  4XLN F;  1G4U S;  2KQ9 A;  2DYS C;  4LDR A;  1SR2 A;  3DJN B;  2A69 F;  4JZA A;  3X1O A;  4JEA A;  4MVO A;  3TOL A;  2XSE A;  2VCB A;  3EHM A;  5CIV A;  3KKB A;  2C03 A;  5FZT A;  4BEM J;  1LS4 A;  4LLE A;  4ZLD A;  4OD5 A;  4NY3 A;  4N6C A;  4JRZ A;  2L6F A;  4CS9 C;  1E86 A;  2LFF A;  3DD7 A;  4RD9 A;  1FMW A;  3HNI A;  1JR8 A;  1O5H A;  4NTF A;  4H54 A;  2KSF A;  3NMK A;  4D4N A;  4E7S A;  2LFD A;  3AGT A;  3HJC A;  3N24 A;  4K0D A;  5L0D A;  2XLM A;  1LKX A;  4HFF B;  5EGY A;  4MVR A;  5DQZ A;  5IY5 C;  3EGX B;  1AUE A;  2DGJ A;  3SP1 A;  4CS7 A;  1T5O A;  3SXK A;  3HNL A;  5CI8 A;  3QVZ A;  1Q0K A;  4BEJ A;  3DZA A;  3TK0 A;  4OIQ F;  2NUT B;  2XLD A;  3S28 A;  3TQO A;  4YT8 A;  2XRH A;  5KYN A;  3W8H A;  3T6G B;  3VYW A;  2XL6 A;  1VOM A;  1S05 A;  3JCU Q;  3GEH A;  4G0H A;  1H9G A;  3M4C A;  3JRT A;  1JOG A;  3SZR A;  3TJ5 A;  2H8A A;  4MTG A;  3ZQV A;  4NTB A;  4AL1 A;  3K1H A;  3PCV A;  5DS6 A;  4W8K A;  1QZX A;  1R5I D;  1VB5 A;  2PNO A;  3GM1 A;  4CS8 A;  3DI5 A;  2HMZ A;  4EHP A;  2DYR C;  3NMI A;  4YJW A;  3ZC4 A;  1L3P A;  2YL3 A;  1JPN A;  2XS8 A;  3T9O A;  1HW1 A;  4U5G A;  4WGZ A;  3NMJ A;  1KNY A;  3C8G A;  2R7O A;  3ASO C;  2ZXW C;  1E85 A;  4XEK A;  4YL0 A;  4G7Z F;  1BZ4 A;  3RF3 A;  3Q7L A;  3QVY A;  1QKR A;  1I4Z A;  1IZM A;  2JD3 A;  4IB4 A;  2X51 A;  2EPO A;  3LJB A;  3RQF A;  3OEO A;  3UMK A;  2EIL C;  3JZ0 A;  2V26 A;  3B0U X;  5KYX A;  3ZTM A;  3QTH A;  3ABL C;  2YRF A;  1XWJ A;  2FGY A;  3S84 A;  1J8Y F;  1IW7 F;  2AVK A;  2LIG A;  2XL4 A;  2NPU A;  1CGM E;  2XL8 A;  1T9K A;  3LLI A;  1PV3 A;  1YZC A;  2BL2 A;  2J46 A;  3G50 A;  1PD1 A;  1G8X A;  3N2Z B;  1BBH A;  4U5E E;  1HY5 A;  1U6H A;  2ZPA A;  3K33 A;  3NYL A;  4J30 B;  1Y4C A;  3S27 A;  2LP4 A;  4AK9 A;  4IWB A;  4N06 A;  1W2W A;  2YQY A;  4EWC A;  2HUJ A;  2WZF A;  1LS1 A;  2EIN C;  1EQ1 A;  2XM0 A;  2LD6 A;  4DRJ B;  3HTK C;  3PHF 2;  2VAS A;  4O7G A;  2HZ8 A;  4GYT A;  1O3U A;  4JEB A;  2EPL X;  3WG7 C;  1RJ9 B;  256B A;  1FNT c;  2CYD A;  3POV A;  1R4T A;  2G3V A;  3NYJ A;  4Z9H A;  1WOL A;  3EFO A;  5A69 A;  4OIO F;  1YAU O;  3F47 A;  3FMS A;  4P9T A;  4YL1 A;  4C3B A;  4E7Z A;  4OD4 A;  5DS4 A;  3RQE A;  2PFD A;  2KJG A;  2AWC A;  1VYI A;  3EGD A;  3T4R A;  1NG1 A;  1OXK A;  2G3K A;  2IBF A;  4N6H A;  1AVO B;  3C8G B;  3ZDL A;  4UDV A;  3IEE A;  4JCZ A;  2Q9C A;  1L7C A;  2Y3G A;  2A1D D;  5E2Q A;  3NYM A;  2L6G A;  4MVQ A;  1T01 A;  1ZU4 A;  2W4M A;  1LI5 A;  1YLM A;  2W9Y A;  3EH1 A;  4BJT A;  4Z9I A;  4BJ6 A;  4CSA C;  2XS1 A;  4KNW A;  2W4B A;  4CDA A;  1ZZP A;  2WVN A;  4J7Y A;  3WAQ A;  1ORY A;  3EZH A;  5KYX B;  4XWJ A;  3KPH A;  4DOZ A;  4E18 A;  3ECS A;  3JRM O;  2PBE A;  1Q0G A;  3IQ5 A;  1ORJ A;  5T3T A;  1JRA A;  3H2V A;  1RKC A;  2UUI A;  1T6Q A;  4M63 A;  2R02 A;  3TUL A;  2CNW D;  1D0Z A;  3U0C A;  3U3F A;  2PP4 A;  3OWT A;  1EKY A;  2LSE A;  2MHR A;  2PX0 A;  3B29 A;  4DXW A;  3ABK C;  1YA7 O;  4U9E A;  4YL3 A;  1HE9 A;  4KI2 A;  4K7B A;  3V5Y A;  2YVK A;  5BQI A;  3O6X A;  3Q6M A;  1GQA A;  1OKK D;  2NG1 A;  2ZXR A;  2CNW A;  2OG2 A;  4EUK B;  4JKV A;  2L7A A;  1GGQ A;  3DKA A;  2P6V A;  5DVW A;  3EPV A;  5L0G A;  2J0X A;  3MBG A;  3Q6N A;  4PJN A;  2YWA A;  3EFO B;  3QW1 A;  1SMY F;  1Z23 A;  1ZVZ A;  2XM4 A;  1V54 C;  3K6B A;  2XLE A;  3ATP A;  4U5C E;  2Q7R A;  3T6B A;  4Q5S F;  3ABM C;  1K04 A;  3LNR A;  4KNV A;  4LDQ A;  1LI7 A;  1H7I A;  3FDQ A;  3EGD B;  1NFO A;  3A11 A;  3KL4 A;  1E84 A;  2AP3 A;  3FAP B;  3C63 A;  3MYI A;  3O55 A;  5BQG A;  4R32 A;  1XZP A;  2QY9 A;  4C7O B;  3SXZ A;  1SYQ A;  2GAQ A;  1RKE A;  2FAP B;  2HSQ A;  2J0W A;  3V7O A;  1HMO A;  1LPE A;  2IXP A;  1Z7Q c;  4NCQ A;  2RD9 A;  2GA0 A;  2KK1 A;  2XLH A;  3S29 A;  1AEP A;  2OEX A;  2GFH A;  2ETS A;  1Z3I X;  3FVY A;  4O6N A;  4JC7 A;  4DVZ A;  3DMD A;  1E2X A;  4E0I A;  2XLO A;  2Q4F A;  1D0X A;  1LE4 A; 
#chains in the Genus database with same CATH homology
 1YVI A;  1QSP A;  2OOC A;  1BDJ B;  4PAC A;  3U3B A;  4G78 A;  1C02 A;  1A0B A;  1I5N A;  2A0B A;  1WN0 A;  1SR2 A;  2R25 A;  3IQT A;  3US6 A;  1OXK A;  1FR0 A;  2LCH A;  2LD6 A;  1C03 A;  3MYF A;  1TQG A;  3KYI A;  2LP4 A;  3KYJ A;  4EUK B;  1Y6D A;  1OXB A;  2Q4F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...