1SR2A

Solution structure of the escherichia coli yojn histidine-phosphotransferase (hpt) domain
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
116
structure length
116
Chain Sequence
MQEAVLQLIEVQLAQEEVTESPLGGDENAQLHASGYYALFVDTVPDDVKRLYTEAATSDFAALAQTAHRLKGVFAMLNLVPGKQLCETLEHLIREKDVPGIEKYISDIDSYVKSLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Putative sensor-like histidine kinase yojN
publication title Solution Structure of the Escherichia coli YojN Histidine-phosphotransferase Domain and its Interaction with Cognate Phosphoryl Receiver Domains
pubmed doi rcsb
source organism Escherichia coli
total genus 37
structure length 116
sequence length 116
ec nomenclature ec 2.7.3.-:
pdb deposition date 2004-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01627 Hpt Hpt domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.160 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) HPT domain 1sr2A00
2Q4FA 4EUKB 1I5NA 3KYJA 1BDJB 1QSPA 1WN0A 2OOCA 2LCHA 1Y6DA 3U3BA 1A0BA 4G78A 3KYIA 3MYFA 3US6A 3IQTA 2LP4A 1YVIA 1FR0A 1TQGA 2LD6A 1C02A 2R25A 1C03A 2A0BA 1OXKA 4PACA 1OXBA 1SR2A
chains in the Genus database with same CATH superfamily
4MVSA 4A4AA 3X2QC 2YLGA 4X0RA 5TJ5E 3LEVA 4G7ZF 2YL7A 3NMJA 2BC5A 1YARO 1ZU4A 4LERA 3QW1A 3WG7C 4ANJA 1VMAA 3SXZA 2XL4A 2C04A 1RCPA 4EBBA 3TQOA 1LI7A 3EG9B 4U5EE 5L0JA 2OOCA 1TWGA 2LSEA 2NUTB 3A9CA 1Y6DA 3W2VA 2H7BA 2XXAB 2G3KA 4IAQA 2JD3A 3HNJA 4U5HA 4BJ6A 4DJ9A 4MVOA 1OKKD 3C8GB 3IPMO 2QTVA 2KYHA 2R7TA 4OD4A 3UMIA 3DZAA 2YL3A 3G50A 1RJ9A 2RD9A 3OA1A 4NTAA 1C02A 1O87A 2A68F 2BL2A 1M2VA 2EIKC 1VYKA 4PFPA 4EHPA 4N6CA 5F28E 4CBEA 2PF4E 3U5SA 2J8WA 2LFDA 3DD7A 4G0HA 4JVSA 5B3SC 4XPYA 2XSEA 1HMDA 3N0TA 2EINC 5DQZA 4CSAC 4ZLCA 5E3CA 4JCZA 5KYWA 4IAOA 2L6HA 1Z3IX 3PMRA 3U9JA 4KBLA 2GWWA 1RXQA 1VOMA 3LAYA 1V54C 1APCA 3EGDB 1FFHA 3X1OA 3IHUA 1WATA 5DS5A 2KNHA 5IY5C 2A6EF 4IARA 3S90A 3MX3A 3KYIA 3NRHA 5JSLA 2V3CC 1A7EA 1T9KA 2J0WA 5A6KA 1TWAA 1NFNA 4P6IC 4JZAA 1H6GA 3I4UA 2QUPA 3F46A 5HV9A 4MQ9F 5JS5A 3ZTMA 1OXBA 2KW3C 3FVYA 1YAUO 2L81A 4G7OF 5L3VA 1U89A 3L1MA 3U0CA 3MLGA 1GM5A 1YZAA 4MW8A 1BR1A 2XL8A 3FMSA 1E83A 4JEAA 3AQCA 3HNKA 4CDYA 2XRHA 4IRUA 4GQHA 1M2VB 2F22A 3DE9A 5A6BD 1UFBA 4MTOA 3UMHA 3K1IA 1BBHA 1WASA 1ZHYA 4FWVA 1OW8A 1T01A 2J7PA 1V74B 2XM4A 2CDQA 3EFOB 5KYNA 5T1DB 4EKWA 1HW2A 4BG0A 4AL0A 5KYWB 3ZG1A 1W2WA 3RFYA 2R25A 4CS9A 5EGYA 4XLPF 4Z9IA 4PJJA 3K1IC 3HNIA 1PCXA 1ZHZA 2LIGA 2Q4FA 3DWWA 3F47A 2XLHA 4ONSA 3AGTA 2NUPA 2G3VA 3NDBB 5EHHA 1CPRA 2A6HF 2CNWD 4C3EA 1ZW2A 1DOWA 1OCZC 2HKVA 4CS9C 5BQIA 2IXPA 5AC4A 4LLEA 4MVQA 1ZW3A 2IM8A 2ICWG 4DVZA 3TOMA 2JX0A 5JT4A 5F5FA 3GODA 2EIJC 2B0HA 1A7DA 3POVA 1M2OA 3H2UA 1H9TA 2VASA 1V55C 2GA0A 3ZDLA 4CJOA 2ASRA 3ITFA 4O6YA 4OINF 2R7UA 3FAPB 2WB7A 4DOZA 1F1MA 1HE9A 1WTYA 4MNDA 1Z23A 4UDVA 4NCQA 1RMVA 2GDCA 1SMYF 1ORSC 3S9OA 1T6UA 4U5BE 3O55A 3U2LA 4L6RA 2XL6A 3LS0A 5FZTA 2HJ3A 3GM1A 4I1OB 1D0XA 3AG3C 3RKOF 3SYNA 5F5HA 1I4YA 2PNOA 4ULVA 3M15A 2VH3A 3TJ6A 3RH3A 1NSGB 4EIYA 3QVZA 4NQFA 1OCCC 2G62A 2OJED 3S0XA 4E7SA 4U9DA 1ZHWA 3BEHA 3G4ZA 2XLEA 3ATPA 3SZRA 2MHRA 2XXAA 2MYSA 2I15A 3JSEO 1T5OA 3NMIA 3W8HA 1MMGA 1QQ3A 2LCHA 3JRMO 3L0IA 5DS4A 2HSBA 4I1MA 2H7OA 1C17M 4EBJA 3JYHA 3US6A 1B68A 3VM6A 4P9FA 2PX3A 3AGUA 5K0IA 3SEOA 2HJMA 4AX2A 1TQGA 4RD9A 4BPMA 3DI5A 1K40A 1D1AA 2DYSC 2YLIA 4JKVA 1EKYA 4HEAJ 5L3QA 1E84A 4WGYA 3RQEA 1HE1A 1YDIA 3DKAA 3JRTA 1YJGA 2R03A 1OQCA 3W2WA 4K7BA 1S7ZA 1JOGA 1VLSA 5A6JA 4W8PA 1LM3B 4KNWA 3U9MA 1R4TA 1QPUA 1N1CA 4QDLA 1KNYA 4GYTA 3KYJA 2KC3A 3QZCA 3VYWA 3EHNA 4DXWA 4E18A 1VB5A 4YT5A 5CI8A 4JURI 4W8KA 5CI9A 1LVKA 4OIQF 4C7OA 2IXOA 4QI0A 3M79A 2OG2A 2IYLD 2VCAA 3WAQA 2XS8A 3ZTZA 3QW0A 4DRHB 4E0IA 1L3PA 2CGEA 3O6XA 4U5GA 2HZ8A 3K7DA 4Q5SF 1FFTC 1WOLA 2J0XA 3CZ6A 3RQFA 1U0BB 2UUIA 3VAYA 1TFOB 3G4XA 2XLDA 3ZVRA 5KYYB 1AUEA 2CCYA 2D5RB 1FTSA 1NBBA 4BJ6C 4PJLA 2R02A 5DQTA 2AVKA 2R7VA 3ZWIA 3DM5A 2TMVP 2WZFA 2ZD9A 4BEMJ 1A41A 2FAPB 5BQHA 3DE8A 1TKNA 4JJGA 3VRCA 4F4BA 3DAGA 3IQ6A 2EPOA 3QMKA 4CIPA 4CJGA 4JJFA 3ASNC 3GM3A 3DAFA 2R9RB 3O10A 2D4UA 2OJQA 3FAJA 2Y39A 2Z15A 1ST6A 4G78A 4E0HA 3KH2A 1S05A 2Q9CA 3EH2A 3LESA 3AG4C 3MYFA 1YVIA 2DI3A 1AEPA 2HV7A 3EGXA 1GS9A 2W9YA 4O6NA 2LD6A 3ABKC 3R2PA 2GFHA 4DBRA 2A0BA 2J9VA 3L8JA 1G4US 4I44A 5JP7A 4LDRA 4EUKB 4C3BA 4BJTA 1NU7D 3UGPA 3T6BA 3V5YA 2J9BA 4PR9A 3L8IA 2DB4A 4H4KC 5E3AA 4CDVA 3ECSA 2ZXRA 4AL1A 3B0PA 3E70C 2C03A 2XLOA 3RW0A 1K05A 4OIRF 4J7TA 1FNTc 1RJ9B 1BR4A 3LLKA 3S29A 3K33A 3Q6MA 2Q7RA 1YYXA 2Q9AA 3RVYA 3SXKA 2LQGA 3JCUQ 4YT4A 2EPLX 2Y3BA 4KNVA 1LS1A 5DLJA 4JW1A 4ER9A 3FHDA 1PD0A 3IQTA 3GEHA 3RVZA 1SF8A 2H7VC 3L34A 5JLIA 2X0CA 4MS2A 2J7PD 4KC9A 4Z9JA 2PFDA 2NG1A 2W4MA 4NTFA 1JR8A 1UG7A 1JPJA 4R32A 5L0FA 4LDQA 2L7AA 1JMWA 5BQGA 4HFFB 2VB6A 2NSGA 4MW3A 4OIPF 4Z9HA 3H2VA 3AOUA 4N06A 5L0IA 2WVNA 3C62A 5B1BC 4ZLDA 1BR2A 5L0GA 3EZHA 1H7IA 2ZXOA 4XTKA 3WODF 2P61A 3GWLA 4YL3A 3WHNA 2IBFA 4B6IA 3S84A 2AU5A 1M56C 3KMIA 3H65A 3NG1A 3B0UX 3CSKA 1MQVA 4FESA 4BJ1A 1YYJA 4IB4A 2EPMX 1FMWA 2KGOA 2GAQA 3SXYA 2LP4A 2YKZA 2AP3A 3C18A 3TK0A 1LIHA 5CIVA 1FR0A 1YA7O 1VTMP 5DVWA 2R7OA 3RF3A 4XEKA 1MNDA 1T6QA 1LS4A 1OXKA 1SYQA 256BA 2P1AA 4XWJA 2IOQA 2CNWA 5COMA 1MMNA 5D91A 1QKRA 2KK1A 5A69A 2L6FA 4AE4A 4XEFA 3UMKA 2ZXPA 1U6HA 2NPUA 4XPXA 4HFKB 3FOOA 1IW7F 2A1DD 1I4ZA 3LS1A 1RKCA 4N6HA 4YT8A 4MVZA 2YRFA 4XEVA 1NG1A 4WABA 2OCCC 1FMVA 4CX9A 4C3DA 1QSPA 1Z7Qc 3C8GD 2R7RA 1D1CA 2ZPAA 2X51A 1EQ1A 4M63A 3RIPA 2V26A 5KYUA 3RQGA 1A0BA 4NY3A 1Q0MA 1Q0DA 3Q6NA 3V5ZA 5A6AA 4YK5A 1Z63A 1J8MF 4I3MA 2NUPB 4KI2A 1Z5ZA 3DJUB 2AWYA 2YVKA 3EHMA 3EJNA 1XWJA 2YEVA 4JTDB 3JT1A 2HSQA 4MVRA 2YLDA 1NZEA 3EG9A 5COGA 4CS8A 1IZMA 1T6IA 3U8VA 2EIMC 3LNMB 2H8AA 3N24A 2YL0A 1QVXA 2KQ9A 4JC7A 1ZHTA 3ASOC 2L6GA 2IXMA 4G7HF 4NC3A 4IWBA 4CS8C 1I5NA 2E87A 3HTKC 1JRAA 1O3UA 3OEOA 1HMOA 3AJMA 2AWCA 1D0YA 3KPHA 3O39A 3IEEA 2RSEB 4MVMA 5JUAA 3UGOA 5T3WA 1QLEC 2L9JA 2J45A 3QTHA 3ZSUA 5T3TA 3NYMA 3PHF2 4E7ZA 1ZYRF 3B9QA 1G8XA 3QVYA 1PV3A 4JCHA 3CQZA 5JVEA 3R7CA 1O5HA 5GPGB 4D4NA 1CGME 1A7VA 1YZCA 1C03A 2YHSA 2DGJA 4PFOA 3FXHA 4OD5A 2XLVA 4JTAB 1ZHXA 5COFA 3UNGC 3NKEA 1OW7A 4HE8D 1HY5A 1QZXA 3VF0A 5KYUB 2QLAA 3B29A 3PDMP 5JRAA 3HJCA 3GANA 2Q00A 5B3IA 1V4AA 4MTGA 1OKKA 2WZLA 2P0NA 2W4BA 3GM2A 3K6BA 3NKDA 3UR3C 1Y4CA 3C63A 3EZIA 2VC9A 3M1CB 3NMKA 1YA9A 1ZU5A 2KJGA 2LK4A 2Y3HA 3FOPA 4LACB 5L0HA 1SZIA 2QE9A 4CSAA 3JYYA 2R7XA 5B1AC 3N2ZB 1LE4A 2YZSA 3V5XA 1R5ID 3ABLC 1NU9C 1LE2A 2Q9BA 2Y69C 5D92A 2JPUA 4YN0B 2M64A 4PJNA 3JSZA 4C7OB 1BZ4A 3DXJF 2R7WA 3EFOA 1LI5A 1XZQA 4JRZA 1GGQA 2Y3GA 1Q0GA 2HUJA 4CDAA 3ABMC 1LKXA 3SP1A 4O79A 3T6JA 3K1HA 3AG2C 4QI2A 3ZQVA 1MMDA 4MVUA 4K1OA 3TOLA 1BDJB 3T4RA 4A2NB 1K04A 2NSFA 3CEXA 1Q0FA 4EBKA 4J7YA 3FDQA 1H9GA 2M4EA 1WGWA 4EWCA 2R7QA 1LPEA 1M6TA 1OR3A 4JEBA 4JIOA 1FAPB 3HKKA 3M4BA 3MYIA 4FX5A 1KTMA 3TULA 3U3FA 4PJMA 2KSFA 2HV6A 2IXNA 3KL4A 1TFKB 1CPQA 1J8YF 1XZPA 1VK5A 3HNLA 4U5DE 1MMAA 4YL1A 2Y3DA 1OCRC 2XM0A 3GWNA 1CGOA 4DBQA 4XLNF 3W8IA 2OEXA 5KYXA 4PACA 4OIOF 3M4CA 2ZXWC 4AK9A 3LJBA 2CW0F 3ZIBA 3NYJA 4DRJB 1PD1A 1E86A 2XLMA 5A6BA 4RBNA 4K0DA 3SXMA 1E85A 3B71A 4WGZA 2EILC 1OCOC 1VLTA 2YQYA 3EGXB 1AVOB 3GEEA 4J32B 1EA8A 1OR2A 1WN0A 3S27A 5BUOA 3EPVA 4DRIB 1TWCA 5FCLA 1EI7A 1RKEA 3KKBA 2B0JA 5L0CA 4GEHA 1GQAA 3U3BA 5L0DA 3TJ5A 5EK0A 5AC5A 3PCVA 2DYRC 4NTBA 1Q0KA 4Q7CA 2HS5A 3BRJA 3T6GB 2OU6A 2WVQA 3LLIA 3MFNA 2W45A 3LEOA 3TD7A 3IQCA 2UUHA 4Q4ZF 1TR2A 3C7JA 3IQ5A 1NLXA 3AG1C 2R7SA 2CYDA 3LUTB 4PK4A 2J9WA 1YLMA 3T9OA 2P6VA 1Z6AA 2P7VA 2PBEA 4CIHA 1OW6A 3K66A 4MTFA 3W4YA 4RDAA 2O9XA 2A69F 3Q7LA 4LLCA 4XPWA 3I5PA 3OWTA 3GEIA 4WJ0A 3B0VC 1ZZPA 2I8BA 2Q3TA 2R05A 4D4XA 2OQMA 5KYXB 1DOVA 5AGFA 1ORJA 3S28A 1JAFA 2XLWA 3C8ZA 3RYLA 4BJ5A 4CS7A 1D1BA 2FFHA 1TWHA 4ULWA 4JE9A 4U5CE 5E33A 4BEJA 3EQLF 2WVOA 3LNRA 3DMDA 2EPKX 3U8PA 4E17A 4YWQA 4J30B 3Q7GA 3V7OA 1ZVZA 5HSWA 2FGYA 4O6MA 3SNHA 2NUTA 2BE5F 2VCCA 1RKEB 2HMQA 3JTLO 1SR2A 4BJ5C 2WZGA 3MBGA 4P9TA 4XQ1A 3A11A 5DS6A 4JTCB 1G5ZA 3C8GA 1L7CA 4O7GA 2QNLA 2EPNA 3JZ0A 4LDKA 4DVYP 1JPNA 2HFIA 4YL0A 1CGNA 1HW1A 4N4WA 2WL8A 1G4WR 2A0UA 1WWPA 3NYLA 4YJWA 3J06A 1NFOA 3AQBA 1KU2A 3EH1A 4YT2A 2VCBA 2J46A 1VYIA 5KYYA 2YWAA 3ZQYA 4FAPB 1E2XA 2LFFA 3ZC4A 4AE4B 2J9UA 4U5FE 1M57C 5E2QA 1D0ZA 2XS1A 2HMZA 3DM9B 2MWQA 1MNEA 2YL1A 2OEVA 2PX0A 3I5QA 1ORYA 3E9VA 4IJJA 2OKUA 2PP4A 4U9EA 3HLZA 3DJNB 3CAXA 3EGDA 2QY9A 3U2MA 3GORA 2ETSA 4H54A 4IGGA
chains in the Genus database with same CATH topology
2Q4FA 4EUKB 1I5NA 3KYJA 1BDJB 1QSPA 1WN0A 2OOCA 2LCHA 1Y6DA 3U3BA 1A0BA 4G78A 3KYIA 3MYFA 3US6A 3IQTA 2LP4A 1YVIA 1FR0A 1TQGA 2LD6A 1C02A 2R25A 1C03A 2A0BA 1OXKA 4PACA 1OXBA 1SR2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q4F A;  4EUK B;  1I5N A;  3KYJ A;  1BDJ B;  1QSP A;  1WN0 A;  2OOC A;  2LCH A;  1Y6D A;  3U3B A;  1A0B A;  4G78 A;  3KYI A;  3MYF A;  3US6 A;  3IQT A;  2LP4 A;  1YVI A;  1FR0 A;  1TQG A;  2LD6 A;  1C02 A;  2R25 A;  1C03 A;  2A0B A;  1OXK A;  4PAC A;  1OXB A;  1SR2 A; 
#chains in the Genus database with same CATH topology
 4MVS A;  4A4A A;  3X2Q C;  2YLG A;  4X0R A;  5TJ5 E;  3LEV A;  4G7Z F;  2YL7 A;  3NMJ A;  2BC5 A;  1YAR O;  1ZU4 A;  4LER A;  3QW1 A;  3WG7 C;  4ANJ A;  1VMA A;  3SXZ A;  2XL4 A;  2C04 A;  1RCP A;  4EBB A;  3TQO A;  1LI7 A;  3EG9 B;  4U5E E;  5L0J A;  2OOC A;  1TWG A;  2LSE A;  2NUT B;  3A9C A;  1Y6D A;  3W2V A;  2H7B A;  2XXA B;  2G3K A;  4IAQ A;  2JD3 A;  3HNJ A;  4U5H A;  4BJ6 A;  4DJ9 A;  4MVO A;  1OKK D;  3C8G B;  3IPM O;  2QTV A;  2KYH A;  2R7T A;  4OD4 A;  3UMI A;  3DZA A;  2YL3 A;  3G50 A;  1RJ9 A;  2RD9 A;  3OA1 A;  4NTA A;  1C02 A;  1O87 A;  2A68 F;  2BL2 A;  1M2V A;  2EIK C;  1VYK A;  4PFP A;  4EHP A;  4N6C A;  5F28 E;  4CBE A;  2PF4 E;  3U5S A;  2J8W A;  2LFD A;  3DD7 A;  4G0H A;  4JVS A;  5B3S C;  4XPY A;  2XSE A;  1HMD A;  3N0T A;  2EIN C;  5DQZ A;  4CSA C;  4ZLC A;  5E3C A;  4JCZ A;  5KYW A;  4IAO A;  2L6H A;  1Z3I X;  3PMR A;  3U9J A;  4KBL A;  2GWW A;  1RXQ A;  1VOM A;  3LAY A;  1V54 C;  1APC A;  3EGD B;  1FFH A;  3X1O A;  3IHU A;  1WAT A;  5DS5 A;  2KNH A;  5IY5 C;  2A6E F;  4IAR A;  3S90 A;  3MX3 A;  3KYI A;  3NRH A;  5JSL A;  2V3C C;  1A7E A;  1T9K A;  2J0W A;  5A6K A;  1TWA A;  1NFN A;  4P6I C;  4JZA A;  1H6G A;  3I4U A;  2QUP A;  3F46 A;  5HV9 A;  4MQ9 F;  5JS5 A;  3ZTM A;  1OXB A;  2KW3 C;  3FVY A;  1YAU O;  2L81 A;  4G7O F;  5L3V A;  1U89 A;  3L1M A;  3U0C A;  3MLG A;  1GM5 A;  1YZA A;  4MW8 A;  1BR1 A;  2XL8 A;  3FMS A;  1E83 A;  4JEA A;  3AQC A;  3HNK A;  4CDY A;  2XRH A;  4IRU A;  4GQH A;  1M2V B;  2F22 A;  3DE9 A;  5A6B D;  1UFB A;  4MTO A;  3UMH A;  3K1I A;  1BBH A;  1WAS A;  1ZHY A;  4FWV A;  1OW8 A;  1T01 A;  2J7P A;  1V74 B;  2XM4 A;  2CDQ A;  3EFO B;  5KYN A;  5T1D B;  4EKW A;  1HW2 A;  4BG0 A;  4AL0 A;  5KYW B;  3ZG1 A;  1W2W A;  3RFY A;  2R25 A;  4CS9 A;  5EGY A;  4XLP F;  4Z9I A;  4PJJ A;  3K1I C;  3HNI A;  1PCX A;  1ZHZ A;  2LIG A;  2Q4F A;  3DWW A;  3F47 A;  2XLH A;  4ONS A;  3AGT A;  2NUP A;  2G3V A;  3NDB B;  5EHH A;  1CPR A;  2A6H F;  2CNW D;  4C3E A;  1ZW2 A;  1DOW A;  1OCZ C;  2HKV A;  4CS9 C;  5BQI A;  2IXP A;  5AC4 A;  4LLE A;  4MVQ A;  1ZW3 A;  2IM8 A;  2ICW G;  4DVZ A;  3TOM A;  2JX0 A;  5JT4 A;  5F5F A;  3GOD A;  2EIJ C;  2B0H A;  1A7D A;  3POV A;  1M2O A;  3H2U A;  1H9T A;  2VAS A;  1V55 C;  2GA0 A;  3ZDL A;  4CJO A;  2ASR A;  3ITF A;  4O6Y A;  4OIN F;  2R7U A;  3FAP B;  2WB7 A;  4DOZ A;  1F1M A;  1HE9 A;  1WTY A;  4MND A;  1Z23 A;  4UDV A;  4NCQ A;  1RMV A;  2GDC A;  1SMY F;  1ORS C;  3S9O A;  1T6U A;  4U5B E;  3O55 A;  3U2L A;  4L6R A;  2XL6 A;  3LS0 A;  5FZT A;  2HJ3 A;  3GM1 A;  4I1O B;  1D0X A;  3AG3 C;  3RKO F;  3SYN A;  5F5H A;  1I4Y A;  2PNO A;  4ULV A;  3M15 A;  2VH3 A;  3TJ6 A;  3RH3 A;  1NSG B;  4EIY A;  3QVZ A;  4NQF A;  1OCC C;  2G62 A;  2OJE D;  3S0X A;  4E7S A;  4U9D A;  1ZHW A;  3BEH A;  3G4Z A;  2XLE A;  3ATP A;  3SZR A;  2MHR A;  2XXA A;  2MYS A;  2I15 A;  3JSE O;  1T5O A;  3NMI A;  3W8H A;  1MMG A;  1QQ3 A;  2LCH A;  3JRM O;  3L0I A;  5DS4 A;  2HSB A;  4I1M A;  2H7O A;  1C17 M;  4EBJ A;  3JYH A;  3US6 A;  1B68 A;  3VM6 A;  4P9F A;  2PX3 A;  3AGU A;  5K0I A;  3SEO A;  2HJM A;  4AX2 A;  1TQG A;  4RD9 A;  4BPM A;  3DI5 A;  1K40 A;  1D1A A;  2DYS C;  2YLI A;  4JKV A;  1EKY A;  4HEA J;  5L3Q A;  1E84 A;  4WGY A;  3RQE A;  1HE1 A;  1YDI A;  3DKA A;  3JRT A;  1YJG A;  2R03 A;  1OQC A;  3W2W A;  4K7B A;  1S7Z A;  1JOG A;  1VLS A;  5A6J A;  4W8P A;  1LM3 B;  4KNW A;  3U9M A;  1R4T A;  1QPU A;  1N1C A;  4QDL A;  1KNY A;  4GYT A;  3KYJ A;  2KC3 A;  3QZC A;  3VYW A;  3EHN A;  4DXW A;  4E18 A;  1VB5 A;  4YT5 A;  5CI8 A;  4JUR I;  4W8K A;  5CI9 A;  1LVK A;  4OIQ F;  4C7O A;  2IXO A;  4QI0 A;  3M79 A;  2OG2 A;  2IYL D;  2VCA A;  3WAQ A;  2XS8 A;  3ZTZ A;  3QW0 A;  4DRH B;  4E0I A;  1L3P A;  2CGE A;  3O6X A;  4U5G A;  2HZ8 A;  3K7D A;  4Q5S F;  1FFT C;  1WOL A;  2J0X A;  3CZ6 A;  3RQF A;  1U0B B;  2UUI A;  3VAY A;  1TFO B;  3G4X A;  2XLD A;  3ZVR A;  5KYY B;  1AUE A;  2CCY A;  2D5R B;  1FTS A;  1NBB A;  4BJ6 C;  4PJL A;  2R02 A;  5DQT A;  2AVK A;  2R7V A;  3ZWI A;  3DM5 A;  2TMV P;  2WZF A;  2ZD9 A;  4BEM J;  1A41 A;  2FAP B;  5BQH A;  3DE8 A;  1TKN A;  4JJG A;  3VRC A;  4F4B A;  3DAG A;  3IQ6 A;  2EPO A;  3QMK A;  4CIP A;  4CJG A;  4JJF A;  3ASN C;  3GM3 A;  3DAF A;  2R9R B;  3O10 A;  2D4U A;  2OJQ A;  3FAJ A;  2Y39 A;  2Z15 A;  1ST6 A;  4G78 A;  4E0H A;  3KH2 A;  1S05 A;  2Q9C A;  3EH2 A;  3LES A;  3AG4 C;  3MYF A;  1YVI A;  2DI3 A;  1AEP A;  2HV7 A;  3EGX A;  1GS9 A;  2W9Y A;  4O6N A;  2LD6 A;  3ABK C;  3R2P A;  2GFH A;  4DBR A;  2A0B A;  2J9V A;  3L8J A;  1G4U S;  4I44 A;  5JP7 A;  4LDR A;  4EUK B;  4C3B A;  4BJT A;  1NU7 D;  3UGP A;  3T6B A;  3V5Y A;  2J9B A;  4PR9 A;  3L8I A;  2DB4 A;  4H4K C;  5E3A A;  4CDV A;  3ECS A;  2ZXR A;  4AL1 A;  3B0P A;  3E70 C;  2C03 A;  2XLO A;  3RW0 A;  1K05 A;  4OIR F;  4J7T A;  1FNT c;  1RJ9 B;  1BR4 A;  3LLK A;  3S29 A;  3K33 A;  3Q6M A;  2Q7R A;  1YYX A;  2Q9A A;  3RVY A;  3SXK A;  2LQG A;  3JCU Q;  4YT4 A;  2EPL X;  2Y3B A;  4KNV A;  1LS1 A;  5DLJ A;  4JW1 A;  4ER9 A;  3FHD A;  1PD0 A;  3IQT A;  3GEH A;  3RVZ A;  1SF8 A;  2H7V C;  3L34 A;  5JLI A;  2X0C A;  4MS2 A;  2J7P D;  4KC9 A;  4Z9J A;  2PFD A;  2NG1 A;  2W4M A;  4NTF A;  1JR8 A;  1UG7 A;  1JPJ A;  4R32 A;  5L0F A;  4LDQ A;  2L7A A;  1JMW A;  5BQG A;  4HFF B;  2VB6 A;  2NSG A;  4MW3 A;  4OIP F;  4Z9H A;  3H2V A;  3AOU A;  4N06 A;  5L0I A;  2WVN A;  3C62 A;  5B1B C;  4ZLD A;  1BR2 A;  5L0G A;  3EZH A;  1H7I A;  2ZXO A;  4XTK A;  3WOD F;  2P61 A;  3GWL A;  4YL3 A;  3WHN A;  2IBF A;  4B6I A;  3S84 A;  2AU5 A;  1M56 C;  3KMI A;  3H65 A;  3NG1 A;  3B0U X;  3CSK A;  1MQV A;  4FES A;  4BJ1 A;  1YYJ A;  4IB4 A;  2EPM X;  1FMW A;  2KGO A;  2GAQ A;  3SXY A;  2LP4 A;  2YKZ A;  2AP3 A;  3C18 A;  3TK0 A;  1LIH A;  5CIV A;  1FR0 A;  1YA7 O;  1VTM P;  5DVW A;  2R7O A;  3RF3 A;  4XEK A;  1MND A;  1T6Q A;  1LS4 A;  1OXK A;  1SYQ A;  256B A;  2P1A A;  4XWJ A;  2IOQ A;  2CNW A;  5COM A;  1MMN A;  5D91 A;  1QKR A;  2KK1 A;  5A69 A;  2L6F A;  4AE4 A;  4XEF A;  3UMK A;  2ZXP A;  1U6H A;  2NPU A;  4XPX A;  4HFK B;  3FOO A;  1IW7 F;  2A1D D;  1I4Z A;  3LS1 A;  1RKC A;  4N6H A;  4YT8 A;  4MVZ A;  2YRF A;  4XEV A;  1NG1 A;  4WAB A;  2OCC C;  1FMV A;  4CX9 A;  4C3D A;  1QSP A;  1Z7Q c;  3C8G D;  2R7R A;  1D1C A;  2ZPA A;  2X51 A;  1EQ1 A;  4M63 A;  3RIP A;  2V26 A;  5KYU A;  3RQG A;  1A0B A;  4NY3 A;  1Q0M A;  1Q0D A;  3Q6N A;  3V5Z A;  5A6A A;  4YK5 A;  1Z63 A;  1J8M F;  4I3M A;  2NUP B;  4KI2 A;  1Z5Z A;  3DJU B;  2AWY A;  2YVK A;  3EHM A;  3EJN A;  1XWJ A;  2YEV A;  4JTD B;  3JT1 A;  2HSQ A;  4MVR A;  2YLD A;  1NZE A;  3EG9 A;  5COG A;  4CS8 A;  1IZM A;  1T6I A;  3U8V A;  2EIM C;  3LNM B;  2H8A A;  3N24 A;  2YL0 A;  1QVX A;  2KQ9 A;  4JC7 A;  1ZHT A;  3ASO C;  2L6G A;  2IXM A;  4G7H F;  4NC3 A;  4IWB A;  4CS8 C;  1I5N A;  2E87 A;  3HTK C;  1JRA A;  1O3U A;  3OEO A;  1HMO A;  3AJM A;  2AWC A;  1D0Y A;  3KPH A;  3O39 A;  3IEE A;  2RSE B;  4MVM A;  5JUA A;  3UGO A;  5T3W A;  1QLE C;  2L9J A;  2J45 A;  3QTH A;  3ZSU A;  5T3T A;  3NYM A;  3PHF 2;  4E7Z A;  1ZYR F;  3B9Q A;  1G8X A;  3QVY A;  1PV3 A;  4JCH A;  3CQZ A;  5JVE A;  3R7C A;  1O5H A;  5GPG B;  4D4N A;  1CGM E;  1A7V A;  1YZC A;  1C03 A;  2YHS A;  2DGJ A;  4PFO A;  3FXH A;  4OD5 A;  2XLV A;  4JTA B;  1ZHX A;  5COF A;  3UNG C;  3NKE A;  1OW7 A;  4HE8 D;  1HY5 A;  1QZX A;  3VF0 A;  5KYU B;  2QLA A;  3B29 A;  3PDM P;  5JRA A;  3HJC A;  3GAN A;  2Q00 A;  5B3I A;  1V4A A;  4MTG A;  1OKK A;  2WZL A;  2P0N A;  2W4B A;  3GM2 A;  3K6B A;  3NKD A;  3UR3 C;  1Y4C A;  3C63 A;  3EZI A;  2VC9 A;  3M1C B;  3NMK A;  1YA9 A;  1ZU5 A;  2KJG A;  2LK4 A;  2Y3H A;  3FOP A;  4LAC B;  5L0H A;  1SZI A;  2QE9 A;  4CSA A;  3JYY A;  2R7X A;  5B1A C;  3N2Z B;  1LE4 A;  2YZS A;  3V5X A;  1R5I D;  3ABL C;  1NU9 C;  1LE2 A;  2Q9B A;  2Y69 C;  5D92 A;  2JPU A;  4YN0 B;  2M64 A;  4PJN A;  3JSZ A;  4C7O B;  1BZ4 A;  3DXJ F;  2R7W A;  3EFO A;  1LI5 A;  1XZQ A;  4JRZ A;  1GGQ A;  2Y3G A;  1Q0G A;  2HUJ A;  4CDA A;  3ABM C;  1LKX A;  3SP1 A;  4O79 A;  3T6J A;  3K1H A;  3AG2 C;  4QI2 A;  3ZQV A;  1MMD A;  4MVU A;  4K1O A;  3TOL A;  1BDJ B;  3T4R A;  4A2N B;  1K04 A;  2NSF A;  3CEX A;  1Q0F A;  4EBK A;  4J7Y A;  3FDQ A;  1H9G A;  2M4E A;  1WGW A;  4EWC A;  2R7Q A;  1LPE A;  1M6T A;  1OR3 A;  4JEB A;  4JIO A;  1FAP B;  3HKK A;  3M4B A;  3MYI A;  4FX5 A;  1KTM A;  3TUL A;  3U3F A;  4PJM A;  2KSF A;  2HV6 A;  2IXN A;  3KL4 A;  1TFK B;  1CPQ A;  1J8Y F;  1XZP A;  1VK5 A;  3HNL A;  4U5D E;  1MMA A;  4YL1 A;  2Y3D A;  1OCR C;  2XM0 A;  3GWN A;  1CGO A;  4DBQ A;  4XLN F;  3W8I A;  2OEX A;  5KYX A;  4PAC A;  4OIO F;  3M4C A;  2ZXW C;  4AK9 A;  3LJB A;  2CW0 F;  3ZIB A;  3NYJ A;  4DRJ B;  1PD1 A;  1E86 A;  2XLM A;  5A6B A;  4RBN A;  4K0D A;  3SXM A;  1E85 A;  3B71 A;  4WGZ A;  2EIL C;  1OCO C;  1VLT A;  2YQY A;  3EGX B;  1AVO B;  3GEE A;  4J32 B;  1EA8 A;  1OR2 A;  1WN0 A;  3S27 A;  5BUO A;  3EPV A;  4DRI B;  1TWC A;  5FCL A;  1EI7 A;  1RKE A;  3KKB A;  2B0J A;  5L0C A;  4GEH A;  1GQA A;  3U3B A;  5L0D A;  3TJ5 A;  5EK0 A;  5AC5 A;  3PCV A;  2DYR C;  4NTB A;  1Q0K A;  4Q7C A;  2HS5 A;  3BRJ A;  3T6G B;  2OU6 A;  2WVQ A;  3LLI A;  3MFN A;  2W45 A;  3LEO A;  3TD7 A;  3IQC A;  2UUH A;  4Q4Z F;  1TR2 A;  3C7J A;  3IQ5 A;  1NLX A;  3AG1 C;  2R7S A;  2CYD A;  3LUT B;  4PK4 A;  2J9W A;  1YLM A;  3T9O A;  2P6V A;  1Z6A A;  2P7V A;  2PBE A;  4CIH A;  1OW6 A;  3K66 A;  4MTF A;  3W4Y A;  4RDA A;  2O9X A;  2A69 F;  3Q7L A;  4LLC A;  4XPW A;  3I5P A;  3OWT A;  3GEI A;  4WJ0 A;  3B0V C;  1ZZP A;  2I8B A;  2Q3T A;  2R05 A;  4D4X A;  2OQM A;  5KYX B;  1DOV A;  5AGF A;  1ORJ A;  3S28 A;  1JAF A;  2XLW A;  3C8Z A;  3RYL A;  4BJ5 A;  4CS7 A;  1D1B A;  2FFH A;  1TWH A;  4ULW A;  4JE9 A;  4U5C E;  5E33 A;  4BEJ A;  3EQL F;  2WVO A;  3LNR A;  3DMD A;  2EPK X;  3U8P A;  4E17 A;  4YWQ A;  4J30 B;  3Q7G A;  3V7O A;  1ZVZ A;  5HSW A;  2FGY A;  4O6M A;  3SNH A;  2NUT A;  2BE5 F;  2VCC A;  1RKE B;  2HMQ A;  3JTL O;  1SR2 A;  4BJ5 C;  2WZG A;  3MBG A;  4P9T A;  4XQ1 A;  3A11 A;  5DS6 A;  4JTC B;  1G5Z A;  3C8G A;  1L7C A;  4O7G A;  2QNL A;  2EPN A;  3JZ0 A;  4LDK A;  4DVY P;  1JPN A;  2HFI A;  4YL0 A;  1CGN A;  1HW1 A;  4N4W A;  2WL8 A;  1G4W R;  2A0U A;  1WWP A;  3NYL A;  4YJW A;  3J06 A;  1NFO A;  3AQB A;  1KU2 A;  3EH1 A;  4YT2 A;  2VCB A;  2J46 A;  1VYI A;  5KYY A;  2YWA A;  3ZQY A;  4FAP B;  1E2X A;  2LFF A;  3ZC4 A;  4AE4 B;  2J9U A;  4U5F E;  1M57 C;  5E2Q A;  1D0Z A;  2XS1 A;  2HMZ A;  3DM9 B;  2MWQ A;  1MNE A;  2YL1 A;  2OEV A;  2PX0 A;  3I5Q A;  1ORY A;  3E9V A;  4IJJ A;  2OKU A;  2PP4 A;  4U9E A;  3HLZ A;  3DJN B;  3CAX A;  3EGD A;  2QY9 A;  3U2M A;  3GOR A;  2ETS A;  4H54 A;  4IGG A; 
#chains in the Genus database with same CATH homology
 2Q4F A;  4EUK B;  1I5N A;  3KYJ A;  1BDJ B;  1QSP A;  1WN0 A;  2OOC A;  2LCH A;  1Y6D A;  3U3B A;  1A0B A;  4G78 A;  3KYI A;  3MYF A;  3US6 A;  3IQT A;  2LP4 A;  1YVI A;  1FR0 A;  1TQG A;  2LD6 A;  1C02 A;  2R25 A;  1C03 A;  2A0B A;  1OXK A;  4PAC A;  1OXB A;  1SR2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...