4C3EA

Hrsv m2-1 mutant s58d s61d, p21 crystal
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
177
structure length
172
Chain Sequence
LGSMSRRNPCKFEIRGHCLNGKRCHFSHNYFEWPPHALLVRQNFMLNRILKSMDLDEIDGAAELDRTEEYALGVVGVLESYIGSINNITKQSACVAMSKLLTELNSDDIKKLRDNEELNSPKIRVYNTVISYIESNRKNNKQTIHLLKRLPADVLKKTIKNTLDIHKSITIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords MATRIX M2-1
publication title Crystal Structure of the Essential Transcription Antiterminator M2-1 Protein of Human Respiratory Syncytial Virus and Implications of its Phosphorylation.
pubmed doi rcsb
source organism Human respiratory syncytial virus
total genus 58
structure length 172
sequence length 177
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P
ec nomenclature
pdb deposition date 2013-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06436 Pneumovirus_M2 Pneumovirus matrix protein 2 (M2)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1350 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4c3eA00
4C3EA 4CS9A 4C3BA 4CSAC 4CS9C 4CS7A 4CS8C 4C3DA 4CSAA 2L9JA 4CS8A
chains in the Genus database with same CATH superfamily
4KNVA 2GA0A 1NU9C 2A6EF 4U5HA 1WATA 3LEVA 4CS7A 2OJQA 3DXJF 1M2VA 1BZ4A 4IWBA 1NBBA 2KQ9A 3UR3C 2YL3A 2VB6A 5A69A 2NPUA 4EUKB 2BE5F 1JRAA 2XM0A 1M56C 3GM1A 5CI9A 2XXAA 2XRHA 2LP4A 4KNWA 1DOWA 3EFOA 3N2ZB 4OD5A 1NU7D 2J9WA 3FAPB 4JJFA 2YHSA 1ZW2A 1MQVA 5BUOA 3IEEA 2XS1A 1J8YF 1WOLA 3CEXA 3NMJA 3RQFA 5JT4A 4JCHA 4Z9JA 1T5OA 1YZCA 2IXMA 4U9DA 3U3BA 1OCOC 1ZHTA 3AG2C 4HFKB 4JEAA 3U9MA 5FCLA 5KYUA 4C7OB 2TMVP 3KMIA 1CGOA 2A68F 5D92A 2AWCA 4PJLA 5B1AC 4DRIB 1M57C 1ZU5A 1OQCA 3PCVA 2J0WA 2XLWA 2YZSA 4DRJB 3DZAA 2NUTA 2XLOA 2HZ8A 1QZXA 3C8GB 4J7TA 2AP3A 1BR4A 1VB5A 2ZD9A 1VYIA 3NYLA 4EBJA 5T3WA 4IJJA 1OW6A 2DB4A 4OIOF 4CDVA 5T1DB 3LAYA 2W4MA 2KW3C 3DAFA 3JT1A 4B6IA 3NKDA 5F28E 1V4AA 4DJ9A 1JPNA 4HE8D 1R4TA 1OW8A 4A2NB 2WVOA 2FAPB 4K1OA 3S0XA 4LDQA 2J7PD 3L34A 2R9RB 4G78A 4XTKA 5AC4A 4EHPA 1Z3IX 1ZZPA 3LLKA 4JIOA 4YL1A 2CYDA 4XEKA 4RDAA 2C03A 4JCZA 4KBLA 2H7OA 4XEVA 1HY5A 5AGFA 5D91A 2OG2A 3M15A 2YWAA 3TD7A 4NQFA 4JURI 4AX2A 3FHDA 3NYJA 4MVQA 1U6HA 2HMQA 4IAOA 4EWCA 5KYNA 4D4XA 3B0UX 1I5NA 1OCCC 3S90A 4G7ZF 2QNLA 4JTDB 2QY9A 3ZWIA 1MMNA 2A69F 2Y3DA 2GWWA 4BJ1A 4DBRA 5JLIA 4XEFA 1T01A 4U5CE 5TJ5E 4YK5A 2PF4E 3JSZA 1L3PA 2EILC 4E7ZA 4MW3A 4AK9A 5L0GA 2AWYA 3GEEA 4CS8A 3J06A 2KGOA 1FMWA 3C7JA 4Z9IA 4Q5SF 1JMWA 1PD1A 1PV3A 2AU5A 3DE8A 3DI5A 3JTLO 3JZ0A 3N24A 3PHF2 2EIMC 1C02A 4YJWA 1ORJA 3C18A 1O5HA 3AQCA 3QVYA 3IQ5A 4X0RA 3RQGA 1E2XA 4P9FA 4G7HF 2R7OA 4I3MA 2OQMA 3C62A 4BG0A 1OCZC 2HSQA 2OEXA 1G5ZA 3T9OA 3KL4A 2WZLA 3W4YA 3IQ6A 4R32A 4C3BA 1ORSC 5HSWA 1Q0DA 4I44A 3ZIBA 2B0HA 1YARO 1V74B 3HJCA 3I5PA 4IRUA 2MYSA 2ETSA 2HFIA 4OIRF 3ZTZA 3ABMC 3ZQVA 4BJ5A 3WAQA 4MQ9F 3CQZA 2W4BA 4O79A 4MVZA 1C03A 3RYLA 2OKUA 2QUPA 3LS0A 2KJGA 2L9JA 3AG3C 5EK0A 2YL7A 4U5DE 4OIPF 4JTCB 2PX0A 2R7TA 1OKKD 4N06A 3G4ZA 1RKCA 3IQTA 1OKKA 4DOZA 2ASRA 4C7OA 2GFHA 3UGPA 5DVWA 3EPVA 2EPKX 3O55A 3C8GD 2J0XA 2A0UA 1YVIA 3C8GA 3QVZA 4LDKA 2VCBA 4RBNA 2PFDA 1LS1A 1T9KA 3GWLA 1BR1A 1VLTA 2PNOA 2WL8A 1A7DA 2PP4A 3CSKA 3LS1A 2Y3BA 3S9OA 2HUJA 2PBEA 3Q6MA 1BBHA 4FESA 3GANA 2XL6A 1H6GA 4NY3A 3RKOF 3RVYA 3JRMO 3VF0A 3S84A 1KTMA 3DWWA 5K0IA 1CPQA 2XLVA 1APCA 2A6HF 1SYQA 3HNJA 2P7VA 1WTYA 2J46A 3U8PA 3HNIA 4XLPF 3Q6NA 2LIGA 2EIJC 3EZHA 1O87A 2R7RA 2YRFA 3HKKA 3MYFA 3W2WA 3FDQA 3LEOA 3NKEA 3FMSA 4FAPB 1LIHA 2G3VA 3Q7GA 3NDBB 3T4RA 2GAQA 3V5XA 5EHHA 3ABLC 4MW8A 4PJJA 1H9GA 3RF3A 3S27A 3RH3A 1LE2A 2EPLX 1Q0FA 2RSEB 2YL0A 3FXHA 3L8IA 5F5FA 3HNKA 5DS5A 4CIPA 3SYNA 2E87A 5L0CA 1Z23A 2NUPB 2OU6A 3FAJA 4K7BA 3W8HA 4ER9A 1TKNA 2LD6A 2X51A 4I1MA 1M6TA 2JD3A 3VYWA 4JW1A 1UFBA 2XLMA 3ABKC 5HV9A 2P6VA 4CX9A 4U5EE 2D4UA 4JE9A 4QDLA 4E0IA 5KYWB 4HEAJ 3RVZA 2Y3GA 3SZRA 1VOMA 2DYSC 2ZXRA 4D4NA 3EGXA 1G8XA 1QPUA 4MNDA 2WB7A 2HV6A 2WVQA 3FOOA 3AQBA 1RXQA 2KYHA 3S29A 4AE4B 3W8IA 5A6BD 2ZXOA 2CGEA 1F1MA 3NYMA 3M79A 2IXOA 5L0FA 1NZEA 3QTHA 2NG1A 3RW0A 3U5SA 3WODF 4ANJA 5CIVA 2Q3TA 3ATPA 1QVXA 3OEOA 2YVKA 3UMKA 2KNHA 4ONSA 3M4BA 1SZIA 4LLCA 1TWHA 2UUIA 2L6HA 1Z63A 1NLXA 3IPMO 1CGNA 4MVUA 4Q7CA 3L0IA 1OR3A 4BEJA 1D0YA 3WHNA 4IAQA 4EBKA 5BQGA 1FFTC 2C04A 1YYJA 3VAYA 3G4XA 3O39A 4CS8C 2XSEA 1E86A 4P9TA 3I4UA 3ZC4A 1NG1A 2QE9A 3OA1A 3GODA 4JC7A 4W8PA 1LVKA 4P6IC 4W8KA 2J7PA 2IOQA 3H2VA 2XM4A 3SXYA 3EH2A 5JRAA 1BDJB 3HTKC 2YKZA 3RFYA 3BRJA 1NSGB 3B0VC 3DJNB 2JX0A 1LI5A 3K6BA 3SXMA 1E85A 1EKYA 3SXKA 2IYLD 5JSLA 3TOLA 2ZPAA 4MVMA 2W45A 4U5BE 1YAUO 3U8VA 1HE9A 2M64A 1Z5ZA 2KK1A 2I8BA 1D1AA 4NTBA 4BJ5C 3AG4C 4CDYA 1LS4A 4DXWA 2LFDA 2V3CC 5L0IA 4XPYA 3DM9B 2LSEA 2IXNA 4OINF 1S05A 2LQGA 4FWVA 3NRHA 1S7ZA 1ZW3A 3UGOA 3EQLF 4CJOA 5JVEA 1RKEB 2R7QA 3NG1A 3UMIA 2I15A 3LJBA 2HKVA 3TQOA 2DYRC 3EH1A 4PJMA 3E70C 4LACB 5E3AA 3ZSUA 2YLIA 2CNWD 4CSAA 1WASA 2JPUA 4JKVA 4WJ0A 3TULA 5DQZA 3EGXB 3TJ6A 1IZMA 3U9JA 5L3QA 3MBGA 1HW2A 1D0XA 4LLEA 4N6CA 4HFFB 3ZG1A 2NUPA 1RCPA 4MVSA 3DJUB 4CDAA 3N0TA 5B3IA 5JUAA 1OXKA 1Z7Qc 1TR2A 1HE1A 1V54C 3OWTA 4O7GA 4WABA 2Q7RA 3B0PA 3LUTB 3R7CA 1EA8A 2J45A 3Q7LA 3DKAA 1EQ1A 5DS6A 4IGGA 2ICWG 3V7OA 5KYWA 5COMA 2HMZA 2Q00A 4L6RA 4OIQF 3U2LA 3ASNC 1C17M 2YL1A 1Q0MA 1JOGA 3GORA 3QMKA 5E3CA 4AE4A 5A6JA 5KYYB 4H4KC 3W2VA 3ASOC 2G3KA 4G0HA 1ZHWA 2EINC 2IM8A 2WZGA 1TWGA 3JRTA 2DI3A 1HMDA 3ECSA 1AEPA 3JSEO 3GEIA 4CS9C 1A0BA 4YL3A 3EHMA 1T6IA 2J9UA 1YA9A 4ZLDA 1BR2A 2VCCA 4JEBA 4JJGA 3UNGC 1FFHA 3E9VA 2YEVA 2P0NA 1TQGA 3F46A 3LNRA 2D5RB 3O10A 1D0ZA 4Q4ZF 4UDVA 3U0CA 3IHUA 3I5QA 2YLGA 3CAXA 1CPRA 1XZQA 2IXPA 1T6UA 2R02A 1K05A 5FZTA 3K7DA 4A4AA 4E17A 1TFOB 1U0BB 3H65A 4I1OB 1VYKA 1ZVZA 1J8MF 2GDCA 1GS9A 2AVKA 1JPJA 2EPMX 4QI2A 1LE4A 3B71A 2FFHA 4CS9A 2VC9A 2ZXPA 4DBQA 3GM3A 1WN0A 1HMOA 4BJ6A 4J7YA 2CW0F 3K1IA 5DLJA 4E18A 2X0CA 4U5FE 4E0HA 3GEHA 1KU2A 3T6JA 1MMDA 2Y39A 3HNLA 3A9CA 1D1BA 2IBFA 4LERA 1JR8A 2UUHA 1GGQA 2KSFA 3T6GB 1I4YA 2J8WA 4YWQA 1M2OA 4MTOA 2OOCA 3SXZA 2NSFA 2MWQA 1AUEA 1HW1A 2L6GA 3EG9B 3EGDB 1RKEA 3FOPA 4FX5A 5AC5A 1JAFA 1Y6DA 3QW1A 2F22A 3PMRA 1ZYRF 2H7VC 4BJTA 1ZU4A 5COGA 4BEMJ 3U3FA 1VTMP 1N1CA 2VH3A 3K66A 2YQYA 4Z9HA 1XZPA 1Z6AA 3AGTA 2Q9AA 4U9EA 3NMKA 1ORYA 2LK4A 3KPHA 5E2QA 4RD9A 1B68A 2H8AA 4NTFA 5A6BA 1IW7F 2R7VA 4O6YA 1RJ9B 1QKRA 3IQCA 1FTSA 2M4EA 2QTVA 2G62A 4MVRA 1VLSA 4N6HA 1LKXA 3ITFA 2A0BA 3DE9A 3C8ZA 2J9BA 4ULVA 3TOMA 3RQEA 5L0HA 3TJ5A 256BA 4NCQA 4PR9A 4WGZA 2VCAA 1Q0KA 4BPMA 4ZLCA 1K04A 2A1DD 3VRCA 5L0DA 1H9TA 1A7EA 3F47A 4J30B 3U2MA 1TWAA 2CDQA 2R7UA 2FGYA 4MVOA 4J32B 2R7XA 4GEHA 5KYYA 3A11A 1WWPA 1Y4CA 3TK0A 4E7SA 1AVOB 5L0JA 2HV7A 5JP7A 4G7OF 4ULWA 5T3TA 4PFOA 3K33A 3M1CB 1U89A 5L3VA 2BC5A 2R05A 3S28A 4CSAC 1YJGA 4GYTA 4WGYA 2EPNA 4DRHB 3VM6A 2XLDA 3AOUA 3DAGA 4U5GA 3GM2A 3RIPA 2P61A 4IARA 1MNEA 2R7SA 5GPGB 4CIHA 5KYXA 1ZHZA 4H54A 3UMHA 1K40A 1A41A 4MS2A 1MNDA 5IY5C 3GWNA 2L6FA 4KC9A 4NTAA 3DMDA 1L7CA 3K1HA 3AJMA 4PJNA 3L1MA 1E84A 4AL1A 1PCXA 1SMYF 2LFFA 3LNMB 2NSGA 4YN0B 1W2WA 2EPOA 2HSBA 2VASA 3JCUQ 2XLHA 1YA7O 1A7VA 1D1CA 2XL8A 2OJED 4CJGA 1ZHYA 1FR0A 2XXAB 2Y69C 1TFKB 4IB4A 1GQAA 1DOVA 3QZCA 3LESA 2KC3A 4XPWA 2YLDA 1MMAA 2J9VA 3MX3A 1M2VB 1OCRC 2HS5A 5E33A 1SF8A 1VK5A 2DGJA 2CNWA 4QI0A 3V5ZA 1PD0A 1OW7A 1QQ3A 2Y3HA 2B0JA 1R5ID 4M63A 1YLMA 1E83A 2WZFA 1FAPB 3MLGA 3ZDLA 2L81A 3EFOB 2PX3A 5B1BC 1SR2A 3PDMP 1XWJA 2Q9CA 3EG9A 3SP1A 3EGDA 5BQIA 3V5YA 5A6KA 4YT4A 3C63A 4GQHA 2EIKC 1V55C 3KYJA 5EGYA 5JS5A 5COFA 4DVZA 1NFNA 2XS8A 4C3EA 4EKWA 2RD9A 1G4WR 1YDIA 2OEVA 4LDRA 3EZIA 5A6AA 1TWCA 5KYUB 3B29A 2LCHA 3ZVRA 3ZTMA 4K0DA 1UG7A 3JYYA 1ST6A 4XQ1A 2MHRA 3EHNA 2OCCC 1RJ9A 2NUTB 1YYXA 2QLAA 3US6A 4C3DA 3CZ6A 3KH2A 2H7BA 4JRZA 3B9QA 2O9XA 3FVYA 1G4US 2BL2A 3L8JA 4XWJA 4JVSA 3T6BA 2ZXWC 2L7AA 4DVYP 4BJ6C 1KNYA 3K1IC 3JYHA 1NFOA 2R7WA 4JZAA 1MMGA 4XLNF 4OD4A 5KYXB 4NC3A 4YL0A 1OR2A 4XPXA 1EI7A 4PFPA 3HLZA 4F4BA 5B3SC 2Q4FA 3AGUA 2V26A 1I4ZA 1T6QA 3X1OA 1LI7A 2P1AA 3M4CA 3R2PA 4EIYA 3DD7A 3H2UA 1FMVA 3BEHA 1VMAA 3EJNA 4MTFA 4YT5A 1Q0GA 1QLEC 4AL0A 3POVA 1RMVA 2R25A 3X2QC 2HJ3A 3LLIA 5CI8A 3ZQYA 3O6XA 4O6NA 2W9YA 3MFNA 4EBBA 2HJMA 4KI2A 1O3UA 4N4WA 5DQTA 1GM5A 5BQHA 3SNHA 3G50A 4O6MA 2XL4A 2WVNA 1FNTc 4PK4A 1ZHXA 2CCYA 2Q9BA 3NMIA 3KYIA 4YT2A 4MTGA 3WG7C 3KKBA 3AG1C 1OXBA 4PACA 2Z15A 4JTAB 2XLEA 1LPEA 2R03A 4CBEA 1YZAA 4YT8A 1CGME 1QSPA 3SEOA 1H7IA 3MYIA 5DS4A 3QW0A 3DM5A 1WGWA 5F5HA 1LM3B
chains in the Genus database with same CATH topology
4KNVA 1NU9C 2A6EF 4U5HA 3LEVA 4CS7A 3DXJF 1M2VA 4IWBA 2KQ9A 3UR3C 2VB6A 2BE5F 5CI9A 1M56C 2XRHA 4KNWA 3EFOA 3N2ZB 4OD5A 1NU7D 2J9WA 4JJFA 2YHSA 5BUOA 3IEEA 1J8YF 4JCHA 2IXMA 1OCOC 1ZHTA 3AG2C 4HFKB 5FCLA 5KYUA 4C7OB 3KMIA 2A68F 5D92A 4PJLA 1M57C 1ZU5A 2J0WA 2YZSA 3DZAA 2NUTA 1QZXA 1BR4A 1VYIA 3NYLA 5T3WA 4IJJA 4OIOF 5T1DB 3LAYA 3JT1A 2KW3C 2W4MA 3DAFA 4B6IA 3NKDA 1JPNA 4HE8D 4A2NB 2WVOA 3S0XA 2J7PD 3L34A 4XTKA 1Z3IX 3LLKA 4RDAA 2C03A 4KBLA 2H7OA 3POVA 5D91A 2OG2A 3TD7A 4AX2A 4JURI 3FHDA 3NYJA 3B0UX 4IAOA 4EWCA 5KYNA 1OCCC 4G7ZF 2QY9A 1MMNA 2A69F 2Y3DA 4BJ1A 4DBRA 4U5CE 2PF4E 3JSZA 2EILC 4E7ZA 4AK9A 4CS8A 2KGOA 1FMWA 4Q5SF 1PD1A 3N24A 3NDBB 3PHF2 2EIMC 4YJWA 1O5HA 3AQCA 4X0RA 4G7HF 2R7OA 4I3MA 4BG0A 1OCZC 3KL4A 2WZLA 4C3BA 5HSWA 4I44A 3ZIBA 4IRUA 3I5PA 3HJCA 2MYSA 4OIRF 3ABMC 4BJ5A 4MQ9F 3CQZA 2W4BA 4O79A 3RYLA 3LS0A 2KJGA 2L9JA 3AG3C 4U5DE 4OIPF 2PX0A 2R7TA 1OKKD 4N06A 1OKKA 4DOZA 4C7OA 2GFHA 3UGPA 5DVWA 3EPVA 2J0XA 4RBNA 2PFDA 1LS1A 1BR1A 2WL8A 3CSKA 2PP4A 3LS1A 2Y3BA 3Q6MA 4FESA 3GANA 4NY3A 3RKOF 2A6HF 2P7VA 2J46A 4XLPF 3Q6NA 2EIJC 3EZHA 1O87A 3W2WA 3FDQA 3NKEA 2G3VA 3Q7GA 3T4RA 5EHHA 3ABLC 4PJJA 3S27A 3RH3A 5F5FA 5DS5A 3SYNA 2E87A 1Z23A 2NUPB 3FAJA 4K7BA 3W8HA 1TKNA 2X51A 4I1MA 2JD3A 3VYWA 4JW1A 3ABKC 2P6VA 4U5EE 4QDLA 5KYWB 4HEAJ 2Y3GA 3SZRA 1VOMA 2DYSC 2ZXRA 3EGXA 1G8XA 4MNDA 2WB7A 2HV6A 2WVQA 3S29A 3AQBA 4AE4B 3W8IA 3NYMA 2CGEA 2IXOA 1NZEA 2NG1A 3WODF 4ANJA 2Q3TA 3OEOA 3UMKA 2KNHA 1SZIA 4LLCA 1TWHA 1Z63A 4Q7CA 3L0IA 4BEJA 1D0YA 3VAYA 1FFTC 2C04A 3O39A 4CS8C 2XSEA 3I4UA 3ZC4A 1NG1A 3OA1A 3GODA 1LVKA 4P6IC 4W8KA 2J7PA 2IOQA 3EH2A 3HTKC 3RFYA 3B0VC 3DJNB 3K6BA 2IYLD 2ZPAA 2W45A 4U5BE 1Z5ZA 2I8BA 1D1AA 4BJ5C 3AG4C 2V3CC 3DM9B 2LSEA 2IXNA 1WGWA 4OINF 4FWVA 3NRHA 1S7ZA 3UGOA 3EQLF 2R7QA 3NG1A 3UMIA 3LJBA 2DYRC 3EH1A 4PJMA 3E70C 4LACB 5E3AA 3ZSUA 2CNWD 4CSAA 4WJ0A 5DQZA 3EGXB 1IZMA 5L3QA 1D0XA 4LLEA 4HFFB 3ZG1A 2NUPA 3DJUB 3N0TA 1TR2A 1V54C 3OWTA 4O7GA 3B0PA 2J45A 3Q7LA 5DS6A 3V7OA 5KYWA 4OIQF 3ASNC 3QMKA 5E3CA 4AE4A 5KYYB 4H4KC 3W2VA 3ASOC 2G3KA 4G0HA 1ZHWA 2EINC 2WZGA 1TWGA 3JRTA 3ECSA 4CS9C 3EHMA 2J9UA 4ZLDA 1BR2A 4JJGA 3UNGC 1FFHA 3E9VA 2YEVA 3F46A 3LNRA 2D5RB 1D0ZA 4Q4ZF 3I5QA 2IXPA 3K7DA 3H65A 4I1OB 1VYKA 1J8MF 1JPJA 4QI2A 2FFHA 4CS9A 2ZXPA 4DBQA 4BJ6A 2CW0F 5DLJA 4U5FE 1KU2A 3T6JA 1MMDA 2Y39A 1D1BA 2R7RA 4LERA 4YWQA 1M2OA 2MWQA 3EG9B 4FX5A 3EGDB 3PMRA 1ZYRF 2H7VC 4BJTA 1ZU4A 1N1CA 2VH3A 3K66A 1Z6AA 2Q9AA 5E2QA 4RD9A 1IW7F 2R7VA 4O6YA 1RJ9B 1FTSA 2M4EA 2QTVA 2G62A 5B1AC 1LKXA 3ITFA 4ZLCA 2A1DD 3F47A 4J30B 1TWAA 2CDQA 2R7UA 2FGYA 4J32B 2R7XA 4GEHA 5KYYA 4E7SA 2HV7A 4G7OF 4ULWA 5T3TA 4PFOA 3K33A 3M1CB 5L3VA 4CSAC 3S28A 4GYTA 3DAGA 4U5GA 3RIPA 1MNEA 2R7SA 4CIHA 5KYXA 1ZHZA 3UMHA 5IY5C 1MNDA 4KC9A 3DMDA 3K1HA 4PJNA 1PCXA 1SMYF 4YN0B 1W2WA 2VASA 3JCUQ 1D1CA 1ZHYA 2XXAB 2Y69C 3QZCA 3LESA 1MMAA 2J9VA 3MX3A 1M2VB 1OCRC 5E33A 1SF8A 1VK5A 2DGJA 2CNWA 4QI0A 1PD0A 2Y3HA 2B0JA 4M63A 2WZFA 3MLGA 2L81A 3EFOB 2PX3A 5B1BC 3SP1A 2Q9CA 3EG9A 3EGDA 4YT4A 2EIKC 1V55C 5EGYA 4DVZA 4C3EA 3EZIA 1TWCA 5KYUB 3ZVRA 4K0DA 1ST6A 3EHNA 2OCCC 1RJ9A 2NUTB 4C3DA 3CZ6A 3KH2A 2H7BA 3B9QA 2O9XA 3FVYA 4XWJA 4JVSA 3T6BA 2ZXWC 4DVYP 4BJ6C 3K1IC 3JYHA 2R7WA 4JZAA 1MMGA 4XLNF 4OD4A 5KYXB 4PFPA 3HLZA 4F4BA 5B3SC 2V26A 3X1OA 3DD7A 1FMVA 1VMAA 3EJNA 4YT5A 1QLEC 3X2QC 3LLIA 5CI8A 3O6XA 4O6NA 2W9YA 4EBBA 4KI2A 5DQTA 3SNHA 4O6MA 2XL4A 2WVNA 4PK4A 1ZHXA 2Q9BA 4YT2A 3WG7C 3KKBA 3AG1C 2Z15A 4CBEA 4YT8A 3SEOA 5DS4A 3DM5A 2ZXOA 5F5HA 2XXAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C3E A;  4CS9 A;  4C3B A;  4CSA C;  4CS9 C;  4CS7 A;  4CS8 C;  4C3D A;  4CSA A;  2L9J A;  4CS8 A; 
#chains in the Genus database with same CATH topology
 4KNV A;  2GA0 A;  1NU9 C;  2A6E F;  4U5H A;  1WAT A;  3LEV A;  4CS7 A;  2OJQ A;  3DXJ F;  1M2V A;  1BZ4 A;  4IWB A;  1NBB A;  2KQ9 A;  3UR3 C;  2YL3 A;  2VB6 A;  5A69 A;  2NPU A;  4EUK B;  2BE5 F;  1JRA A;  2XM0 A;  1M56 C;  3GM1 A;  5CI9 A;  2XXA A;  2XRH A;  2LP4 A;  4KNW A;  1DOW A;  3EFO A;  3N2Z B;  4OD5 A;  1NU7 D;  2J9W A;  3FAP B;  4JJF A;  2YHS A;  1ZW2 A;  1MQV A;  5BUO A;  3IEE A;  2XS1 A;  1J8Y F;  1WOL A;  3CEX A;  3NMJ A;  3RQF A;  5JT4 A;  4JCH A;  4Z9J A;  1T5O A;  1YZC A;  2IXM A;  4U9D A;  3U3B A;  1OCO C;  1ZHT A;  3AG2 C;  4HFK B;  4JEA A;  3U9M A;  5FCL A;  5KYU A;  4C7O B;  2TMV P;  3KMI A;  1CGO A;  2A68 F;  5D92 A;  2AWC A;  4PJL A;  5B1A C;  4DRI B;  1M57 C;  1ZU5 A;  1OQC A;  3PCV A;  2J0W A;  2XLW A;  2YZS A;  4DRJ B;  3DZA A;  2NUT A;  2XLO A;  2HZ8 A;  1QZX A;  3C8G B;  4J7T A;  2AP3 A;  1BR4 A;  1VB5 A;  2ZD9 A;  1VYI A;  3NYL A;  4EBJ A;  5T3W A;  4IJJ A;  1OW6 A;  2DB4 A;  4OIO F;  4CDV A;  5T1D B;  3LAY A;  2W4M A;  2KW3 C;  3DAF A;  3JT1 A;  4B6I A;  3NKD A;  5F28 E;  1V4A A;  4DJ9 A;  1JPN A;  4HE8 D;  1R4T A;  1OW8 A;  4A2N B;  2WVO A;  2FAP B;  4K1O A;  3S0X A;  4LDQ A;  2J7P D;  3L34 A;  2R9R B;  4G78 A;  4XTK A;  5AC4 A;  4EHP A;  1Z3I X;  1ZZP A;  3LLK A;  4JIO A;  4YL1 A;  2CYD A;  4XEK A;  4RDA A;  2C03 A;  4JCZ A;  4KBL A;  2H7O A;  4XEV A;  1HY5 A;  5AGF A;  5D91 A;  2OG2 A;  3M15 A;  2YWA A;  3TD7 A;  4NQF A;  4JUR I;  4AX2 A;  3FHD A;  3NYJ A;  4MVQ A;  1U6H A;  2HMQ A;  4IAO A;  4EWC A;  5KYN A;  4D4X A;  3B0U X;  1I5N A;  1OCC C;  3S90 A;  4G7Z F;  2QNL A;  4JTD B;  2QY9 A;  3ZWI A;  1MMN A;  2A69 F;  2Y3D A;  2GWW A;  4BJ1 A;  4DBR A;  5JLI A;  4XEF A;  1T01 A;  4U5C E;  5TJ5 E;  4YK5 A;  2PF4 E;  3JSZ A;  1L3P A;  2EIL C;  4E7Z A;  4MW3 A;  4AK9 A;  5L0G A;  2AWY A;  3GEE A;  4CS8 A;  3J06 A;  2KGO A;  1FMW A;  3C7J A;  4Z9I A;  4Q5S F;  1JMW A;  1PD1 A;  1PV3 A;  2AU5 A;  3DE8 A;  3DI5 A;  3JTL O;  3JZ0 A;  3N24 A;  3PHF 2;  2EIM C;  1C02 A;  4YJW A;  1ORJ A;  3C18 A;  1O5H A;  3AQC A;  3QVY A;  3IQ5 A;  4X0R A;  3RQG A;  1E2X A;  4P9F A;  4G7H F;  2R7O A;  4I3M A;  2OQM A;  3C62 A;  4BG0 A;  1OCZ C;  2HSQ A;  2OEX A;  1G5Z A;  3T9O A;  3KL4 A;  2WZL A;  3W4Y A;  3IQ6 A;  4R32 A;  4C3B A;  1ORS C;  5HSW A;  1Q0D A;  4I44 A;  3ZIB A;  2B0H A;  1YAR O;  1V74 B;  3HJC A;  3I5P A;  4IRU A;  2MYS A;  2ETS A;  2HFI A;  4OIR F;  3ZTZ A;  3ABM C;  3ZQV A;  4BJ5 A;  3WAQ A;  4MQ9 F;  3CQZ A;  2W4B A;  4O79 A;  4MVZ A;  1C03 A;  3RYL A;  2OKU A;  2QUP A;  3LS0 A;  2KJG A;  2L9J A;  3AG3 C;  5EK0 A;  2YL7 A;  4U5D E;  4OIP F;  4JTC B;  2PX0 A;  2R7T A;  1OKK D;  4N06 A;  3G4Z A;  1RKC A;  3IQT A;  1OKK A;  4DOZ A;  2ASR A;  4C7O A;  2GFH A;  3UGP A;  5DVW A;  3EPV A;  2EPK X;  3O55 A;  3C8G D;  2J0X A;  2A0U A;  1YVI A;  3C8G A;  3QVZ A;  4LDK A;  2VCB A;  4RBN A;  2PFD A;  1LS1 A;  1T9K A;  3GWL A;  1BR1 A;  1VLT A;  2PNO A;  2WL8 A;  1A7D A;  2PP4 A;  3CSK A;  3LS1 A;  2Y3B A;  3S9O A;  2HUJ A;  2PBE A;  3Q6M A;  1BBH A;  4FES A;  3GAN A;  2XL6 A;  1H6G A;  4NY3 A;  3RKO F;  3RVY A;  3JRM O;  3VF0 A;  3S84 A;  1KTM A;  3DWW A;  5K0I A;  1CPQ A;  2XLV A;  1APC A;  2A6H F;  1SYQ A;  3HNJ A;  2P7V A;  1WTY A;  2J46 A;  3U8P A;  3HNI A;  4XLP F;  3Q6N A;  2LIG A;  2EIJ C;  3EZH A;  1O87 A;  2R7R A;  2YRF A;  3HKK A;  3MYF A;  3W2W A;  3FDQ A;  3LEO A;  3NKE A;  3FMS A;  4FAP B;  1LIH A;  2G3V A;  3Q7G A;  3NDB B;  3T4R A;  2GAQ A;  3V5X A;  5EHH A;  3ABL C;  4MW8 A;  4PJJ A;  1H9G A;  3RF3 A;  3S27 A;  3RH3 A;  1LE2 A;  2EPL X;  1Q0F A;  2RSE B;  2YL0 A;  3FXH A;  3L8I A;  5F5F A;  3HNK A;  5DS5 A;  4CIP A;  3SYN A;  2E87 A;  5L0C A;  1Z23 A;  2NUP B;  2OU6 A;  3FAJ A;  4K7B A;  3W8H A;  4ER9 A;  1TKN A;  2LD6 A;  2X51 A;  4I1M A;  1M6T A;  2JD3 A;  3VYW A;  4JW1 A;  1UFB A;  2XLM A;  3ABK C;  5HV9 A;  2P6V A;  4CX9 A;  4U5E E;  2D4U A;  4JE9 A;  4QDL A;  4E0I A;  5KYW B;  4HEA J;  3RVZ A;  2Y3G A;  3SZR A;  1VOM A;  2DYS C;  2ZXR A;  4D4N A;  3EGX A;  1G8X A;  1QPU A;  4MND A;  2WB7 A;  2HV6 A;  2WVQ A;  3FOO A;  3AQB A;  1RXQ A;  2KYH A;  3S29 A;  4AE4 B;  3W8I A;  5A6B D;  2ZXO A;  2CGE A;  1F1M A;  3NYM A;  3M79 A;  2IXO A;  5L0F A;  1NZE A;  3QTH A;  2NG1 A;  3RW0 A;  3U5S A;  3WOD F;  4ANJ A;  5CIV A;  2Q3T A;  3ATP A;  1QVX A;  3OEO A;  2YVK A;  3UMK A;  2KNH A;  4ONS A;  3M4B A;  1SZI A;  4LLC A;  1TWH A;  2UUI A;  2L6H A;  1Z63 A;  1NLX A;  3IPM O;  1CGN A;  4MVU A;  4Q7C A;  3L0I A;  1OR3 A;  4BEJ A;  1D0Y A;  3WHN A;  4IAQ A;  4EBK A;  5BQG A;  1FFT C;  2C04 A;  1YYJ A;  3VAY A;  3G4X A;  3O39 A;  4CS8 C;  2XSE A;  1E86 A;  4P9T A;  3I4U A;  3ZC4 A;  1NG1 A;  2QE9 A;  3OA1 A;  3GOD A;  4JC7 A;  4W8P A;  1LVK A;  4P6I C;  4W8K A;  2J7P A;  2IOQ A;  3H2V A;  2XM4 A;  3SXY A;  3EH2 A;  5JRA A;  1BDJ B;  3HTK C;  2YKZ A;  3RFY A;  3BRJ A;  1NSG B;  3B0V C;  3DJN B;  2JX0 A;  1LI5 A;  3K6B A;  3SXM A;  1E85 A;  1EKY A;  3SXK A;  2IYL D;  5JSL A;  3TOL A;  2ZPA A;  4MVM A;  2W45 A;  4U5B E;  1YAU O;  3U8V A;  1HE9 A;  2M64 A;  1Z5Z A;  2KK1 A;  2I8B A;  1D1A A;  4NTB A;  4BJ5 C;  3AG4 C;  4CDY A;  1LS4 A;  4DXW A;  2LFD A;  2V3C C;  5L0I A;  4XPY A;  3DM9 B;  2LSE A;  2IXN A;  4OIN F;  1S05 A;  2LQG A;  4FWV A;  3NRH A;  1S7Z A;  1ZW3 A;  3UGO A;  3EQL F;  4CJO A;  5JVE A;  1RKE B;  2R7Q A;  3NG1 A;  3UMI A;  2I15 A;  3LJB A;  2HKV A;  3TQO A;  2DYR C;  3EH1 A;  4PJM A;  3E70 C;  4LAC B;  5E3A A;  3ZSU A;  2YLI A;  2CNW D;  4CSA A;  1WAS A;  2JPU A;  4JKV A;  4WJ0 A;  3TUL A;  5DQZ A;  3EGX B;  3TJ6 A;  1IZM A;  3U9J A;  5L3Q A;  3MBG A;  1HW2 A;  1D0X A;  4LLE A;  4N6C A;  4HFF B;  3ZG1 A;  2NUP A;  1RCP A;  4MVS A;  3DJU B;  4CDA A;  3N0T A;  5B3I A;  5JUA A;  1OXK A;  1Z7Q c;  1TR2 A;  1HE1 A;  1V54 C;  3OWT A;  4O7G A;  4WAB A;  2Q7R A;  3B0P A;  3LUT B;  3R7C A;  1EA8 A;  2J45 A;  3Q7L A;  3DKA A;  1EQ1 A;  5DS6 A;  4IGG A;  2ICW G;  3V7O A;  5KYW A;  5COM A;  2HMZ A;  2Q00 A;  4L6R A;  4OIQ F;  3U2L A;  3ASN C;  1C17 M;  2YL1 A;  1Q0M A;  1JOG A;  3GOR A;  3QMK A;  5E3C A;  4AE4 A;  5A6J A;  5KYY B;  4H4K C;  3W2V A;  3ASO C;  2G3K A;  4G0H A;  1ZHW A;  2EIN C;  2IM8 A;  2WZG A;  1TWG A;  3JRT A;  2DI3 A;  1HMD A;  3ECS A;  1AEP A;  3JSE O;  3GEI A;  4CS9 C;  1A0B A;  4YL3 A;  3EHM A;  1T6I A;  2J9U A;  1YA9 A;  4ZLD A;  1BR2 A;  2VCC A;  4JEB A;  4JJG A;  3UNG C;  1FFH A;  3E9V A;  2YEV A;  2P0N A;  1TQG A;  3F46 A;  3LNR A;  2D5R B;  3O10 A;  1D0Z A;  4Q4Z F;  4UDV A;  3U0C A;  3IHU A;  3I5Q A;  2YLG A;  3CAX A;  1CPR A;  1XZQ A;  2IXP A;  1T6U A;  2R02 A;  1K05 A;  5FZT A;  3K7D A;  4A4A A;  4E17 A;  1TFO B;  1U0B B;  3H65 A;  4I1O B;  1VYK A;  1ZVZ A;  1J8M F;  2GDC A;  1GS9 A;  2AVK A;  1JPJ A;  2EPM X;  4QI2 A;  1LE4 A;  3B71 A;  2FFH A;  4CS9 A;  2VC9 A;  2ZXP A;  4DBQ A;  3GM3 A;  1WN0 A;  1HMO A;  4BJ6 A;  4J7Y A;  2CW0 F;  3K1I A;  5DLJ A;  4E18 A;  2X0C A;  4U5F E;  4E0H A;  3GEH A;  1KU2 A;  3T6J A;  1MMD A;  2Y39 A;  3HNL A;  3A9C A;  1D1B A;  2IBF A;  4LER A;  1JR8 A;  2UUH A;  1GGQ A;  2KSF A;  3T6G B;  1I4Y A;  2J8W A;  4YWQ A;  1M2O A;  4MTO A;  2OOC A;  3SXZ A;  2NSF A;  2MWQ A;  1AUE A;  1HW1 A;  2L6G A;  3EG9 B;  3EGD B;  1RKE A;  3FOP A;  4FX5 A;  5AC5 A;  1JAF A;  1Y6D A;  3QW1 A;  2F22 A;  3PMR A;  1ZYR F;  2H7V C;  4BJT A;  1ZU4 A;  5COG A;  4BEM J;  3U3F A;  1VTM P;  1N1C A;  2VH3 A;  3K66 A;  2YQY A;  4Z9H A;  1XZP A;  1Z6A A;  3AGT A;  2Q9A A;  4U9E A;  3NMK A;  1ORY A;  2LK4 A;  3KPH A;  5E2Q A;  4RD9 A;  1B68 A;  2H8A A;  4NTF A;  5A6B A;  1IW7 F;  2R7V A;  4O6Y A;  1RJ9 B;  1QKR A;  3IQC A;  1FTS A;  2M4E A;  2QTV A;  2G62 A;  4MVR A;  1VLS A;  4N6H A;  1LKX A;  3ITF A;  2A0B A;  3DE9 A;  3C8Z A;  2J9B A;  4ULV A;  3TOM A;  3RQE A;  5L0H A;  3TJ5 A;  256B A;  4NCQ A;  4PR9 A;  4WGZ A;  2VCA A;  1Q0K A;  4BPM A;  4ZLC A;  1K04 A;  2A1D D;  3VRC A;  5L0D A;  1H9T A;  1A7E A;  3F47 A;  4J30 B;  3U2M A;  1TWA A;  2CDQ A;  2R7U A;  2FGY A;  4MVO A;  4J32 B;  2R7X A;  4GEH A;  5KYY A;  3A11 A;  1WWP A;  1Y4C A;  3TK0 A;  4E7S A;  1AVO B;  5L0J A;  2HV7 A;  5JP7 A;  4G7O F;  4ULW A;  5T3T A;  4PFO A;  3K33 A;  3M1C B;  1U89 A;  5L3V A;  2BC5 A;  2R05 A;  3S28 A;  4CSA C;  1YJG A;  4GYT A;  4WGY A;  2EPN A;  4DRH B;  3VM6 A;  2XLD A;  3AOU A;  3DAG A;  4U5G A;  3GM2 A;  3RIP A;  2P61 A;  4IAR A;  1MNE A;  2R7S A;  5GPG B;  4CIH A;  5KYX A;  1ZHZ A;  4H54 A;  3UMH A;  1K40 A;  1A41 A;  4MS2 A;  1MND A;  5IY5 C;  3GWN A;  2L6F A;  4KC9 A;  4NTA A;  3DMD A;  1L7C A;  3K1H A;  3AJM A;  4PJN A;  3L1M A;  1E84 A;  4AL1 A;  1PCX A;  1SMY F;  2LFF A;  3LNM B;  2NSG A;  4YN0 B;  1W2W A;  2EPO A;  2HSB A;  2VAS A;  3JCU Q;  2XLH A;  1YA7 O;  1A7V A;  1D1C A;  2XL8 A;  2OJE D;  4CJG A;  1ZHY A;  1FR0 A;  2XXA B;  2Y69 C;  1TFK B;  4IB4 A;  1GQA A;  1DOV A;  3QZC A;  3LES A;  2KC3 A;  4XPW A;  2YLD A;  1MMA A;  2J9V A;  3MX3 A;  1M2V B;  1OCR C;  2HS5 A;  5E33 A;  1SF8 A;  1VK5 A;  2DGJ A;  2CNW A;  4QI0 A;  3V5Z A;  1PD0 A;  1OW7 A;  1QQ3 A;  2Y3H A;  2B0J A;  1R5I D;  4M63 A;  1YLM A;  1E83 A;  2WZF A;  1FAP B;  3MLG A;  3ZDL A;  2L81 A;  3EFO B;  2PX3 A;  5B1B C;  1SR2 A;  3PDM P;  1XWJ A;  2Q9C A;  3EG9 A;  3SP1 A;  3EGD A;  5BQI A;  3V5Y A;  5A6K A;  4YT4 A;  3C63 A;  4GQH A;  2EIK C;  1V55 C;  3KYJ A;  5EGY A;  5JS5 A;  5COF A;  4DVZ A;  1NFN A;  2XS8 A;  4C3E A;  4EKW A;  2RD9 A;  1G4W R;  1YDI A;  2OEV A;  4LDR A;  3EZI A;  5A6A A;  1TWC A;  5KYU B;  3B29 A;  2LCH A;  3ZVR A;  3ZTM A;  4K0D A;  1UG7 A;  3JYY A;  1ST6 A;  4XQ1 A;  2MHR A;  3EHN A;  2OCC C;  1RJ9 A;  2NUT B;  1YYX A;  2QLA A;  3US6 A;  4C3D A;  3CZ6 A;  3KH2 A;  2H7B A;  4JRZ A;  3B9Q A;  2O9X A;  3FVY A;  1G4U S;  2BL2 A;  3L8J A;  4XWJ A;  4JVS A;  3T6B A;  2ZXW C;  2L7A A;  4DVY P;  4BJ6 C;  1KNY A;  3K1I C;  3JYH A;  1NFO A;  2R7W A;  4JZA A;  1MMG A;  4XLN F;  4OD4 A;  5KYX B;  4NC3 A;  4YL0 A;  1OR2 A;  4XPX A;  1EI7 A;  4PFP A;  3HLZ A;  4F4B A;  5B3S C;  2Q4F A;  3AGU A;  2V26 A;  1I4Z A;  1T6Q A;  3X1O A;  1LI7 A;  2P1A A;  3M4C A;  3R2P A;  4EIY A;  3DD7 A;  3H2U A;  1FMV A;  3BEH A;  1VMA A;  3EJN A;  4MTF A;  4YT5 A;  1Q0G A;  1QLE C;  4AL0 A;  3POV A;  1RMV A;  2R25 A;  3X2Q C;  2HJ3 A;  3LLI A;  5CI8 A;  3ZQY A;  3O6X A;  4O6N A;  2W9Y A;  3MFN A;  4EBB A;  2HJM A;  4KI2 A;  1O3U A;  4N4W A;  5DQT A;  1GM5 A;  5BQH A;  3SNH A;  3G50 A;  4O6M A;  2XL4 A;  2WVN A;  1FNT c;  4PK4 A;  1ZHX A;  2CCY A;  2Q9B A;  3NMI A;  3KYI A;  4YT2 A;  4MTG A;  3WG7 C;  3KKB A;  3AG1 C;  1OXB A;  4PAC A;  2Z15 A;  4JTA B;  2XLE A;  1LPE A;  2R03 A;  4CBE A;  1YZA A;  4YT8 A;  1CGM E;  1QSP A;  3SEO A;  1H7I A;  3MYI A;  5DS4 A;  3QW0 A;  3DM5 A;  1WGW A;  5F5H A;  1LM3 B; 
#chains in the Genus database with same CATH homology
 4KNV A;  1NU9 C;  2A6E F;  4U5H A;  3LEV A;  4CS7 A;  3DXJ F;  1M2V A;  4IWB A;  2KQ9 A;  3UR3 C;  2VB6 A;  2BE5 F;  5CI9 A;  1M56 C;  2XRH A;  4KNW A;  3EFO A;  3N2Z B;  4OD5 A;  1NU7 D;  2J9W A;  4JJF A;  2YHS A;  5BUO A;  3IEE A;  1J8Y F;  4JCH A;  2IXM A;  1OCO C;  1ZHT A;  3AG2 C;  4HFK B;  5FCL A;  5KYU A;  4C7O B;  3KMI A;  2A68 F;  5D92 A;  4PJL A;  1M57 C;  1ZU5 A;  2J0W A;  2YZS A;  3DZA A;  2NUT A;  1QZX A;  1BR4 A;  1VYI A;  3NYL A;  5T3W A;  4IJJ A;  4OIO F;  5T1D B;  3LAY A;  3JT1 A;  2KW3 C;  2W4M A;  3DAF A;  4B6I A;  3NKD A;  1JPN A;  4HE8 D;  4A2N B;  2WVO A;  3S0X A;  2J7P D;  3L34 A;  4XTK A;  1Z3I X;  3LLK A;  4RDA A;  2C03 A;  4KBL A;  2H7O A;  3POV A;  5D91 A;  2OG2 A;  3TD7 A;  4AX2 A;  4JUR I;  3FHD A;  3NYJ A;  3B0U X;  4IAO A;  4EWC A;  5KYN A;  1OCC C;  4G7Z F;  2QY9 A;  1MMN A;  2A69 F;  2Y3D A;  4BJ1 A;  4DBR A;  4U5C E;  2PF4 E;  3JSZ A;  2EIL C;  4E7Z A;  4AK9 A;  4CS8 A;  2KGO A;  1FMW A;  4Q5S F;  1PD1 A;  3N24 A;  3NDB B;  3PHF 2;  2EIM C;  4YJW A;  1O5H A;  3AQC A;  4X0R A;  4G7H F;  2R7O A;  4I3M A;  4BG0 A;  1OCZ C;  3KL4 A;  2WZL A;  4C3B A;  5HSW A;  4I44 A;  3ZIB A;  4IRU A;  3I5P A;  3HJC A;  2MYS A;  4OIR F;  3ABM C;  4BJ5 A;  4MQ9 F;  3CQZ A;  2W4B A;  4O79 A;  3RYL A;  3LS0 A;  2KJG A;  2L9J A;  3AG3 C;  4U5D E;  4OIP F;  2PX0 A;  2R7T A;  1OKK D;  4N06 A;  1OKK A;  4DOZ A;  4C7O A;  2GFH A;  3UGP A;  5DVW A;  3EPV A;  2J0X A;  4RBN A;  2PFD A;  1LS1 A;  1BR1 A;  2WL8 A;  3CSK A;  2PP4 A;  3LS1 A;  2Y3B A;  3Q6M A;  4FES A;  3GAN A;  4NY3 A;  3RKO F;  2A6H F;  2P7V A;  2J46 A;  4XLP F;  3Q6N A;  2EIJ C;  3EZH A;  1O87 A;  3W2W A;  3FDQ A;  3NKE A;  2G3V A;  3Q7G A;  3T4R A;  5EHH A;  3ABL C;  4PJJ A;  3S27 A;  3RH3 A;  5F5F A;  5DS5 A;  3SYN A;  2E87 A;  1Z23 A;  2NUP B;  3FAJ A;  4K7B A;  3W8H A;  1TKN A;  2X51 A;  4I1M A;  2JD3 A;  3VYW A;  4JW1 A;  3ABK C;  2P6V A;  4U5E E;  4QDL A;  5KYW B;  4HEA J;  2Y3G A;  3SZR A;  1VOM A;  2DYS C;  2ZXR A;  3EGX A;  1G8X A;  4MND A;  2WB7 A;  2HV6 A;  2WVQ A;  3S29 A;  3AQB A;  4AE4 B;  3W8I A;  3NYM A;  2CGE A;  2IXO A;  1NZE A;  2NG1 A;  3WOD F;  4ANJ A;  2Q3T A;  3OEO A;  3UMK A;  2KNH A;  1SZI A;  4LLC A;  1TWH A;  1Z63 A;  4Q7C A;  3L0I A;  4BEJ A;  1D0Y A;  3VAY A;  1FFT C;  2C04 A;  3O39 A;  4CS8 C;  2XSE A;  3I4U A;  3ZC4 A;  1NG1 A;  3OA1 A;  3GOD A;  1LVK A;  4P6I C;  4W8K A;  2J7P A;  2IOQ A;  3EH2 A;  3HTK C;  3RFY A;  3B0V C;  3DJN B;  3K6B A;  2IYL D;  2ZPA A;  2W45 A;  4U5B E;  1Z5Z A;  2I8B A;  1D1A A;  4BJ5 C;  3AG4 C;  2V3C C;  3DM9 B;  2LSE A;  2IXN A;  1WGW A;  4OIN F;  4FWV A;  3NRH A;  1S7Z A;  3UGO A;  3EQL F;  2R7Q A;  3NG1 A;  3UMI A;  3LJB A;  2DYR C;  3EH1 A;  4PJM A;  3E70 C;  4LAC B;  5E3A A;  3ZSU A;  2CNW D;  4CSA A;  4WJ0 A;  5DQZ A;  3EGX B;  1IZM A;  5L3Q A;  1D0X A;  4LLE A;  4HFF B;  3ZG1 A;  2NUP A;  3DJU B;  3N0T A;  1TR2 A;  1V54 C;  3OWT A;  4O7G A;  3B0P A;  2J45 A;  3Q7L A;  5DS6 A;  3V7O A;  5KYW A;  4OIQ F;  3ASN C;  3QMK A;  5E3C A;  4AE4 A;  5KYY B;  4H4K C;  3W2V A;  3ASO C;  2G3K A;  4G0H A;  1ZHW A;  2EIN C;  2WZG A;  1TWG A;  3JRT A;  3ECS A;  4CS9 C;  3EHM A;  2J9U A;  4ZLD A;  1BR2 A;  4JJG A;  3UNG C;  1FFH A;  3E9V A;  2YEV A;  3F46 A;  3LNR A;  2D5R B;  1D0Z A;  4Q4Z F;  3I5Q A;  2IXP A;  3K7D A;  3H65 A;  4I1O B;  1VYK A;  1J8M F;  1JPJ A;  4QI2 A;  2FFH A;  4CS9 A;  2ZXP A;  4DBQ A;  4BJ6 A;  2CW0 F;  5DLJ A;  4U5F E;  1KU2 A;  3T6J A;  1MMD A;  2Y39 A;  1D1B A;  2R7R A;  4LER A;  4YWQ A;  1M2O A;  2MWQ A;  3EG9 B;  4FX5 A;  3EGD B;  3PMR A;  1ZYR F;  2H7V C;  4BJT A;  1ZU4 A;  1N1C A;  2VH3 A;  3K66 A;  1Z6A A;  2Q9A A;  5E2Q A;  4RD9 A;  1IW7 F;  2R7V A;  4O6Y A;  1RJ9 B;  1FTS A;  2M4E A;  2QTV A;  2G62 A;  5B1A C;  1LKX A;  3ITF A;  4ZLC A;  2A1D D;  3F47 A;  4J30 B;  1TWA A;  2CDQ A;  2R7U A;  2FGY A;  4J32 B;  2R7X A;  4GEH A;  5KYY A;  4E7S A;  2HV7 A;  4G7O F;  4ULW A;  5T3T A;  4PFO A;  3K33 A;  3M1C B;  5L3V A;  4CSA C;  3S28 A;  4GYT A;  3DAG A;  4U5G A;  3RIP A;  1MNE A;  2R7S A;  4CIH A;  5KYX A;  1ZHZ A;  3UMH A;  5IY5 C;  1MND A;  4KC9 A;  3DMD A;  3K1H A;  4PJN A;  1PCX A;  1SMY F;  4YN0 B;  1W2W A;  2VAS A;  3JCU Q;  1D1C A;  1ZHY A;  2XXA B;  2Y69 C;  3QZC A;  3LES A;  1MMA A;  2J9V A;  3MX3 A;  1M2V B;  1OCR C;  5E33 A;  1SF8 A;  1VK5 A;  2DGJ A;  2CNW A;  4QI0 A;  1PD0 A;  2Y3H A;  2B0J A;  4M63 A;  2WZF A;  3MLG A;  2L81 A;  3EFO B;  2PX3 A;  5B1B C;  3SP1 A;  2Q9C A;  3EG9 A;  3EGD A;  4YT4 A;  2EIK C;  1V55 C;  5EGY A;  4DVZ A;  4C3E A;  3EZI A;  1TWC A;  5KYU B;  3ZVR A;  4K0D A;  1ST6 A;  3EHN A;  2OCC C;  1RJ9 A;  2NUT B;  4C3D A;  3CZ6 A;  3KH2 A;  2H7B A;  3B9Q A;  2O9X A;  3FVY A;  4XWJ A;  4JVS A;  3T6B A;  2ZXW C;  4DVY P;  4BJ6 C;  3K1I C;  3JYH A;  2R7W A;  4JZA A;  1MMG A;  4XLN F;  4OD4 A;  5KYX B;  4PFP A;  3HLZ A;  4F4B A;  5B3S C;  2V26 A;  3X1O A;  3DD7 A;  1FMV A;  1VMA A;  3EJN A;  4YT5 A;  1QLE C;  3X2Q C;  3LLI A;  5CI8 A;  3O6X A;  4O6N A;  2W9Y A;  4EBB A;  4KI2 A;  5DQT A;  3SNH A;  4O6M A;  2XL4 A;  2WVN A;  4PK4 A;  1ZHX A;  2Q9B A;  4YT2 A;  3WG7 C;  3KKB A;  3AG1 C;  2Z15 A;  4CBE A;  4YT8 A;  3SEO A;  5DS4 A;  3DM5 A;  2ZXO A;  5F5H A;  2XXA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...