4C3EA

Hrsv m2-1 mutant s58d s61d, p21 crystal
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
177
structure length
172
Chain Sequence
b'LGSMSRRNPCKFEIRGHCLNGKRCHFSHNYFEWPPHALLVRQNFMLNRILKSMDLDEIDGAAELDRTEEYALGVVGVLESYIGSINNITKQSACVAMSKLLTELNSDDIKKLRDNEELNSPKIRVYNTVISYIESNRKNNKQTIHLLKRLPADVLKKTIKNTLDIHKSITIN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MATRIX M2-1
publication title Crystal Structure of the Essential Transcription Antiterminator M2-1 Protein of Human Respiratory Syncytial Virus and Implications of its Phosphorylation.
pubmed doi rcsb
source organism Human respiratory syncytial virus
molecule tags Viral protein
total genus 58
structure length 172
sequence length 177
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P
ec nomenclature
pdb deposition date 2013-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06436 Pneumovirus_M2 Pneumovirus matrix protein 2 (M2)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1350 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4c3eA00
4CS9C 4CSAA 4CSAC 4C3DA 2L9JA 4C3EA 4C3BA 4CS7A 4CS8A 4CS9A 4CS8C
chains in the Genus database with same CATH superfamily
1GQAA 3B0UX 1Q0DA 3AG4C 5KYXB 4JRZA 3T4RA 3V5ZA 4NQFA 1ZVZA 1Z23A 3SP1A 2OKUA 4CSAC 4OIOF 3NDBB 3T6GB 1VOMA 2NUTB 1LI5A 1MMDA 3U8VA 1R5ID 3WODF 3K1IC 4A2NB 4U5FE 2W9YA 3CSKA 1ZHTA 4ZLDA 1OQCA 3L0IA 1FR0A 3SXZA 2FGYA 4OIQF 3KH2A 1RMVA 2AU5A 2WZGA 3C8GD 2HMZA 3H2UA 5D91A 1GM5A 1C17M 2QE9A 4MVMA 2HJMA 3W8IA 5DS4A 4BJ6C 2YLGA 2XL6A 2XLOA 3C18A 4JCHA 4N4WA 1ZU4A 2QY9A 3L8JA 2EPLX 3NMJA 1E86A 1RJ9A 4MTFA 4CX9A 4CS8A 3IEEA 4W8KA 4PFOA 2Q9BA 1T6IA 2C03A 4BPMA 3FAJA 4DOZA 1YA9A 1SR2A 2ASRA 2WVNA 4G78A 2QUPA 3SXKA 4XPXA 4KNWA 1O87A 1ZZPA 4I1OB 3X2QC 1E83A 1A7EA 2J0XA 1OCCC 1L3PA 1UFBA 4DBQA 2J7PA 4BJ1A 1YJGA 3QVZA 4MW3A 2YVKA 4P9TA 1LM3B 2JPUA 2AVKA 3S29A 4F4BA 5JLIA 4CSAA 1JAFA 3EJNA 2L9JA 2AWYA 4OD5A 4DBRA 1M56C 1CGNA 2NG1A 3G4ZA 4H4KC 1WGWA 1E2XA 4C7OA 3AGUA 1LI7A 5FZTA 2OG2A 2MYSA 4DJ9A 5AC5A 3MLGA 5L0JA 4U9EA 4G7ZF 2I8BA 5TJ5E 2Q3TA 1FAPB 3DJNB 1ZYRF 3GWNA 4BJ6A 2CW0F 2J9WA 4ULVA 1VLTA 1M6TA 1WOLA 3GEIA 2PNOA 1DOWA 1ZHZA 2CNWA 4XEKA 4YT8A 5BQHA 3LLIA 1ZHXA 4MW8A 4E0HA 1OR3A 1JPNA 3DM9B 3PMRA 2PX3A 1U0BB 2OEVA 2LP4A 4NCQA 4JIOA 3O55A 3B0VC 1LE4A 3U9MA 2IXMA 2B0JA 3E70C 5DS5A 3VRCA 3DXJF 1FFHA 1YZAA 2NUPA 1ZW2A 3RIPA 3GM1A 2DI3A 2FFHA 1NZEA 3CEXA 4MVQA 4XEFA 2EPMX 2A69F 4MVZA 5DVWA 1YARO 2IYLD 2YEVA 2ZXRA 4NTFA 4WJ0A 3RH3A 3W2VA 4BJ5C 5IY5C 2A6HF 2HV6A 2VCBA 5L3QA 3S28A 3SYNA 2HJ3A 3TJ6A 4IAOA 2YLIA 1WWPA 4KI2A 1D0XA 2OOCA 1EA8A 2HS5A 2Q00A 3IQ6A 4LLCA 3N0TA 4CS9A 1H9TA 1PD1A 2TMVP 4QI2A 2UUHA 3UGOA 4NC3A 2YRFA 3EGDA 1V4AA 2IM8A 2PBEA 3C8GB 3DZAA 4H54A 4XLPF 3IQTA 4EHPA 3PHF2 2JX0A 3A9CA 2EILC 2H7VC 1Z7Qc 4D4XA 5B3IA 3JCUQ 4RBNA 3JYHA 3ZC4A 2B0HA 1TFKB 2XXAA 1XWJA 2R7RA 4N6CA 4EKWA 2J8WA 4OIPF 2R7TA 3WHNA 3FXHA 4LDKA 1A7DA 1YAUO 3DE9A 3NRHA 4PR9A 3EFOB 4UDVA 1E84A 1K05A 3FMSA 4FESA 1LE2A 1EI7A 3GEEA 3K6BA 2BE5F 1LS4A 1QQ3A 2EPKX 4YL1A 3NMKA 1LIHA 4YN0B 1Z3IX 5A6BD 2QNLA 2P0NA 3UNGC 4DVZA 5JT4A 2VCCA 4AE4A 3QMKA 5KYWA 5D92A 3WAQA 1R4TA 1KNYA 1O5HA 3ASNC 1S05A 3EG9A 3NKEA 3ASOC 4J32B 4C3BA 2L6FA 5B3SC 2O9XA 4JVSA 3G50A 1Q0MA 2ETSA 5BQGA 3U5SA 2CDQA 2YWAA 3G4XA 2KNHA 1QZXA 2LQGA 2VASA 1RKEB 2R7UA 3NG1A 4MTGA 5KYYB 5HSWA 5JS5A 3H65A 1CGME 1AUEA 3B9QA 3MYFA 3RYLA 3EGXB 2Y3DA 3PCVA 2YHSA 3SEOA 4FWVA 4WABA 3Q7GA 4PFPA 3EHNA 5HV9A 1BR2A 4I44A 2J9BA 1NFOA 1TR2A 1M57C 1CPQA 1ZU5A 1T6QA 4Z9JA 3IHUA 1V74B 2R7OA 5E3AA 2LK4A 3EZHA 4CIHA 2Z15A 5E33A 4MTOA 3US6A 1LS1A 2X51A 1KTMA 3M4CA 3CAXA 2F22A 3M79A 1Z63A 2EINC 3B29A 1SF8A 4IAQA 1TWAA 3LNRA 4HFFB 3DI5A 4JZAA 1HE1A 3HNIA 1U6HA 4ZLCA 3KMIA 1RJ9B 2PX0A 4JEAA 4C3DA 5A6KA 5BUOA 3AOUA 2A6EF 2R02A 5L3VA 3DM5A 4JEBA 5KYUA 3GODA 4G0HA 3HKKA 2HMQA 3AG1C 1A41A 3W2WA 1EKYA 3PDMP 5COMA 4JTCB 2LFFA 3KL4A 4YWQA 1N1CA 2VH3A 3FOOA 3UMKA 1Q0GA 5KYXA 3S0XA 2YL0A 1GGQA 2MWQA 1OKKD 1Q0KA 2KC3A 2V26A 3WG7C 1I4ZA 1SMYF 2NUTA 5CI8A 2J9UA 3KYJA 1NFNA 1PV3A 4QI0A 3LNMB 1QPUA 3K33A 3DWWA 4J7YA 2LIGA 1TWCA 1TWHA 2W4MA 4DVYP 3V5YA 3NMIA 1ZHYA 4EIYA 1CGOA 4N06A 1NSGB 3CQZA 4YT4A 5L0DA 2HKVA 5AGFA 1D1BA 2UUIA 3AG2C 3JSEO 4IGGA 5E3CA 3HTKC 3JRTA 3QZCA 1QSPA 4BEJA 4FX5A 3F46A 4G7OF 3R2PA 3AQCA 4CS9C 2XLMA 4E7SA 4ONSA 4IRUA 4XPWA 3AG3C 4YT2A 3L1MA 2HV7A 4JTDB 4CS7A 3L8IA 2EPOA 4IJJA 1OW8A 4LDRA 3ZTZA 5L0HA 5A6AA 3RQFA 2HUJA 3RQEA 2OQMA 3U2LA 3GANA 3KPHA 2KK1A 4RD9A 3U0CA 1EQ1A 3QW1A 5AC4A 4XTKA 2P6VA 3ZG1A 2M4EA 2VC9A 1HW1A 3ABKC 3ITFA 2IXNA 3BEHA 3F47A 3RKOF 2EIJC 1T6UA 1WASA 2PF4E 1LKXA 4YL0A 1FTSA 2HZ8A 1VYKA 3MFNA 4EBJA 4CIPA 2L6HA 3UGPA 4Q5SF 4CDYA 4U5BE 1O3UA 4NY3A 3GORA 3SXYA 4IB4A 5EGYA 2Q7RA 2CYDA 3LJBA 5T3TA 2HSQA 1UG7A 2R7QA 1G4US 5E2QA 5GPGB 4OINF 2XM4A 4XLNF 3EH2A 3C62A 2H7OA 4PJNA 3MBGA 4O6MA 1PCXA 4EBKA 4U5EE 1M2OA 2L81A 4EBBA 1AEPA 2AP3A 2D4UA 3HNJA 1QKRA 4DRHB 1M2VB 2OEXA 1VTMP 2D5RB 2H8AA 3C7JA 3K1HA 3M1CB 3LUTB 3I5PA 3HNKA 1BZ4A 2L7AA 2Q4FA 4L6RA 4EUKB 2EIKC 4D4NA 2J7PD 3AQBA 3KYIA 1MMGA 1TFOB 2GA0A 2DYRC 4J7TA 2AWCA 5T3WA 3JT1A 3ZDLA 3S90A 3M15A 5F28E 2YLDA 2GWWA 2P1AA 2RSEB 2XS1A 4XQ1A 1YA7O 4JTAB 3OEOA 5DQZA 4WGYA 1RXQA 3C8ZA 4LLEA 3EPVA 2ZD9A 3GEHA 2Q9AA 3LEOA 2J9VA 1YDIA 4U5HA 3GWLA 2LCHA 4JC7A 2A0BA 5EK0A 2P7VA 4LERA 5DLJA 4E7ZA 4YL3A 3T6JA 1A0BA 3HNLA 4CBEA 4CJGA 2QTVA 4CDVA 3TK0A 4M63A 4BEMJ 2CNWD 3C8GA 4E17A 1OCOC 2R7WA 2R7VA 4MVOA 4XPYA 3TOLA 3ECSA 1HW2A 1NBBA 3JYYA 4Z9HA 1S7ZA 3FAPB 5EHHA 2OU6A 4MVSA 1MNEA 1FNTc 1D0ZA 3POVA 2ICWG 2EPNA 4I1MA 1DOVA 1G8XA 3RF3A 4FAPB 2C04A 2WB7A 2EIMC 3EFOA 3LEVA 1I5NA 1LVKA 4K7BA 1ORYA 2KJGA 1GS9A 3Q6MA 3TULA 4R32A 1V55C 1ORSC 3ATPA 4X0RA 5B1AC 3K66A 3TD7A 1T9KA 2JD3A 2Y3GA 3CZ6A 4Q4ZF 2XS8A 4JJFA 4ULWA 1K40A 4EWCA 2CCYA 1I4YA 4O7GA 5A69A 1F1MA 3UMIA 4DRJB 4OIRF 1WTYA 1KU2A 1RCPA 2GDCA 3TOMA 1C02A 1BDJB 3S9OA 2IOQA 3U3BA 3A11A 3L34A 1BR4A 2WZFA 1RKEA 1VMAA 1NG1A 2YKZA 5COFA 1JRAA 3B0PA 5KYYA 2R7XA 2BC5A 1VB5A 1XZPA 2QLAA 1Y6DA 2Y39A 3GM3A 2GFHA 3JTLO 1VYIA 4BJTA 3EGXA 3KKBA 2LFDA 1HY5A 2WZLA 4AL0A 1YVIA 3NKDA 2DGJA 3W4YA 1Q0FA 3RFYA 2XL8A 3U2MA 3MX3A 4HE8D 3DD7A 4XEVA 2E87A 1JR8A 5T1DB 1OW7A 3X1OA 4CDAA 1YLMA 4BG0A 3JRMO 3TQOA 1OW6A 1V54C 5A6JA 4PJLA 4LACB 5DS6A 2KGOA 4JW1A 3S84A 1APCA 4PACA 4PJJA 3O39A 3R7CA 4ANJA 2RD9A 1FFTC 1TQGA 1CPRA 3O6XA 1MQVA 2W45A 1J8YF 1TWGA 4QDLA 3UR3C 1SZIA 5L0CA 5JRAA 4KNVA 1PD0A 4MVUA 2A1DD 3TJ5A 4WGZA 5JUAA 4C7OB 2KQ9A 4GQHA 5F5FA 2R03A 1IZMA 3VAYA 4HFKB 2HSBA 4KBLA 1NLXA 2PFDA 3EZIA 4Z9IA 4GEHA 4ER9A 3S27A 3IQCA 5L0FA 4IWBA 2DB4A 4J30B 4O6YA 3FHDA 5CI9A 3VM6A 5FCLA 3B71A 3E9VA 1NU9C 2VB6A 3RVYA 1FMWA 4U5GA 4C3EA 1Z6AA 1SYQA 256BA 2BL2A 3U8PA 1OCZC 1ST6A 4A4AA 3FOPA 4G7HF 4AX2A 4HEAJ 4Q7CA 2WVQA 1OXBA 2GAQA 5JSLA 1NU7D 5L0GA 3RVZA 3K7DA 4MNDA 2KSFA 1JOGA 3GM2A 1H9GA 3NYMA 2WL8A 2XLVA 2XLHA 3K1IA 2NUPB 3DMDA 4LDQA 3SXMA 5KYNA 1LPEA 2WVOA 4NTAA 3UMHA 1H6GA 4B6IA 1BR1A 2CGEA 3N2ZB 4K0DA 5A6BA 1WN0A 2NSGA 1G5ZA 2R05A 2IXOA 1YYXA 4JKVA 3OWTA 2M64A 4XWJA 1G4WR 3VF0A 1Z5ZA 3NYLA 2Y3BA 3JSZA 1JMWA 1C03A 3NYJA 1ZW3A 5BQIA 3Q6NA 1QVXA 3ZQYA 3DAFA 3EGDB 4O6NA 2XRHA 1Y4CA 2IXPA 2XM0A 3AGTA 4N6HA 3IQ5A 3MYIA 1QLEC 1VK5A 3QW0A 4PK4A 1D1CA 3SNHA 3DAGA 4OD4A 5JVEA 3LESA 4GYTA 4I3MA 1D0YA 2YZSA 3V5XA 2G3KA 3ZQVA 2XXAB 2R7SA 2XLWA 1E85A 3EHMA 3HLZA 1OXKA 2ZPAA 2J45A 3ABMC 4K1OA 4P6IC 1ORJA 3O10A 1D1AA 1OR2A 5B1BC 5JP7A 4MS2A 3SZRA 5F5HA 1MMAA 3ZIBA 3ZTMA 5CIVA 4AL1A 4JE9A 4W8PA 3Q7LA 2LD6A 4YT5A 2P61A 2J46A 5L0IA 3HJCA 2Q9CA 1A7VA 1JPJA 2HFIA 3T6BA 3I5QA 3U3FA 2DYSC 4AK9A 2IBFA 4JJGA 2V3CC 2A0UA 2MHRA 4JURI 4AE4B 5KYWB 3T9OA 2KW3C 3RQGA 4RDAA 1K04A 2NSFA 3DE8A 2ZXOA 3EG9B 2R9RB 3EQLF 3OA1A 3IPMO 4NTBA 3ZWIA 2ZXPA 1TKNA 4KC9A 4U5DE 3RW0A 4E18A 1FMVA 2KYHA 3VYWA 2I15A 3M4BA 1M2VA 4JCZA 3V7OA 2ZXWC 3BRJA 4IARA 1J8MF 2LSEA 4O79A 2VCAA 2XLDA 3ZSUA 1H7IA 4PJMA 2G62A 2H7BA 1WATA 2PP4A 1L7CA 4MVRA 2X0CA 2NPUA 3W8HA 3QVYA 1OCRC 1BBHA 1T01A 1T5OA 2XSEA 3U9JA 1AVOB 3ZVRA 2YQYA 2J0WA 3EH1A 2YL3A 4CJOA 2XL4A 2FAPB 1B68A 1MMNA 1XZQA 1OKKA 2YL1A 2XLEA 3ABLC 4BJ5A 5DQTA 1VLSA 3FVYA 4DRIB 4U9DA 1W2WA 3LS1A 1HMDA 2L6GA 4E0IA 3LS0A 2Y3HA 3LAYA 2G3VA 3N24A 4DXWA 1IW7F 2Y69C 1RKCA 3JZ0A 3QTHA 2W4BA 2A68F 4YK5A 4YJWA 1HE9A 3FDQA 3I4UA 4P9FA 5K0IA 3AJMA 1HMOA 1MNDA 3J06A 1YYJA 1YZCA 3C63A 2OCCC 2OJQA 3DKAA 4CS8C 3LLKA 3H2VA 4U5CE 5COGA 1U89A 1ZHWA 4MQ9F 5KYUB 2R25A 3DJUB 2YL7A 2OJED
chains in the Genus database with same CATH topology
3B0UX 3AG4C 5KYXB 3T4RA 1Z23A 3SP1A 4CSAC 4OIOF 3NDBB 1VOMA 2NUTB 1MMDA 3WODF 4A2NB 3K1IC 4U5FE 2W9YA 3CSKA 1ZHTA 4ZLDA 3L0IA 2FGYA 4OIQF 3KH2A 2WZGA 5D91A 3W8IA 5DS4A 4BJ6C 4JCHA 1ZU4A 2QY9A 1RJ9A 4CS8A 3IEEA 4W8KA 4PFOA 2Q9BA 2C03A 4DOZA 3FAJA 2WVNA 4KNWA 1O87A 4I1OB 3X2QC 2J0XA 1OCCC 4DBQA 2J7PA 4BJ1A 3S29A 4F4BA 4CSAA 3EJNA 2L9JA 4OD5A 4DBRA 1M56C 2NG1A 4H4KC 1WGWA 4C7OA 2OG2A 2MYSA 3MLGA 4G7ZF 2I8BA 2Q3TA 3DJNB 1ZYRF 4BJ6A 2CW0F 2J9WA 1ZHZA 4YT8A 2CNWA 3LLIA 1ZHXA 1JPNA 3DM9B 3PMRA 2PX3A 3B0VC 2IXMA 2B0JA 3E70C 5DS5A 3DXJF 1FFHA 2NUPA 3RIPA 2FFHA 1NZEA 2A69F 5DVWA 2IYLD 2YEVA 2ZXRA 4WJ0A 3RH3A 3W2VA 5IY5C 4BJ5C 2A6HF 2HV6A 5L3QA 3S28A 3SYNA 4IAOA 4KI2A 1D0XA 4LLCA 3N0TA 4CS9A 4QI2A 1PD1A 3UGOA 3EGDA 3DZAA 4XLPF 3PHF2 2EILC 2H7VC 3JCUQ 4RBNA 3JYHA 3ZC4A 2XXAA 2R7RA 4OIPF 2R7TA 3NRHA 3EFOB 4FESA 3K6BA 2BE5F 4YN0B 1Z3IX 3UNGC 4DVZA 5KYWA 4AE4A 3QMKA 1O5HA 3ASNC 3EG9A 3NKEA 3ASOC 4J32B 4C3BA 5B3SC 2O9XA 4JVSA 2CDQA 2R7UA 2KNHA 1QZXA 2VASA 3NG1A 5KYYB 5HSWA 3H65A 3B9QA 3RYLA 3EGXB 2Y3DA 3SEOA 2YHSA 4FWVA 3Q7GA 4PFPA 3EHNA 1BR2A 4I44A 1TR2A 1M57C 1ZU5A 2R7OA 5E3AA 3EZHA 4CIHA 2Z15A 5E33A 1LS1A 2X51A 1Z63A 2EINC 1SF8A 1TWAA 3LNRA 4HFFB 4JZAA 4ZLCA 3KMIA 1RJ9B 2PX0A 4C3DA 5BUOA 2A6EF 5L3VA 3DM5A 5KYUA 3GODA 4G0HA 3W2WA 3AG1C 3KL4A 4YWQA 1N1CA 2VH3A 5KYXA 3UMKA 3S0XA 2MWQA 1OKKD 2V26A 3WG7C 1SMYF 2NUTA 5CI8A 2J9UA 4QI0A 3K33A 1TWCA 1TWHA 2W4MA 4DVYP 1ZHYA 4N06A 3CQZA 4YT4A 1D1BA 3AG2C 5E3CA 3HTKC 3JRTA 3QZCA 4BEJA 4FX5A 3F46A 4G7OF 3AQCA 4CS9C 4E7SA 4IRUA 4YT2A 3AG3C 2HV7A 4CS7A 4IJJA 3GANA 4RD9A 4XTKA 2P6VA 3ZG1A 2M4EA 3ABKC 3ITFA 2IXNA 3F47A 3RKOF 2EIJC 2PF4E 1LKXA 1FTSA 1VYKA 3UGPA 4Q5SF 4U5BE 4NY3A 5EGYA 3LJBA 5T3TA 4OINF 2R7QA 4XLNF 5E2QA 3EH2A 2H7OA 4PJNA 4O6MA 1PCXA 4U5EE 1M2OA 2L81A 4EBBA 1M2VB 2D5RB 2V3CC 3K1HA 3M1CB 3I5PA 2EIKC 2J7PD 3AQBA 1MMGA 2DYRC 5T3WA 3JT1A 3OEOA 5DQZA 4LLEA 3EPVA 2Q9AA 2J9VA 4U5HA 5DLJA 2P7VA 4LERA 4E7ZA 3T6JA 4CBEA 2QTVA 4M63A 2CNWD 2R7WA 1OCOC 2R7VA 3ECSA 1S7ZA 5EHHA 1MNEA 1D0ZA 3POVA 4I1MA 1G8XA 2C04A 2WB7A 2EIMC 3EFOA 3LEVA 1LVKA 4K7BA 2KJGA 3Q6MA 1V55C 4X0RA 5B1AC 3K66A 3TD7A 2JD3A 2Y3GA 3CZ6A 4Q4ZF 4JJFA 4ULWA 4EWCA 4O7GA 3UMIA 4OIRF 1KU2A 2IOQA 3L34A 1BR4A 2WZFA 1VMAA 1NG1A 5KYYA 3B0PA 2R7XA 2Y39A 2GFHA 1VYIA 4BJTA 3EGXA 3KKBA 2WZLA 3NKDA 2DGJA 3RFYA 3MX3A 4HE8D 3DD7A 2E87A 5T1DB 3X1OA 4BG0A 1V54C 4PJLA 4LACB 5DS6A 2KGOA 4JW1A 4PJJA 3O39A 4ANJA 3O6XA 1FFTC 4QDLA 2W45A 1J8YF 1TWGA 3UR3C 1SZIA 4KNVA 1PD0A 2A1DD 4C7OB 2KQ9A 5F5FA 1IZMA 3VAYA 4HFKB 4KBLA 2PFDA 3EZIA 4GEHA 3S27A 4IWBA 4J30B 5CI9A 4O6YA 3FHDA 5FCLA 3E9VA 1NU9C 2VB6A 1FMWA 4U5GA 4C3EA 1Z6AA 1OCZC 1ST6A 4G7HF 4AX2A 4HEAJ 4Q7CA 2WVQA 1NU7D 3K7DA 4MNDA 3NYMA 2WL8A 5KYNA 2NUPB 3DMDA 2WVOA 3UMHA 4B6IA 1BR1A 2CGEA 3N2ZB 4K0DA 2IXOA 3OWTA 4XWJA 1Z5ZA 3NYLA 2Y3BA 3JSZA 3NYJA 3Q6NA 3DAFA 3EGDB 4O6NA 2XRHA 2IXPA 1QLEC 1VK5A 4PK4A 1D1CA 3SNHA 3DAGA 4OD4A 3LESA 4GYTA 4I3MA 1D0YA 2YZSA 2XXAB 2G3KA 2R7SA 3EHMA 3HLZA 4P6IC 2ZPAA 2J45A 3ABMC 3SZRA 3ZIBA 1D1AA 5B1BC 5F5HA 1MMAA 4YT5A 3Q7LA 2J46A 3HJCA 2Q9CA 3T6BA 1JPJA 3I5QA 2DYSC 4AK9A 4JJGA 5KYWB 4JURI 4AE4B 2KW3C 4RDAA 5D92A 3EQLF 2ZXOA 3EG9B 3OA1A 2ZXPA 1TKNA 4KC9A 4U5DE 1FMVA 3VYWA 1M2VA 3V7OA 2ZXWC 1J8MF 2LSEA 4O79A 3ZSUA 4PJMA 2G62A 2H7BA 2PP4A 3W8HA 1OCRC 2XSEA 3ZVRA 2J0WA 3EH1A 2XL4A 1MMNA 3ABLC 1OKKA 5DQTA 4BJ5A 3FVYA 1W2WA 3LS1A 3LS0A 2Y3HA 3LAYA 2G3VA 3N24A 1IW7F 2Y69C 2W4BA 2A68F 4YJWA 3FDQA 3I4UA 1MNDA 2OCCC 4CS8C 3LLKA 4U5CE 1ZHWA 5KYUB 3DJUB 4MQ9F
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CS9 C;  4CSA A;  4CSA C;  4C3D A;  2L9J A;  4C3E A;  4C3B A;  4CS7 A;  4CS8 A;  4CS9 A;  4CS8 C; 
#chains in the Genus database with same CATH topology
 1GQA A;  3B0U X;  1Q0D A;  3AG4 C;  5KYX B;  4JRZ A;  3T4R A;  3V5Z A;  4NQF A;  1ZVZ A;  1Z23 A;  3SP1 A;  2OKU A;  4CSA C;  4OIO F;  3NDB B;  3T6G B;  1VOM A;  2NUT B;  1LI5 A;  1MMD A;  3U8V A;  1R5I D;  3WOD F;  3K1I C;  4A2N B;  4U5F E;  2W9Y A;  3CSK A;  1ZHT A;  4ZLD A;  1OQC A;  3L0I A;  1FR0 A;  3SXZ A;  2FGY A;  4OIQ F;  3KH2 A;  1RMV A;  2AU5 A;  2WZG A;  3C8G D;  2HMZ A;  3H2U A;  5D91 A;  1GM5 A;  1C17 M;  2QE9 A;  4MVM A;  2HJM A;  3W8I A;  5DS4 A;  4BJ6 C;  2YLG A;  2XL6 A;  2XLO A;  3C18 A;  4JCH A;  4N4W A;  1ZU4 A;  2QY9 A;  3L8J A;  2EPL X;  3NMJ A;  1E86 A;  1RJ9 A;  4MTF A;  4CX9 A;  4CS8 A;  3IEE A;  4W8K A;  4PFO A;  2Q9B A;  1T6I A;  2C03 A;  4BPM A;  3FAJ A;  4DOZ A;  1YA9 A;  1SR2 A;  2ASR A;  2WVN A;  4G78 A;  2QUP A;  3SXK A;  4XPX A;  4KNW A;  1O87 A;  1ZZP A;  4I1O B;  3X2Q C;  1E83 A;  1A7E A;  2J0X A;  1OCC C;  1L3P A;  1UFB A;  4DBQ A;  2J7P A;  4BJ1 A;  1YJG A;  3QVZ A;  4MW3 A;  2YVK A;  4P9T A;  1LM3 B;  2JPU A;  2AVK A;  3S29 A;  4F4B A;  5JLI A;  4CSA A;  1JAF A;  3EJN A;  2L9J A;  2AWY A;  4OD5 A;  4DBR A;  1M56 C;  1CGN A;  2NG1 A;  3G4Z A;  4H4K C;  1WGW A;  1E2X A;  4C7O A;  3AGU A;  1LI7 A;  5FZT A;  2OG2 A;  2MYS A;  4DJ9 A;  5AC5 A;  3MLG A;  5L0J A;  4U9E A;  4G7Z F;  2I8B A;  5TJ5 E;  2Q3T A;  1FAP B;  3DJN B;  1ZYR F;  3GWN A;  4BJ6 A;  2CW0 F;  2J9W A;  4ULV A;  1VLT A;  1M6T A;  1WOL A;  3GEI A;  2PNO A;  1DOW A;  1ZHZ A;  2CNW A;  4XEK A;  4YT8 A;  5BQH A;  3LLI A;  1ZHX A;  4MW8 A;  4E0H A;  1OR3 A;  1JPN A;  3DM9 B;  3PMR A;  2PX3 A;  1U0B B;  2OEV A;  2LP4 A;  4NCQ A;  4JIO A;  3O55 A;  3B0V C;  1LE4 A;  3U9M A;  2IXM A;  2B0J A;  3E70 C;  5DS5 A;  3VRC A;  3DXJ F;  1FFH A;  1YZA A;  2NUP A;  1ZW2 A;  3RIP A;  3GM1 A;  2DI3 A;  2FFH A;  1NZE A;  3CEX A;  4MVQ A;  4XEF A;  2EPM X;  2A69 F;  4MVZ A;  5DVW A;  1YAR O;  2IYL D;  2YEV A;  2ZXR A;  4NTF A;  4WJ0 A;  3RH3 A;  3W2V A;  4BJ5 C;  5IY5 C;  2A6H F;  2HV6 A;  2VCB A;  5L3Q A;  3S28 A;  3SYN A;  2HJ3 A;  3TJ6 A;  4IAO A;  2YLI A;  1WWP A;  4KI2 A;  1D0X A;  2OOC A;  1EA8 A;  2HS5 A;  2Q00 A;  3IQ6 A;  4LLC A;  3N0T A;  4CS9 A;  1H9T A;  1PD1 A;  2TMV P;  4QI2 A;  2UUH A;  3UGO A;  4NC3 A;  2YRF A;  3EGD A;  1V4A A;  2IM8 A;  2PBE A;  3C8G B;  3DZA A;  4H54 A;  4XLP F;  3IQT A;  4EHP A;  3PHF 2;  2JX0 A;  3A9C A;  2EIL C;  2H7V C;  1Z7Q c;  4D4X A;  5B3I A;  3JCU Q;  4RBN A;  3JYH A;  3ZC4 A;  2B0H A;  1TFK B;  2XXA A;  1XWJ A;  2R7R A;  4N6C A;  4EKW A;  2J8W A;  4OIP F;  2R7T A;  3WHN A;  3FXH A;  4LDK A;  1A7D A;  1YAU O;  3DE9 A;  3NRH A;  4PR9 A;  3EFO B;  4UDV A;  1E84 A;  1K05 A;  3FMS A;  4FES A;  1LE2 A;  1EI7 A;  3GEE A;  3K6B A;  2BE5 F;  1LS4 A;  1QQ3 A;  2EPK X;  4YL1 A;  3NMK A;  1LIH A;  4YN0 B;  1Z3I X;  5A6B D;  2QNL A;  2P0N A;  3UNG C;  4DVZ A;  5JT4 A;  2VCC A;  4AE4 A;  3QMK A;  5KYW A;  5D92 A;  3WAQ A;  1R4T A;  1KNY A;  1O5H A;  3ASN C;  1S05 A;  3EG9 A;  3NKE A;  3ASO C;  4J32 B;  4C3B A;  2L6F A;  5B3S C;  2O9X A;  4JVS A;  3G50 A;  1Q0M A;  2ETS A;  5BQG A;  3U5S A;  2CDQ A;  2YWA A;  3G4X A;  2KNH A;  1QZX A;  2LQG A;  2VAS A;  1RKE B;  2R7U A;  3NG1 A;  4MTG A;  5KYY B;  5HSW A;  5JS5 A;  3H65 A;  1CGM E;  1AUE A;  3B9Q A;  3MYF A;  3RYL A;  3EGX B;  2Y3D A;  3PCV A;  2YHS A;  3SEO A;  4FWV A;  4WAB A;  3Q7G A;  4PFP A;  3EHN A;  5HV9 A;  1BR2 A;  4I44 A;  2J9B A;  1NFO A;  1TR2 A;  1M57 C;  1CPQ A;  1ZU5 A;  1T6Q A;  4Z9J A;  3IHU A;  1V74 B;  2R7O A;  5E3A A;  2LK4 A;  3EZH A;  4CIH A;  2Z15 A;  5E33 A;  4MTO A;  3US6 A;  1LS1 A;  2X51 A;  1KTM A;  3M4C A;  3CAX A;  2F22 A;  3M79 A;  1Z63 A;  2EIN C;  3B29 A;  1SF8 A;  4IAQ A;  1TWA A;  3LNR A;  4HFF B;  3DI5 A;  4JZA A;  1HE1 A;  3HNI A;  1U6H A;  4ZLC A;  3KMI A;  1RJ9 B;  2PX0 A;  4JEA A;  4C3D A;  5A6K A;  5BUO A;  3AOU A;  2A6E F;  2R02 A;  5L3V A;  3DM5 A;  4JEB A;  5KYU A;  3GOD A;  4G0H A;  3HKK A;  2HMQ A;  3AG1 C;  1A41 A;  3W2W A;  1EKY A;  3PDM P;  5COM A;  4JTC B;  2LFF A;  3KL4 A;  4YWQ A;  1N1C A;  2VH3 A;  3FOO A;  3UMK A;  1Q0G A;  5KYX A;  3S0X A;  2YL0 A;  1GGQ A;  2MWQ A;  1OKK D;  1Q0K A;  2KC3 A;  2V26 A;  3WG7 C;  1I4Z A;  1SMY F;  2NUT A;  5CI8 A;  2J9U A;  3KYJ A;  1NFN A;  1PV3 A;  4QI0 A;  3LNM B;  1QPU A;  3K33 A;  3DWW A;  4J7Y A;  2LIG A;  1TWC A;  1TWH A;  2W4M A;  4DVY P;  3V5Y A;  3NMI A;  1ZHY A;  4EIY A;  1CGO A;  4N06 A;  1NSG B;  3CQZ A;  4YT4 A;  5L0D A;  2HKV A;  5AGF A;  1D1B A;  2UUI A;  3AG2 C;  3JSE O;  4IGG A;  5E3C A;  3HTK C;  3JRT A;  3QZC A;  1QSP A;  4BEJ A;  4FX5 A;  3F46 A;  4G7O F;  3R2P A;  3AQC A;  4CS9 C;  2XLM A;  4E7S A;  4ONS A;  4IRU A;  4XPW A;  3AG3 C;  4YT2 A;  3L1M A;  2HV7 A;  4JTD B;  4CS7 A;  3L8I A;  2EPO A;  4IJJ A;  1OW8 A;  4LDR A;  3ZTZ A;  5L0H A;  5A6A A;  3RQF A;  2HUJ A;  3RQE A;  2OQM A;  3U2L A;  3GAN A;  3KPH A;  2KK1 A;  4RD9 A;  3U0C A;  1EQ1 A;  3QW1 A;  5AC4 A;  4XTK A;  2P6V A;  3ZG1 A;  2M4E A;  2VC9 A;  1HW1 A;  3ABK C;  3ITF A;  2IXN A;  3BEH A;  3F47 A;  3RKO F;  2EIJ C;  1T6U A;  1WAS A;  2PF4 E;  1LKX A;  4YL0 A;  1FTS A;  2HZ8 A;  1VYK A;  3MFN A;  4EBJ A;  4CIP A;  2L6H A;  3UGP A;  4Q5S F;  4CDY A;  4U5B E;  1O3U A;  4NY3 A;  3GOR A;  3SXY A;  4IB4 A;  5EGY A;  2Q7R A;  2CYD A;  3LJB A;  5T3T A;  2HSQ A;  1UG7 A;  2R7Q A;  1G4U S;  5E2Q A;  5GPG B;  4OIN F;  2XM4 A;  4XLN F;  3EH2 A;  3C62 A;  2H7O A;  4PJN A;  3MBG A;  4O6M A;  1PCX A;  4EBK A;  4U5E E;  1M2O A;  2L81 A;  4EBB A;  1AEP A;  2AP3 A;  2D4U A;  3HNJ A;  1QKR A;  4DRH B;  1M2V B;  2OEX A;  1VTM P;  2D5R B;  2H8A A;  3C7J A;  3K1H A;  3M1C B;  3LUT B;  3I5P A;  3HNK A;  1BZ4 A;  2L7A A;  2Q4F A;  4L6R A;  4EUK B;  2EIK C;  4D4N A;  2J7P D;  3AQB A;  3KYI A;  1MMG A;  1TFO B;  2GA0 A;  2DYR C;  4J7T A;  2AWC A;  5T3W A;  3JT1 A;  3ZDL A;  3S90 A;  3M15 A;  5F28 E;  2YLD A;  2GWW A;  2P1A A;  2RSE B;  2XS1 A;  4XQ1 A;  1YA7 O;  4JTA B;  3OEO A;  5DQZ A;  4WGY A;  1RXQ A;  3C8Z A;  4LLE A;  3EPV A;  2ZD9 A;  3GEH A;  2Q9A A;  3LEO A;  2J9V A;  1YDI A;  4U5H A;  3GWL A;  2LCH A;  4JC7 A;  2A0B A;  5EK0 A;  2P7V A;  4LER A;  5DLJ A;  4E7Z A;  4YL3 A;  3T6J A;  1A0B A;  3HNL A;  4CBE A;  4CJG A;  2QTV A;  4CDV A;  3TK0 A;  4M63 A;  4BEM J;  2CNW D;  3C8G A;  4E17 A;  1OCO C;  2R7W A;  2R7V A;  4MVO A;  4XPY A;  3TOL A;  3ECS A;  1HW2 A;  1NBB A;  3JYY A;  4Z9H A;  1S7Z A;  3FAP B;  5EHH A;  2OU6 A;  4MVS A;  1MNE A;  1FNT c;  1D0Z A;  3POV A;  2ICW G;  2EPN A;  4I1M A;  1DOV A;  1G8X A;  3RF3 A;  4FAP B;  2C04 A;  2WB7 A;  2EIM C;  3EFO A;  3LEV A;  1I5N A;  1LVK A;  4K7B A;  1ORY A;  2KJG A;  1GS9 A;  3Q6M A;  3TUL A;  4R32 A;  1V55 C;  1ORS C;  3ATP A;  4X0R A;  5B1A C;  3K66 A;  3TD7 A;  1T9K A;  2JD3 A;  2Y3G A;  3CZ6 A;  4Q4Z F;  2XS8 A;  4JJF A;  4ULW A;  1K40 A;  4EWC A;  2CCY A;  1I4Y A;  4O7G A;  5A69 A;  1F1M A;  3UMI A;  4DRJ B;  4OIR F;  1WTY A;  1KU2 A;  1RCP A;  2GDC A;  3TOM A;  1C02 A;  1BDJ B;  3S9O A;  2IOQ A;  3U3B A;  3A11 A;  3L34 A;  1BR4 A;  2WZF A;  1RKE A;  1VMA A;  1NG1 A;  2YKZ A;  5COF A;  1JRA A;  3B0P A;  5KYY A;  2R7X A;  2BC5 A;  1VB5 A;  1XZP A;  2QLA A;  1Y6D A;  2Y39 A;  3GM3 A;  2GFH A;  3JTL O;  1VYI A;  4BJT A;  3EGX A;  3KKB A;  2LFD A;  1HY5 A;  2WZL A;  4AL0 A;  1YVI A;  3NKD A;  2DGJ A;  3W4Y A;  1Q0F A;  3RFY A;  2XL8 A;  3U2M A;  3MX3 A;  4HE8 D;  3DD7 A;  4XEV A;  2E87 A;  1JR8 A;  5T1D B;  1OW7 A;  3X1O A;  4CDA A;  1YLM A;  4BG0 A;  3JRM O;  3TQO A;  1OW6 A;  1V54 C;  5A6J A;  4PJL A;  4LAC B;  5DS6 A;  2KGO A;  4JW1 A;  3S84 A;  1APC A;  4PAC A;  4PJJ A;  3O39 A;  3R7C A;  4ANJ A;  2RD9 A;  1FFT C;  1TQG A;  1CPR A;  3O6X A;  1MQV A;  2W45 A;  1J8Y F;  1TWG A;  4QDL A;  3UR3 C;  1SZI A;  5L0C A;  5JRA A;  4KNV A;  1PD0 A;  4MVU A;  2A1D D;  3TJ5 A;  4WGZ A;  5JUA A;  4C7O B;  2KQ9 A;  4GQH A;  5F5F A;  2R03 A;  1IZM A;  3VAY A;  4HFK B;  2HSB A;  4KBL A;  1NLX A;  2PFD A;  3EZI A;  4Z9I A;  4GEH A;  4ER9 A;  3S27 A;  3IQC A;  5L0F A;  4IWB A;  2DB4 A;  4J30 B;  4O6Y A;  3FHD A;  5CI9 A;  3VM6 A;  5FCL A;  3B71 A;  3E9V A;  1NU9 C;  2VB6 A;  3RVY A;  1FMW A;  4U5G A;  4C3E A;  1Z6A A;  1SYQ A;  256B A;  2BL2 A;  3U8P A;  1OCZ C;  1ST6 A;  4A4A A;  3FOP A;  4G7H F;  4AX2 A;  4HEA J;  4Q7C A;  2WVQ A;  1OXB A;  2GAQ A;  5JSL A;  1NU7 D;  5L0G A;  3RVZ A;  3K7D A;  4MND A;  2KSF A;  1JOG A;  3GM2 A;  1H9G A;  3NYM A;  2WL8 A;  2XLV A;  2XLH A;  3K1I A;  2NUP B;  3DMD A;  4LDQ A;  3SXM A;  5KYN A;  1LPE A;  2WVO A;  4NTA A;  3UMH A;  1H6G A;  4B6I A;  1BR1 A;  2CGE A;  3N2Z B;  4K0D A;  5A6B A;  1WN0 A;  2NSG A;  1G5Z A;  2R05 A;  2IXO A;  1YYX A;  4JKV A;  3OWT A;  2M64 A;  4XWJ A;  1G4W R;  3VF0 A;  1Z5Z A;  3NYL A;  2Y3B A;  3JSZ A;  1JMW A;  1C03 A;  3NYJ A;  1ZW3 A;  5BQI A;  3Q6N A;  1QVX A;  3ZQY A;  3DAF A;  3EGD B;  4O6N A;  2XRH A;  1Y4C A;  2IXP A;  2XM0 A;  3AGT A;  4N6H A;  3IQ5 A;  3MYI A;  1QLE C;  1VK5 A;  3QW0 A;  4PK4 A;  1D1C A;  3SNH A;  3DAG A;  4OD4 A;  5JVE A;  3LES A;  4GYT A;  4I3M A;  1D0Y A;  2YZS A;  3V5X A;  2G3K A;  3ZQV A;  2XXA B;  2R7S A;  2XLW A;  1E85 A;  3EHM A;  3HLZ A;  1OXK A;  2ZPA A;  2J45 A;  3ABM C;  4K1O A;  4P6I C;  1ORJ A;  3O10 A;  1D1A A;  1OR2 A;  5B1B C;  5JP7 A;  4MS2 A;  3SZR A;  5F5H A;  1MMA A;  3ZIB A;  3ZTM A;  5CIV A;  4AL1 A;  4JE9 A;  4W8P A;  3Q7L A;  2LD6 A;  4YT5 A;  2P61 A;  2J46 A;  5L0I A;  3HJC A;  2Q9C A;  1A7V A;  1JPJ A;  2HFI A;  3T6B A;  3I5Q A;  3U3F A;  2DYS C;  4AK9 A;  2IBF A;  4JJG A;  2V3C C;  2A0U A;  2MHR A;  4JUR I;  4AE4 B;  5KYW B;  3T9O A;  2KW3 C;  3RQG A;  4RDA A;  1K04 A;  2NSF A;  3DE8 A;  2ZXO A;  3EG9 B;  2R9R B;  3EQL F;  3OA1 A;  3IPM O;  4NTB A;  3ZWI A;  2ZXP A;  1TKN A;  4KC9 A;  4U5D E;  3RW0 A;  4E18 A;  1FMV A;  2KYH A;  3VYW A;  2I15 A;  3M4B A;  1M2V A;  4JCZ A;  3V7O A;  2ZXW C;  3BRJ A;  4IAR A;  1J8M F;  2LSE A;  4O79 A;  2VCA A;  2XLD A;  3ZSU A;  1H7I A;  4PJM A;  2G62 A;  2H7B A;  1WAT A;  2PP4 A;  1L7C A;  4MVR A;  2X0C A;  2NPU A;  3W8H A;  3QVY A;  1OCR C;  1BBH A;  1T01 A;  1T5O A;  2XSE A;  3U9J A;  1AVO B;  3ZVR A;  2YQY A;  2J0W A;  3EH1 A;  2YL3 A;  4CJO A;  2XL4 A;  2FAP B;  1B68 A;  1MMN A;  1XZQ A;  1OKK A;  2YL1 A;  2XLE A;  3ABL C;  4BJ5 A;  5DQT A;  1VLS A;  3FVY A;  4DRI B;  4U9D A;  1W2W A;  3LS1 A;  1HMD A;  2L6G A;  4E0I A;  3LS0 A;  2Y3H A;  3LAY A;  2G3V A;  3N24 A;  4DXW A;  1IW7 F;  2Y69 C;  1RKC A;  3JZ0 A;  3QTH A;  2W4B A;  2A68 F;  4YK5 A;  4YJW A;  1HE9 A;  3FDQ A;  3I4U A;  4P9F A;  5K0I A;  3AJM A;  1HMO A;  1MND A;  3J06 A;  1YYJ A;  1YZC A;  3C63 A;  2OCC C;  2OJQ A;  3DKA A;  4CS8 C;  3LLK A;  3H2V A;  4U5C E;  5COG A;  1U89 A;  1ZHW A;  4MQ9 F;  5KYU B;  2R25 A;  3DJU B;  2YL7 A;  2OJE D; 
#chains in the Genus database with same CATH homology
 3B0U X;  3AG4 C;  5KYX B;  3T4R A;  1Z23 A;  3SP1 A;  4CSA C;  4OIO F;  3NDB B;  1VOM A;  2NUT B;  1MMD A;  3WOD F;  4A2N B;  3K1I C;  4U5F E;  2W9Y A;  3CSK A;  1ZHT A;  4ZLD A;  3L0I A;  2FGY A;  4OIQ F;  3KH2 A;  2WZG A;  5D91 A;  3W8I A;  5DS4 A;  4BJ6 C;  4JCH A;  1ZU4 A;  2QY9 A;  1RJ9 A;  4CS8 A;  3IEE A;  4W8K A;  4PFO A;  2Q9B A;  2C03 A;  4DOZ A;  3FAJ A;  2WVN A;  4KNW A;  1O87 A;  4I1O B;  3X2Q C;  2J0X A;  1OCC C;  4DBQ A;  2J7P A;  4BJ1 A;  3S29 A;  4F4B A;  4CSA A;  3EJN A;  2L9J A;  4OD5 A;  4DBR A;  1M56 C;  2NG1 A;  4H4K C;  1WGW A;  4C7O A;  2OG2 A;  2MYS A;  3MLG A;  4G7Z F;  2I8B A;  2Q3T A;  3DJN B;  1ZYR F;  4BJ6 A;  2CW0 F;  2J9W A;  1ZHZ A;  4YT8 A;  2CNW A;  3LLI A;  1ZHX A;  1JPN A;  3DM9 B;  3PMR A;  2PX3 A;  3B0V C;  2IXM A;  2B0J A;  3E70 C;  5DS5 A;  3DXJ F;  1FFH A;  2NUP A;  3RIP A;  2FFH A;  1NZE A;  2A69 F;  5DVW A;  2IYL D;  2YEV A;  2ZXR A;  4WJ0 A;  3RH3 A;  3W2V A;  5IY5 C;  4BJ5 C;  2A6H F;  2HV6 A;  5L3Q A;  3S28 A;  3SYN A;  4IAO A;  4KI2 A;  1D0X A;  4LLC A;  3N0T A;  4CS9 A;  4QI2 A;  1PD1 A;  3UGO A;  3EGD A;  3DZA A;  4XLP F;  3PHF 2;  2EIL C;  2H7V C;  3JCU Q;  4RBN A;  3JYH A;  3ZC4 A;  2XXA A;  2R7R A;  4OIP F;  2R7T A;  3NRH A;  3EFO B;  4FES A;  3K6B A;  2BE5 F;  4YN0 B;  1Z3I X;  3UNG C;  4DVZ A;  5KYW A;  4AE4 A;  3QMK A;  1O5H A;  3ASN C;  3EG9 A;  3NKE A;  3ASO C;  4J32 B;  4C3B A;  5B3S C;  2O9X A;  4JVS A;  2CDQ A;  2R7U A;  2KNH A;  1QZX A;  2VAS A;  3NG1 A;  5KYY B;  5HSW A;  3H65 A;  3B9Q A;  3RYL A;  3EGX B;  2Y3D A;  3SEO A;  2YHS A;  4FWV A;  3Q7G A;  4PFP A;  3EHN A;  1BR2 A;  4I44 A;  1TR2 A;  1M57 C;  1ZU5 A;  2R7O A;  5E3A A;  3EZH A;  4CIH A;  2Z15 A;  5E33 A;  1LS1 A;  2X51 A;  1Z63 A;  2EIN C;  1SF8 A;  1TWA A;  3LNR A;  4HFF B;  4JZA A;  4ZLC A;  3KMI A;  1RJ9 B;  2PX0 A;  4C3D A;  5BUO A;  2A6E F;  5L3V A;  3DM5 A;  5KYU A;  3GOD A;  4G0H A;  3W2W A;  3AG1 C;  3KL4 A;  4YWQ A;  1N1C A;  2VH3 A;  5KYX A;  3UMK A;  3S0X A;  2MWQ A;  1OKK D;  2V26 A;  3WG7 C;  1SMY F;  2NUT A;  5CI8 A;  2J9U A;  4QI0 A;  3K33 A;  1TWC A;  1TWH A;  2W4M A;  4DVY P;  1ZHY A;  4N06 A;  3CQZ A;  4YT4 A;  1D1B A;  3AG2 C;  5E3C A;  3HTK C;  3JRT A;  3QZC A;  4BEJ A;  4FX5 A;  3F46 A;  4G7O F;  3AQC A;  4CS9 C;  4E7S A;  4IRU A;  4YT2 A;  3AG3 C;  2HV7 A;  4CS7 A;  4IJJ A;  3GAN A;  4RD9 A;  4XTK A;  2P6V A;  3ZG1 A;  2M4E A;  3ABK C;  3ITF A;  2IXN A;  3F47 A;  3RKO F;  2EIJ C;  2PF4 E;  1LKX A;  1FTS A;  1VYK A;  3UGP A;  4Q5S F;  4U5B E;  4NY3 A;  5EGY A;  3LJB A;  5T3T A;  4OIN F;  2R7Q A;  4XLN F;  5E2Q A;  3EH2 A;  2H7O A;  4PJN A;  4O6M A;  1PCX A;  4U5E E;  1M2O A;  2L81 A;  4EBB A;  1M2V B;  2D5R B;  2V3C C;  3K1H A;  3M1C B;  3I5P A;  2EIK C;  2J7P D;  3AQB A;  1MMG A;  2DYR C;  5T3W A;  3JT1 A;  3OEO A;  5DQZ A;  4LLE A;  3EPV A;  2Q9A A;  2J9V A;  4U5H A;  5DLJ A;  2P7V A;  4LER A;  4E7Z A;  3T6J A;  4CBE A;  2QTV A;  4M63 A;  2CNW D;  2R7W A;  1OCO C;  2R7V A;  3ECS A;  1S7Z A;  5EHH A;  1MNE A;  1D0Z A;  3POV A;  4I1M A;  1G8X A;  2C04 A;  2WB7 A;  2EIM C;  3EFO A;  3LEV A;  1LVK A;  4K7B A;  2KJG A;  3Q6M A;  1V55 C;  4X0R A;  5B1A C;  3K66 A;  3TD7 A;  2JD3 A;  2Y3G A;  3CZ6 A;  4Q4Z F;  4JJF A;  4ULW A;  4EWC A;  4O7G A;  3UMI A;  4OIR F;  1KU2 A;  2IOQ A;  3L34 A;  1BR4 A;  2WZF A;  1VMA A;  1NG1 A;  5KYY A;  3B0P A;  2R7X A;  2Y39 A;  2GFH A;  1VYI A;  4BJT A;  3EGX A;  3KKB A;  2WZL A;  3NKD A;  2DGJ A;  3RFY A;  3MX3 A;  4HE8 D;  3DD7 A;  2E87 A;  5T1D B;  3X1O A;  4BG0 A;  1V54 C;  4PJL A;  4LAC B;  5DS6 A;  2KGO A;  4JW1 A;  4PJJ A;  3O39 A;  4ANJ A;  3O6X A;  1FFT C;  4QDL A;  2W45 A;  1J8Y F;  1TWG A;  3UR3 C;  1SZI A;  4KNV A;  1PD0 A;  2A1D D;  4C7O B;  2KQ9 A;  5F5F A;  1IZM A;  3VAY A;  4HFK B;  4KBL A;  2PFD A;  3EZI A;  4GEH A;  3S27 A;  4IWB A;  4J30 B;  5CI9 A;  4O6Y A;  3FHD A;  5FCL A;  3E9V A;  1NU9 C;  2VB6 A;  1FMW A;  4U5G A;  4C3E A;  1Z6A A;  1OCZ C;  1ST6 A;  4G7H F;  4AX2 A;  4HEA J;  4Q7C A;  2WVQ A;  1NU7 D;  3K7D A;  4MND A;  3NYM A;  2WL8 A;  5KYN A;  2NUP B;  3DMD A;  2WVO A;  3UMH A;  4B6I A;  1BR1 A;  2CGE A;  3N2Z B;  4K0D A;  2IXO A;  3OWT A;  4XWJ A;  1Z5Z A;  3NYL A;  2Y3B A;  3JSZ A;  3NYJ A;  3Q6N A;  3DAF A;  3EGD B;  4O6N A;  2XRH A;  2IXP A;  1QLE C;  1VK5 A;  4PK4 A;  1D1C A;  3SNH A;  3DAG A;  4OD4 A;  3LES A;  4GYT A;  4I3M A;  1D0Y A;  2YZS A;  2XXA B;  2G3K A;  2R7S A;  3EHM A;  3HLZ A;  4P6I C;  2ZPA A;  2J45 A;  3ABM C;  3SZR A;  3ZIB A;  1D1A A;  5B1B C;  5F5H A;  1MMA A;  4YT5 A;  3Q7L A;  2J46 A;  3HJC A;  2Q9C A;  3T6B A;  1JPJ A;  3I5Q A;  2DYS C;  4AK9 A;  4JJG A;  5KYW B;  4JUR I;  4AE4 B;  2KW3 C;  4RDA A;  5D92 A;  3EQL F;  2ZXO A;  3EG9 B;  3OA1 A;  2ZXP A;  1TKN A;  4KC9 A;  4U5D E;  1FMV A;  3VYW A;  1M2V A;  3V7O A;  2ZXW C;  1J8M F;  2LSE A;  4O79 A;  3ZSU A;  4PJM A;  2G62 A;  2H7B A;  2PP4 A;  3W8H A;  1OCR C;  2XSE A;  3ZVR A;  2J0W A;  3EH1 A;  2XL4 A;  1MMN A;  3ABL C;  1OKK A;  5DQT A;  4BJ5 A;  3FVY A;  1W2W A;  3LS1 A;  3LS0 A;  2Y3H A;  3LAY A;  2G3V A;  3N24 A;  1IW7 F;  2Y69 C;  2W4B A;  2A68 F;  4YJW A;  3FDQ A;  3I4U A;  1MND A;  2OCC C;  4CS8 C;  3LLK A;  4U5C E;  1ZHW A;  5KYU B;  3DJU B;  4MQ9 F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...