4C3EA

Hrsv m2-1 mutant s58d s61d, p21 crystal
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
177
structure length
172
Chain Sequence
b'LGSMSRRNPCKFEIRGHCLNGKRCHFSHNYFEWPPHALLVRQNFMLNRILKSMDLDEIDGAAELDRTEEYALGVVGVLESYIGSINNITKQSACVAMSKLLTELNSDDIKKLRDNEELNSPKIRVYNTVISYIESNRKNNKQTIHLLKRLPADVLKKTIKNTLDIHKSITIN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MATRIX M2-1
publication title Crystal Structure of the Essential Transcription Antiterminator M2-1 Protein of Human Respiratory Syncytial Virus and Implications of its Phosphorylation.
pubmed doi rcsb
source organism Human respiratory syncytial virus
molecule tags Viral protein
total genus 58
structure length 172
sequence length 177
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P
ec nomenclature
pdb deposition date 2013-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06436 Pneumovirus_M2 Pneumovirus matrix protein 2 (M2)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1350 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4c3eA00
2L9JA 4C3BA 4C3EA 4CS7A 4CSAC 4CSAA 4CS9C 4CS9A 4CS8C 4CS8A 4C3DA
chains in the Genus database with same CATH superfamily
4OIQF 2H8AA 5BQGA 3JRTA 5KYNA 2KYHA 2PX3A 2Q4FA 3ABMC 4KI2A 4KC9A 4MW8A 5JP7A 2PF4E 3JRMO 4KNVA 4C7OB 3SP1A 3T6BA 1QLEC 2OKUA 2YL0A 1HY5A 2YRFA 3ZDLA 1HE1A 1Z23A 4MTOA 4E18A 5IY5C 3LS0A 4CSAC 3LNRA 3FVYA 5A6BD 3V7OA 3U5SA 4XLNF 4JIOA 3TULA 2J45A 1NU9C 2HKVA 1GM5A 4JJGA 1TWGA 3EZHA 4PJLA 3PHF2 4K0DA 3TOMA 3I5QA 5JLIA 2R25A 1PV3A 2A6EF 2ZXOA 4Q4ZF 1T5OA 3MYFA 1YZCA 2X0CA 4FESA 2H7BA 2R7RA 1ORSC 1HW1A 1FMWA 3B0VC 3OA1A 5CI8A 5TJ5E 1MQVA 2IYLD 2M64A 4NY3A 3SXZA 2LCHA 2HV7A 4JRZA 4DBQA 4I1OB 5DVWA 2IXPA 1SR2A 4I3MA 1L7CA 2V26A 3IQ6A 1NFNA 3F47A 2GDCA 2AU5A 2Y69C 4U5BE 4CS9A 2A1DD 5JRAA 1YDIA 1OW7A 4G78A 3UMKA 4NTBA 2KGOA 3RF3A 3V5YA 1NG1A 4J32B 1R5ID 1S7ZA 4JVSA 4P9TA 1O87A 5COMA 3K6BA 3NG1A 2VH3A 4DRIB 3RQGA 1M6TA 3KH2A 3EG9A 3IQ5A 4XTKA 2QTVA 4PJNA 2IM8A 4LLCA 1SMYF 3K7DA 1Q0KA 1YYJA 4O6NA 4CS9C 1A0BA 3BRJA 1MNEA 3VRCA 3EGDB 3ZWIA 5JS5A 2HJ3A 2XLEA 3EPVA 2HMZA 3R7CA 1OW8A 4JURI 4CBEA 256BA 1ST6A 3LESA 3NMIA 2XRHA 1J8YF 1YLMA 1T9KA 2R7QA 1YAUO 4J30B 3Q7GA 2Q3TA 2PBEA 3DM9B 3JYYA 1AEPA 2PX0A 3K33A 4PR9A 2ZXWC 4XPWA 1LE4A 1YARO 3LEOA 3GORA 4XPYA 5L0IA 1L3PA 4OIPF 1D0YA 2GFHA 4CS8A 3DE9A 1ZHWA 1ORJA 3US6A 3RW0A 2YWAA 1Q0GA 2UUIA 3KMIA 3U9JA 4MS2A 1RKCA 2J46A 4CDAA 2CNWD 5K0IA 2WZLA 3UMIA 2WZGA 3NKEA 2KC3A 2XL6A 2TMVP 2XLVA 1CPRA 1YYXA 3FDQA 2LP4A 2IXNA 3NKDA 2AP3A 4E7ZA 4CS8C 4JJFA 2L7AA 1T6UA 1LI5A 2OJQA 2WVQA 1C03A 3KYIA 3UR3C 1VTMP 2VCAA 4CIPA 3TOLA 1QZXA 2OQMA 2A68F 2ASRA 3SEOA 3U0CA 3RVZA 3S9OA 3EH2A 3W8HA 1NLXA 5DQZA 4BG0A 3NMJA 1NZEA 3LAYA 5DLJA 3S90A 4BJ5A 2P0NA 1Q0MA 3W4YA 1OKKA 3WODF 3B9QA 4HFKB 3S28A 3ZSUA 2J0WA 5JSLA 1E83A 3FAPB 2PFDA 3PDMP 2G62A 3V5XA 3ZQYA 1NFOA 1MMNA 2NSFA 3AQCA 4JC7A 1Y6DA 3IPMO 5KYUA 1MNDA 3DAGA 5BUOA 1O3UA 1I4YA 3AGUA 3C7JA 4BJ5C 1OCCC 3KYJA 1SZIA 4IRUA 3RFYA 1OCZC 2XS8A 1JPNA 1FTSA 3U8PA 3LEVA 4K7BA 4U9DA 2XL4A 3O55A 3AGTA 4YT5A 5FZTA 1U6HA 1TQGA 5AGFA 4CS7A 1E85A 3EFOA 3MYIA 4JCZA 3JSZA 2KSFA 4N4WA 3U3FA 3G4ZA 4OIOF 3QZCA 1LM3B 2QNLA 2KQ9A 3ASNC 3C8GA 3GWLA 4N6CA 1V4AA 4Z9HA 2J7PA 1GS9A 4BJ6A 1GGQA 2J9UA 2Y3GA 2XLHA 4J7YA 1RJ9B 4FX5A 5L0FA 3S0XA 3CZ6A 3EGXB 1FR0A 1QKRA 2Y3BA 1JPJA 5GPGB 4AK9A 1NBBA 1WN0A 3L1MA 5KYXA 1VYKA 2FFHA 2FGYA 2L6FA 2QUPA 3B0PA 2YLGA 4EBKA 4G7ZF 2NG1A 1T6IA 4U5CE 1C17M 1LS1A 3SNHA 1EKYA 4CDVA 1Y4CA 1G5ZA 1M2VA 2ICWG 3LS1A 5B3SC 1RMVA 2HMQA 3UMHA 3I4UA 4Q7CA 2HV6A 3DKAA 2I15A 2BC5A 2WZFA 2CCYA 1D1AA 4WGZA 2Q7RA 2YL3A 4AL1A 1FAPB 2A6HF 2C03A 2VCBA 2B0HA 3CAXA 3ECSA 4C7OA 5HV9A 1EQ1A 3MFNA 2XL8A 2DYRC 4XPXA 2G3KA 2D5RB 4U5GA 5JT4A 1V55C 2IXMA 2ZXRA 4U5EE 3IHUA 1BBHA 1HMOA 1JRAA 3MBGA 2ETSA 4ANJA 4YT2A 1ZHXA 2FAPB 4DVYP 1MMAA 3HNIA 2Q9AA 3K1HA 3TJ6A 5F5HA 3V5ZA 5HSWA 4R32A 3T6JA 4AX2A 4HEAJ 3S84A 4FAPB 4PJMA 4LDKA 3OWTA 4AE4B 2Y3DA 4DRJB 3IEEA 3N2ZB 4ER9A 3U2MA 2YVKA 1BZ4A 5T3TA 4IGGA 1LIHA 2HZ8A 2YL7A 4EBBA 2Z15A 4MVSA 4BJTA 1RXQA 1WASA 4IARA 1CGNA 5DS4A 3DMDA 2LD6A 3SZRA 5L0GA 3ZTMA 3FXHA 4PJJA 4U5HA 1TR2A 2NPUA 1KNYA 4X0RA 4RDAA 4O7GA 2Q9CA 5D92A 5A6KA 4JTCB 3GEEA 1E84A 3CEXA 4C3BA 3B71A 2Q9BA 1EA8A 4LACB 4D4NA 4YT8A 2WB7A 1BR2A 4NCQA 5L3VA 1N1CA 3JSEO 4NTFA 2YZSA 2EIMC 5EK0A 3U3BA 5CI9A 1IW7F 2OCCC 3H65A 1C02A 1BR4A 1LPEA 1OR2A 2GAQA 1H7IA 3HNLA 3JZ0A 1ZHZA 1SYQA 4LDQA 3DWWA 1U89A 1OW6A 4P9FA 1YJGA 4ZLCA 1Q0FA 4G7HF 1YA9A 5B3IA 5JVEA 4H54A 1Q0DA 1DOVA 2W4BA 2XM0A 3ZG1A 3UNGC 4C3DA 4DRHB 4MW3A 3U8VA 5DS6A 3POVA 3DAFA 3VAYA 4GQHA 2MWQA 5A6BA 2QLAA 4W8KA 4Q5SF 2I8BA 4MVQA 4IJJA 4WABA 2D4UA 4LLEA 1QSPA 1XWJA 4M63A 4CJGA 3RQEA 3DM5A 1JOGA 4NQFA 1R4TA 2VB6A 4QI0A 3TK0A 1QVXA 2OJED 3FAJA 1G4WR 3S27A 1WOLA 3FHDA 4BEMJ 2XLMA 3LJBA 1E86A 4JEAA 3EHMA 3DXJF 3K66A 3T4RA 3A11A 2L81A 1I4ZA 1D1BA 1ZW2A 2R7OA 3ATPA 5L0DA 2WVOA 3C8GD 4MQ9F 2QE9A 2A0BA 4JEBA 4G0HA 4YN0B 2R7WA 2J7PD 1APCA 1M2OA 1LKXA 4JTAB 5D91A 3NDBB 2R7XA 2R7VA 3SYNA 5T1DB 4G7OF 2DYSC 3X2QC 3JT1A 1LE2A 1V54C 2VASA 3HNKA 4KBLA 4MVOA 4PK4A 3UGPA 1KU2A 1SF8A 2AVKA 2EPKX 4U5DE 2J9WA 4BPMA 1ORYA 1Z3IX 3HKKA 3QMKA 2CGEA 1H9TA 1OQCA 1AUEA 3G4XA 1B68A 3RYLA 3T9OA 3QW0A 4JZAA 4XEFA 5A69A 1VB5A 3AQBA 4CJOA 2F22A 1JAFA 2LIGA 4W8PA 1LI7A 3EQLF 3SXKA 2LK4A 1OKKD 4L6RA 3AG1C 3FMSA 2P7VA 4YL1A 2ZXPA 2PP4A 3T6GB 4H4KC 4WGYA 3ITFA 4A4AA 2R05A 2A69F 3LLIA 4ULVA 2J0XA 1MMDA 1GQAA 1T6QA 2BE5F 2LSEA 2XS1A 1TWAA 2NUPB 1BDJB 1RJ9A 3LNMB 2J9VA 2CNWA 1TKNA 4IWBA 3EGXA 2NUTB 2DB4A 3GEIA 4LDRA 3JCUQ 1T01A 4XWJA 1F1MA 3L34A 2OU6A 2R9RB 3IQCA 3LUTB 2R02A 3HJCA 4YT4A 2IOQA 1VLSA 3ASOC 5DQTA 1TFKB 1VLTA 2XSEA 2R7UA 4MVZA 1G8XA 4O79A 2E87A 2NSGA 3O39A 1PCXA 4IAOA 3DJUB 4J7TA 4N06A 4YWQA 5KYYB 1FMVA 3EH1A 1HE9A 4DBRA 2VC9A 3N24A 3NYMA 3Q6NA 3C8GB 3S29A 5KYWB 3R2PA 2KW3C 2P6VA 1PD0A 2LFFA 2Y3HA 1RKEB 3MX3A 3Q6MA 1E2XA 1WATA 2XXAB 3W8IA 5L0HA 1D1CA 1IZMA 2MYSA 1M57C 5BQIA 1K04A 1Z6AA 3C62A 4EKWA 3MLGA 4N6HA 4E0IA 1OCOC 1UFBA 3A9CA 4E0HA 4LERA 4ONSA 4RBNA 4JTDB 3CSKA 2OEVA 3U2LA 1M2VB 2HFIA 4MTFA 4EIYA 4AE4A 5T3WA 1W2WA 2X51A 3LLKA 3GM1A 2LQGA 1ZU5A 2OEXA 4KNWA 1WTYA 3N0TA 4MNDA 2YLDA 3GWNA 3QVYA 4XEVA 2PNOA 3E9VA 1NU7D 3GM2A 3RIPA 4E17A 5A6AA 2WVNA 3NYLA 2KJGA 3F46A 3RQFA 3GM3A 2EIJC 4OINF 4DJ9A 3O6XA 5CIVA 2HJMA 5AC4A 3E70C 2KK1A 2XM4A 1S05A 3C18A 2W9YA 2YKZA 1A7DA 3DJNB 1LVKA 2HSBA 3JYHA 3Q7LA 4HFFB 4K1OA 2AWCA 4O6YA 4U9EA 3VF0A 4DVZA 1Z63A 1KTMA 5E33A 2XLOA 2HSQA 3C63A 3OEOA 4CDYA 2IBFA 3EGDA 1FFHA 4DXWA 2JX0A 1JR8A 1ZHTA 4AL0A 3EZIA 2XLWA 2O9XA 2ZPAA 3QTHA 4YK5A 4Z9IA 1D0XA 5B1BC 1JMWA 2WL8A 1TWHA 2GA0A 1CGOA 2DGJA 4Z9JA 2V3CC 4JE9A 1YA7O 2YQYA 5B1AC 1EI7A 2RD9A 5E3CA 3ZTZA 3SXYA 2R7SA 4EHPA 1OR3A 1XZPA 2EILC 1A7EA 3O10A 4PFPA 2EPMX 1K40A 2M4EA 5COFA 2EINC 3ZC4A 1A41A 2QY9A 3RVYA 4JW1A 2YHSA 3EG9B 4NTAA 4PACA 1LS4A 2RSEB 3W2VA 5FCLA 1OCRC 2JD3A 1ZU4A 2CYDA 3GANA 3M79A 3VM6A 1XZQA 3K1IA 1CGME 3AG4C 3CQZA 3QVZA 1ZW3A 4JKVA 4YJWA 1V74B 3DE8A 4XEKA 1O5HA 1VMAA 3X1OA 5L0JA 4NC3A 1DOWA 4HE8D 5COGA 2L6GA 3WHNA 4QI2A 5F5FA 4IAQA 4F4BA 4GYTA 3JTLO 3M4BA 1WWPA 4YL3A 3TQOA 2L9JA 3K1IC 4BEJA 2ZD9A 4XLPF 1H6GA 3FOPA 4XQ1A 4ZLDA 4GEHA 2GWWA 4O6MA 1ZHYA 3DZAA 3H2VA 3C8ZA 3ZQVA 1QQ3A 4EWCA 3L8IA 2R7TA 3KKBA 1QPUA 1M56C 3GODA 4MVUA 4RD9A 1MMGA 1VK5A 3B0UX 4MTGA 2G3VA 1NSGB 3PMRA 2BL2A 2IXOA 2A0UA 4ULWA 3EHNA 3HTKC 1HMDA 4OD4A 1ZYRF 2J9BA 1TFOB 4P6IC 3W2WA 3QW1A 1UG7A 4BJ1A 1H9GA 4E7SA 3H2UA 2AWYA 2B0JA 2UUHA 3G50A 3L0IA 3M15A 3AJMA 1WGWA 1FNTc 1CPQA 4EBJA 2EPNA 5DS5A 3IQTA 3TD7A 2NUPA 4OIRF 1PD1A 3ABKC 3KPHA 2L6HA 4PFOA 2NUTA 4UDVA 2P1AA 3TJ5A 2Y39A 1HW2A 1AVOB 1K05A 3BEHA 4CX9A 4CIHA 2EIKC 3RKOF 3KL4A 2P61A 3U9MA 3UGOA 3GEHA 3AOUA 5KYUB 2EPOA 3ZVRA 3FOOA 3RH3A 3SXMA 2Q00A 2HUJA 5AC5A 2OOCA 4OD5A 4C3EA 2VCCA 3DD7A 3J06A 3NYJA 2MHRA 2H7OA 3ABLC 5KYYA 3PCVA 4I1MA 4D4XA 1VYIA 5EGYA 2YLIA 3EFOB 3HNJA 2W4MA 3ZIBA 4FWVA 4YL0A 2YL1A 1I5NA 1BR1A 5KYWA 2EPLX 4MVMA 2HS5A 1ZVZA 1RKEA 1YVIA 3EJNA 2LFDA 4QDLA 4WJ0A 2R03A 1Z7Qc 3WG7C 2XXAA 1VOMA 5EHHA 3AG3C 3B29A 3VYWA 2XLDA 1ZZPA 2DI3A 4IB4A 1U0BB 3M1CB 5JUAA 2CW0F 3WAQA 2YEVA 2OG2A 5KYXB 4MVRA 1YZAA 1D0ZA 1RCPA 5L3QA 3HLZA 3AG2C 1OXKA 5A6JA 2KNHA 3DI5A 5BQHA 2CDQA 2J8WA 4I44A 4U5FE 5E3AA 1J8MF 4A2NB 3NRHA 4JCHA 4BJ6C 4DOZA 5L0CA 1FFTC 1Z5ZA 3I5PA 4B6IA 2JPUA 1TWCA 2W45A 1G4US 3L8JA 1A7VA 3M4CA 5E2QA 5F28E 3NMKA 4CSAA 4EUKB 2H7VC 1OXBA 2C04A
chains in the Genus database with same CATH topology
4OIQF 3JRTA 5KYNA 2PX3A 3ABMC 4KI2A 4KC9A 2PF4E 4C7OB 4KNVA 3SP1A 3T6BA 1QLEC 5IY5C 1Z23A 3LS0A 4CSAC 3LNRA 3FVYA 3V7OA 4XLNF 2J45A 1NU9C 4JJGA 1TWGA 3EZHA 4PJLA 3PHF2 4K0DA 3I5QA 2A6EF 2ZXOA 4Q4ZF 4FESA 2H7BA 2R7RA 3B0VC 1FMWA 3OA1A 5CI8A 2IYLD 4NY3A 2HV7A 4DBQA 4I1OB 5DVWA 2IXPA 4I3MA 2V26A 3F47A 4U5BE 2Y69C 4CS9A 2A1DD 3UMKA 2KGOA 5DQTA 4C3EA 1NG1A 4J32B 3TD7A 1S7ZA 4JVSA 1O87A 3K6BA 3NG1A 2VH3A 3KH2A 3EG9A 4XTKA 2QTVA 4PJNA 4LLCA 1SMYF 3K7DA 4O6NA 4CS9C 1MNEA 3EGDB 3EPVA 4CBEA 3LESA 1ST6A 2XRHA 1J8YF 2R7QA 4J30B 3Q7GA 2Q3TA 3DM9B 3K33A 2PX0A 2ZXWC 4OIPF 1D0YA 2GFHA 4CS8A 1ZHWA 3KMIA 2J46A 2CNWD 2WZLA 3UMIA 2WZGA 3NKEA 3FDQA 2IXNA 3NKDA 4E7ZA 4CS8C 4JJFA 2WVQA 3UR3C 1QZXA 2A68F 3SEOA 3EH2A 3W8HA 5DQZA 4BG0A 1NZEA 3LAYA 5DLJA 4BJ5A 3WODF 3B9QA 4HFKB 3S28A 3ZSUA 2J0WA 2PFDA 2G62A 1MMNA 3AQCA 5KYUA 1MNDA 3DAGA 5BUOA 4BJ5C 1OCCC 1SZIA 4IRUA 3RFYA 1OCZC 1JPNA 1FTSA 3LEVA 4K7BA 2XL4A 4YT5A 4CS7A 3EFOA 3JSZA 3QZCA 2KQ9A 3ASNC 2J7PA 4BJ6A 2J9UA 2Y3GA 1RJ9B 4FX5A 3S0XA 3CZ6A 3EGXB 2Y3BA 1JPJA 4AK9A 5KYXA 1VYKA 2FFHA 2FGYA 3B0PA 4G7ZF 2NG1A 4U5CE 1LS1A 3SNHA 3LS1A 1M2VA 5B3SC 3UMHA 3I4UA 4Q7CA 2HV6A 2WZFA 1D1AA 2A6HF 2C03A 3ECSA 4C7OA 2DYRC 2G3KA 2D5RB 4U5GA 1V55C 2ZXRA 2IXMA 4U5EE 4ANJA 4YT2A 1ZHXA 4DVYP 1MMAA 2Q9AA 3K1HA 5F5HA 5HSWA 3T6JA 4AX2A 4HEAJ 4PJMA 3OWTA 4AE4B 2Y3DA 3IEEA 3N2ZB 5T3TA 4EBBA 2Z15A 4BJTA 5DS4A 3DMDA 3SZRA 4PJJA 4U5HA 1TR2A 4X0RA 4RDAA 4O7GA 2Q9CA 5D92A 4C3BA 2Q9BA 4LACB 4YT8A 2WB7A 1BR2A 5L3VA 1N1CA 2YZSA 2EIMC 5CI9A 1IW7F 2OCCC 3H65A 1BR4A 1ZHZA 4G7HF 4ZLCA 2W4BA 3ZG1A 3UNGC 4C3DA 5DS6A 3POVA 3DAFA 3VAYA 2MWQA 4W8KA 4Q5SF 2I8BA 4IJJA 4LLEA 4M63A 3DM5A 2VB6A 4QI0A 3FAJA 3S27A 3FHDA 3LJBA 3T4RA 3EHMA 3DXJF 3K66A 2L81A 1D1BA 2R7OA 2WVOA 4MQ9F 4G0HA 4YN0B 2R7WA 2J7PD 1M2OA 1LKXA 5D91A 3NDBB 2R7XA 2R7VA 3SYNA 5T1DB 4G7OF 2DYSC 3X2QC 3JT1A 1V54C 2VASA 4KBLA 4PK4A 3UGPA 1KU2A 1SF8A 4U5DE 2J9WA 1Z3IX 3QMKA 2CGEA 3RYLA 4JZAA 3AQBA 3EQLF 1OKKD 3AG1C 2P7VA 2ZXPA 2PP4A 4H4KC 3ITFA 2A69F 3LLIA 2J0XA 1MMDA 2BE5F 2LSEA 3NYLA 4JURI 4OIOF 1TWAA 2NUPB 1RJ9A 2J9VA 2CNWA 1TKNA 4IWBA 3EGXA 2NUTB 3JCUQ 4XWJA 3L34A 3HJCA 4YT4A 2IOQA 3ASOC 2R7UA 2XSEA 1G8XA 4O79A 2E87A 3O39A 4N06A 1PCXA 4IAOA 3DJUB 5KYYB 4YWQA 1FMVA 3EH1A 4DBRA 3NYMA 3N24A 3Q6NA 5KYWB 3S29A 2KW3C 2P6VA 1PD0A 2Y3HA 3MX3A 3Q6MA 2XXAB 3W8IA 1D1CA 1IZMA 2MYSA 1M57C 1Z6AA 3MLGA 1OCOC 4LERA 4RBNA 3CSKA 1M2VB 4AE4A 5T3WA 1W2WA 2X51A 3LLKA 4KNWA 1ZU5A 3N0TA 4MNDA 3E9VA 1NU7D 3RIPA 2WVNA 2KJGA 3F46A 2EIJC 4OINF 3O6XA 3E70C 2W9YA 3DJNB 1LVKA 3JYHA 3Q7LA 4O6YA 4HFFB 4DVZA 1Z63A 5E33A 3OEOA 3EGDA 1FFHA 1ZHTA 3EZIA 2O9XA 2ZPAA 1D0XA 5B1BC 2WL8A 1TWHA 2DGJA 2V3CC 5B1AC 5E3CA 2R7SA 2EILC 4PFPA 2M4EA 2EINC 3ZC4A 2QY9A 4JW1A 2YHSA 3EG9B 3W2VA 5FCLA 1OCRC 2JD3A 1ZU4A 3GANA 3AG4C 3CQZA 4YJWA 1O5HA 1VMAA 3X1OA 4HE8D 5F5FA 4QI2A 4F4BA 4GYTA 4BEJA 4XLPF 2L9JA 3K1IC 4ZLDA 4GEHA 4O6MA 1ZHYA 3DZAA 4EWCA 2R7TA 3KKBA 1M56C 3GODA 4RD9A 1MMGA 1VK5A 3B0UX 2G3VA 3PMRA 2IXOA 4ULWA 3EHNA 3HTKC 4OD4A 1ZYRF 4P6IC 3W2WA 4E7SA 4BJ1A 2B0JA 3L0IA 1WGWA 5DS5A 2NUPA 4OIRF 1PD1A 3ABKC 4PFOA 2NUTA 2Y39A 4CIHA 2EIKC 3RKOF 3KL4A 3UGOA 5KYUB 3ZVRA 3RH3A 4OD5A 3DD7A 3NYJA 2H7OA 3ABLC 5KYYA 4I1MA 1VYIA 5EGYA 3EFOB 3ZIBA 2W4MA 4FWVA 5KYWA 1BR1A 3EJNA 4QDLA 3WG7C 4WJ0A 2XXAA 1VOMA 5EHHA 3AG3C 3VYWA 3M1CB 2CW0F 2YEVA 2OG2A 5KYXB 1D0ZA 5L3QA 3HLZA 3AG2C 2KNHA 2CDQA 4U5FE 4I44A 5E3AA 4BJ6C 1J8MF 4A2NB 3NRHA 4JCHA 4DOZA 1FFTC 1Z5ZA 3I5PA 4B6IA 1TWCA 2W45A 4CSAA 5E2QA 2H7VC 1OKKA 2C04A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L9J A;  4C3B A;  4C3E A;  4CS7 A;  4CSA C;  4CSA A;  4CS9 C;  4CS9 A;  4CS8 C;  4CS8 A;  4C3D A; 
#chains in the Genus database with same CATH topology
 4OIQ F;  2H8A A;  5BQG A;  3JRT A;  5KYN A;  2KYH A;  2PX3 A;  2Q4F A;  3ABM C;  4KI2 A;  4KC9 A;  4MW8 A;  5JP7 A;  2PF4 E;  3JRM O;  4KNV A;  4C7O B;  3SP1 A;  3T6B A;  1QLE C;  2OKU A;  2YL0 A;  1HY5 A;  2YRF A;  3ZDL A;  1HE1 A;  1Z23 A;  4MTO A;  4E18 A;  5IY5 C;  3LS0 A;  4CSA C;  3LNR A;  3FVY A;  5A6B D;  3V7O A;  3U5S A;  4XLN F;  4JIO A;  3TUL A;  2J45 A;  1NU9 C;  2HKV A;  1GM5 A;  4JJG A;  1TWG A;  3EZH A;  4PJL A;  3PHF 2;  4K0D A;  3TOM A;  3I5Q A;  5JLI A;  2R25 A;  1PV3 A;  2A6E F;  2ZXO A;  4Q4Z F;  1T5O A;  3MYF A;  1YZC A;  2X0C A;  4FES A;  2H7B A;  2R7R A;  1ORS C;  1HW1 A;  1FMW A;  3B0V C;  3OA1 A;  5CI8 A;  5TJ5 E;  1MQV A;  2IYL D;  2M64 A;  4NY3 A;  3SXZ A;  2LCH A;  2HV7 A;  4JRZ A;  4DBQ A;  4I1O B;  5DVW A;  2IXP A;  1SR2 A;  4I3M A;  1L7C A;  2V26 A;  3IQ6 A;  1NFN A;  3F47 A;  2GDC A;  2AU5 A;  2Y69 C;  4U5B E;  4CS9 A;  2A1D D;  5JRA A;  1YDI A;  1OW7 A;  4G78 A;  3UMK A;  4NTB A;  2KGO A;  3RF3 A;  3V5Y A;  1NG1 A;  4J32 B;  1R5I D;  1S7Z A;  4JVS A;  4P9T A;  1O87 A;  5COM A;  3K6B A;  3NG1 A;  2VH3 A;  4DRI B;  3RQG A;  1M6T A;  3KH2 A;  3EG9 A;  3IQ5 A;  4XTK A;  2QTV A;  4PJN A;  2IM8 A;  4LLC A;  1SMY F;  3K7D A;  1Q0K A;  1YYJ A;  4O6N A;  4CS9 C;  1A0B A;  3BRJ A;  1MNE A;  3VRC A;  3EGD B;  3ZWI A;  5JS5 A;  2HJ3 A;  2XLE A;  3EPV A;  2HMZ A;  3R7C A;  1OW8 A;  4JUR I;  4CBE A;  256B A;  1ST6 A;  3LES A;  3NMI A;  2XRH A;  1J8Y F;  1YLM A;  1T9K A;  2R7Q A;  1YAU O;  4J30 B;  3Q7G A;  2Q3T A;  2PBE A;  3DM9 B;  3JYY A;  1AEP A;  2PX0 A;  3K33 A;  4PR9 A;  2ZXW C;  4XPW A;  1LE4 A;  1YAR O;  3LEO A;  3GOR A;  4XPY A;  5L0I A;  1L3P A;  4OIP F;  1D0Y A;  2GFH A;  4CS8 A;  3DE9 A;  1ZHW A;  1ORJ A;  3US6 A;  3RW0 A;  2YWA A;  1Q0G A;  2UUI A;  3KMI A;  3U9J A;  4MS2 A;  1RKC A;  2J46 A;  4CDA A;  2CNW D;  5K0I A;  2WZL A;  3UMI A;  2WZG A;  3NKE A;  2KC3 A;  2XL6 A;  2TMV P;  2XLV A;  1CPR A;  1YYX A;  3FDQ A;  2LP4 A;  2IXN A;  3NKD A;  2AP3 A;  4E7Z A;  4CS8 C;  4JJF A;  2L7A A;  1T6U A;  1LI5 A;  2OJQ A;  2WVQ A;  1C03 A;  3KYI A;  3UR3 C;  1VTM P;  2VCA A;  4CIP A;  3TOL A;  1QZX A;  2OQM A;  2A68 F;  2ASR A;  3SEO A;  3U0C A;  3RVZ A;  3S9O A;  3EH2 A;  3W8H A;  1NLX A;  5DQZ A;  4BG0 A;  3NMJ A;  1NZE A;  3LAY A;  5DLJ A;  3S90 A;  4BJ5 A;  2P0N A;  1Q0M A;  3W4Y A;  1OKK A;  3WOD F;  3B9Q A;  4HFK B;  3S28 A;  3ZSU A;  2J0W A;  5JSL A;  1E83 A;  3FAP B;  2PFD A;  3PDM P;  2G62 A;  3V5X A;  3ZQY A;  1NFO A;  1MMN A;  2NSF A;  3AQC A;  4JC7 A;  1Y6D A;  3IPM O;  5KYU A;  1MND A;  3DAG A;  5BUO A;  1O3U A;  1I4Y A;  3AGU A;  3C7J A;  4BJ5 C;  1OCC C;  3KYJ A;  1SZI A;  4IRU A;  3RFY A;  1OCZ C;  2XS8 A;  1JPN A;  1FTS A;  3U8P A;  3LEV A;  4K7B A;  4U9D A;  2XL4 A;  3O55 A;  3AGT A;  4YT5 A;  5FZT A;  1U6H A;  1TQG A;  5AGF A;  4CS7 A;  1E85 A;  3EFO A;  3MYI A;  4JCZ A;  3JSZ A;  2KSF A;  4N4W A;  3U3F A;  3G4Z A;  4OIO F;  3QZC A;  1LM3 B;  2QNL A;  2KQ9 A;  3ASN C;  3C8G A;  3GWL A;  4N6C A;  1V4A A;  4Z9H A;  2J7P A;  1GS9 A;  4BJ6 A;  1GGQ A;  2J9U A;  2Y3G A;  2XLH A;  4J7Y A;  1RJ9 B;  4FX5 A;  5L0F A;  3S0X A;  3CZ6 A;  3EGX B;  1FR0 A;  1QKR A;  2Y3B A;  1JPJ A;  5GPG B;  4AK9 A;  1NBB A;  1WN0 A;  3L1M A;  5KYX A;  1VYK A;  2FFH A;  2FGY A;  2L6F A;  2QUP A;  3B0P A;  2YLG A;  4EBK A;  4G7Z F;  2NG1 A;  1T6I A;  4U5C E;  1C17 M;  1LS1 A;  3SNH A;  1EKY A;  4CDV A;  1Y4C A;  1G5Z A;  1M2V A;  2ICW G;  3LS1 A;  5B3S C;  1RMV A;  2HMQ A;  3UMH A;  3I4U A;  4Q7C A;  2HV6 A;  3DKA A;  2I15 A;  2BC5 A;  2WZF A;  2CCY A;  1D1A A;  4WGZ A;  2Q7R A;  2YL3 A;  4AL1 A;  1FAP B;  2A6H F;  2C03 A;  2VCB A;  2B0H A;  3CAX A;  3ECS A;  4C7O A;  5HV9 A;  1EQ1 A;  3MFN A;  2XL8 A;  2DYR C;  4XPX A;  2G3K A;  2D5R B;  4U5G A;  5JT4 A;  1V55 C;  2IXM A;  2ZXR A;  4U5E E;  3IHU A;  1BBH A;  1HMO A;  1JRA A;  3MBG A;  2ETS A;  4ANJ A;  4YT2 A;  1ZHX A;  2FAP B;  4DVY P;  1MMA A;  3HNI A;  2Q9A A;  3K1H A;  3TJ6 A;  5F5H A;  3V5Z A;  5HSW A;  4R32 A;  3T6J A;  4AX2 A;  4HEA J;  3S84 A;  4FAP B;  4PJM A;  4LDK A;  3OWT A;  4AE4 B;  2Y3D A;  4DRJ B;  3IEE A;  3N2Z B;  4ER9 A;  3U2M A;  2YVK A;  1BZ4 A;  5T3T A;  4IGG A;  1LIH A;  2HZ8 A;  2YL7 A;  4EBB A;  2Z15 A;  4MVS A;  4BJT A;  1RXQ A;  1WAS A;  4IAR A;  1CGN A;  5DS4 A;  3DMD A;  2LD6 A;  3SZR A;  5L0G A;  3ZTM A;  3FXH A;  4PJJ A;  4U5H A;  1TR2 A;  2NPU A;  1KNY A;  4X0R A;  4RDA A;  4O7G A;  2Q9C A;  5D92 A;  5A6K A;  4JTC B;  3GEE A;  1E84 A;  3CEX A;  4C3B A;  3B71 A;  2Q9B A;  1EA8 A;  4LAC B;  4D4N A;  4YT8 A;  2WB7 A;  1BR2 A;  4NCQ A;  5L3V A;  1N1C A;  3JSE O;  4NTF A;  2YZS A;  2EIM C;  5EK0 A;  3U3B A;  5CI9 A;  1IW7 F;  2OCC C;  3H65 A;  1C02 A;  1BR4 A;  1LPE A;  1OR2 A;  2GAQ A;  1H7I A;  3HNL A;  3JZ0 A;  1ZHZ A;  1SYQ A;  4LDQ A;  3DWW A;  1U89 A;  1OW6 A;  4P9F A;  1YJG A;  4ZLC A;  1Q0F A;  4G7H F;  1YA9 A;  5B3I A;  5JVE A;  4H54 A;  1Q0D A;  1DOV A;  2W4B A;  2XM0 A;  3ZG1 A;  3UNG C;  4C3D A;  4DRH B;  4MW3 A;  3U8V A;  5DS6 A;  3POV A;  3DAF A;  3VAY A;  4GQH A;  2MWQ A;  5A6B A;  2QLA A;  4W8K A;  4Q5S F;  2I8B A;  4MVQ A;  4IJJ A;  4WAB A;  2D4U A;  4LLE A;  1QSP A;  1XWJ A;  4M63 A;  4CJG A;  3RQE A;  3DM5 A;  1JOG A;  4NQF A;  1R4T A;  2VB6 A;  4QI0 A;  3TK0 A;  1QVX A;  2OJE D;  3FAJ A;  1G4W R;  3S27 A;  1WOL A;  3FHD A;  4BEM J;  2XLM A;  3LJB A;  1E86 A;  4JEA A;  3EHM A;  3DXJ F;  3K66 A;  3T4R A;  3A11 A;  2L81 A;  1I4Z A;  1D1B A;  1ZW2 A;  2R7O A;  3ATP A;  5L0D A;  2WVO A;  3C8G D;  4MQ9 F;  2QE9 A;  2A0B A;  4JEB A;  4G0H A;  4YN0 B;  2R7W A;  2J7P D;  1APC A;  1M2O A;  1LKX A;  4JTA B;  5D91 A;  3NDB B;  2R7X A;  2R7V A;  3SYN A;  5T1D B;  4G7O F;  2DYS C;  3X2Q C;  3JT1 A;  1LE2 A;  1V54 C;  2VAS A;  3HNK A;  4KBL A;  4MVO A;  4PK4 A;  3UGP A;  1KU2 A;  1SF8 A;  2AVK A;  2EPK X;  4U5D E;  2J9W A;  4BPM A;  1ORY A;  1Z3I X;  3HKK A;  3QMK A;  2CGE A;  1H9T A;  1OQC A;  1AUE A;  3G4X A;  1B68 A;  3RYL A;  3T9O A;  3QW0 A;  4JZA A;  4XEF A;  5A69 A;  1VB5 A;  3AQB A;  4CJO A;  2F22 A;  1JAF A;  2LIG A;  4W8P A;  1LI7 A;  3EQL F;  3SXK A;  2LK4 A;  1OKK D;  4L6R A;  3AG1 C;  3FMS A;  2P7V A;  4YL1 A;  2ZXP A;  2PP4 A;  3T6G B;  4H4K C;  4WGY A;  3ITF A;  4A4A A;  2R05 A;  2A69 F;  3LLI A;  4ULV A;  2J0X A;  1MMD A;  1GQA A;  1T6Q A;  2BE5 F;  2LSE A;  2XS1 A;  1TWA A;  2NUP B;  1BDJ B;  1RJ9 A;  3LNM B;  2J9V A;  2CNW A;  1TKN A;  4IWB A;  3EGX A;  2NUT B;  2DB4 A;  3GEI A;  4LDR A;  3JCU Q;  1T01 A;  4XWJ A;  1F1M A;  3L34 A;  2OU6 A;  2R9R B;  3IQC A;  3LUT B;  2R02 A;  3HJC A;  4YT4 A;  2IOQ A;  1VLS A;  3ASO C;  5DQT A;  1TFK B;  1VLT A;  2XSE A;  2R7U A;  4MVZ A;  1G8X A;  4O79 A;  2E87 A;  2NSG A;  3O39 A;  1PCX A;  4IAO A;  3DJU B;  4J7T A;  4N06 A;  4YWQ A;  5KYY B;  1FMV A;  3EH1 A;  1HE9 A;  4DBR A;  2VC9 A;  3N24 A;  3NYM A;  3Q6N A;  3C8G B;  3S29 A;  5KYW B;  3R2P A;  2KW3 C;  2P6V A;  1PD0 A;  2LFF A;  2Y3H A;  1RKE B;  3MX3 A;  3Q6M A;  1E2X A;  1WAT A;  2XXA B;  3W8I A;  5L0H A;  1D1C A;  1IZM A;  2MYS A;  1M57 C;  5BQI A;  1K04 A;  1Z6A A;  3C62 A;  4EKW A;  3MLG A;  4N6H A;  4E0I A;  1OCO C;  1UFB A;  3A9C A;  4E0H A;  4LER A;  4ONS A;  4RBN A;  4JTD B;  3CSK A;  2OEV A;  3U2L A;  1M2V B;  2HFI A;  4MTF A;  4EIY A;  4AE4 A;  5T3W A;  1W2W A;  2X51 A;  3LLK A;  3GM1 A;  2LQG A;  1ZU5 A;  2OEX A;  4KNW A;  1WTY A;  3N0T A;  4MND A;  2YLD A;  3GWN A;  3QVY A;  4XEV A;  2PNO A;  3E9V A;  1NU7 D;  3GM2 A;  3RIP A;  4E17 A;  5A6A A;  2WVN A;  3NYL A;  2KJG A;  3F46 A;  3RQF A;  3GM3 A;  2EIJ C;  4OIN F;  4DJ9 A;  3O6X A;  5CIV A;  2HJM A;  5AC4 A;  3E70 C;  2KK1 A;  2XM4 A;  1S05 A;  3C18 A;  2W9Y A;  2YKZ A;  1A7D A;  3DJN B;  1LVK A;  2HSB A;  3JYH A;  3Q7L A;  4HFF B;  4K1O A;  2AWC A;  4O6Y A;  4U9E A;  3VF0 A;  4DVZ A;  1Z63 A;  1KTM A;  5E33 A;  2XLO A;  2HSQ A;  3C63 A;  3OEO A;  4CDY A;  2IBF A;  3EGD A;  1FFH A;  4DXW A;  2JX0 A;  1JR8 A;  1ZHT A;  4AL0 A;  3EZI A;  2XLW A;  2O9X A;  2ZPA A;  3QTH A;  4YK5 A;  4Z9I A;  1D0X A;  5B1B C;  1JMW A;  2WL8 A;  1TWH A;  2GA0 A;  1CGO A;  2DGJ A;  4Z9J A;  2V3C C;  4JE9 A;  1YA7 O;  2YQY A;  5B1A C;  1EI7 A;  2RD9 A;  5E3C A;  3ZTZ A;  3SXY A;  2R7S A;  4EHP A;  1OR3 A;  1XZP A;  2EIL C;  1A7E A;  3O10 A;  4PFP A;  2EPM X;  1K40 A;  2M4E A;  5COF A;  2EIN C;  3ZC4 A;  1A41 A;  2QY9 A;  3RVY A;  4JW1 A;  2YHS A;  3EG9 B;  4NTA A;  4PAC A;  1LS4 A;  2RSE B;  3W2V A;  5FCL A;  1OCR C;  2JD3 A;  1ZU4 A;  2CYD A;  3GAN A;  3M79 A;  3VM6 A;  1XZQ A;  3K1I A;  1CGM E;  3AG4 C;  3CQZ A;  3QVZ A;  1ZW3 A;  4JKV A;  4YJW A;  1V74 B;  3DE8 A;  4XEK A;  1O5H A;  1VMA A;  3X1O A;  5L0J A;  4NC3 A;  1DOW A;  4HE8 D;  5COG A;  2L6G A;  3WHN A;  4QI2 A;  5F5F A;  4IAQ A;  4F4B A;  4GYT A;  3JTL O;  3M4B A;  1WWP A;  4YL3 A;  3TQO A;  2L9J A;  3K1I C;  4BEJ A;  2ZD9 A;  4XLP F;  1H6G A;  3FOP A;  4XQ1 A;  4ZLD A;  4GEH A;  2GWW A;  4O6M A;  1ZHY A;  3DZA A;  3H2V A;  3C8Z A;  3ZQV A;  1QQ3 A;  4EWC A;  3L8I A;  2R7T A;  3KKB A;  1QPU A;  1M56 C;  3GOD A;  4MVU A;  4RD9 A;  1MMG A;  1VK5 A;  3B0U X;  4MTG A;  2G3V A;  1NSG B;  3PMR A;  2BL2 A;  2IXO A;  2A0U A;  4ULW A;  3EHN A;  3HTK C;  1HMD A;  4OD4 A;  1ZYR F;  2J9B A;  1TFO B;  4P6I C;  3W2W A;  3QW1 A;  1UG7 A;  4BJ1 A;  1H9G A;  4E7S A;  3H2U A;  2AWY A;  2B0J A;  2UUH A;  3G50 A;  3L0I A;  3M15 A;  3AJM A;  1WGW A;  1FNT c;  1CPQ A;  4EBJ A;  2EPN A;  5DS5 A;  3IQT A;  3TD7 A;  2NUP A;  4OIR F;  1PD1 A;  3ABK C;  3KPH A;  2L6H A;  4PFO A;  2NUT A;  4UDV A;  2P1A A;  3TJ5 A;  2Y39 A;  1HW2 A;  1AVO B;  1K05 A;  3BEH A;  4CX9 A;  4CIH A;  2EIK C;  3RKO F;  3KL4 A;  2P61 A;  3U9M A;  3UGO A;  3GEH A;  3AOU A;  5KYU B;  2EPO A;  3ZVR A;  3FOO A;  3RH3 A;  3SXM A;  2Q00 A;  2HUJ A;  5AC5 A;  2OOC A;  4OD5 A;  4C3E A;  2VCC A;  3DD7 A;  3J06 A;  3NYJ A;  2MHR A;  2H7O A;  3ABL C;  5KYY A;  3PCV A;  4I1M A;  4D4X A;  1VYI A;  5EGY A;  2YLI A;  3EFO B;  3HNJ A;  2W4M A;  3ZIB A;  4FWV A;  4YL0 A;  2YL1 A;  1I5N A;  1BR1 A;  5KYW A;  2EPL X;  4MVM A;  2HS5 A;  1ZVZ A;  1RKE A;  1YVI A;  3EJN A;  2LFD A;  4QDL A;  4WJ0 A;  2R03 A;  1Z7Q c;  3WG7 C;  2XXA A;  1VOM A;  5EHH A;  3AG3 C;  3B29 A;  3VYW A;  2XLD A;  1ZZP A;  2DI3 A;  4IB4 A;  1U0B B;  3M1C B;  5JUA A;  2CW0 F;  3WAQ A;  2YEV A;  2OG2 A;  5KYX B;  4MVR A;  1YZA A;  1D0Z A;  1RCP A;  5L3Q A;  3HLZ A;  3AG2 C;  1OXK A;  5A6J A;  2KNH A;  3DI5 A;  5BQH A;  2CDQ A;  2J8W A;  4I44 A;  4U5F E;  5E3A A;  1J8M F;  4A2N B;  3NRH A;  4JCH A;  4BJ6 C;  4DOZ A;  5L0C A;  1FFT C;  1Z5Z A;  3I5P A;  4B6I A;  2JPU A;  1TWC A;  2W45 A;  1G4U S;  3L8J A;  1A7V A;  3M4C A;  5E2Q A;  5F28 E;  3NMK A;  4CSA A;  4EUK B;  2H7V C;  1OXB A;  2C04 A; 
#chains in the Genus database with same CATH homology
 4OIQ F;  3JRT A;  5KYN A;  2PX3 A;  3ABM C;  4KI2 A;  4KC9 A;  2PF4 E;  4C7O B;  4KNV A;  3SP1 A;  3T6B A;  1QLE C;  5IY5 C;  1Z23 A;  3LS0 A;  4CSA C;  3LNR A;  3FVY A;  3V7O A;  4XLN F;  2J45 A;  1NU9 C;  4JJG A;  1TWG A;  3EZH A;  4PJL A;  3PHF 2;  4K0D A;  3I5Q A;  2A6E F;  2ZXO A;  4Q4Z F;  4FES A;  2H7B A;  2R7R A;  3B0V C;  1FMW A;  3OA1 A;  5CI8 A;  2IYL D;  4NY3 A;  2HV7 A;  4DBQ A;  4I1O B;  5DVW A;  2IXP A;  4I3M A;  2V26 A;  3F47 A;  4U5B E;  2Y69 C;  4CS9 A;  2A1D D;  3UMK A;  2KGO A;  5DQT A;  4C3E A;  1NG1 A;  4J32 B;  3TD7 A;  1S7Z A;  4JVS A;  1O87 A;  3K6B A;  3NG1 A;  2VH3 A;  3KH2 A;  3EG9 A;  4XTK A;  2QTV A;  4PJN A;  4LLC A;  1SMY F;  3K7D A;  4O6N A;  4CS9 C;  1MNE A;  3EGD B;  3EPV A;  4CBE A;  3LES A;  1ST6 A;  2XRH A;  1J8Y F;  2R7Q A;  4J30 B;  3Q7G A;  2Q3T A;  3DM9 B;  3K33 A;  2PX0 A;  2ZXW C;  4OIP F;  1D0Y A;  2GFH A;  4CS8 A;  1ZHW A;  3KMI A;  2J46 A;  2CNW D;  2WZL A;  3UMI A;  2WZG A;  3NKE A;  3FDQ A;  2IXN A;  3NKD A;  4E7Z A;  4CS8 C;  4JJF A;  2WVQ A;  3UR3 C;  1QZX A;  2A68 F;  3SEO A;  3EH2 A;  3W8H A;  5DQZ A;  4BG0 A;  1NZE A;  3LAY A;  5DLJ A;  4BJ5 A;  3WOD F;  3B9Q A;  4HFK B;  3S28 A;  3ZSU A;  2J0W A;  2PFD A;  2G62 A;  1MMN A;  3AQC A;  5KYU A;  1MND A;  3DAG A;  5BUO A;  4BJ5 C;  1OCC C;  1SZI A;  4IRU A;  3RFY A;  1OCZ C;  1JPN A;  1FTS A;  3LEV A;  4K7B A;  2XL4 A;  4YT5 A;  4CS7 A;  3EFO A;  3JSZ A;  3QZC A;  2KQ9 A;  3ASN C;  2J7P A;  4BJ6 A;  2J9U A;  2Y3G A;  1RJ9 B;  4FX5 A;  3S0X A;  3CZ6 A;  3EGX B;  2Y3B A;  1JPJ A;  4AK9 A;  5KYX A;  1VYK A;  2FFH A;  2FGY A;  3B0P A;  4G7Z F;  2NG1 A;  4U5C E;  1LS1 A;  3SNH A;  3LS1 A;  1M2V A;  5B3S C;  3UMH A;  3I4U A;  4Q7C A;  2HV6 A;  2WZF A;  1D1A A;  2A6H F;  2C03 A;  3ECS A;  4C7O A;  2DYR C;  2G3K A;  2D5R B;  4U5G A;  1V55 C;  2ZXR A;  2IXM A;  4U5E E;  4ANJ A;  4YT2 A;  1ZHX A;  4DVY P;  1MMA A;  2Q9A A;  3K1H A;  5F5H A;  5HSW A;  3T6J A;  4AX2 A;  4HEA J;  4PJM A;  3OWT A;  4AE4 B;  2Y3D A;  3IEE A;  3N2Z B;  5T3T A;  4EBB A;  2Z15 A;  4BJT A;  5DS4 A;  3DMD A;  3SZR A;  4PJJ A;  4U5H A;  1TR2 A;  4X0R A;  4RDA A;  4O7G A;  2Q9C A;  5D92 A;  4C3B A;  2Q9B A;  4LAC B;  4YT8 A;  2WB7 A;  1BR2 A;  5L3V A;  1N1C A;  2YZS A;  2EIM C;  5CI9 A;  1IW7 F;  2OCC C;  3H65 A;  1BR4 A;  1ZHZ A;  4G7H F;  4ZLC A;  2W4B A;  3ZG1 A;  3UNG C;  4C3D A;  5DS6 A;  3POV A;  3DAF A;  3VAY A;  2MWQ A;  4W8K A;  4Q5S F;  2I8B A;  4IJJ A;  4LLE A;  4M63 A;  3DM5 A;  2VB6 A;  4QI0 A;  3FAJ A;  3S27 A;  3FHD A;  3LJB A;  3T4R A;  3EHM A;  3DXJ F;  3K66 A;  2L81 A;  1D1B A;  2R7O A;  2WVO A;  4MQ9 F;  4G0H A;  4YN0 B;  2R7W A;  2J7P D;  1M2O A;  1LKX A;  5D91 A;  3NDB B;  2R7X A;  2R7V A;  3SYN A;  5T1D B;  4G7O F;  2DYS C;  3X2Q C;  3JT1 A;  1V54 C;  2VAS A;  4KBL A;  4PK4 A;  3UGP A;  1KU2 A;  1SF8 A;  4U5D E;  2J9W A;  1Z3I X;  3QMK A;  2CGE A;  3RYL A;  4JZA A;  3AQB A;  3EQL F;  1OKK D;  3AG1 C;  2P7V A;  2ZXP A;  2PP4 A;  4H4K C;  3ITF A;  2A69 F;  3LLI A;  2J0X A;  1MMD A;  2BE5 F;  2LSE A;  3NYL A;  4JUR I;  4OIO F;  1TWA A;  2NUP B;  1RJ9 A;  2J9V A;  2CNW A;  1TKN A;  4IWB A;  3EGX A;  2NUT B;  3JCU Q;  4XWJ A;  3L34 A;  3HJC A;  4YT4 A;  2IOQ A;  3ASO C;  2R7U A;  2XSE A;  1G8X A;  4O79 A;  2E87 A;  3O39 A;  4N06 A;  1PCX A;  4IAO A;  3DJU B;  5KYY B;  4YWQ A;  1FMV A;  3EH1 A;  4DBR A;  3NYM A;  3N24 A;  3Q6N A;  5KYW B;  3S29 A;  2KW3 C;  2P6V A;  1PD0 A;  2Y3H A;  3MX3 A;  3Q6M A;  2XXA B;  3W8I A;  1D1C A;  1IZM A;  2MYS A;  1M57 C;  1Z6A A;  3MLG A;  1OCO C;  4LER A;  4RBN A;  3CSK A;  1M2V B;  4AE4 A;  5T3W A;  1W2W A;  2X51 A;  3LLK A;  4KNW A;  1ZU5 A;  3N0T A;  4MND A;  3E9V A;  1NU7 D;  3RIP A;  2WVN A;  2KJG A;  3F46 A;  2EIJ C;  4OIN F;  3O6X A;  3E70 C;  2W9Y A;  3DJN B;  1LVK A;  3JYH A;  3Q7L A;  4O6Y A;  4HFF B;  4DVZ A;  1Z63 A;  5E33 A;  3OEO A;  3EGD A;  1FFH A;  1ZHT A;  3EZI A;  2O9X A;  2ZPA A;  1D0X A;  5B1B C;  2WL8 A;  1TWH A;  2DGJ A;  2V3C C;  5B1A C;  5E3C A;  2R7S A;  2EIL C;  4PFP A;  2M4E A;  2EIN C;  3ZC4 A;  2QY9 A;  4JW1 A;  2YHS A;  3EG9 B;  3W2V A;  5FCL A;  1OCR C;  2JD3 A;  1ZU4 A;  3GAN A;  3AG4 C;  3CQZ A;  4YJW A;  1O5H A;  1VMA A;  3X1O A;  4HE8 D;  5F5F A;  4QI2 A;  4F4B A;  4GYT A;  4BEJ A;  4XLP F;  2L9J A;  3K1I C;  4ZLD A;  4GEH A;  4O6M A;  1ZHY A;  3DZA A;  4EWC A;  2R7T A;  3KKB A;  1M56 C;  3GOD A;  4RD9 A;  1MMG A;  1VK5 A;  3B0U X;  2G3V A;  3PMR A;  2IXO A;  4ULW A;  3EHN A;  3HTK C;  4OD4 A;  1ZYR F;  4P6I C;  3W2W A;  4E7S A;  4BJ1 A;  2B0J A;  3L0I A;  1WGW A;  5DS5 A;  2NUP A;  4OIR F;  1PD1 A;  3ABK C;  4PFO A;  2NUT A;  2Y39 A;  4CIH A;  2EIK C;  3RKO F;  3KL4 A;  3UGO A;  5KYU B;  3ZVR A;  3RH3 A;  4OD5 A;  3DD7 A;  3NYJ A;  2H7O A;  3ABL C;  5KYY A;  4I1M A;  1VYI A;  5EGY A;  3EFO B;  3ZIB A;  2W4M A;  4FWV A;  5KYW A;  1BR1 A;  3EJN A;  4QDL A;  3WG7 C;  4WJ0 A;  2XXA A;  1VOM A;  5EHH A;  3AG3 C;  3VYW A;  3M1C B;  2CW0 F;  2YEV A;  2OG2 A;  5KYX B;  1D0Z A;  5L3Q A;  3HLZ A;  3AG2 C;  2KNH A;  2CDQ A;  4U5F E;  4I44 A;  5E3A A;  4BJ6 C;  1J8M F;  4A2N B;  3NRH A;  4JCH A;  4DOZ A;  1FFT C;  1Z5Z A;  3I5P A;  4B6I A;  1TWC A;  2W45 A;  4CSA A;  5E2Q A;  2H7V C;  1OKK A;  2C04 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...