4C3EA

Hrsv m2-1 mutant s58d s61d, p21 crystal
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
177
structure length
172
Chain Sequence
LGSMSRRNPCKFEIRGHCLNGKRCHFSHNYFEWPPHALLVRQNFMLNRILKSMDLDEIDGAAELDRTEEYALGVVGVLESYIGSINNITKQSACVAMSKLLTELNSDDIKKLRDNEELNSPKIRVYNTVISYIESNRKNNKQTIHLLKRLPADVLKKTIKNTLDIHKSITIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MATRIX M2-1
publication title Crystal Structure of the Essential Transcription Antiterminator M2-1 Protein of Human Respiratory Syncytial Virus and Implications of its Phosphorylation.
pubmed doi rcsb
source organism Human respiratory syncytial virus
molecule tags Viral protein
total genus 58
structure length 172
sequence length 177
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P
ec nomenclature
pdb deposition date 2013-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06436 Pneumovirus_M2 Pneumovirus matrix protein 2 (M2)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1350 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4c3eA00
4CS9A 4CSAC 4C3BA 2L9JA 4CS7A 4CSAA 4CS8C 4C3DA 4C3EA 4CS9C 4CS8A
chains in the Genus database with same CATH superfamily
2KQ9A 2W45A 2YEVA 3AQBA 3CSKA 3DJNB 3U3BA 5KYYA 2AU5A 3MFNA 4JTAB 2JX0A 3RH3A 2EIMC 3GM2A 4ULVA 1C03A 2LP4A 3GWLA 4WABA 4W8PA 4CS7A 3SXMA 3W2VA 4OINF 4K0DA 3CAXA 1D1AA 4CJOA 1EA8A 1RKCA 1OW8A 1PCXA 5E2QA 3ZVRA 3I5QA 4HEAJ 3S84A 1LI5A 2P6VA 3HTKC 3HNKA 3FOOA 4E7SA 3JT1A 3U9JA 1A0BA 1ORYA 1TWAA 2B0JA 2JPUA 2A0BA 3ASNC 1RKEA 3C8GD 1TR2A 2OEXA 3JYYA 3L8JA 4F4BA 5IY5C 4IB4A 1ZHZA 2MHRA 3W2WA 1M57C 3B9QA 3A9CA 1ZU5A 5BQGA 4RBNA 3IQCA 3N2ZB 1YYXA 3TOLA 1RXQA 2WZFA 3LEOA 4WGZA 4YJWA 5BQIA 5KYUB 2EILC 3S29A 4NQFA 5EHHA 4QI0A 1LE4A 2YHSA 2ZXWC 2R02A 4YWQA 1Q0FA 2DYRC 4BJ5A 2XXAA 2DYSC 1NU9C 2J0XA 3LNRA 4ZLDA 5JUAA 3QZCA 3NKEA 5COGA 4K1OA 1FAPB 5L0CA 4OIPF 2XL8A 5F28E 2ZXPA 2E87A 4QDLA 5DS6A 4U5HA 5T3TA 3W8HA 1PD1A 2GWWA 1T01A 5L0GA 1E85A 3EFOA 4MVUA 2CCYA 3W8IA 4DVZA 2DGJA 3KPHA 1T6UA 2G62A 3Q6NA 2LFFA 4JKVA 3UR3C 2PNOA 2QNLA 4MVRA 2P7VA 1JMWA 2PX0A 3GODA 3OA1A 2H7VC 2HJ3A 4XPXA 3BEHA 4RDAA 3OEOA 3UGOA 3ITFA 3JZ0A 4MVZA 1FNTc 3EHMA 1HE1A 3CZ6A 3HNJA 2R9RB 1G8XA 3FAJA 3IEEA 1QVXA 4NTFA 2ZD9A 3Q7GA 3TULA 4ER9A 2R7UA 2LCHA 1FFHA 4CS9A 2XXAB 1FMVA 2DB4A 3SP1A 1SYQA 2M64A 1EQ1A 2AWCA 3NG1A 3V5ZA 2CDQA 1RKEB 3PDMP 2IXMA 4IRUA 1O87A 4BPMA 4M63A 4YN0B 1B68A 2CYDA 2HUJA 3M79A 5JT4A 3UNGC 2Y3HA 5B1BC 1C02A 3LLKA 5K0IA 2Q9BA 2QE9A 5DQZA 2HJMA 1Q0MA 2OG2A 4ULWA 3C18A 1OR2A 3EH2A 2YL7A 3JTLO 2NSGA 4E17A 3QVZA 4JCZA 1VMAA 1ZHXA 1NZEA 1M2OA 3MBGA 4XEKA 4U5GA 1FR0A 2OOCA 1UG7A 3GEIA 4JJFA 5B3IA 2P1AA 4U5CE 3LAYA 3GWNA 3SNHA 4N6HA 2NUPB 5BUOA 1VK5A 2A6EF 5A6AA 1Q0KA 1MMGA 2ETSA 2GDCA 3KKBA 1TQGA 3GANA 1OQCA 1QPUA 1WN0A 2WVQA 2GFHA 3LLIA 1YYJA 3DAGA 3G4ZA 5DQTA 2X51A 4IJJA 4Z9IA 3J06A 1ORJA 1T6QA 4FAPB 2J9VA 4AE4B 3DM9B 2Z15A 4J32B 1ZW2A 3EHNA 1H6GA 4O6MA 2LFDA 1J8YF 2J8WA 1TWCA 4LACB 3K66A 1FFTC 1Y4CA 1Z7Qc 3KYJA 1BR1A 2A69F 2L9JA 1WATA 1A7VA 3JCUQ 1JR8A 1LI7A 3JSZA 2L7AA 3U8VA 1IZMA 3K6BA 2CGEA 5D91A 3H65A 2J9WA 3MYFA 1L7CA 2HZ8A 3VYWA 1SR2A 3NMKA 1U6HA 1G4WR 2JD3A 3UMIA 5DS4A 4LLCA 3AG4C 3K7DA 4JURI 1TFOB 4E18A 4IAQA 4PACA 1RJ9B 4K7BA 4Z9JA 2Y39A 4AX2A 5JLIA 3EQLF 1M2VA 3VM6A 1HMDA 1FTSA 4JTCB 3LJBA 3GM1A 3US6A 4BJ6C 1MNEA 3L1MA 2WZLA 1BDJB 1ZHWA 2BL2A 3PMRA 1D0XA 4C7OA 1LKXA 3S0XA 3B71A 3U5SA 3U0CA 5HSWA 2YVKA 1VYIA 3ZC4A 1NG1A 1VB5A 2IXOA 1Q0DA 2ZXOA 2EPKX 1YJGA 4EWCA 1T6IA 3W4YA 5KYXA 3FHDA 2YQYA 4OD5A 5JVEA 2ZPAA 3L34A 3WODF 3JYHA 3LNMB 2WZGA 1N1CA 2EPMX 2IOQA 2WB7A 3AG1C 3FDQA 2XS8A 2YLDA 3HNIA 1Y6DA 4PR9A 3V5XA 5E3CA 3EG9B 5B3SC 3G4XA 1TWGA 4RD9A 2TMVP 5JSLA 1LS4A 1DOWA 5KYWA 4PFPA 3VAYA 2YKZA 4N06A 4DRIB 1KTMA 1SMYF 3B29A 1YLMA 3NMIA 1OKKA 2EINC 1OCZC 3DJUB 2ZXRA 4NTAA 2X0CA 3ZSUA 1LIHA 1LPEA 1QSPA 3M4CA 4IWBA 2L81A 3ASOC 1Z63A 1HY5A 1PV3A 1APCA 1YZAA 3FMSA 1EKYA 3EGDA 3KH2A 2QTVA 3O39A 3RQGA 1Q0GA 1LVKA 2YLIA 4N6CA 3UGPA 5T1DB 4XTKA 1RMVA 4JJGA 3RW0A 1E84A 1V74B 3DWWA 2YLGA 3AG3C 4BJ5C 3KMIA 4GYTA 2YWAA 2GA0A 4MTOA 1ZHYA 4DXWA 1YZCA 2H7BA 2C03A 4G7OF 1BZ4A 4U9DA 1ZW3A 4XLPF 3ZQYA 3DKAA 4DVYP 2KYHA 4I1MA 2R7XA 2LQGA 3MLGA 2NUTA 4JE9A 2XL6A 1YARO 3HKKA 4NCQA 1QQ3A 2AP3A 2W4BA 2UUIA 1JOGA 3DI5A 4YT5A 2XL4A 1O5HA 5E3AA 1M56C 2KK1A 3RIPA 5A6BA 3R7CA 4C7OB 5COFA 4Q4ZF 3EGXA 1MQVA 2KC3A 4O6YA 3U2MA 3EH1A 4BG0A 5KYYB 4J30B 2AWYA 2J7PD 2Q9AA 5CI8A 5TJ5E 3A11A 4O79A 2Q9CA 2R05A 2XLMA 4NTBA 4U5DE 3RKOF 2QLAA 2OU6A 2WVNA 4IGGA 5L0HA 3DE9A 2CNWD 4ONSA 3ZTMA 4CIHA 3EJNA 4CS9C 1OXKA 3R2PA 4EHPA 1YA7O 3SXYA 3HJCA 2YL3A 3HNLA 3IQ6A 3T9OA 3TK0A 3ZQVA 4DRHB 2OJED 3VF0A 3GEHA 3E9VA 3TJ5A 1HMOA 3UMKA 5HV9A 2PX3A 1WASA 1HW2A 4HFKB 2KGOA 3V5YA 4GQHA 3MX3A 4WGYA 1W2WA 3DD7A 1I5NA 2J45A 2VC9A 1MMAA 1Z3IX 3LEVA 4MVQA 1SF8A 4YT2A 1CGOA 2HV7A 4OD4A 2O9XA 4E0IA 4U5FE 1T9KA 2NPUA 3QW1A 2H7OA 3F46A 3B0VC 2XSEA 2LSEA 2IXPA 5A6JA 1TFKB 3NYMA 3B0UX 3SZRA 4AL1A 3U2LA 2EIKC 4MTGA 4E7ZA 1C17M 2PFDA 5A6KA 3DE8A 3QW0A 3VRCA 1VYKA 2LIGA 2WL8A 4JEAA 2C04A 2NUTB 1BR4A 3C63A 3Q7LA 4NY3A 2LD6A 3O6XA 4U9EA 3LS0A 4CBEA 2D4UA 3DXJF 4P6IC 1BR2A 4QI2A 3AOUA 3N0TA 3NKDA 2GAQA 1YDIA 1LE2A 3EFOB 3QVYA 4DBQA 1VTMP 1S05A 1LM3B 2M4EA 4YL1A 2P0NA 2VCCA 3V7OA 5DVWA 1UFBA 3EGXB 3PCVA 1GS9A 5KYNA 4Q5SF 5AC4A 1NLXA 4D4NA 1ZZPA 2QUPA 5CI9A 1G5ZA 4MW3A 1OCCC 3SXZA 4I3MA 2VASA 3QMKA 3C8GA 3ABMC 3ZG1A 1G4US 4BJTA 1GGQA 2A6HF 2A68F 4A4AA 2HSQA 2AVKA 2H8AA 2V3CC 2XLDA 1FMWA 2G3KA 3RQFA 2P61A 4U5EE 4C3EA 3C7JA 5EGYA 1A7DA 1CGNA 2BC5A 4KI2A 4B6IA 4CX9A 2G3VA 3AG2C 2LK4A 2Q4FA 3K1IA 2FFHA 4G7HF 2NG1A 2HFIA 4P9FA 3SXKA 1RCPA 4XQ1A 3IQ5A 4PJMA 2OEVA 2XLVA 3LESA 4OIRF 1OR3A 2UUHA 2YZSA 5L3VA 3TQOA 3NYLA 1YAUO 2HKVA 3IQTA 4H54A 2OQMA 2J9BA 3TJ6A 1A7EA 4LDQA 4NC3A 1Z5ZA 4JRZA 5AGFA 5DLJA 1XZQA 4WJ0A 4KC9A 2I8BA 1PD0A 4JW1A 3GORA 4XLNF 3GEEA 1R4TA 1BBHA 1J8MF 1GM5A 3DM5A 2VH3A 4JZAA 2XLHA 2PBEA 4JTDB 2R7TA 4CDYA 2KNHA 2Y3BA 4MVMA 3DAFA 2HMZA 4EBKA 1IW7F 1QKRA 4YL0A 4OIOF 3MYIA 1WTYA 4AL0A 4XEVA 3H2VA 3O10A 5L0IA 2NSFA 3AGUA 1DOVA 2J9UA 4FESA 4ANJA 3KYIA 3RF3A 3ZTZA 4EIYA 3DMDA 5FCLA 3RVZA 2ICWG 3I4UA 3T6GB 1T5OA 1QLEC 4LDKA 4MNDA 4XPYA 2XS1A 1KU2A 2HV6A 2IM8A 3PHF2 3KL4A 3UMHA 3FVYA 3NRHA 4EUKB 4P9TA 2DI3A 5BQHA 1GQAA 4O6NA 4CJGA 4CS8C 5D92A 3C8GB 3BRJA 4MW8A 2IYLD 4CS8A 3EZIA 5E33A 5EK0A 4Z9HA 4CIPA 4UDVA 4LLEA 1V54C 3T6BA 4AK9A 1XWJA 4Q7CA 2KJGA 4HFFB 1NSGB 1ZU4A 2IBFA 1CPQA 4XWJA 2R7WA 2EPLX 3LS1A 1MNDA 3SEOA 2RSEB 4L6RA 4MVOA 1V4AA 3C62A 1XZPA 4JEBA 4ZLCA 1QZXA 1WWPA 1I4ZA 4G7ZF 4MVSA 1LS1A 2BE5F 1M2VB 2A1DD 3C8ZA 1OXBA 4CSAA 1Z6AA 2R7OA 3F47A 3GM3A 3AGTA 3FAPB 3CQZA 1ORSC 2MYSA 4PJLA 4YK5A 4PJJA 3ZDLA 4D4XA 3U3FA 1F1MA 4LERA 4XPWA 3M1CB 1CPRA 4MTFA 5T3WA 4JIOA 5F5FA 1R5ID 3I5PA 2Q3TA 4YT4A 4J7TA 3FXHA 5KYXB 1KNYA 4KNVA 1A41A 4H4KC 4BEMJ 3K33A 1WGWA 3JRTA 5CIVA 4I44A 3X1OA 1JAFA 2NUPA 2HSBA 1U89A 5COMA 3ZWIA 3FOPA 4LDRA 2XLWA 5F5HA 1E83A 1MMNA 3ABLC 1JRAA 5KYWB 3WHNA 1VOMA 2VCAA 3S28A 1OCOC 2RD9A 3M15A 1VLTA 4EBBA 4DRJB 1VLSA 4N4WA 2KSFA 4AE4A 3K1HA 2D5RB 2R03A 3G50A 4MQ9F 3TD7A 1H9GA 1ST6A 4J7YA 1K05A 3EGDB 1E2XA 1D1BA 1H9TA 4PJNA 1MMDA 3RQEA 3ZIBA 3NYJA 5L0DA 5L0JA 1JPNA 4MS2A 2IXNA 1HE9A 1O3UA 3DZAA 2HS5A 3S27A 2YL1A 4BEJA 2XM4A 1TWHA 2Q00A 2R25A 1OKKD 4FWVA 1ZYRF 4EBJA 5JP7A 1H7IA 3RYLA 2ASRA 2EPNA 4EKWA 3QTHA 3IPMO 1D1CA 5AC5A 2A0UA 2FAPB 1E86A 3Q6MA 1RJ9A 2YRFA 4DOZA 4G0HA 4DJ9A 1NFNA 2I15A 2L6FA 2OKUA 2XLEA 2XRHA 1AUEA 3EPVA 2QY9A 3E70C 2L6HA 1M6TA 3O55A 4YL3A 4DBRA 4JCHA 1ZVZA 3U9MA 2W4MA 2OJQA 2XM0A 5A69A 2VCBA 1V55C 5JS5A 1AEPA 1HW1A 2Y69C 4G78A 1D0YA 2R7VA 4IARA 1I4YA 2Y3GA 4OIQF 4JVSA 4IAOA 3TOMA 3NDBB 3L8IA 3RVYA 4PK4A 1JPJA 1TKNA 5FZTA 1YA9A 3T4RA 5A6BD 2FGYA 2HMQA 4U5BE 3ATPA 2B0HA 3EG9A 1K04A 3K1IC 3IHUA 4W8KA 1AVOB 2MWQA 2L6GA 1OW7A 3EZHA 4GEHA 4C3DA 256BA 3S90A 2WVOA 2EIJC 3B0PA 3ECSA 4O7GA 2Y3DA 5JRAA 2R7SA 1L3PA 4E0HA 2CW0F 3M4BA 3T6JA 2PF4E 3HLZA 4YT8A 4I1OB 3N24A 4HE8D 2R7RA 5GPGB 4BJ1A 3H2UA 1S7ZA 3SYNA 3JSEO 4PFOA 1EI7A 2R7QA 3POVA 3X2QC 1NBBA 3OWTA 2W9YA 4R32A 2EPOA 5KYUA 2Q7RA 1OCRC 1SZIA 2KW3C 4KBLA 1NU7D 1Z23A 2VB6A 1OW6A 4KNWA 2F22A 5L3QA 1D0ZA 5L0FA 3RFYA 4CDVA 2OCCC 2J46A 1NFOA 3ABKC 3AJMA 1U0BB 1YVIA 3LUTB 1K40A 4XEFA 4CSAC 3CEXA 4CDAA 4A2NB 2J0WA 1ZHTA 4JC7A 4C3BA 2J7PA 3U8PA 4FX5A 2V26A 3WG7C 3AQCA 3JRMO 5B1AC 2XLOA 1CGME 2CNWA 3NMJA 3L0IA 3WAQA 1WOLA 4BJ6A 2YL0A 3S9OA 4X0RA 2PP4A 5DS5A
chains in the Genus database with same CATH topology
2KQ9A 2W45A 2YEVA 3AQBA 3CSKA 3DJNB 5KYYA 3RH3A 2EIMC 4CS7A 3W2VA 4OINF 4K0DA 1D1AA 5E2QA 1PCXA 3ZVRA 3I5QA 4HEAJ 2P6VA 3HTKC 4E7SA 3JT1A 1TWAA 2B0JA 4CSAC 3ASNC 4F4BA 1TR2A 5IY5C 1ZHZA 3W2WA 1M57C 3B9QA 1ZU5A 4RBNA 3N2ZB 2WZFA 5KYUB 4YJWA 2EILC 3S29A 5EHHA 4QI0A 2YHSA 2ZXWC 4YWQA 2DYRC 4BJ5A 2DYSC 1NU9C 2J0XA 3LNRA 4ZLDA 3QZCA 3NKEA 4OIPF 2ZXPA 2E87A 4QDLA 5DS6A 4U5HA 5T3TA 3W8HA 1PD1A 3EFOA 3W8IA 4DVZA 2DGJA 2G62A 3Q6NA 3UR3C 2P7VA 2PX0A 3OA1A 3GODA 2H7VC 4RDAA 3OEOA 3UGOA 3ITFA 3EHMA 3CZ6A 1G8XA 3FAJA 3IEEA 3Q7GA 2R7UA 1FFHA 4CS9A 2XXAB 1FMVA 3SP1A 3NG1A 2CDQA 2IXMA 4IRUA 1O87A 4M63A 4YN0B 3UNGC 2Y3HA 5B1BC 3LLKA 2Q9BA 5DQZA 2OG2A 4ULWA 3EH2A 1VMAA 1ZHXA 1NZEA 1M2OA 4U5GA 4JJFA 4U5CE 3LAYA 3SNHA 2NUPB 5BUOA 1VK5A 2A6EF 1MMGA 3KKBA 3GANA 2WVQA 2GFHA 3LLIA 5DQTA 3DAGA 2X51A 4IJJA 2J9VA 4AE4B 3DM9B 2Z15A 4J32B 3EHNA 4O6MA 1J8YF 4LACB 1TWCA 3K66A 1FFTC 1BR1A 2A69F 2L9JA 3JCUQ 3JSZA 1IZMA 3K6BA 2CGEA 5D91A 3H65A 2J9WA 3VYWA 2JD3A 3UMIA 5DS4A 4LLCA 3AG4C 3K7DA 4JURI 1RJ9B 4K7BA 2Y39A 4AX2A 3EQLF 1M2VA 4BJ6C 1FTSA 3LJBA 1MNEA 2WZLA 1ZHWA 3PMRA 1D0XA 4C7OA 1LKXA 3S0XA 5HSWA 1VYIA 3ZC4A 1NG1A 2IXOA 2ZXOA 4EWCA 5KYXA 3FHDA 4OD5A 2ZPAA 3L34A 3WODF 3JYHA 2WZGA 1N1CA 2IOQA 3AG1C 2WB7A 3FDQA 5E3CA 3EG9B 5B3SC 1TWGA 4RD9A 5KYWA 4PFPA 3VAYA 4N06A 1SMYF 1OKKA 2EINC 1OCZC 3DJUB 2ZXRA 3ZSUA 4IWBA 2L81A 3ASOC 1Z63A 3EGDA 3KH2A 2QTVA 3O39A 1LVKA 3UGPA 5T1DB 4XTKA 4JJGA 3AG3C 4BJ5C 3KMIA 4GYTA 1ZHYA 2H7BA 2C03A 4G7OF 4XLPF 4DVYP 4I1MA 2R7XA 3MLGA 2NUTA 2W4BA 4YT5A 2XL4A 1O5HA 5E3AA 1M56C 3RIPA 4C7OB 4Q4ZF 3EGXA 4O6YA 3EH1A 4BG0A 5KYYB 4J30B 2J7PD 2Q9AA 5CI8A 4O79A 2Q9CA 4U5DE 3RKOF 2WVNA 2CNWD 4CIHA 3EJNA 4CS9C 3HJCA 3E9VA 3UMKA 2PX3A 4HFKB 2KGOA 3MX3A 1W2WA 3DD7A 2J45A 3LEVA 1MMAA 1Z3IX 4YT2A 1SF8A 2HV7A 4OD4A 2O9XA 4U5FE 2H7OA 3F46A 3B0VC 2XSEA 2LSEA 2IXPA 3NYMA 3B0UX 3SZRA 2EIKC 4E7ZA 2PFDA 1VYKA 2WL8A 2C04A 2NUTB 1BR4A 3Q7LA 4NY3A 3O6XA 4CBEA 3LS0A 3DXJF 4P6IC 1BR2A 4QI2A 3N0TA 3NKDA 3EFOB 4DBQA 2M4EA 3V7OA 5DVWA 3EGXB 4Q5SF 5CI9A 1OCCC 3ZG1A 4I3MA 2VASA 3QMKA 3ABMC 4BJTA 2A6HF 2A68F 2V3CC 1FMWA 2G3KA 4U5EE 4C3EA 5EGYA 4KI2A 4B6IA 2G3VA 3AG2C 2FFHA 4G7HF 2NG1A 4PJMA 3LESA 4OIRF 2YZSA 5L3VA 3NYLA 1Z5ZA 5DLJA 4WJ0A 4KC9A 2I8BA 1PD0A 4JW1A 4XLNF 1J8MF 2R7TA 3DM5A 2VH3A 4JZAA 2KNHA 2Y3BA 3DAFA 1IW7F 4OIOF 4FESA 4ANJA 2J9UA 3DMDA 5FCLA 3I4UA 1QLEC 4MNDA 3PHF2 1KU2A 2HV6A 3KL4A 3UMHA 3FVYA 3NRHA 4O6NA 4CS8C 5D92A 4CS8A 2IYLD 3EZIA 5E33A 4LLEA 1V54C 3T6BA 4AK9A 4Q7CA 2KJGA 4HFFB 1ZU4A 2R7WA 2XXAA 4XWJA 3LS1A 1MNDA 3SEOA 4ZLCA 1QZXA 4G7ZF 1LS1A 2BE5F 1M2VB 2A1DD 4CSAA 1Z6AA 2R7OA 3F47A 3CQZA 2MYSA 4PJLA 5KYNA 4PJJA 4LERA 5F5FA 5T3WA 3M1CB 3I5PA 2Q3TA 4YT4A 5KYXB 4KNVA 4H4KC 3K33A 1WGWA 3JRTA 4I44A 3X1OA 2NUPA 5F5HA 1MMNA 3ABLC 5KYWB 1VOMA 3S28A 1OCOC 4EBBA 4AE4A 3K1HA 2D5RB 4MQ9F 3TD7A 1ST6A 3EGDB 1D1BA 4PJNA 1MMDA 3ZIBA 3NYJA 1JPNA 2IXNA 3DZAA 3S27A 4BEJA 1TWHA 1OKKD 4FWVA 1ZYRF 3RYLA 1D1CA 3Q6MA 1RJ9A 4DOZA 4G0HA 2XRHA 3EPVA 2QY9A 3E70C 4DBRA 4JCHA 2W4MA 1V55C 2Y69C 1D0YA 2R7VA 2Y3GA 4OIQF 4JVSA 4IAOA 3NDBB 4PK4A 1JPJA 1TKNA 3T4RA 2FGYA 4U5BE 3EG9A 3K1IC 4W8KA 2MWQA 3EZHA 4C3DA 4GEHA 2WVOA 2EIJC 3B0PA 3ECSA 4O7GA 2Y3DA 2R7SA 2CW0F 3T6JA 2PF4E 3HLZA 4YT8A 4I1OB 3N24A 4HE8D 2R7RA 4BJ1A 1S7ZA 3SYNA 4PFOA 3POVA 2R7QA 3X2QC 3OWTA 2W9YA 5KYUA 1OCRC 1SZIA 2KW3C 4KBLA 1NU7D 1Z23A 2VB6A 4KNWA 5L3QA 1D0ZA 3RFYA 2OCCC 2J46A 3ABKC 4A2NB 2J0WA 1ZHTA 4C3BA 2J7PA 4FX5A 2V26A 3WG7C 3AQCA 5B1AC 2CNWA 3L0IA 4BJ6A 4X0RA 2PP4A 5DS5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CS9 A;  4CSA C;  4C3B A;  2L9J A;  4CS7 A;  4CSA A;  4CS8 C;  4C3D A;  4C3E A;  4CS9 C;  4CS8 A; 
#chains in the Genus database with same CATH topology
 2KQ9 A;  2W45 A;  2YEV A;  3AQB A;  3CSK A;  3DJN B;  3U3B A;  5KYY A;  2AU5 A;  3MFN A;  4JTA B;  2JX0 A;  3RH3 A;  2EIM C;  3GM2 A;  4ULV A;  1C03 A;  2LP4 A;  3GWL A;  4WAB A;  4W8P A;  4CS7 A;  3SXM A;  3W2V A;  4OIN F;  4K0D A;  3CAX A;  1D1A A;  4CJO A;  1EA8 A;  1RKC A;  1OW8 A;  1PCX A;  5E2Q A;  3ZVR A;  3I5Q A;  4HEA J;  3S84 A;  1LI5 A;  2P6V A;  3HTK C;  3HNK A;  3FOO A;  4E7S A;  3JT1 A;  3U9J A;  1A0B A;  1ORY A;  1TWA A;  2B0J A;  2JPU A;  2A0B A;  3ASN C;  1RKE A;  3C8G D;  1TR2 A;  2OEX A;  3JYY A;  3L8J A;  4F4B A;  5IY5 C;  4IB4 A;  1ZHZ A;  2MHR A;  3W2W A;  1M57 C;  3B9Q A;  3A9C A;  1ZU5 A;  5BQG A;  4RBN A;  3IQC A;  3N2Z B;  1YYX A;  3TOL A;  1RXQ A;  2WZF A;  3LEO A;  4WGZ A;  4YJW A;  5BQI A;  5KYU B;  2EIL C;  3S29 A;  4NQF A;  5EHH A;  4QI0 A;  1LE4 A;  2YHS A;  2ZXW C;  2R02 A;  4YWQ A;  1Q0F A;  2DYR C;  4BJ5 A;  2XXA A;  2DYS C;  1NU9 C;  2J0X A;  3LNR A;  4ZLD A;  5JUA A;  3QZC A;  3NKE A;  5COG A;  4K1O A;  1FAP B;  5L0C A;  4OIP F;  2XL8 A;  5F28 E;  2ZXP A;  2E87 A;  4QDL A;  5DS6 A;  4U5H A;  5T3T A;  3W8H A;  1PD1 A;  2GWW A;  1T01 A;  5L0G A;  1E85 A;  3EFO A;  4MVU A;  2CCY A;  3W8I A;  4DVZ A;  2DGJ A;  3KPH A;  1T6U A;  2G62 A;  3Q6N A;  2LFF A;  4JKV A;  3UR3 C;  2PNO A;  2QNL A;  4MVR A;  2P7V A;  1JMW A;  2PX0 A;  3GOD A;  3OA1 A;  2H7V C;  2HJ3 A;  4XPX A;  3BEH A;  4RDA A;  3OEO A;  3UGO A;  3ITF A;  3JZ0 A;  4MVZ A;  1FNT c;  3EHM A;  1HE1 A;  3CZ6 A;  3HNJ A;  2R9R B;  1G8X A;  3FAJ A;  3IEE A;  1QVX A;  4NTF A;  2ZD9 A;  3Q7G A;  3TUL A;  4ER9 A;  2R7U A;  2LCH A;  1FFH A;  4CS9 A;  2XXA B;  1FMV A;  2DB4 A;  3SP1 A;  1SYQ A;  2M64 A;  1EQ1 A;  2AWC A;  3NG1 A;  3V5Z A;  2CDQ A;  1RKE B;  3PDM P;  2IXM A;  4IRU A;  1O87 A;  4BPM A;  4M63 A;  4YN0 B;  1B68 A;  2CYD A;  2HUJ A;  3M79 A;  5JT4 A;  3UNG C;  2Y3H A;  5B1B C;  1C02 A;  3LLK A;  5K0I A;  2Q9B A;  2QE9 A;  5DQZ A;  2HJM A;  1Q0M A;  2OG2 A;  4ULW A;  3C18 A;  1OR2 A;  3EH2 A;  2YL7 A;  3JTL O;  2NSG A;  4E17 A;  3QVZ A;  4JCZ A;  1VMA A;  1ZHX A;  1NZE A;  1M2O A;  3MBG A;  4XEK A;  4U5G A;  1FR0 A;  2OOC A;  1UG7 A;  3GEI A;  4JJF A;  5B3I A;  2P1A A;  4U5C E;  3LAY A;  3GWN A;  3SNH A;  4N6H A;  2NUP B;  5BUO A;  1VK5 A;  2A6E F;  5A6A A;  1Q0K A;  1MMG A;  2ETS A;  2GDC A;  3KKB A;  1TQG A;  3GAN A;  1OQC A;  1QPU A;  1WN0 A;  2WVQ A;  2GFH A;  3LLI A;  1YYJ A;  3DAG A;  3G4Z A;  5DQT A;  2X51 A;  4IJJ A;  4Z9I A;  3J06 A;  1ORJ A;  1T6Q A;  4FAP B;  2J9V A;  4AE4 B;  3DM9 B;  2Z15 A;  4J32 B;  1ZW2 A;  3EHN A;  1H6G A;  4O6M A;  2LFD A;  1J8Y F;  2J8W A;  1TWC A;  4LAC B;  3K66 A;  1FFT C;  1Y4C A;  1Z7Q c;  3KYJ A;  1BR1 A;  2A69 F;  2L9J A;  1WAT A;  1A7V A;  3JCU Q;  1JR8 A;  1LI7 A;  3JSZ A;  2L7A A;  3U8V A;  1IZM A;  3K6B A;  2CGE A;  5D91 A;  3H65 A;  2J9W A;  3MYF A;  1L7C A;  2HZ8 A;  3VYW A;  1SR2 A;  3NMK A;  1U6H A;  1G4W R;  2JD3 A;  3UMI A;  5DS4 A;  4LLC A;  3AG4 C;  3K7D A;  4JUR I;  1TFO B;  4E18 A;  4IAQ A;  4PAC A;  1RJ9 B;  4K7B A;  4Z9J A;  2Y39 A;  4AX2 A;  5JLI A;  3EQL F;  1M2V A;  3VM6 A;  1HMD A;  1FTS A;  4JTC B;  3LJB A;  3GM1 A;  3US6 A;  4BJ6 C;  1MNE A;  3L1M A;  2WZL A;  1BDJ B;  1ZHW A;  2BL2 A;  3PMR A;  1D0X A;  4C7O A;  1LKX A;  3S0X A;  3B71 A;  3U5S A;  3U0C A;  5HSW A;  2YVK A;  1VYI A;  3ZC4 A;  1NG1 A;  1VB5 A;  2IXO A;  1Q0D A;  2ZXO A;  2EPK X;  1YJG A;  4EWC A;  1T6I A;  3W4Y A;  5KYX A;  3FHD A;  2YQY A;  4OD5 A;  5JVE A;  2ZPA A;  3L34 A;  3WOD F;  3JYH A;  3LNM B;  2WZG A;  1N1C A;  2EPM X;  2IOQ A;  2WB7 A;  3AG1 C;  3FDQ A;  2XS8 A;  2YLD A;  3HNI A;  1Y6D A;  4PR9 A;  3V5X A;  5E3C A;  3EG9 B;  5B3S C;  3G4X A;  1TWG A;  4RD9 A;  2TMV P;  5JSL A;  1LS4 A;  1DOW A;  5KYW A;  4PFP A;  3VAY A;  2YKZ A;  4N06 A;  4DRI B;  1KTM A;  1SMY F;  3B29 A;  1YLM A;  3NMI A;  1OKK A;  2EIN C;  1OCZ C;  3DJU B;  2ZXR A;  4NTA A;  2X0C A;  3ZSU A;  1LIH A;  1LPE A;  1QSP A;  3M4C A;  4IWB A;  2L81 A;  3ASO C;  1Z63 A;  1HY5 A;  1PV3 A;  1APC A;  1YZA A;  3FMS A;  1EKY A;  3EGD A;  3KH2 A;  2QTV A;  3O39 A;  3RQG A;  1Q0G A;  1LVK A;  2YLI A;  4N6C A;  3UGP A;  5T1D B;  4XTK A;  1RMV A;  4JJG A;  3RW0 A;  1E84 A;  1V74 B;  3DWW A;  2YLG A;  3AG3 C;  4BJ5 C;  3KMI A;  4GYT A;  2YWA A;  2GA0 A;  4MTO A;  1ZHY A;  4DXW A;  1YZC A;  2H7B A;  2C03 A;  4G7O F;  1BZ4 A;  4U9D A;  1ZW3 A;  4XLP F;  3ZQY A;  3DKA A;  4DVY P;  2KYH A;  4I1M A;  2R7X A;  2LQG A;  3MLG A;  2NUT A;  4JE9 A;  2XL6 A;  1YAR O;  3HKK A;  4NCQ A;  1QQ3 A;  2AP3 A;  2W4B A;  2UUI A;  1JOG A;  3DI5 A;  4YT5 A;  2XL4 A;  1O5H A;  5E3A A;  1M56 C;  2KK1 A;  3RIP A;  5A6B A;  3R7C A;  4C7O B;  5COF A;  4Q4Z F;  3EGX A;  1MQV A;  2KC3 A;  4O6Y A;  3U2M A;  3EH1 A;  4BG0 A;  5KYY B;  4J30 B;  2AWY A;  2J7P D;  2Q9A A;  5CI8 A;  5TJ5 E;  3A11 A;  4O79 A;  2Q9C A;  2R05 A;  2XLM A;  4NTB A;  4U5D E;  3RKO F;  2QLA A;  2OU6 A;  2WVN A;  4IGG A;  5L0H A;  3DE9 A;  2CNW D;  4ONS A;  3ZTM A;  4CIH A;  3EJN A;  4CS9 C;  1OXK A;  3R2P A;  4EHP A;  1YA7 O;  3SXY A;  3HJC A;  2YL3 A;  3HNL A;  3IQ6 A;  3T9O A;  3TK0 A;  3ZQV A;  4DRH B;  2OJE D;  3VF0 A;  3GEH A;  3E9V A;  3TJ5 A;  1HMO A;  3UMK A;  5HV9 A;  2PX3 A;  1WAS A;  1HW2 A;  4HFK B;  2KGO A;  3V5Y A;  4GQH A;  3MX3 A;  4WGY A;  1W2W A;  3DD7 A;  1I5N A;  2J45 A;  2VC9 A;  1MMA A;  1Z3I X;  3LEV A;  4MVQ A;  1SF8 A;  4YT2 A;  1CGO A;  2HV7 A;  4OD4 A;  2O9X A;  4E0I A;  4U5F E;  1T9K A;  2NPU A;  3QW1 A;  2H7O A;  3F46 A;  3B0V C;  2XSE A;  2LSE A;  2IXP A;  5A6J A;  1TFK B;  3NYM A;  3B0U X;  3SZR A;  4AL1 A;  3U2L A;  2EIK C;  4MTG A;  4E7Z A;  1C17 M;  2PFD A;  5A6K A;  3DE8 A;  3QW0 A;  3VRC A;  1VYK A;  2LIG A;  2WL8 A;  4JEA A;  2C04 A;  2NUT B;  1BR4 A;  3C63 A;  3Q7L A;  4NY3 A;  2LD6 A;  3O6X A;  4U9E A;  3LS0 A;  4CBE A;  2D4U A;  3DXJ F;  4P6I C;  1BR2 A;  4QI2 A;  3AOU A;  3N0T A;  3NKD A;  2GAQ A;  1YDI A;  1LE2 A;  3EFO B;  3QVY A;  4DBQ A;  1VTM P;  1S05 A;  1LM3 B;  2M4E A;  4YL1 A;  2P0N A;  2VCC A;  3V7O A;  5DVW A;  1UFB A;  3EGX B;  3PCV A;  1GS9 A;  5KYN A;  4Q5S F;  5AC4 A;  1NLX A;  4D4N A;  1ZZP A;  2QUP A;  5CI9 A;  1G5Z A;  4MW3 A;  1OCC C;  3SXZ A;  4I3M A;  2VAS A;  3QMK A;  3C8G A;  3ABM C;  3ZG1 A;  1G4U S;  4BJT A;  1GGQ A;  2A6H F;  2A68 F;  4A4A A;  2HSQ A;  2AVK A;  2H8A A;  2V3C C;  2XLD A;  1FMW A;  2G3K A;  3RQF A;  2P61 A;  4U5E E;  4C3E A;  3C7J A;  5EGY A;  1A7D A;  1CGN A;  2BC5 A;  4KI2 A;  4B6I A;  4CX9 A;  2G3V A;  3AG2 C;  2LK4 A;  2Q4F A;  3K1I A;  2FFH A;  4G7H F;  2NG1 A;  2HFI A;  4P9F A;  3SXK A;  1RCP A;  4XQ1 A;  3IQ5 A;  4PJM A;  2OEV A;  2XLV A;  3LES A;  4OIR F;  1OR3 A;  2UUH A;  2YZS A;  5L3V A;  3TQO A;  3NYL A;  1YAU O;  2HKV A;  3IQT A;  4H54 A;  2OQM A;  2J9B A;  3TJ6 A;  1A7E A;  4LDQ A;  4NC3 A;  1Z5Z A;  4JRZ A;  5AGF A;  5DLJ A;  1XZQ A;  4WJ0 A;  4KC9 A;  2I8B A;  1PD0 A;  4JW1 A;  3GOR A;  4XLN F;  3GEE A;  1R4T A;  1BBH A;  1J8M F;  1GM5 A;  3DM5 A;  2VH3 A;  4JZA A;  2XLH A;  2PBE A;  4JTD B;  2R7T A;  4CDY A;  2KNH A;  2Y3B A;  4MVM A;  3DAF A;  2HMZ A;  4EBK A;  1IW7 F;  1QKR A;  4YL0 A;  4OIO F;  3MYI A;  1WTY A;  4AL0 A;  4XEV A;  3H2V A;  3O10 A;  5L0I A;  2NSF A;  3AGU A;  1DOV A;  2J9U A;  4FES A;  4ANJ A;  3KYI A;  3RF3 A;  3ZTZ A;  4EIY A;  3DMD A;  5FCL A;  3RVZ A;  2ICW G;  3I4U A;  3T6G B;  1T5O A;  1QLE C;  4LDK A;  4MND A;  4XPY A;  2XS1 A;  1KU2 A;  2HV6 A;  2IM8 A;  3PHF 2;  3KL4 A;  3UMH A;  3FVY A;  3NRH A;  4EUK B;  4P9T A;  2DI3 A;  5BQH A;  1GQA A;  4O6N A;  4CJG A;  4CS8 C;  5D92 A;  3C8G B;  3BRJ A;  4MW8 A;  2IYL D;  4CS8 A;  3EZI A;  5E33 A;  5EK0 A;  4Z9H A;  4CIP A;  4UDV A;  4LLE A;  1V54 C;  3T6B A;  4AK9 A;  1XWJ A;  4Q7C A;  2KJG A;  4HFF B;  1NSG B;  1ZU4 A;  2IBF A;  1CPQ A;  4XWJ A;  2R7W A;  2EPL X;  3LS1 A;  1MND A;  3SEO A;  2RSE B;  4L6R A;  4MVO A;  1V4A A;  3C62 A;  1XZP A;  4JEB A;  4ZLC A;  1QZX A;  1WWP A;  1I4Z A;  4G7Z F;  4MVS A;  1LS1 A;  2BE5 F;  1M2V B;  2A1D D;  3C8Z A;  1OXB A;  4CSA A;  1Z6A A;  2R7O A;  3F47 A;  3GM3 A;  3AGT A;  3FAP B;  3CQZ A;  1ORS C;  2MYS A;  4PJL A;  4YK5 A;  4PJJ A;  3ZDL A;  4D4X A;  3U3F A;  1F1M A;  4LER A;  4XPW A;  3M1C B;  1CPR A;  4MTF A;  5T3W A;  4JIO A;  5F5F A;  1R5I D;  3I5P A;  2Q3T A;  4YT4 A;  4J7T A;  3FXH A;  5KYX B;  1KNY A;  4KNV A;  1A41 A;  4H4K C;  4BEM J;  3K33 A;  1WGW A;  3JRT A;  5CIV A;  4I44 A;  3X1O A;  1JAF A;  2NUP A;  2HSB A;  1U89 A;  5COM A;  3ZWI A;  3FOP A;  4LDR A;  2XLW A;  5F5H A;  1E83 A;  1MMN A;  3ABL C;  1JRA A;  5KYW B;  3WHN A;  1VOM A;  2VCA A;  3S28 A;  1OCO C;  2RD9 A;  3M15 A;  1VLT A;  4EBB A;  4DRJ B;  1VLS A;  4N4W A;  2KSF A;  4AE4 A;  3K1H A;  2D5R B;  2R03 A;  3G50 A;  4MQ9 F;  3TD7 A;  1H9G A;  1ST6 A;  4J7Y A;  1K05 A;  3EGD B;  1E2X A;  1D1B A;  1H9T A;  4PJN A;  1MMD A;  3RQE A;  3ZIB A;  3NYJ A;  5L0D A;  5L0J A;  1JPN A;  4MS2 A;  2IXN A;  1HE9 A;  1O3U A;  3DZA A;  2HS5 A;  3S27 A;  2YL1 A;  4BEJ A;  2XM4 A;  1TWH A;  2Q00 A;  2R25 A;  1OKK D;  4FWV A;  1ZYR F;  4EBJ A;  5JP7 A;  1H7I A;  3RYL A;  2ASR A;  2EPN A;  4EKW A;  3QTH A;  3IPM O;  1D1C A;  5AC5 A;  2A0U A;  2FAP B;  1E86 A;  3Q6M A;  1RJ9 A;  2YRF A;  4DOZ A;  4G0H A;  4DJ9 A;  1NFN A;  2I15 A;  2L6F A;  2OKU A;  2XLE A;  2XRH A;  1AUE A;  3EPV A;  2QY9 A;  3E70 C;  2L6H A;  1M6T A;  3O55 A;  4YL3 A;  4DBR A;  4JCH A;  1ZVZ A;  3U9M A;  2W4M A;  2OJQ A;  2XM0 A;  5A69 A;  2VCB A;  1V55 C;  5JS5 A;  1AEP A;  1HW1 A;  2Y69 C;  4G78 A;  1D0Y A;  2R7V A;  4IAR A;  1I4Y A;  2Y3G A;  4OIQ F;  4JVS A;  4IAO A;  3TOM A;  3NDB B;  3L8I A;  3RVY A;  4PK4 A;  1JPJ A;  1TKN A;  5FZT A;  1YA9 A;  3T4R A;  5A6B D;  2FGY A;  2HMQ A;  4U5B E;  3ATP A;  2B0H A;  3EG9 A;  1K04 A;  3K1I C;  3IHU A;  4W8K A;  1AVO B;  2MWQ A;  2L6G A;  1OW7 A;  3EZH A;  4GEH A;  4C3D A;  256B A;  3S90 A;  2WVO A;  2EIJ C;  3B0P A;  3ECS A;  4O7G A;  2Y3D A;  5JRA A;  2R7S A;  1L3P A;  4E0H A;  2CW0 F;  3M4B A;  3T6J A;  2PF4 E;  3HLZ A;  4YT8 A;  4I1O B;  3N24 A;  4HE8 D;  2R7R A;  5GPG B;  4BJ1 A;  3H2U A;  1S7Z A;  3SYN A;  3JSE O;  4PFO A;  1EI7 A;  2R7Q A;  3POV A;  3X2Q C;  1NBB A;  3OWT A;  2W9Y A;  4R32 A;  2EPO A;  5KYU A;  2Q7R A;  1OCR C;  1SZI A;  2KW3 C;  4KBL A;  1NU7 D;  1Z23 A;  2VB6 A;  1OW6 A;  4KNW A;  2F22 A;  5L3Q A;  1D0Z A;  5L0F A;  3RFY A;  4CDV A;  2OCC C;  2J46 A;  1NFO A;  3ABK C;  3AJM A;  1U0B B;  1YVI A;  3LUT B;  1K40 A;  4XEF A;  4CSA C;  3CEX A;  4CDA A;  4A2N B;  2J0W A;  1ZHT A;  4JC7 A;  4C3B A;  2J7P A;  3U8P A;  4FX5 A;  2V26 A;  3WG7 C;  3AQC A;  3JRM O;  5B1A C;  2XLO A;  1CGM E;  2CNW A;  3NMJ A;  3L0I A;  3WAQ A;  1WOL A;  4BJ6 A;  2YL0 A;  3S9O A;  4X0R A;  2PP4 A;  5DS5 A; 
#chains in the Genus database with same CATH homology
 2KQ9 A;  2W45 A;  2YEV A;  3AQB A;  3CSK A;  3DJN B;  5KYY A;  3RH3 A;  2EIM C;  4CS7 A;  3W2V A;  4OIN F;  4K0D A;  1D1A A;  5E2Q A;  1PCX A;  3ZVR A;  3I5Q A;  4HEA J;  2P6V A;  3HTK C;  4E7S A;  3JT1 A;  1TWA A;  2B0J A;  4CSA C;  3ASN C;  4F4B A;  1TR2 A;  5IY5 C;  1ZHZ A;  3W2W A;  1M57 C;  3B9Q A;  1ZU5 A;  4RBN A;  3N2Z B;  2WZF A;  5KYU B;  4YJW A;  2EIL C;  3S29 A;  5EHH A;  4QI0 A;  2YHS A;  2ZXW C;  4YWQ A;  2DYR C;  4BJ5 A;  2DYS C;  1NU9 C;  2J0X A;  3LNR A;  4ZLD A;  3QZC A;  3NKE A;  4OIP F;  2ZXP A;  2E87 A;  4QDL A;  5DS6 A;  4U5H A;  5T3T A;  3W8H A;  1PD1 A;  3EFO A;  3W8I A;  4DVZ A;  2DGJ A;  2G62 A;  3Q6N A;  3UR3 C;  2P7V A;  2PX0 A;  3OA1 A;  3GOD A;  2H7V C;  4RDA A;  3OEO A;  3UGO A;  3ITF A;  3EHM A;  3CZ6 A;  1G8X A;  3FAJ A;  3IEE A;  3Q7G A;  2R7U A;  1FFH A;  4CS9 A;  2XXA B;  1FMV A;  3SP1 A;  3NG1 A;  2CDQ A;  2IXM A;  4IRU A;  1O87 A;  4M63 A;  4YN0 B;  3UNG C;  2Y3H A;  5B1B C;  3LLK A;  2Q9B A;  5DQZ A;  2OG2 A;  4ULW A;  3EH2 A;  1VMA A;  1ZHX A;  1NZE A;  1M2O A;  4U5G A;  4JJF A;  4U5C E;  3LAY A;  3SNH A;  2NUP B;  5BUO A;  1VK5 A;  2A6E F;  1MMG A;  3KKB A;  3GAN A;  2WVQ A;  2GFH A;  3LLI A;  5DQT A;  3DAG A;  2X51 A;  4IJJ A;  2J9V A;  4AE4 B;  3DM9 B;  2Z15 A;  4J32 B;  3EHN A;  4O6M A;  1J8Y F;  4LAC B;  1TWC A;  3K66 A;  1FFT C;  1BR1 A;  2A69 F;  2L9J A;  3JCU Q;  3JSZ A;  1IZM A;  3K6B A;  2CGE A;  5D91 A;  3H65 A;  2J9W A;  3VYW A;  2JD3 A;  3UMI A;  5DS4 A;  4LLC A;  3AG4 C;  3K7D A;  4JUR I;  1RJ9 B;  4K7B A;  2Y39 A;  4AX2 A;  3EQL F;  1M2V A;  4BJ6 C;  1FTS A;  3LJB A;  1MNE A;  2WZL A;  1ZHW A;  3PMR A;  1D0X A;  4C7O A;  1LKX A;  3S0X A;  5HSW A;  1VYI A;  3ZC4 A;  1NG1 A;  2IXO A;  2ZXO A;  4EWC A;  5KYX A;  3FHD A;  4OD5 A;  2ZPA A;  3L34 A;  3WOD F;  3JYH A;  2WZG A;  1N1C A;  2IOQ A;  3AG1 C;  2WB7 A;  3FDQ A;  5E3C A;  3EG9 B;  5B3S C;  1TWG A;  4RD9 A;  5KYW A;  4PFP A;  3VAY A;  4N06 A;  1SMY F;  1OKK A;  2EIN C;  1OCZ C;  3DJU B;  2ZXR A;  3ZSU A;  4IWB A;  2L81 A;  3ASO C;  1Z63 A;  3EGD A;  3KH2 A;  2QTV A;  3O39 A;  1LVK A;  3UGP A;  5T1D B;  4XTK A;  4JJG A;  3AG3 C;  4BJ5 C;  3KMI A;  4GYT A;  1ZHY A;  2H7B A;  2C03 A;  4G7O F;  4XLP F;  4DVY P;  4I1M A;  2R7X A;  3MLG A;  2NUT A;  2W4B A;  4YT5 A;  2XL4 A;  1O5H A;  5E3A A;  1M56 C;  3RIP A;  4C7O B;  4Q4Z F;  3EGX A;  4O6Y A;  3EH1 A;  4BG0 A;  5KYY B;  4J30 B;  2J7P D;  2Q9A A;  5CI8 A;  4O79 A;  2Q9C A;  4U5D E;  3RKO F;  2WVN A;  2CNW D;  4CIH A;  3EJN A;  4CS9 C;  3HJC A;  3E9V A;  3UMK A;  2PX3 A;  4HFK B;  2KGO A;  3MX3 A;  1W2W A;  3DD7 A;  2J45 A;  3LEV A;  1MMA A;  1Z3I X;  4YT2 A;  1SF8 A;  2HV7 A;  4OD4 A;  2O9X A;  4U5F E;  2H7O A;  3F46 A;  3B0V C;  2XSE A;  2LSE A;  2IXP A;  3NYM A;  3B0U X;  3SZR A;  2EIK C;  4E7Z A;  2PFD A;  1VYK A;  2WL8 A;  2C04 A;  2NUT B;  1BR4 A;  3Q7L A;  4NY3 A;  3O6X A;  4CBE A;  3LS0 A;  3DXJ F;  4P6I C;  1BR2 A;  4QI2 A;  3N0T A;  3NKD A;  3EFO B;  4DBQ A;  2M4E A;  3V7O A;  5DVW A;  3EGX B;  4Q5S F;  5CI9 A;  1OCC C;  3ZG1 A;  4I3M A;  2VAS A;  3QMK A;  3ABM C;  4BJT A;  2A6H F;  2A68 F;  2V3C C;  1FMW A;  2G3K A;  4U5E E;  4C3E A;  5EGY A;  4KI2 A;  4B6I A;  2G3V A;  3AG2 C;  2FFH A;  4G7H F;  2NG1 A;  4PJM A;  3LES A;  4OIR F;  2YZS A;  5L3V A;  3NYL A;  1Z5Z A;  5DLJ A;  4WJ0 A;  4KC9 A;  2I8B A;  1PD0 A;  4JW1 A;  4XLN F;  1J8M F;  2R7T A;  3DM5 A;  2VH3 A;  4JZA A;  2KNH A;  2Y3B A;  3DAF A;  1IW7 F;  4OIO F;  4FES A;  4ANJ A;  2J9U A;  3DMD A;  5FCL A;  3I4U A;  1QLE C;  4MND A;  3PHF 2;  1KU2 A;  2HV6 A;  3KL4 A;  3UMH A;  3FVY A;  3NRH A;  4O6N A;  4CS8 C;  5D92 A;  4CS8 A;  2IYL D;  3EZI A;  5E33 A;  4LLE A;  1V54 C;  3T6B A;  4AK9 A;  4Q7C A;  2KJG A;  4HFF B;  1ZU4 A;  2R7W A;  2XXA A;  4XWJ A;  3LS1 A;  1MND A;  3SEO A;  4ZLC A;  1QZX A;  4G7Z F;  1LS1 A;  2BE5 F;  1M2V B;  2A1D D;  4CSA A;  1Z6A A;  2R7O A;  3F47 A;  3CQZ A;  2MYS A;  4PJL A;  5KYN A;  4PJJ A;  4LER A;  5F5F A;  5T3W A;  3M1C B;  3I5P A;  2Q3T A;  4YT4 A;  5KYX B;  4KNV A;  4H4K C;  3K33 A;  1WGW A;  3JRT A;  4I44 A;  3X1O A;  2NUP A;  5F5H A;  1MMN A;  3ABL C;  5KYW B;  1VOM A;  3S28 A;  1OCO C;  4EBB A;  4AE4 A;  3K1H A;  2D5R B;  4MQ9 F;  3TD7 A;  1ST6 A;  3EGD B;  1D1B A;  4PJN A;  1MMD A;  3ZIB A;  3NYJ A;  1JPN A;  2IXN A;  3DZA A;  3S27 A;  4BEJ A;  1TWH A;  1OKK D;  4FWV A;  1ZYR F;  3RYL A;  1D1C A;  3Q6M A;  1RJ9 A;  4DOZ A;  4G0H A;  2XRH A;  3EPV A;  2QY9 A;  3E70 C;  4DBR A;  4JCH A;  2W4M A;  1V55 C;  2Y69 C;  1D0Y A;  2R7V A;  2Y3G A;  4OIQ F;  4JVS A;  4IAO A;  3NDB B;  4PK4 A;  1JPJ A;  1TKN A;  3T4R A;  2FGY A;  4U5B E;  3EG9 A;  3K1I C;  4W8K A;  2MWQ A;  3EZH A;  4C3D A;  4GEH A;  2WVO A;  2EIJ C;  3B0P A;  3ECS A;  4O7G A;  2Y3D A;  2R7S A;  2CW0 F;  3T6J A;  2PF4 E;  3HLZ A;  4YT8 A;  4I1O B;  3N24 A;  4HE8 D;  2R7R A;  4BJ1 A;  1S7Z A;  3SYN A;  4PFO A;  3POV A;  2R7Q A;  3X2Q C;  3OWT A;  2W9Y A;  5KYU A;  1OCR C;  1SZI A;  2KW3 C;  4KBL A;  1NU7 D;  1Z23 A;  2VB6 A;  4KNW A;  5L3Q A;  1D0Z A;  3RFY A;  2OCC C;  2J46 A;  3ABK C;  4A2N B;  2J0W A;  1ZHT A;  4C3B A;  2J7P A;  4FX5 A;  2V26 A;  3WG7 C;  3AQC A;  5B1A C;  2CNW A;  3L0I A;  4BJ6 A;  4X0R A;  2PP4 A;  5DS5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...