3GM3A

Crystal structure of the focal adhesion targeting (fat) domain of pyk2
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
133
structure length
133
Chain Sequence
b'NLDRTDDLVYLNVMELVRAVLELKNELAQLPPEGYVVVVKNVGLTLRKLIGSVDDLLPSLPSSSRTEIEGTQKLLNKDLAELINKMRLAQQNAVTSLSEECKRQMLTASHTLAVDAKNLLDAVDQAKVLANLA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Protein tyrosine kinase 2 beta
publication title Crystal structures of free and ligand-bound focal adhesion targeting domain of Pyk2
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 55
structure length 133
sequence length 133
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2009-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03623 Focal_AT Focal adhesion targeting region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 3gm3A00
5F28E 1JOGA 1OW6A 4NQFA 4XEFA 1OW7A 3O10A 1K04A 1PV3A 3BRJA 3MFNA 3RQGA 3S9OA 1O3UA 1UFBA 3JYYA 1ZZPA 1K05A 3C8GA 3GM3A 3B71A 3C8GB 1OW8A 2L6HA 2LK4A 2PBEA 1QVXA 3GM2A 1WWPA 1KNYA 2KK1A 2JX0A 3GM1A 2L6GA 3C8GD 1K40A 4EBJA 1KTMA 3L8IA 3K7DA 3RQFA 3JZ0A 1WTYA 3C18A 1WOLA 2L6FA 3U0CA 2JPUA 4EBKA 2Q00A 3TULA 3RQEA 4XEKA 2YWAA 3L8JA 4XEVA 3U3FA 1V4AA 3AJMA 4R32A 2HSBA
chains in the Genus database with same CATH superfamily
1SYQA 2NSGA 2J9VA 2NUPB 1AEPA 2W4BA 2Y69C 4LDRA 3BRJA 4PJMA 5L0DA 4M63A 4AX2A 1Z3IX 2E87A 4LDKA 2PF4E 3V5XA 4MVUA 4E0HA 3B0UX 4NCQA 4E0IA 2ZD9A 1MQVA 2ZPAA 4NTFA 3BEHA 4AE4A 1DOWA 1Z5ZA 1V55C 3T6BA 4G7ZF 2AVKA 2D4UA 4JRZA 5KYUA 1LS4A 1HW2A 3LS0A 3C63A 3O55A 1YA9A 4JJFA 4ZLCA 5L0HA 3U9JA 3PHF2 1C17M 3O6XA 4IARA 4YL3A 2WVNA 4OIOF 3WAQA 1NLXA 3RH3A 1Y6DA 5KYWB 1VLSA 2P0NA 4H4KC 2AWYA 5COGA 3FOOA 4A2NB 4MTOA 3MX3A 3MBGA 2HKVA 2XS1A 5JT4A 2L7AA 3S9OA 4BG0A 1F1MA 1O3UA 2W45A 1T6IA 2VH3A 3GODA 4P9TA 3JYYA 1G8XA 4U5DE 3ZDLA 4GQHA 4CIHA 1E84A 4CS8C 1OW8A 1WN0A 4QI2A 3MYFA 3S90A 3SXKA 4Z9JA 2R7RA 2XLWA 3K1IC 2ZXOA 1CGOA 1ORYA 2J7PD 3B29A 1RMVA 3ZVRA 1JMWA 3OEOA 2ZXRA 3RQFA 1WTYA 5A6AA 1ZHWA 2R02A 1OXKA 1WGWA 5T3WA 3U0CA 1KU2A 2Q00A 1GGQA 3HNJA 5DS6A 3DM5A 3S27A 3FDQA 1JRAA 3GWNA 1I4ZA 1LVKA 2IXMA 4MS2A 4NTBA 2WZLA 1LPEA 1L3PA 4NQFA 1FFHA 5B3IA 1NG1A 2YL0A 4K7BA 4OD5A 5E33A 4G7OF 1M56C 4FWVA 3B9QA 3EFOB 2LFFA 2J7PA 2O9XA 3NKDA 4I1MA 3T4RA 2WVOA 4U9EA 4WGZA 3GM2A 1YA7O 3JRMO 1R4TA 4Z9HA 3G50A 1NFNA 1RXQA 2YEVA 3GM1A 2M4EA 4YL0A 4I1OB 3TOLA 3WODF 5DS4A 2KW3C 3AG2C 4XWJA 1MMDA 2AWCA 4BJ5C 1WOLA 3ZWIA 2NUTB 3SEOA 4J32B 4EBKA 4B6IA 1M2OA 3TULA 3QVYA 1VYKA 1W2WA 1Y4CA 3C62A 2OOCA 2Q9AA 4XEKA 1LI7A 2J0WA 4C3EA 4ER9A 5FCLA 4CSAA 1ZW2A 4JURI 3GEIA 3FAPB 3JSEO 3K66A 2IXPA 1OCOC 3X1OA 2YLDA 5KYNA 1Z6AA 1PV3A 3MFNA 5DS5A 1T6UA 1MNEA 1UFBA 3DWWA 1C02A 1ZZPA 3GEEA 3EG9B 5D91A 3RVYA 1R5ID 3IEEA 4XPWA 1QPUA 1TQGA 2EIJC 4LERA 2KSFA 5KYXA 2R7WA 4BJTA 2XXAA 1Z63A 2QY9A 2ICWG 2R7QA 3I5QA 3DJUB 2XLMA 3DE8A 2KNHA 2EPMX 4XLNF 4GYTA 3GEHA 1FAPB 4JKVA 2VCCA 3K7DA 2CYDA 4MVSA 5IY5C 2QUPA 3FXHA 1XZPA 3EGXB 3JZ0A 2YL3A 3C18A 2Q9CA 2L9JA 2UUHA 5AGFA 3R2PA 4RDAA 4JTCB 3SXMA 2Z15A 2H7OA 2OCCC 4G7HF 1FMVA 3JYHA 4MTFA 2OQMA 3L8JA 3LUTB 3JTLO 3JSZA 1V4AA 2YHSA 3ZQVA 3NMJA 2VC9A 1I4YA 2HSBA 2QE9A 3JCUQ 3IQ5A 5BQHA 3J06A 1OQCA 2NUPA 5COMA 2DGJA 1OKKD 1BZ4A 4GEHA 5CIVA 1EA8A 4JE9A 4E18A 1SZIA 3DAGA 2PNOA 3CQZA 3IQ6A 3RVZA 4H54A 4PR9A 1A0BA 2AU5A 1Z7Qc 2G62A 2Y3GA 3ECSA 1H7IA 2R05A 1RKEB 3KYJA 5KYYB 4UDVA 2KYHA 4LACB 2IXNA 3SXYA 2OEVA 3M4CA 3QW1A 2V3CC 2XLDA 3CSKA 2J9WA 3FMSA 4DRHB 4YK5A 2EIKC 3MYIA 1ZVZA 2JPUA 3K1IA 2WZFA 3RQEA 2IXOA 1YLMA 2HZ8A 3AG4C 3QW0A 1OKKA 5CI8A 4U5EE 2KQ9A 1VLTA 1BR4A 3L34A 2UUIA 3U5SA 2HUJA 4MVRA 4CDVA 5A6JA 5KYWA 1O5HA 3SXZA 1WASA 1OW6A 3X2QC 2OKUA 4KI2A 1K04A 4IAQA 4JTAB 4CBEA 3CAXA 4CJOA 3M79A 1M6TA 5L0IA 2Y3DA 2LK4A 1QKRA 4Q5SF 4U5HA 1E85A 2KC3A 4N6CA 2XLEA 2YQYA 4MW3A 4QI0A 3FAJA 3VRCA 1HW1A 2W9YA 4OD4A 5B1AC 3JRTA 4EIYA 3LNMB 1A41A 1GQAA 1ZHTA 2OJED 2L6FA 2Q4FA 2YZSA 3NYLA 5EK0A 3POVA 2IYLD 2AP3A 3JT1A 4PK4A 1CPRA 1Q0DA 5JVEA 2A6HF 3E9VA 1YVIA 3DD7A 4E17A 3FHDA 3U2LA 3M1CB 4BJ5A 1FNTc 4XTKA 1VB5A 3GANA 3PCVA 3QZCA 3UGPA 1OR3A 3KKBA 1QQ3A 3O10A 5F5FA 2A6EF 2BL2A 3EFOA 3M4BA 3EH1A 1SR2A 3HNKA 5JSLA 1ST6A 2DB4A 1BDJB 2L6HA 2PBEA 4U5FE 3DXJF 4BJ6C 3NKEA 1YJGA 3LEVA 3DKAA 2KK1A 2HJMA 3KYIA 4KBLA 5F5HA 2MWQA 1KTMA 1NU7D 3L8IA 4J30B 5T1DB 4XLPF 2BE5F 1RJ9B 2NUTA 3RW0A 3F47A 5HSWA 5AC5A 5B3SC 4K0DA 2EPKX 1A7DA 1O87A 2LCHA 4JEBA 4YJWA 4Q4ZF 2YLGA 4J7YA 2Q9BA 3AJMA 4IWBA 1ZU5A 4PJJA 2NG1A 5T3TA 4JVSA 3SZRA 1APCA 1SMYF 4RD9A 3DAFA 5L3QA 3UMHA 2ASRA 2J45A 4XPYA 4OINF 2R7XA 1H6GA 2WL8A 3EG9A 3G4ZA 2TMVP 2KGOA 3GM3A 4YT4A 4DVZA 5DLJA 1VK5A 3EQLF 4PJNA 2EPLX 2XLVA 1S7ZA 2B0HA 4CDYA 3S84A 1HE9A 1ORSC 1RCPA 1YZCA 2HV6A 3EGXA 4PFOA 3G4XA 3AOUA 2KJGA 4FX5A 3U8PA 4D4NA 1LE4A 3Q7GA 4ULWA 2XL8A 1TWAA 2WVQA 2YWAA 2CNWD 2GA0A 2QTVA 4PACA 3TD7A 3U3FA 1V54C 2Y39A 2L81A 3H2UA 2B0JA 4R32A 1FTSA 2XS8A 4E7SA 4A4AA 1UG7A 1D1CA 256BA 1IW7F 1ZW3A 3K33A 3T9OA 5L0GA 4P9FA 5JRAA 3T6GB 3K1HA 3NRHA 4YL1A 3AQCA 2P1AA 1K05A 4BJ1A 4C7OB 1L7CA 3QMKA 3V5YA 3VF0A 1J8YF 3GORA 1RKEA 1AVOB 2HV7A 3NYMA 2VASA 3US6A 2X0CA 5KYYA 3ZIBA 1H9GA 4DRJB 2A0UA 3B0PA 4CIPA 3KPHA 3UMIA 3CZ6A 5A6BD 2CNWA 2EPOA 3K6BA 5DQZA 3ZSUA 1TWGA 2IBFA 2NPUA 2YL7A 2ZXWC 3W2VA 4C3DA 3ZQYA 1HY5A 3Q7LA 2PFDA 3F46A 3A9CA 4JIOA 2DYRC 2IM8A 4CS9C 1FMWA 3FOPA 3LEOA 5L0JA 1A7VA 3RF3A 2G3KA 3EHNA 4MTGA 3HNIA 1E86A 5JLIA 4XEFA 2CCYA 1D0XA 1U6HA 2GFHA 1T01A 2J0XA 3NMIA 4O6MA 3ITFA 4IAOA 1OCRC 4YWQA 5A6BA 2RSEB 1MMNA 4OIQF 1H9TA 3FVYA 3HLZA 3W2WA 3ZTMA 4PJLA 3VAYA 4O7GA 1DOVA 5EGYA 1LS1A 5L0FA 1M2VB 3M15A 4CS8A 1NFOA 5TJ5E 1YYJA 3TK0A 4BJ6A 4ZLDA 1HMDA 1V74B 2R7OA 1ZHZA 2IOQA 1D0YA 4DXWA 2A69F 2EILC 5L3VA 1LIHA 1QZXA 2DYSC 1U89A 2P6VA 2HSQA 1ORJA 2CGEA 2LFDA 3EJNA 4HFFB 5F28E 4D4XA 4EBBA 3S0XA 4WABA 3GWLA 2RD9A 2H7BA 3LLKA 3H65A 4JJGA 4KC9A 1BR1A 3L1MA 2I8BA 3N24A 2GWWA 3S28A 4BEMJ 3HTKC 4K1OA 3C8GB 1JR8A 3HKKA 4ANJA 4DBQA 3EH2A 2EPNA 5COFA 3DI5A 3V5ZA 1NZEA 3QVZA 3RYLA 2I15A 4FAPB 1LM3B 3LESA 2JD3A 1T5OA 3AQBA 2L6GA 4QDLA 1ZHXA 3AG1C 1RJ9A 5CI9A 3OA1A 4IJJA 2QLAA 3W8HA 3DMDA 3U3BA 1TFOB 3KH2A 4CS7A 3NDBB 3AGTA 1HE1A 4JEAA 2XL6A 2Y3BA 3ZTZA 2C04A 4C3BA 2HJ3A 1J8MF 2R7SA 3ABLC 2MHRA 2YKZA 1G5ZA 1TWCA 4KNWA 2R9RB 3NMKA 1SF8A 1OCCC 4U5CE 3SYNA 4EHPA 3I4UA 3NG1A 3ZG1A 2A0BA 1MMGA 4OIPF 3PDMP 2LD6A 3IQCA 4YT8A 4F4BA 1E83A 2C03A 5E2QA 4ONSA 2XM4A 3T6JA 2R7VA 3KL4A 1GS9A 1VTMP 4JZAA 3S29A 4BEJA 4NTAA 3IQTA 4PFPA 3PMRA 2R25A 4L6RA 1YYXA 3SP1A 5EHHA 4O6NA 2HMZA 1D1BA 4KNVA 4FESA 1U0BB 3TJ6A 3TOMA 1S05A 4YT2A 4XEVA 1OXBA 1CPQA 2HS5A 5BQGA 4DOZA 3LJBA 3ABMC 3EGDB 5D92A 1Q0FA 2LQGA 2OU6A 4MVZA 4P6IC 4OIRF 2BC5A 3R7CA 1Q0MA 2GAQA 3DE9A 3EHMA 4XQ1A 1QSPA 2OG2A 5E3AA 3RIPA 3RQGA 4CS9A 4C7OA 2J46A 2QNLA 3B71A 3EPVA 2DI3A 3OWTA 3UR3C 1NSGB 1PD1A 4JW1A 1T9KA 1WATA 4IB4A 4IGGA 4U5BE 4ULVA 3RKOF 4BPMA 2R7UA 1VYIA 2JX0A 5GPGB 4AE4B 2G3VA 1MNDA 1K40A 1OCZC 2H7VC 4G0HA 3LNRA 3W8IA 1FFTC 2XM0A 3ASNC 3H2VA 4J7TA 4AK9A 2XSEA 2YL1A 5KYUB 1XWJA 3SNHA 4LLEA 1HMOA 3O39A 2XRHA 3HJCA 4Q7CA 2XLHA 2CW0F 4MQ9F 1XZQA 3DZAA 3E70C 4W8KA 3VYWA 2FGYA 1JPJA 4LLCA 3Q6NA 1LKXA 2P7VA 4MVMA 3MLGA 1D0ZA 4W8PA 4MW8A 4NY3A 3V7OA 2VB6A 5JUAA 4IRUA 4YT5A 4DBRA 4E7ZA 1FR0A 4Z9IA 1LE2A 1EI7A 3ASOC 4EWCA 1AUEA 4AL0A 4HEAJ 3DJNB 3TQOA 2A68F 3I5PA 5JP7A 5AC4A 2D5RB 4N6HA 4YN0B 3IHUA 2H8AA 5FZTA 2Q7RA 1TFKB 3Q6MA 1IZMA 1BR2A 3AGUA 3C7JA 2Y3HA 3C8GD 1Q0KA 1M2VA 3N0TA 3RFYA 5DVWA 3UNGC 2CDQA 5DQTA 1G4WR 2OEXA 3ZC4A 1GM5A 1ZHYA 2HMQA 4XPXA 1NU9C 2J9BA 3A11A 1YAUO 1YARO 4CJGA 5BUOA 2R03A 3KMIA 1Z23A 4CX9A 2V26A 1YDIA 3ATPA 5JS5A 2EIMC 2HFIA 2XLOA 4O6YA 1T6QA 1VOMA 3L0IA 4RBNA 4CDAA 1JOGA 2A1DD 2YVKA 2FAPB 4HFKB 2PP4A 2F22A 1OW7A 2WZGA 3DM9B 3LLIA 3IPMO 5E3CA 3UGOA 2X51A 2XL4A 4LDQA 4WJ0A 5B1BC 3C8GA 3B0VC 1EKYA 5A6KA 1A7EA 4AL1A 5K0IA 3U9MA 1WWPA 1M57C 1KNYA 4U5GA 2VCAA 1CGME 1G4US 1YZAA 2GDCA 2ZXPA 1VMAA 4MVQA 3WG7C 4EBJA 1D1AA 2LP4A 4DJ9A 3C8ZA 2EINC 1TWHA 1LI5A 1PCXA 2J8WA 3AG3C 3NYJA 1I5NA 1Q0GA 1TR2A 1QLEC 2MYSA 2YRFA 4MNDA 1JAFA 4U9DA 3UMKA 1C03A 3CEXA 2LIGA 1TKNA 4NC3A 1E2XA 2J9UA 2YLIA 4WGYA 3HNLA 1ZU4A 2NSFA 4HE8D 4I3MA 3LAYA 4JCHA 3WHNA 1ZYRF 2WB7A 5L0CA 2LSEA 1MMAA 2FFHA 1BBHA 4DVYP 1RKCA 2P61A 1QVXA 2ETSA 3EZHA 4X0RA 4EKWA 2XXAB 5KYXB 3N2ZB 1N1CA 4O79A 3LS1A 1JPNA 1B68A 3U8VA 4JTDB 4DRIB 4G78A 2PX3A 1EQ1A 4CSAC 2OJQA 5HV9A 1CGNA 4MVOA 2R7TA 2M64A 3QTHA 3TJ5A 4I44A 5BQIA 4N4WA 5A69A 2VCBA 1OR2A 4N06A 1PD0A 2PX0A 3VM6A 4JC7A 3EZIA 1NBBA 2W4MA 4JCZA 3U2MA 3W4YA 4EUKB 3EGDA 3ABKC 2Q3TA
chains in the Genus database with same CATH topology
5F28E 1JOGA 1OW6A 4NQFA 4XEFA 1OW7A 3O10A 1K04A 1PV3A 3BRJA 3MFNA 3RQGA 3S9OA 1O3UA 1UFBA 3JYYA 1ZZPA 1K05A 3C8GA 3GM3A 3B71A 3C8GB 1OW8A 2L6HA 2LK4A 2PBEA 1QVXA 3GM2A 1WWPA 1KNYA 2KK1A 2JX0A 3GM1A 2L6GA 3C8GD 1K40A 4EBJA 1KTMA 3L8IA 3K7DA 3RQFA 3JZ0A 1WTYA 3C18A 1WOLA 2L6FA 3U0CA 2JPUA 4EBKA 2Q00A 3TULA 3RQEA 4XEKA 2YWAA 3L8JA 4XEVA 3U3FA 1V4AA 3AJMA 4R32A 2HSBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5F28 E;  1JOG A;  1OW6 A;  4NQF A;  4XEF A;  1OW7 A;  3O10 A;  1K04 A;  1PV3 A;  3BRJ A;  3MFN A;  3RQG A;  3S9O A;  1O3U A;  1UFB A;  3JYY A;  1ZZP A;  1K05 A;  3C8G A;  3GM3 A;  3B71 A;  3C8G B;  1OW8 A;  2L6H A;  2LK4 A;  2PBE A;  1QVX A;  3GM2 A;  1WWP A;  1KNY A;  2KK1 A;  2JX0 A;  3GM1 A;  2L6G A;  3C8G D;  1K40 A;  4EBJ A;  1KTM A;  3L8I A;  3K7D A;  3RQF A;  3JZ0 A;  1WTY A;  3C18 A;  1WOL A;  2L6F A;  3U0C A;  2JPU A;  4EBK A;  2Q00 A;  3TUL A;  3RQE A;  4XEK A;  2YWA A;  3L8J A;  4XEV A;  3U3F A;  1V4A A;  3AJM A;  4R32 A;  2HSB A; 
#chains in the Genus database with same CATH topology
 1SYQ A;  2NSG A;  2J9V A;  2NUP B;  1AEP A;  2W4B A;  2Y69 C;  4LDR A;  3BRJ A;  4PJM A;  5L0D A;  4M63 A;  4AX2 A;  1Z3I X;  2E87 A;  4LDK A;  2PF4 E;  3V5X A;  4MVU A;  4E0H A;  3B0U X;  4NCQ A;  4E0I A;  2ZD9 A;  1MQV A;  2ZPA A;  4NTF A;  3BEH A;  4AE4 A;  1DOW A;  1Z5Z A;  1V55 C;  3T6B A;  4G7Z F;  2AVK A;  2D4U A;  4JRZ A;  5KYU A;  1LS4 A;  1HW2 A;  3LS0 A;  3C63 A;  3O55 A;  1YA9 A;  4JJF A;  4ZLC A;  5L0H A;  3U9J A;  3PHF 2;  1C17 M;  3O6X A;  4IAR A;  4YL3 A;  2WVN A;  4OIO F;  3WAQ A;  1NLX A;  3RH3 A;  1Y6D A;  5KYW B;  1VLS A;  2P0N A;  4H4K C;  2AWY A;  5COG A;  3FOO A;  4A2N B;  4MTO A;  3MX3 A;  3MBG A;  2HKV A;  2XS1 A;  5JT4 A;  2L7A A;  3S9O A;  4BG0 A;  1F1M A;  1O3U A;  2W45 A;  1T6I A;  2VH3 A;  3GOD A;  4P9T A;  3JYY A;  1G8X A;  4U5D E;  3ZDL A;  4GQH A;  4CIH A;  1E84 A;  4CS8 C;  1OW8 A;  1WN0 A;  4QI2 A;  3MYF A;  3S90 A;  3SXK A;  4Z9J A;  2R7R A;  2XLW A;  3K1I C;  2ZXO A;  1CGO A;  1ORY A;  2J7P D;  3B29 A;  1RMV A;  3ZVR A;  1JMW A;  3OEO A;  2ZXR A;  3RQF A;  1WTY A;  5A6A A;  1ZHW A;  2R02 A;  1OXK A;  1WGW A;  5T3W A;  3U0C A;  1KU2 A;  2Q00 A;  1GGQ A;  3HNJ A;  5DS6 A;  3DM5 A;  3S27 A;  3FDQ A;  1JRA A;  3GWN A;  1I4Z A;  1LVK A;  2IXM A;  4MS2 A;  4NTB A;  2WZL A;  1LPE A;  1L3P A;  4NQF A;  1FFH A;  5B3I A;  1NG1 A;  2YL0 A;  4K7B A;  4OD5 A;  5E33 A;  4G7O F;  1M56 C;  4FWV A;  3B9Q A;  3EFO B;  2LFF A;  2J7P A;  2O9X A;  3NKD A;  4I1M A;  3T4R A;  2WVO A;  4U9E A;  4WGZ A;  3GM2 A;  1YA7 O;  3JRM O;  1R4T A;  4Z9H A;  3G50 A;  1NFN A;  1RXQ A;  2YEV A;  3GM1 A;  2M4E A;  4YL0 A;  4I1O B;  3TOL A;  3WOD F;  5DS4 A;  2KW3 C;  3AG2 C;  4XWJ A;  1MMD A;  2AWC A;  4BJ5 C;  1WOL A;  3ZWI A;  2NUT B;  3SEO A;  4J32 B;  4EBK A;  4B6I A;  1M2O A;  3TUL A;  3QVY A;  1VYK A;  1W2W A;  1Y4C A;  3C62 A;  2OOC A;  2Q9A A;  4XEK A;  1LI7 A;  2J0W A;  4C3E A;  4ER9 A;  5FCL A;  4CSA A;  1ZW2 A;  4JUR I;  3GEI A;  3FAP B;  3JSE O;  3K66 A;  2IXP A;  1OCO C;  3X1O A;  2YLD A;  5KYN A;  1Z6A A;  1PV3 A;  3MFN A;  5DS5 A;  1T6U A;  1MNE A;  1UFB A;  3DWW A;  1C02 A;  1ZZP A;  3GEE A;  3EG9 B;  5D91 A;  3RVY A;  1R5I D;  3IEE A;  4XPW A;  1QPU A;  1TQG A;  2EIJ C;  4LER A;  2KSF A;  5KYX A;  2R7W A;  4BJT A;  2XXA A;  1Z63 A;  2QY9 A;  2ICW G;  2R7Q A;  3I5Q A;  3DJU B;  2XLM A;  3DE8 A;  2KNH A;  2EPM X;  4XLN F;  4GYT A;  3GEH A;  1FAP B;  4JKV A;  2VCC A;  3K7D A;  2CYD A;  4MVS A;  5IY5 C;  2QUP A;  3FXH A;  1XZP A;  3EGX B;  3JZ0 A;  2YL3 A;  3C18 A;  2Q9C A;  2L9J A;  2UUH A;  5AGF A;  3R2P A;  4RDA A;  4JTC B;  3SXM A;  2Z15 A;  2H7O A;  2OCC C;  4G7H F;  1FMV A;  3JYH A;  4MTF A;  2OQM A;  3L8J A;  3LUT B;  3JTL O;  3JSZ A;  1V4A A;  2YHS A;  3ZQV A;  3NMJ A;  2VC9 A;  1I4Y A;  2HSB A;  2QE9 A;  3JCU Q;  3IQ5 A;  5BQH A;  3J06 A;  1OQC A;  2NUP A;  5COM A;  2DGJ A;  1OKK D;  1BZ4 A;  4GEH A;  5CIV A;  1EA8 A;  4JE9 A;  4E18 A;  1SZI A;  3DAG A;  2PNO A;  3CQZ A;  3IQ6 A;  3RVZ A;  4H54 A;  4PR9 A;  1A0B A;  2AU5 A;  1Z7Q c;  2G62 A;  2Y3G A;  3ECS A;  1H7I A;  2R05 A;  1RKE B;  3KYJ A;  5KYY B;  4UDV A;  2KYH A;  4LAC B;  2IXN A;  3SXY A;  2OEV A;  3M4C A;  3QW1 A;  2V3C C;  2XLD A;  3CSK A;  2J9W A;  3FMS A;  4DRH B;  4YK5 A;  2EIK C;  3MYI A;  1ZVZ A;  2JPU A;  3K1I A;  2WZF A;  3RQE A;  2IXO A;  1YLM A;  2HZ8 A;  3AG4 C;  3QW0 A;  1OKK A;  5CI8 A;  4U5E E;  2KQ9 A;  1VLT A;  1BR4 A;  3L34 A;  2UUI A;  3U5S A;  2HUJ A;  4MVR A;  4CDV A;  5A6J A;  5KYW A;  1O5H A;  3SXZ A;  1WAS A;  1OW6 A;  3X2Q C;  2OKU A;  4KI2 A;  1K04 A;  4IAQ A;  4JTA B;  4CBE A;  3CAX A;  4CJO A;  3M79 A;  1M6T A;  5L0I A;  2Y3D A;  2LK4 A;  1QKR A;  4Q5S F;  4U5H A;  1E85 A;  2KC3 A;  4N6C A;  2XLE A;  2YQY A;  4MW3 A;  4QI0 A;  3FAJ A;  3VRC A;  1HW1 A;  2W9Y A;  4OD4 A;  5B1A C;  3JRT A;  4EIY A;  3LNM B;  1A41 A;  1GQA A;  1ZHT A;  2OJE D;  2L6F A;  2Q4F A;  2YZS A;  3NYL A;  5EK0 A;  3POV A;  2IYL D;  2AP3 A;  3JT1 A;  4PK4 A;  1CPR A;  1Q0D A;  5JVE A;  2A6H F;  3E9V A;  1YVI A;  3DD7 A;  4E17 A;  3FHD A;  3U2L A;  3M1C B;  4BJ5 A;  1FNT c;  4XTK A;  1VB5 A;  3GAN A;  3PCV A;  3QZC A;  3UGP A;  1OR3 A;  3KKB A;  1QQ3 A;  3O10 A;  5F5F A;  2A6E F;  2BL2 A;  3EFO A;  3M4B A;  3EH1 A;  1SR2 A;  3HNK A;  5JSL A;  1ST6 A;  2DB4 A;  1BDJ B;  2L6H A;  2PBE A;  4U5F E;  3DXJ F;  4BJ6 C;  3NKE A;  1YJG A;  3LEV A;  3DKA A;  2KK1 A;  2HJM A;  3KYI A;  4KBL A;  5F5H A;  2MWQ A;  1KTM A;  1NU7 D;  3L8I A;  4J30 B;  5T1D B;  4XLP F;  2BE5 F;  1RJ9 B;  2NUT A;  3RW0 A;  3F47 A;  5HSW A;  5AC5 A;  5B3S C;  4K0D A;  2EPK X;  1A7D A;  1O87 A;  2LCH A;  4JEB A;  4YJW A;  4Q4Z F;  2YLG A;  4J7Y A;  2Q9B A;  3AJM A;  4IWB A;  1ZU5 A;  4PJJ A;  2NG1 A;  5T3T A;  4JVS A;  3SZR A;  1APC A;  1SMY F;  4RD9 A;  3DAF A;  5L3Q A;  3UMH A;  2ASR A;  2J45 A;  4XPY A;  4OIN F;  2R7X A;  1H6G A;  2WL8 A;  3EG9 A;  3G4Z A;  2TMV P;  2KGO A;  3GM3 A;  4YT4 A;  4DVZ A;  5DLJ A;  1VK5 A;  3EQL F;  4PJN A;  2EPL X;  2XLV A;  1S7Z A;  2B0H A;  4CDY A;  3S84 A;  1HE9 A;  1ORS C;  1RCP A;  1YZC A;  2HV6 A;  3EGX A;  4PFO A;  3G4X A;  3AOU A;  2KJG A;  4FX5 A;  3U8P A;  4D4N A;  1LE4 A;  3Q7G A;  4ULW A;  2XL8 A;  1TWA A;  2WVQ A;  2YWA A;  2CNW D;  2GA0 A;  2QTV A;  4PAC A;  3TD7 A;  3U3F A;  1V54 C;  2Y39 A;  2L81 A;  3H2U A;  2B0J A;  4R32 A;  1FTS A;  2XS8 A;  4E7S A;  4A4A A;  1UG7 A;  1D1C A;  256B A;  1IW7 F;  1ZW3 A;  3K33 A;  3T9O A;  5L0G A;  4P9F A;  5JRA A;  3T6G B;  3K1H A;  3NRH A;  4YL1 A;  3AQC A;  2P1A A;  1K05 A;  4BJ1 A;  4C7O B;  1L7C A;  3QMK A;  3V5Y A;  3VF0 A;  1J8Y F;  3GOR A;  1RKE A;  1AVO B;  2HV7 A;  3NYM A;  2VAS A;  3US6 A;  2X0C A;  5KYY A;  3ZIB A;  1H9G A;  4DRJ B;  2A0U A;  3B0P A;  4CIP A;  3KPH A;  3UMI A;  3CZ6 A;  5A6B D;  2CNW A;  2EPO A;  3K6B A;  5DQZ A;  3ZSU A;  1TWG A;  2IBF A;  2NPU A;  2YL7 A;  2ZXW C;  3W2V A;  4C3D A;  3ZQY A;  1HY5 A;  3Q7L A;  2PFD A;  3F46 A;  3A9C A;  4JIO A;  2DYR C;  2IM8 A;  4CS9 C;  1FMW A;  3FOP A;  3LEO A;  5L0J A;  1A7V A;  3RF3 A;  2G3K A;  3EHN A;  4MTG A;  3HNI A;  1E86 A;  5JLI A;  4XEF A;  2CCY A;  1D0X A;  1U6H A;  2GFH A;  1T01 A;  2J0X A;  3NMI A;  4O6M A;  3ITF A;  4IAO A;  1OCR C;  4YWQ A;  5A6B A;  2RSE B;  1MMN A;  4OIQ F;  1H9T A;  3FVY A;  3HLZ A;  3W2W A;  3ZTM A;  4PJL A;  3VAY A;  4O7G A;  1DOV A;  5EGY A;  1LS1 A;  5L0F A;  1M2V B;  3M15 A;  4CS8 A;  1NFO A;  5TJ5 E;  1YYJ A;  3TK0 A;  4BJ6 A;  4ZLD A;  1HMD A;  1V74 B;  2R7O A;  1ZHZ A;  2IOQ A;  1D0Y A;  4DXW A;  2A69 F;  2EIL C;  5L3V A;  1LIH A;  1QZX A;  2DYS C;  1U89 A;  2P6V A;  2HSQ A;  1ORJ A;  2CGE A;  2LFD A;  3EJN A;  4HFF B;  5F28 E;  4D4X A;  4EBB A;  3S0X A;  4WAB A;  3GWL A;  2RD9 A;  2H7B A;  3LLK A;  3H65 A;  4JJG A;  4KC9 A;  1BR1 A;  3L1M A;  2I8B A;  3N24 A;  2GWW A;  3S28 A;  4BEM J;  3HTK C;  4K1O A;  3C8G B;  1JR8 A;  3HKK A;  4ANJ A;  4DBQ A;  3EH2 A;  2EPN A;  5COF A;  3DI5 A;  3V5Z A;  1NZE A;  3QVZ A;  3RYL A;  2I15 A;  4FAP B;  1LM3 B;  3LES A;  2JD3 A;  1T5O A;  3AQB A;  2L6G A;  4QDL A;  1ZHX A;  3AG1 C;  1RJ9 A;  5CI9 A;  3OA1 A;  4IJJ A;  2QLA A;  3W8H A;  3DMD A;  3U3B A;  1TFO B;  3KH2 A;  4CS7 A;  3NDB B;  3AGT A;  1HE1 A;  4JEA A;  2XL6 A;  2Y3B A;  3ZTZ A;  2C04 A;  4C3B A;  2HJ3 A;  1J8M F;  2R7S A;  3ABL C;  2MHR A;  2YKZ A;  1G5Z A;  1TWC A;  4KNW A;  2R9R B;  3NMK A;  1SF8 A;  1OCC C;  4U5C E;  3SYN A;  4EHP A;  3I4U A;  3NG1 A;  3ZG1 A;  2A0B A;  1MMG A;  4OIP F;  3PDM P;  2LD6 A;  3IQC A;  4YT8 A;  4F4B A;  1E83 A;  2C03 A;  5E2Q A;  4ONS A;  2XM4 A;  3T6J A;  2R7V A;  3KL4 A;  1GS9 A;  1VTM P;  4JZA A;  3S29 A;  4BEJ A;  4NTA A;  3IQT A;  4PFP A;  3PMR A;  2R25 A;  4L6R A;  1YYX A;  3SP1 A;  5EHH A;  4O6N A;  2HMZ A;  1D1B A;  4KNV A;  4FES A;  1U0B B;  3TJ6 A;  3TOM A;  1S05 A;  4YT2 A;  4XEV A;  1OXB A;  1CPQ A;  2HS5 A;  5BQG A;  4DOZ A;  3LJB A;  3ABM C;  3EGD B;  5D92 A;  1Q0F A;  2LQG A;  2OU6 A;  4MVZ A;  4P6I C;  4OIR F;  2BC5 A;  3R7C A;  1Q0M A;  2GAQ A;  3DE9 A;  3EHM A;  4XQ1 A;  1QSP A;  2OG2 A;  5E3A A;  3RIP A;  3RQG A;  4CS9 A;  4C7O A;  2J46 A;  2QNL A;  3B71 A;  3EPV A;  2DI3 A;  3OWT A;  3UR3 C;  1NSG B;  1PD1 A;  4JW1 A;  1T9K A;  1WAT A;  4IB4 A;  4IGG A;  4U5B E;  4ULV A;  3RKO F;  4BPM A;  2R7U A;  1VYI A;  2JX0 A;  5GPG B;  4AE4 B;  2G3V A;  1MND A;  1K40 A;  1OCZ C;  2H7V C;  4G0H A;  3LNR A;  3W8I A;  1FFT C;  2XM0 A;  3ASN C;  3H2V A;  4J7T A;  4AK9 A;  2XSE A;  2YL1 A;  5KYU B;  1XWJ A;  3SNH A;  4LLE A;  1HMO A;  3O39 A;  2XRH A;  3HJC A;  4Q7C A;  2XLH A;  2CW0 F;  4MQ9 F;  1XZQ A;  3DZA A;  3E70 C;  4W8K A;  3VYW A;  2FGY A;  1JPJ A;  4LLC A;  3Q6N A;  1LKX A;  2P7V A;  4MVM A;  3MLG A;  1D0Z A;  4W8P A;  4MW8 A;  4NY3 A;  3V7O A;  2VB6 A;  5JUA A;  4IRU A;  4YT5 A;  4DBR A;  4E7Z A;  1FR0 A;  4Z9I A;  1LE2 A;  1EI7 A;  3ASO C;  4EWC A;  1AUE A;  4AL0 A;  4HEA J;  3DJN B;  3TQO A;  2A68 F;  3I5P A;  5JP7 A;  5AC4 A;  2D5R B;  4N6H A;  4YN0 B;  3IHU A;  2H8A A;  5FZT A;  2Q7R A;  1TFK B;  3Q6M A;  1IZM A;  1BR2 A;  3AGU A;  3C7J A;  2Y3H A;  3C8G D;  1Q0K A;  1M2V A;  3N0T A;  3RFY A;  5DVW A;  3UNG C;  2CDQ A;  5DQT A;  1G4W R;  2OEX A;  3ZC4 A;  1GM5 A;  1ZHY A;  2HMQ A;  4XPX A;  1NU9 C;  2J9B A;  3A11 A;  1YAU O;  1YAR O;  4CJG A;  5BUO A;  2R03 A;  3KMI A;  1Z23 A;  4CX9 A;  2V26 A;  1YDI A;  3ATP A;  5JS5 A;  2EIM C;  2HFI A;  2XLO A;  4O6Y A;  1T6Q A;  1VOM A;  3L0I A;  4RBN A;  4CDA A;  1JOG A;  2A1D D;  2YVK A;  2FAP B;  4HFK B;  2PP4 A;  2F22 A;  1OW7 A;  2WZG A;  3DM9 B;  3LLI A;  3IPM O;  5E3C A;  3UGO A;  2X51 A;  2XL4 A;  4LDQ A;  4WJ0 A;  5B1B C;  3C8G A;  3B0V C;  1EKY A;  5A6K A;  1A7E A;  4AL1 A;  5K0I A;  3U9M A;  1WWP A;  1M57 C;  1KNY A;  4U5G A;  2VCA A;  1CGM E;  1G4U S;  1YZA A;  2GDC A;  2ZXP A;  1VMA A;  4MVQ A;  3WG7 C;  4EBJ A;  1D1A A;  2LP4 A;  4DJ9 A;  3C8Z A;  2EIN C;  1TWH A;  1LI5 A;  1PCX A;  2J8W A;  3AG3 C;  3NYJ A;  1I5N A;  1Q0G A;  1TR2 A;  1QLE C;  2MYS A;  2YRF A;  4MND A;  1JAF A;  4U9D A;  3UMK A;  1C03 A;  3CEX A;  2LIG A;  1TKN A;  4NC3 A;  1E2X A;  2J9U A;  2YLI A;  4WGY A;  3HNL A;  1ZU4 A;  2NSF A;  4HE8 D;  4I3M A;  3LAY A;  4JCH A;  3WHN A;  1ZYR F;  2WB7 A;  5L0C A;  2LSE A;  1MMA A;  2FFH A;  1BBH A;  4DVY P;  1RKC A;  2P61 A;  1QVX A;  2ETS A;  3EZH A;  4X0R A;  4EKW A;  2XXA B;  5KYX B;  3N2Z B;  1N1C A;  4O79 A;  3LS1 A;  1JPN A;  1B68 A;  3U8V A;  4JTD B;  4DRI B;  4G78 A;  2PX3 A;  1EQ1 A;  4CSA C;  2OJQ A;  5HV9 A;  1CGN A;  4MVO A;  2R7T A;  2M64 A;  3QTH A;  3TJ5 A;  4I44 A;  5BQI A;  4N4W A;  5A69 A;  2VCB A;  1OR2 A;  4N06 A;  1PD0 A;  2PX0 A;  3VM6 A;  4JC7 A;  3EZI A;  1NBB A;  2W4M A;  4JCZ A;  3U2M A;  3W4Y A;  4EUK B;  3EGD A;  3ABK C;  2Q3T A; 
#chains in the Genus database with same CATH homology
 5F28 E;  1JOG A;  1OW6 A;  4NQF A;  4XEF A;  1OW7 A;  3O10 A;  1K04 A;  1PV3 A;  3BRJ A;  3MFN A;  3RQG A;  3S9O A;  1O3U A;  1UFB A;  3JYY A;  1ZZP A;  1K05 A;  3C8G A;  3GM3 A;  3B71 A;  3C8G B;  1OW8 A;  2L6H A;  2LK4 A;  2PBE A;  1QVX A;  3GM2 A;  1WWP A;  1KNY A;  2KK1 A;  2JX0 A;  3GM1 A;  2L6G A;  3C8G D;  1K40 A;  4EBJ A;  1KTM A;  3L8I A;  3K7D A;  3RQF A;  3JZ0 A;  1WTY A;  3C18 A;  1WOL A;  2L6F A;  3U0C A;  2JPU A;  4EBK A;  2Q00 A;  3TUL A;  3RQE A;  4XEK A;  2YWA A;  3L8J A;  4XEV A;  3U3F A;  1V4A A;  3AJM A;  4R32 A;  2HSB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...