3GM3A

Crystal structure of the focal adhesion targeting (fat) domain of pyk2
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
133
structure length
133
Chain Sequence
b'NLDRTDDLVYLNVMELVRAVLELKNELAQLPPEGYVVVVKNVGLTLRKLIGSVDDLLPSLPSSSRTEIEGTQKLLNKDLAELINKMRLAQQNAVTSLSEECKRQMLTASHTLAVDAKNLLDAVDQAKVLANLA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Protein tyrosine kinase 2 beta
publication title Crystal structures of free and ligand-bound focal adhesion targeting domain of Pyk2
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 55
structure length 133
sequence length 133
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2009-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03623 Focal_AT Focal adhesion targeting region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 3gm3A00
3C8GA 4R32A 3S9OA 3B71A 2L6HA 3C8GD 3L8JA 1O3UA 2KK1A 4XEKA 4EBJA 2JPUA 3TULA 1WWPA 1JOGA 2L6FA 4XEFA 1K05A 3JZ0A 3U0CA 3GM3A 2HSBA 2L6GA 3RQEA 1KTMA 3RQFA 3AJMA 3L8IA 3C18A 2Q00A 1UFBA 3GM1A 2LK4A 5F28E 4EBKA 1ZZPA 3RQGA 1WTYA 2PBEA 3U3FA 4NQFA 1KNYA 1OW6A 3MFNA 1K04A 2YWAA 1QVXA 1WOLA 1OW8A 3O10A 4XEVA 3K7DA 3BRJA 1K40A 3C8GB 3JYYA 1PV3A 1V4AA 1OW7A 2JX0A 3GM2A
chains in the Genus database with same CATH superfamily
3DJUB 3NMJA 4U5EE 3H2VA 2XM4A 2YLGA 5KYXA 4RBNA 1U89A 5KYYA 1VB5A 3T6BA 4BJ6A 1ZHTA 1T6QA 4UDVA 1SR2A 4JTAB 4C3DA 3M4CA 3OEOA 3WG7C 4W8KA 3ABMC 2J7PA 3DXJF 3NMKA 5HV9A 1UFBA 5F28E 5A69A 5JLIA 4CSAC 4KI2A 2IOQA 5E3AA 2H7OA 2YEVA 4O6MA 2Q9AA 4AE4B 4BJTA 4JTCB 1EQ1A 2YL1A 4YT5A 3KH2A 3MFNA 4DRIB 5IY5C 4CBEA 1GGQA 1BBHA 2OU6A 3RH3A 5JT4A 4O6NA 5K0IA 4XLNF 3EZHA 4IGGA 5L3QA 3QZCA 4QI0A 2HSQA 1ZHYA 3C8ZA 1V55C 4ER9A 3B0VC 5L3VA 4GQHA 3ATPA 3ECSA 4NC3A 3B71A 4FAPB 4C7OA 1FAPB 1MQVA 2XLOA 2QUPA 3SYNA 4JCHA 5DLJA 1E84A 3FMSA 3QW1A 3GM3A 2MWQA 3L1MA 4CS9C 2XXAA 1ZHXA 3HJCA 1HY5A 4BG0A 4Q5SF 5DQZA 1Q0MA 2J9WA 3ZSUA 1ZZPA 3K1IC 4MNDA 4FWVA 4NQFA 1MNEA 1YYXA 4PK4A 1KNYA 1I4ZA 2C03A 4HFFB 4WABA 4Z9HA 4A4AA 5L0IA 2LSEA 1TKNA 2W4MA 5BQGA 3UMKA 4OINF 3NDBB 5AC5A 1Q0GA 3X1OA 1ZU5A 2J8WA 2YRFA 2R7WA 2R7XA 3F46A 3VYWA 2OOCA 2H7VC 3W8HA 1JRAA 2IYLD 3LUTB 5D92A 4N06A 3C8GA 3FXHA 3S9OA 4MS2A 2FFHA 1B68A 1A41A 4PJNA 2YL3A 2ZXOA 4PJLA 1MMNA 2EIJC 2OKUA 2R05A 1M2OA 1U6HA 5B1BC 2L6FA 2YVKA 3V5ZA 4EHPA 3B0UX 4G7HF 2EPKX 2A1DD 2KGOA 2E87A 3C63A 3GM1A 2FGYA 4PFPA 2UUHA 3L34A 2Q3TA 2Y3BA 1CPQA 3EGXA 1NU9C 4E7ZA 3DE9A 3PHF2 1OW6A 4JJFA 3MBGA 3JYHA 1FNTc 4DBRA 3N0TA 1G4WR 2F22A 2OJED 1RKCA 2P61A 4J32B 2ASRA 4CS9A 1LIHA 1SYQA 1W2WA 3QTHA 3WODF 4YT2A 3HNIA 4XPWA 3K1IA 4YL0A 2DGJA 1Q0DA 1OXBA 1Z5ZA 3V7OA 3S27A 2ZD9A 2EPOA 3RIPA 4IRUA 3B0PA 3ZVRA 5E3CA 1OKKD 4OIRF 5B1AC 3TJ6A 2GA0A 1YVIA 2V3CC 5JSLA 4EBKA 2XL8A 3T6JA 4Q4ZF 3JCUQ 2WVQA 1T01A 1RKEB 4JRZA 3DAFA 4CDYA 4IAOA 3Q7GA 5E2QA 4OIOF 2HFIA 3O6XA 2HMQA 4H54A 2GDCA 1WOLA 2A68F 3KMIA 1WGWA 3G4ZA 2XSEA 3I5PA 4C3EA 4OIPF 3C7JA 2OEXA 4NTAA 1JAFA 1QSPA 3U2LA 3V5XA 4AL1A 5A6BA 4E7SA 1VLTA 2WVOA 3OA1A 2PFDA 3SXYA 3GM2A 2G62A 2WZFA 4BEMJ 3NRHA 4CS8A 1L7CA 1YLMA 2VC9A 1WATA 2EINC 2L9JA 3ABKC 2KNHA 1PD1A 3PMRA 4BPMA 4DBQA 2R7TA 2LCHA 4DVZA 2J9BA 1BR2A 2O9XA 4YN0B 2L81A 5AC4A 3A9CA 4NTFA 1YZCA 4P9TA 4JEBA 2EIKC 1NSGB 3RQEA 4CDAA 2XL6A 4ZLCA 3EH2A 3RFYA 3L8IA 3S90A 2J46A 3EQLF 1JMWA 1XZQA 3HNKA 3I4UA 4MTGA 4OD4A 2LP4A 3AG2C 1BDJB 4IARA 3RQGA 2PNOA 3TQOA 3T9OA 1PCXA 5BQHA 5JVEA 3L0IA 3LEVA 4C3BA 1Y6DA 5AGFA 4G7OF 4MVQA 1S05A 1N1CA 2AWYA 4K7BA 1BZ4A 5KYWB 2ZPAA 2HS5A 4K1OA 4KNWA 4N6CA 1JR8A 2B0HA 3IQ6A 1O5HA 4CS7A 4EKWA 1E86A 2VASA 4JVSA 4H4KC 2W4BA 3LNRA 3LS1A 4G0HA 3V5YA 5T3WA 3QVYA 4WJ0A 2WVNA 4EIYA 5L0DA 2NG1A 3FVYA 3FAJA 1EKYA 3US6A 1RXQA 1M57C 3M79A 5KYWA 2HJ3A 4BJ5C 4X0RA 1LVKA 1TFKB 5KYUB 2R25A 1ZVZA 1YARO 4O79A 1Z63A 3U2MA 3RKOF 1DOVA 1DOWA 4NCQA 4YJWA 4DOZA 4CIPA 1JPJA 2EIMC 1APCA 4KNVA 1MMAA 3OWTA 2QNLA 4MW8A 4AE4A 1BR4A 2XLVA 3N2ZB 5CI9A 3Q6MA 3G4XA 1V54C 4HEAJ 2KC3A 3G50A 3JSEO 3SP1A 2LIGA 2ICWG 3M15A 1ST6A 3DM9B 4I1MA 2LFDA 1V74B 3EHMA 1VTMP 2M4EA 1KU2A 2R7QA 3TJ5A 2OEVA 5L0JA 3E9VA 5BQIA 3CSKA 1NLXA 4NTBA 3AGUA 5L0CA 3FOPA 3AGTA 3B29A 4O6YA 3ZDLA 1E83A 2V26A 1OCOC 3C62A 4JEAA 2XL4A 4MVSA 4OD5A 1FTSA 5A6KA 1K04A 3UGOA 3N24A 2R7OA 4JJGA 3DD7A 1D1BA 2J0WA 4LACB 2R7SA 1RMVA 1M2VB 1OCZC 3HLZA 2HV7A 3DWWA 4BJ5A 4CSAA 3QMKA 3ITFA 3TOMA 2VCBA 4I3MA 3TK0A 3UGPA 4XQ1A 2JPUA 1H9GA 3U3BA 3VM6A 3SEOA 5COGA 4XWJA 1ZYRF 3HTKC 4CDVA 1T9KA 2HUJA 4OIQF 4MQ9F 3EG9A 3K66A 2LK4A 4DRJB 2AVKA 3W8IA 2VCCA 1TWGA 2PF4E 1T6UA 4LDKA 2H7BA 3NMIA 2L7AA 1OQCA 3LS0A 5A6JA 4D4XA 1LS4A 2NSGA 3DZAA 3IEEA 3W2VA 2CYDA 1YYJA 3K7DA 3U9JA 2A0UA 2YZSA 2BL2A 1YA9A 4YL1A 2NUTB 4MVRA 2ETSA 2Y3GA 4IB4A 1D1CA 3LLKA 1TWCA 1AVOB 2PBEA 3JT1A 3GWLA 3PCVA 4ANJA 4CJGA 4DXWA 3F47A 4EUKB 5L0FA 2J9VA 1VYIA 2PX0A 1LKXA 3L8JA 3ZWIA 4BEJA 5KYNA 1EA8A 1VLSA 3DI5A 3JZ0A 2I15A 4LERA 3UMIA 3IPMO 2WZGA 2FAPB 3AG3C 4HE8D 1Z7Qc 1FMVA 3HNLA 4E0IA 1A7EA 2Q00A 4I44A 3O55A 3RYLA 3DMDA 2XLMA 1Y4CA 2KW3C 3IQTA 2IXMA 4N4WA 4GEHA 4PR9A 2IXPA 4E17A 2GWWA 3CEXA 2BC5A 2CW0F 3S0XA 1TQGA 3FAPB 2IXNA 2NUTA 1YDIA 1RCPA 2UUIA 1QZXA 2YLDA 1H6GA 1A7VA 1OW8A 3GWNA 1RKEA 3IQCA 2W45A 3BRJA 3MLGA 4E0HA 1G4US 3JYYA 3ASOC 3EGDB 1SZIA 5COFA 2CNWD 3EFOB 3KPHA 4JW1A 4D4NA 4LDQA 4ULWA 5FCLA 3QW0A 4MVOA 1O87A 4LDRA 4EBJA 3O39A 2A69F 3GEIA 2MYSA 3IHUA 4A2NB 5CIVA 4LLEA 2R03A 2RSEB 3B9QA 2J9UA 2EPLX 1TR2A 3ZQVA 1AEPA 3W4YA 4P9FA 2KJGA 4EWCA 2YQYA 2JD3A 1I4YA 5CI8A 1SF8A 2WZLA 4JZAA 3ABLC 2R7UA 2R02A 2Q7RA 2NUPB 1MNDA 1QQ3A 1HE9A 2HJMA 3RVZA 1E2XA 2D4UA 3DJNB 4CJOA 4G7ZF 5DS4A 256BA 2M64A 3AOUA 1R4TA 1VOMA 1C02A 3QVZA 4J7TA 1WASA 5E33A 3WHNA 1LI5A 3X2QC 2XM0A 4JE9A 4N6HA 4R32A 1OR3A 1CGOA 1OXKA 4U5HA 4U5BE 1QKRA 2LD6A 1ZW3A 1O3UA 4QDLA 2XRHA 4XEKA 4XPYA 2X0CA 1OKKA 5T3TA 3PDMP 3FDQA 3ZTZA 1FR0A 5A6AA 2HZ8A 3IQ5A 3RQFA 4J30B 1D0ZA 1YJGA 4DRHB 3H2UA 4ZLDA 2ZXRA 3LJBA 1RJ9B 4YWQA 3HKKA 1TWAA 3NYLA 4U9DA 4O7GA 4MTFA 1C03A 4J7YA 1NFOA 4CIHA 1R5ID 5KYUA 1MMGA 5HSWA 3LEOA 2RD9A 3DM5A 1A0BA 1Z3IX 4K0DA 3K6BA 4XEVA 3NG1A 2HKVA 1ORYA 2OJQA 2LQGA 1I5NA 3GANA 2QTVA 3UR3C 5KYXB 1M6TA 4YK5A 1V4AA 4YT8A 5KYYB 5FZTA 2Y69C 3EH1A 2DYRC 1L3PA 3WAQA 2WB7A 4IAQA 4AX2A 3AQCA 2P1AA 2ZXPA 1YZAA 2L6HA 3C8GD 3FHDA 4JIOA 3U5SA 4E18A 4XLPF 3TULA 3GEHA 4P6IC 3POVA 3SXMA 2HMZA 1D1AA 4U9EA 1K05A 1XWJA 4U5FE 3U0CA 2HSBA 2L6GA 5TJ5E 2B0JA 1HMOA 2X51A 3C18A 1ORJA 3KYJA 1U0BB 1TFOB 2YL7A 1WTYA 3U3FA 5DVWA 3ZTMA 2P7VA 1CPRA 2CDQA 4XTKA 4U5GA 3JTLO 3SNHA 1HE1A 1ZHZA 1HW1A 2PP4A 3U9MA 3VAYA 3S29A 2QE9A 3VRCA 2KQ9A 1QVXA 2DB4A 3FOOA 1G8XA 2P0NA 3CZ6A 3SXKA 1A7DA 3LAYA 1LM3B 1VK5A 2NPUA 3AG4C 1MMDA 4KBLA 3ASNC 2XLHA 3RVYA 3VF0A 2D5RB 3GODA 3JRMO 2GAQA 3ZIBA 4C7OB 3K1HA 2KYHA 2OG2A 1GQAA 1VYKA 2CCYA 1NZEA 4HFKB 1Q0KA 1M2VA 1E85A 1GS9A 3EJNA 3TD7A 2XXAB 5F5FA 1XZPA 3M4BA 1M56C 3H65A 4MVZA 2XS8A 3NKEA 1D0XA 2EPNA 2WL8A 3BEHA 2R9RB 4XEFA 1QLEC 5BUOA 1NG1A 4ONSA 1CGNA 2GFHA 3SXZA 3M1CB 2DYSC 2CGEA 3JSZA 4L6RA 4JCZA 3R7CA 2MHRA 5DS5A 1J8YF 2A6HF 2KSFA 3CQZA 4CX9A 2Q9CA 2XLDA 1FMWA 2QY9A 4F4BA 5JUAA 4IWBA 1Q0FA 4NY3A 3J06A 3NYMA 3LLIA 3AG1C 1BR1A 1NU7D 3C8GB 4B6IA 4DVYP 2ZXWC 1C17M 1QPUA 1UG7A 3KYIA 2JX0A 4ULVA 2Q4FA 3HNJA 5F5HA 1IW7F 1J8MF 4JTDB 3UMHA 3RF3A 1WN0A 3I5QA 4MW3A 4IJJA 2VB6A 2YHSA 1Z23A 1OR2A 1TWHA 2XLEA 2YKZA 3EG9B 3Q7LA 2Q9BA 4MVMA 5JP7A 4BJ1A 2Y3DA 2EILC 1Z6AA 4FESA 3EGXB 4WGYA 3E70C 2H8AA 3AJMA 2J45A 3MYFA 4CS8C 4YL3A 5GPGB 5T1DB 4DJ9A 2NSFA 2YLIA 5B3SC 1GM5A 3MX3A 3T6GB 1G5ZA 2OCCC 1PD0A 2G3VA 2VH3A 3LNMB 4JKVA 3K33A 2YWAA 2AP3A 1LE2A 4LLCA 5JRAA 3DE8A 2DI3A 1AUEA 2IXOA 3AQBA 2AU5A 1NFNA 3EPVA 3NKDA 1PV3A 3EHNA 4PACA 4RD9A 5B3IA 3LESA 1ZW2A 2EPMX 1IZMA 5EK0A 3ZQYA 2XS1A 1YAUO 1YA7O 2Y3HA 2XLWA 3GEEA 3KL4A 3EGDA 2IBFA 2PX3A 1LI7A 2KK1A 2QLAA 2W9YA 1H7IA 2C04A 1WWPA 4QI2A 3EFOA 1LE4A 4GYTA 1KTMA 3W2WA 1D0YA 1FFTC 2AWCA 2VCAA 4XPXA 1OCCC 1OCRC 2Y39A 2J7PD 3A11A 4YT4A 3ZG1A 3TOLA 5L0GA 5EGYA 2R7RA 1T6IA 4BJ6C 1T5OA 4Z9IA 5A6BD 5DQTA 2BE5F 4MTOA 3ZC4A 3T4RA 4G78A 1JPNA 3Q6NA 4WGZA 1H9TA 1LS1A 1K40A 1NBBA 1VMAA 3JRTA 4Q7CA 1ZU4A 4U5CE 5L0HA 3NYJA 3RW0A 2NUPA 4KC9A 2I8BA 1OW7A 4Z9JA 3UNGC 5EHHA 1SMYF 3KKBA 1CGME 2IM8A 3DAGA 2R7VA 5DS6A 2J0XA 2Z15A 2P6VA 4PFOA 4MVUA 4PJJA 1HMDA 1JOGA 1S7ZA 5COMA 4EBBA 5JS5A 2LFFA 4JURI 3U8VA 4M63A 2G3KA 4I1OB 4U5DE 3U8PA 1FFHA 3DKAA 3R2PA 3GORA 2OQMA 3S28A 1HW2A 4W8PA 1RJ9A 4PJMA 4FX5A 3O10A 2HV6A 2A6EF 3CAXA 4JC7A 5D91A 1LPEA 2TMVP 4AK9A 1ORSC 1F1MA 1EI7A 3EZIA 2CNWA 4RDAA 1ZHWA 2A0BA 2YL0A 3MYIA 3SZRA 3S84A 4AL0A
chains in the Genus database with same CATH topology
3C8GA 4R32A 3S9OA 3B71A 2L6HA 3C8GD 3L8JA 1O3UA 2KK1A 4XEKA 4EBJA 2JPUA 3TULA 1WWPA 1JOGA 2L6FA 4XEFA 1K05A 3JZ0A 3U0CA 3GM3A 2HSBA 2L6GA 3RQEA 1KTMA 3RQFA 3AJMA 3L8IA 3C18A 2Q00A 1UFBA 3GM1A 2LK4A 5F28E 4EBKA 1ZZPA 3RQGA 1WTYA 2PBEA 3U3FA 4NQFA 1KNYA 1OW6A 3MFNA 1K04A 2YWAA 1QVXA 1WOLA 1OW8A 3O10A 4XEVA 3K7DA 3BRJA 1K40A 3C8GB 3JYYA 1PV3A 1V4AA 1OW7A 2JX0A 3GM2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C8G A;  4R32 A;  3S9O A;  3B71 A;  2L6H A;  3C8G D;  3L8J A;  1O3U A;  2KK1 A;  4XEK A;  4EBJ A;  2JPU A;  3TUL A;  1WWP A;  1JOG A;  2L6F A;  4XEF A;  1K05 A;  3JZ0 A;  3U0C A;  3GM3 A;  2HSB A;  2L6G A;  3RQE A;  1KTM A;  3RQF A;  3AJM A;  3L8I A;  3C18 A;  2Q00 A;  1UFB A;  3GM1 A;  2LK4 A;  5F28 E;  4EBK A;  1ZZP A;  3RQG A;  1WTY A;  2PBE A;  3U3F A;  4NQF A;  1KNY A;  1OW6 A;  3MFN A;  1K04 A;  2YWA A;  1QVX A;  1WOL A;  1OW8 A;  3O10 A;  4XEV A;  3K7D A;  3BRJ A;  1K40 A;  3C8G B;  3JYY A;  1PV3 A;  1V4A A;  1OW7 A;  2JX0 A;  3GM2 A; 
#chains in the Genus database with same CATH topology
 3DJU B;  3NMJ A;  4U5E E;  3H2V A;  2XM4 A;  2YLG A;  5KYX A;  4RBN A;  1U89 A;  5KYY A;  1VB5 A;  3T6B A;  4BJ6 A;  1ZHT A;  1T6Q A;  4UDV A;  1SR2 A;  4JTA B;  4C3D A;  3M4C A;  3OEO A;  3WG7 C;  4W8K A;  3ABM C;  2J7P A;  3DXJ F;  3NMK A;  5HV9 A;  1UFB A;  5F28 E;  5A69 A;  5JLI A;  4CSA C;  4KI2 A;  2IOQ A;  5E3A A;  2H7O A;  2YEV A;  4O6M A;  2Q9A A;  4AE4 B;  4BJT A;  4JTC B;  1EQ1 A;  2YL1 A;  4YT5 A;  3KH2 A;  3MFN A;  4DRI B;  5IY5 C;  4CBE A;  1GGQ A;  1BBH A;  2OU6 A;  3RH3 A;  5JT4 A;  4O6N A;  5K0I A;  4XLN F;  3EZH A;  4IGG A;  5L3Q A;  3QZC A;  4QI0 A;  2HSQ A;  1ZHY A;  3C8Z A;  1V55 C;  4ER9 A;  3B0V C;  5L3V A;  4GQH A;  3ATP A;  3ECS A;  4NC3 A;  3B71 A;  4FAP B;  4C7O A;  1FAP B;  1MQV A;  2XLO A;  2QUP A;  3SYN A;  4JCH A;  5DLJ A;  1E84 A;  3FMS A;  3QW1 A;  3GM3 A;  2MWQ A;  3L1M A;  4CS9 C;  2XXA A;  1ZHX A;  3HJC A;  1HY5 A;  4BG0 A;  4Q5S F;  5DQZ A;  1Q0M A;  2J9W A;  3ZSU A;  1ZZP A;  3K1I C;  4MND A;  4FWV A;  4NQF A;  1MNE A;  1YYX A;  4PK4 A;  1KNY A;  1I4Z A;  2C03 A;  4HFF B;  4WAB A;  4Z9H A;  4A4A A;  5L0I A;  2LSE A;  1TKN A;  2W4M A;  5BQG A;  3UMK A;  4OIN F;  3NDB B;  5AC5 A;  1Q0G A;  3X1O A;  1ZU5 A;  2J8W A;  2YRF A;  2R7W A;  2R7X A;  3F46 A;  3VYW A;  2OOC A;  2H7V C;  3W8H A;  1JRA A;  2IYL D;  3LUT B;  5D92 A;  4N06 A;  3C8G A;  3FXH A;  3S9O A;  4MS2 A;  2FFH A;  1B68 A;  1A41 A;  4PJN A;  2YL3 A;  2ZXO A;  4PJL A;  1MMN A;  2EIJ C;  2OKU A;  2R05 A;  1M2O A;  1U6H A;  5B1B C;  2L6F A;  2YVK A;  3V5Z A;  4EHP A;  3B0U X;  4G7H F;  2EPK X;  2A1D D;  2KGO A;  2E87 A;  3C63 A;  3GM1 A;  2FGY A;  4PFP A;  2UUH A;  3L34 A;  2Q3T A;  2Y3B A;  1CPQ A;  3EGX A;  1NU9 C;  4E7Z A;  3DE9 A;  3PHF 2;  1OW6 A;  4JJF A;  3MBG A;  3JYH A;  1FNT c;  4DBR A;  3N0T A;  1G4W R;  2F22 A;  2OJE D;  1RKC A;  2P61 A;  4J32 B;  2ASR A;  4CS9 A;  1LIH A;  1SYQ A;  1W2W A;  3QTH A;  3WOD F;  4YT2 A;  3HNI A;  4XPW A;  3K1I A;  4YL0 A;  2DGJ A;  1Q0D A;  1OXB A;  1Z5Z A;  3V7O A;  3S27 A;  2ZD9 A;  2EPO A;  3RIP A;  4IRU A;  3B0P A;  3ZVR A;  5E3C A;  1OKK D;  4OIR F;  5B1A C;  3TJ6 A;  2GA0 A;  1YVI A;  2V3C C;  5JSL A;  4EBK A;  2XL8 A;  3T6J A;  4Q4Z F;  3JCU Q;  2WVQ A;  1T01 A;  1RKE B;  4JRZ A;  3DAF A;  4CDY A;  4IAO A;  3Q7G A;  5E2Q A;  4OIO F;  2HFI A;  3O6X A;  2HMQ A;  4H54 A;  2GDC A;  1WOL A;  2A68 F;  3KMI A;  1WGW A;  3G4Z A;  2XSE A;  3I5P A;  4C3E A;  4OIP F;  3C7J A;  2OEX A;  4NTA A;  1JAF A;  1QSP A;  3U2L A;  3V5X A;  4AL1 A;  5A6B A;  4E7S A;  1VLT A;  2WVO A;  3OA1 A;  2PFD A;  3SXY A;  3GM2 A;  2G62 A;  2WZF A;  4BEM J;  3NRH A;  4CS8 A;  1L7C A;  1YLM A;  2VC9 A;  1WAT A;  2EIN C;  2L9J A;  3ABK C;  2KNH A;  1PD1 A;  3PMR A;  4BPM A;  4DBQ A;  2R7T A;  2LCH A;  4DVZ A;  2J9B A;  1BR2 A;  2O9X A;  4YN0 B;  2L81 A;  5AC4 A;  3A9C A;  4NTF A;  1YZC A;  4P9T A;  4JEB A;  2EIK C;  1NSG B;  3RQE A;  4CDA A;  2XL6 A;  4ZLC A;  3EH2 A;  3RFY A;  3L8I A;  3S90 A;  2J46 A;  3EQL F;  1JMW A;  1XZQ A;  3HNK A;  3I4U A;  4MTG A;  4OD4 A;  2LP4 A;  3AG2 C;  1BDJ B;  4IAR A;  3RQG A;  2PNO A;  3TQO A;  3T9O A;  1PCX A;  5BQH A;  5JVE A;  3L0I A;  3LEV A;  4C3B A;  1Y6D A;  5AGF A;  4G7O F;  4MVQ A;  1S05 A;  1N1C A;  2AWY A;  4K7B A;  1BZ4 A;  5KYW B;  2ZPA A;  2HS5 A;  4K1O A;  4KNW A;  4N6C A;  1JR8 A;  2B0H A;  3IQ6 A;  1O5H A;  4CS7 A;  4EKW A;  1E86 A;  2VAS A;  4JVS A;  4H4K C;  2W4B A;  3LNR A;  3LS1 A;  4G0H A;  3V5Y A;  5T3W A;  3QVY A;  4WJ0 A;  2WVN A;  4EIY A;  5L0D A;  2NG1 A;  3FVY A;  3FAJ A;  1EKY A;  3US6 A;  1RXQ A;  1M57 C;  3M79 A;  5KYW A;  2HJ3 A;  4BJ5 C;  4X0R A;  1LVK A;  1TFK B;  5KYU B;  2R25 A;  1ZVZ A;  1YAR O;  4O79 A;  1Z63 A;  3U2M A;  3RKO F;  1DOV A;  1DOW A;  4NCQ A;  4YJW A;  4DOZ A;  4CIP A;  1JPJ A;  2EIM C;  1APC A;  4KNV A;  1MMA A;  3OWT A;  2QNL A;  4MW8 A;  4AE4 A;  1BR4 A;  2XLV A;  3N2Z B;  5CI9 A;  3Q6M A;  3G4X A;  1V54 C;  4HEA J;  2KC3 A;  3G50 A;  3JSE O;  3SP1 A;  2LIG A;  2ICW G;  3M15 A;  1ST6 A;  3DM9 B;  4I1M A;  2LFD A;  1V74 B;  3EHM A;  1VTM P;  2M4E A;  1KU2 A;  2R7Q A;  3TJ5 A;  2OEV A;  5L0J A;  3E9V A;  5BQI A;  3CSK A;  1NLX A;  4NTB A;  3AGU A;  5L0C A;  3FOP A;  3AGT A;  3B29 A;  4O6Y A;  3ZDL A;  1E83 A;  2V26 A;  1OCO C;  3C62 A;  4JEA A;  2XL4 A;  4MVS A;  4OD5 A;  1FTS A;  5A6K A;  1K04 A;  3UGO A;  3N24 A;  2R7O A;  4JJG A;  3DD7 A;  1D1B A;  2J0W A;  4LAC B;  2R7S A;  1RMV A;  1M2V B;  1OCZ C;  3HLZ A;  2HV7 A;  3DWW A;  4BJ5 A;  4CSA A;  3QMK A;  3ITF A;  3TOM A;  2VCB A;  4I3M A;  3TK0 A;  3UGP A;  4XQ1 A;  2JPU A;  1H9G A;  3U3B A;  3VM6 A;  3SEO A;  5COG A;  4XWJ A;  1ZYR F;  3HTK C;  4CDV A;  1T9K A;  2HUJ A;  4OIQ F;  4MQ9 F;  3EG9 A;  3K66 A;  2LK4 A;  4DRJ B;  2AVK A;  3W8I A;  2VCC A;  1TWG A;  2PF4 E;  1T6U A;  4LDK A;  2H7B A;  3NMI A;  2L7A A;  1OQC A;  3LS0 A;  5A6J A;  4D4X A;  1LS4 A;  2NSG A;  3DZA A;  3IEE A;  3W2V A;  2CYD A;  1YYJ A;  3K7D A;  3U9J A;  2A0U A;  2YZS A;  2BL2 A;  1YA9 A;  4YL1 A;  2NUT B;  4MVR A;  2ETS A;  2Y3G A;  4IB4 A;  1D1C A;  3LLK A;  1TWC A;  1AVO B;  2PBE A;  3JT1 A;  3GWL A;  3PCV A;  4ANJ A;  4CJG A;  4DXW A;  3F47 A;  4EUK B;  5L0F A;  2J9V A;  1VYI A;  2PX0 A;  1LKX A;  3L8J A;  3ZWI A;  4BEJ A;  5KYN A;  1EA8 A;  1VLS A;  3DI5 A;  3JZ0 A;  2I15 A;  4LER A;  3UMI A;  3IPM O;  2WZG A;  2FAP B;  3AG3 C;  4HE8 D;  1Z7Q c;  1FMV A;  3HNL A;  4E0I A;  1A7E A;  2Q00 A;  4I44 A;  3O55 A;  3RYL A;  3DMD A;  2XLM A;  1Y4C A;  2KW3 C;  3IQT A;  2IXM A;  4N4W A;  4GEH A;  4PR9 A;  2IXP A;  4E17 A;  2GWW A;  3CEX A;  2BC5 A;  2CW0 F;  3S0X A;  1TQG A;  3FAP B;  2IXN A;  2NUT A;  1YDI A;  1RCP A;  2UUI A;  1QZX A;  2YLD A;  1H6G A;  1A7V A;  1OW8 A;  3GWN A;  1RKE A;  3IQC A;  2W45 A;  3BRJ A;  3MLG A;  4E0H A;  1G4U S;  3JYY A;  3ASO C;  3EGD B;  1SZI A;  5COF A;  2CNW D;  3EFO B;  3KPH A;  4JW1 A;  4D4N A;  4LDQ A;  4ULW A;  5FCL A;  3QW0 A;  4MVO A;  1O87 A;  4LDR A;  4EBJ A;  3O39 A;  2A69 F;  3GEI A;  2MYS A;  3IHU A;  4A2N B;  5CIV A;  4LLE A;  2R03 A;  2RSE B;  3B9Q A;  2J9U A;  2EPL X;  1TR2 A;  3ZQV A;  1AEP A;  3W4Y A;  4P9F A;  2KJG A;  4EWC A;  2YQY A;  2JD3 A;  1I4Y A;  5CI8 A;  1SF8 A;  2WZL A;  4JZA A;  3ABL C;  2R7U A;  2R02 A;  2Q7R A;  2NUP B;  1MND A;  1QQ3 A;  1HE9 A;  2HJM A;  3RVZ A;  1E2X A;  2D4U A;  3DJN B;  4CJO A;  4G7Z F;  5DS4 A;  256B A;  2M64 A;  3AOU A;  1R4T A;  1VOM A;  1C02 A;  3QVZ A;  4J7T A;  1WAS A;  5E33 A;  3WHN A;  1LI5 A;  3X2Q C;  2XM0 A;  4JE9 A;  4N6H A;  4R32 A;  1OR3 A;  1CGO A;  1OXK A;  4U5H A;  4U5B E;  1QKR A;  2LD6 A;  1ZW3 A;  1O3U A;  4QDL A;  2XRH A;  4XEK A;  4XPY A;  2X0C A;  1OKK A;  5T3T A;  3PDM P;  3FDQ A;  3ZTZ A;  1FR0 A;  5A6A A;  2HZ8 A;  3IQ5 A;  3RQF A;  4J30 B;  1D0Z A;  1YJG A;  4DRH B;  3H2U A;  4ZLD A;  2ZXR A;  3LJB A;  1RJ9 B;  4YWQ A;  3HKK A;  1TWA A;  3NYL A;  4U9D A;  4O7G A;  4MTF A;  1C03 A;  4J7Y A;  1NFO A;  4CIH A;  1R5I D;  5KYU A;  1MMG A;  5HSW A;  3LEO A;  2RD9 A;  3DM5 A;  1A0B A;  1Z3I X;  4K0D A;  3K6B A;  4XEV A;  3NG1 A;  2HKV A;  1ORY A;  2OJQ A;  2LQG A;  1I5N A;  3GAN A;  2QTV A;  3UR3 C;  5KYX B;  1M6T A;  4YK5 A;  1V4A A;  4YT8 A;  5KYY B;  5FZT A;  2Y69 C;  3EH1 A;  2DYR C;  1L3P A;  3WAQ A;  2WB7 A;  4IAQ A;  4AX2 A;  3AQC A;  2P1A A;  2ZXP A;  1YZA A;  2L6H A;  3C8G D;  3FHD A;  4JIO A;  3U5S A;  4E18 A;  4XLP F;  3TUL A;  3GEH A;  4P6I C;  3POV A;  3SXM A;  2HMZ A;  1D1A A;  4U9E A;  1K05 A;  1XWJ A;  4U5F E;  3U0C A;  2HSB A;  2L6G A;  5TJ5 E;  2B0J A;  1HMO A;  2X51 A;  3C18 A;  1ORJ A;  3KYJ A;  1U0B B;  1TFO B;  2YL7 A;  1WTY A;  3U3F A;  5DVW A;  3ZTM A;  2P7V A;  1CPR A;  2CDQ A;  4XTK A;  4U5G A;  3JTL O;  3SNH A;  1HE1 A;  1ZHZ A;  1HW1 A;  2PP4 A;  3U9M A;  3VAY A;  3S29 A;  2QE9 A;  3VRC A;  2KQ9 A;  1QVX A;  2DB4 A;  3FOO A;  1G8X A;  2P0N A;  3CZ6 A;  3SXK A;  1A7D A;  3LAY A;  1LM3 B;  1VK5 A;  2NPU A;  3AG4 C;  1MMD A;  4KBL A;  3ASN C;  2XLH A;  3RVY A;  3VF0 A;  2D5R B;  3GOD A;  3JRM O;  2GAQ A;  3ZIB A;  4C7O B;  3K1H A;  2KYH A;  2OG2 A;  1GQA A;  1VYK A;  2CCY A;  1NZE A;  4HFK B;  1Q0K A;  1M2V A;  1E85 A;  1GS9 A;  3EJN A;  3TD7 A;  2XXA B;  5F5F A;  1XZP A;  3M4B A;  1M56 C;  3H65 A;  4MVZ A;  2XS8 A;  3NKE A;  1D0X A;  2EPN A;  2WL8 A;  3BEH A;  2R9R B;  4XEF A;  1QLE C;  5BUO A;  1NG1 A;  4ONS A;  1CGN A;  2GFH A;  3SXZ A;  3M1C B;  2DYS C;  2CGE A;  3JSZ A;  4L6R A;  4JCZ A;  3R7C A;  2MHR A;  5DS5 A;  1J8Y F;  2A6H F;  2KSF A;  3CQZ A;  4CX9 A;  2Q9C A;  2XLD A;  1FMW A;  2QY9 A;  4F4B A;  5JUA A;  4IWB A;  1Q0F A;  4NY3 A;  3J06 A;  3NYM A;  3LLI A;  3AG1 C;  1BR1 A;  1NU7 D;  3C8G B;  4B6I A;  4DVY P;  2ZXW C;  1C17 M;  1QPU A;  1UG7 A;  3KYI A;  2JX0 A;  4ULV A;  2Q4F A;  3HNJ A;  5F5H A;  1IW7 F;  1J8M F;  4JTD B;  3UMH A;  3RF3 A;  1WN0 A;  3I5Q A;  4MW3 A;  4IJJ A;  2VB6 A;  2YHS A;  1Z23 A;  1OR2 A;  1TWH A;  2XLE A;  2YKZ A;  3EG9 B;  3Q7L A;  2Q9B A;  4MVM A;  5JP7 A;  4BJ1 A;  2Y3D A;  2EIL C;  1Z6A A;  4FES A;  3EGX B;  4WGY A;  3E70 C;  2H8A A;  3AJM A;  2J45 A;  3MYF A;  4CS8 C;  4YL3 A;  5GPG B;  5T1D B;  4DJ9 A;  2NSF A;  2YLI A;  5B3S C;  1GM5 A;  3MX3 A;  3T6G B;  1G5Z A;  2OCC C;  1PD0 A;  2G3V A;  2VH3 A;  3LNM B;  4JKV A;  3K33 A;  2YWA A;  2AP3 A;  1LE2 A;  4LLC A;  5JRA A;  3DE8 A;  2DI3 A;  1AUE A;  2IXO A;  3AQB A;  2AU5 A;  1NFN A;  3EPV A;  3NKD A;  1PV3 A;  3EHN A;  4PAC A;  4RD9 A;  5B3I A;  3LES A;  1ZW2 A;  2EPM X;  1IZM A;  5EK0 A;  3ZQY A;  2XS1 A;  1YAU O;  1YA7 O;  2Y3H A;  2XLW A;  3GEE A;  3KL4 A;  3EGD A;  2IBF A;  2PX3 A;  1LI7 A;  2KK1 A;  2QLA A;  2W9Y A;  1H7I A;  2C04 A;  1WWP A;  4QI2 A;  3EFO A;  1LE4 A;  4GYT A;  1KTM A;  3W2W A;  1D0Y A;  1FFT C;  2AWC A;  2VCA A;  4XPX A;  1OCC C;  1OCR C;  2Y39 A;  2J7P D;  3A11 A;  4YT4 A;  3ZG1 A;  3TOL A;  5L0G A;  5EGY A;  2R7R A;  1T6I A;  4BJ6 C;  1T5O A;  4Z9I A;  5A6B D;  5DQT A;  2BE5 F;  4MTO A;  3ZC4 A;  3T4R A;  4G78 A;  1JPN A;  3Q6N A;  4WGZ A;  1H9T A;  1LS1 A;  1K40 A;  1NBB A;  1VMA A;  3JRT A;  4Q7C A;  1ZU4 A;  4U5C E;  5L0H A;  3NYJ A;  3RW0 A;  2NUP A;  4KC9 A;  2I8B A;  1OW7 A;  4Z9J A;  3UNG C;  5EHH A;  1SMY F;  3KKB A;  1CGM E;  2IM8 A;  3DAG A;  2R7V A;  5DS6 A;  2J0X A;  2Z15 A;  2P6V A;  4PFO A;  4MVU A;  4PJJ A;  1HMD A;  1JOG A;  1S7Z A;  5COM A;  4EBB A;  5JS5 A;  2LFF A;  4JUR I;  3U8V A;  4M63 A;  2G3K A;  4I1O B;  4U5D E;  3U8P A;  1FFH A;  3DKA A;  3R2P A;  3GOR A;  2OQM A;  3S28 A;  1HW2 A;  4W8P A;  1RJ9 A;  4PJM A;  4FX5 A;  3O10 A;  2HV6 A;  2A6E F;  3CAX A;  4JC7 A;  5D91 A;  1LPE A;  2TMV P;  4AK9 A;  1ORS C;  1F1M A;  1EI7 A;  3EZI A;  2CNW A;  4RDA A;  1ZHW A;  2A0B A;  2YL0 A;  3MYI A;  3SZR A;  3S84 A;  4AL0 A; 
#chains in the Genus database with same CATH homology
 3C8G A;  4R32 A;  3S9O A;  3B71 A;  2L6H A;  3C8G D;  3L8J A;  1O3U A;  2KK1 A;  4XEK A;  4EBJ A;  2JPU A;  3TUL A;  1WWP A;  1JOG A;  2L6F A;  4XEF A;  1K05 A;  3JZ0 A;  3U0C A;  3GM3 A;  2HSB A;  2L6G A;  3RQE A;  1KTM A;  3RQF A;  3AJM A;  3L8I A;  3C18 A;  2Q00 A;  1UFB A;  3GM1 A;  2LK4 A;  5F28 E;  4EBK A;  1ZZP A;  3RQG A;  1WTY A;  2PBE A;  3U3F A;  4NQF A;  1KNY A;  1OW6 A;  3MFN A;  1K04 A;  2YWA A;  1QVX A;  1WOL A;  1OW8 A;  3O10 A;  4XEV A;  3K7D A;  3BRJ A;  1K40 A;  3C8G B;  3JYY A;  1PV3 A;  1V4A A;  1OW7 A;  2JX0 A;  3GM2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...