3GM3A

Crystal structure of the focal adhesion targeting (fat) domain of pyk2
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
133
structure length
133
Chain Sequence
NLDRTDDLVYLNVMELVRAVLELKNELAQLPPEGYVVVVKNVGLTLRKLIGSVDDLLPSLPSSSRTEIEGTQKLLNKDLAELINKMRLAQQNAVTSLSEECKRQMLTASHTLAVDAKNLLDAVDQAKVLANLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Protein tyrosine kinase 2 beta
publication title Crystal structures of free and ligand-bound focal adhesion targeting domain of Pyk2
pubmed doi rcsb
source organism Homo sapiens
total genus 55
structure length 133
sequence length 133
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2009-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03623 Focal_AT Focal adhesion targeting region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 3gm3A00
3TULA 1O3UA 2HSBA 1OW7A 3GM2A 4NQFA 3MFNA 1KNYA 4EBKA 3BRJA 1K40A 3RQGA 4R32A 3L8JA 3U3FA 3C8GD 3GM3A 1QVXA 2L6HA 3JZ0A 5F28E 3U0CA 1KTMA 4EBJA 1WOLA 1K05A 1WTYA 3O10A 2JX0A 3C18A 3K7DA 2KK1A 2Q00A 3GM1A 4XEFA 1V4AA 1WWPA 3L8IA 2L6FA 1OW8A 1PV3A 2LK4A 1K04A 2L6GA 2PBEA 1JOGA 1UFBA 2YWAA 3AJMA 4XEKA 3RQFA 3JYYA 3C8GB 3B71A 1OW6A 3RQEA 4XEVA 3S9OA 1ZZPA 2JPUA 3C8GA
chains in the Genus database with same CATH superfamily
1AVOB 4RDAA 4WJ0A 4DJ9A 3GEIA 2Q7RA 5JVEA 3HNJA 4YWQA 1BZ4A 4Q5SF 2HJ3A 3B0PA 2PX0A 4PJMA 4I3MA 4NY3A 1C03A 3ATPA 4U5GA 2JD3A 3EGDA 2PNOA 3KYJA 3LAYA 1JMWA 1QKRA 5EK0A 3V7OA 3K66A 3U5SA 1GQAA 2NG1A 1KU2A 4G78A 4XPWA 3UMHA 3SP1A 2W9YA 2A68F 4HEAJ 4JTAB 2J45A 2P6VA 1T6UA 1TQGA 3SXKA 1APCA 4N4WA 1IZMA 4JC7A 4ULVA 4CS7A 1IW7F 2EPMX 2IXPA 5BQIA 4OIQF 1UFBA 4O6MA 2KYHA 2X51A 1FMWA 3C8GB 4AE4A 1L7CA 3LUTB 2NSFA 1Z3IX 2PFDA 2R02A 3MYFA 1AUEA 4JEAA 2J9BA 1OW7A 1SYQA 2EILC 2HKVA 2KGOA 2PX3A 3VAYA 4H54A 3VYWA 2G3KA 2IXNA 1Y4CA 4IARA 2MYSA 2Y69C 1CPQA 4CS8A 2IOQA 4MVQA 1MNDA 2HMQA 5AC5A 3N0TA 2XXAA 2GWWA 5L3QA 1D1BA 1TKNA 1ZHXA 2LD6A 4JJGA 1G4US 4MNDA 1V55C 4PJNA 4MVSA 5T3TA 1H9TA 3BEHA 5E3AA 1H6GA 3C8ZA 1ST6A 4YT2A 1D1AA 1E84A 1LKXA 3QVYA 1MNEA 2P61A 5CI9A 4U5EE 4MTFA 2B0JA 1CGME 2J46A 2MWQA 3AJMA 1NLXA 3EH2A 2Q4FA 4ZLCA 5E3CA 3S90A 3EHMA 1ZHYA 4IAQA 3S9OA 2CCYA 1VYIA 1O3UA 3KH2A 4KNWA 5FCLA 1T6IA 5A6BD 5L3VA 1HE1A 3M4CA 4MVRA 3EPVA 3AG2C 4QI2A 1Q0GA 2OQMA 1Z6AA 2HS5A 5GPGB 1Z7Qc 2NSGA 4E17A 3Q7LA 3O6XA 2PF4E 3K1IC 3U3FA 3C8GD 2J9UA 5L0IA 1ZW3A 2OJQA 4C7OA 2YLGA 3GODA 2G3VA 2HFIA 3U9JA 2R7QA 1K05A 2QUPA 4YN0B 2JX0A 1SF8A 5KYYA 3E70C 3EFOA 2I15A 4BJ5C 2L6FA 2I8BA 3HNIA 1JPNA 1V54C 4XEKA 2YWAA 4CSAC 3RQFA 2R03A 1U6HA 2CW0F 3RVYA 1V74B 2A0BA 4GQHA 5DQZA 1OW6A 2XM0A 2OJED 4R32A 2CGEA 4JE9A 3A9CA 3CZ6A 3K33A 1LM3B 1OR2A 1R5ID 4G0HA 4UDVA 2R9RB 2ICWG 1NU7D 4MVUA 1HW2A 1Q0DA 4A4AA 3DD7A 1LE2A 2G62A 1ORYA 4XPYA 2M4EA 1Z5ZA 1YA9A 1EA8A 4JZAA 1YYJA 4XLPF 1TFOB 2UUHA 1KTMA 3GANA 2R05A 4MW8A 4P6IC 1I4ZA 3NMIA 5KYWA 3RW0A 1CGNA 1OQCA 1VLSA 3GWLA 3MBGA 2XL4A 4HFFB 2LSEA 1I5NA 1EQ1A 2R7SA 4CS9C 3NDBB 2R7TA 2WL8A 4U5CE 2FAPB 2BL2A 4J7TA 3LEVA 4DRHB 3B0UX 1FAPB 2W45A 3M1CB 2OU6A 1KNYA 2EINC 3WHNA 2Y3DA 5L0HA 1S05A 3ZVRA 2H7OA 3HNLA 4YL1A 3EH1A 2XRHA 3MYIA 2MHRA 2Y39A 1OKKD 2J9WA 4JVSA 5BUOA 5F28E 4N6HA 1M57C 3G4XA 2QNLA 1NFNA 4LACB 2KW3C 2A6HF 3QW0A 3TD7A 4EBJA 4BEJA 4O7GA 1FMVA 4JCZA 4Z9JA 4DVYP 4BEMJ 1SMYF 2FFHA 4KC9A 4U5HA 2OEXA 3SNHA 2WZGA 2XLEA 1NBBA 5A6BA 2NUTA 3IEEA 1VK5A 4FAPB 1R4TA 2J8WA 1T5OA 2A1DD 3DE8A 5TJ5E 3NKDA 3ZWIA 2A6EF 4QDLA 3DJNB 3SYNA 3VF0A 1Y6DA 2F22A 2XLDA 3C8GA 3IQCA 3LJBA 3O55A 4PFPA 4F4BA 5DS6A 1YDIA 3PHF2 3RF3A 2W4BA 3ZQYA 3EQLF 4H4KC 1OCCC 4OIRF 2O9XA 3HJCA 3LS0A 2Z15A 2J0WA 3CQZA 2TMVP 2WVOA 1YVIA 2EPNA 3LNRA 5KYXB 1YAUO 2R7RA 3U0CA 4ANJA 3FMSA 1T9KA 1H7IA 3TK0A 2HV7A 1WOLA 3DXJF 3DE9A 5JRAA 4ER9A 2KJGA 4EWCA 4IGGA 1VMAA 3FXHA 3GM1A 4KBLA 3V5YA 2LCHA 2CNWD 4OD4A 5JLIA 1T6QA 3X1OA 1E2XA 1QZXA 1RKEB 2L6GA 1ZHZA 3LS1A 3SXMA 5HSWA 2HZ8A 3WODF 3OA1A 4G7OF 3N24A 1EKYA 2HMZA 4J32B 2XLWA 5L0GA 1Q0FA 4MTOA 3QW1A 2WB7A 3ZC4A 5KYNA 2VCBA 3DAGA 3ITFA 4E7SA 3PMRA 3K1IA 3ASOC 3EGXB 3I5PA 3AGTA 1HMOA 2H7BA 3W4YA 3S0XA 3FDQA 4JRZA 3JZ0A 1SZIA 1OXKA 3H2VA 4AK9A 2EPOA 4Z9IA 3EHNA 3FOPA 3S27A 3EG9B 5CIVA 4NC3A 3Q6NA 3TJ6A 4BJ5A 1M2VB 1OCOC 2KK1A 4E7ZA 3NG1A 5B1AC 4CSAA 1O5HA 4XLNF 3US6A 4EHPA 2E87A 1PV3A 2PBEA 5KYUA 4JURI 4XTKA 3B29A 3SEOA 5A69A 3G50A 1O87A 2BE5F 1BR1A 4IRUA 3LEOA 1A7DA 4NTBA 3TQOA 2VC9A 1C02A 1EI7A 2YL0A 3MX3A 2XLOA 2Q3TA 2VH3A 2LFFA 1TWAA 4I44A 3KPHA 1ZU4A 2W4MA 3L34A 5T3WA 1QQ3A 5L0FA 3PCVA 4AL0A 1ZHWA 3SXYA 1G4WR 4G7HF 4ZLDA 2IXOA 2XM4A 2FGYA 2EIJC 2EPLX 2L81A 3H65A 4AX2A 5CI8A 1S7ZA 4OIPF 2DYRC 2HSQA 4XPXA 3OWTA 2XSEA 1WGWA 2VCCA 2WZLA 3O10A 3HNKA 3ZTZA 1Z63A 2IXMA 4BG0A 1LS1A 4BJ6C 3JYHA 4AE4B 4CS9A 4DBQA 1DOVA 1E85A 1OXBA 3O39A 4HE8D 3KL4A 4G7ZF 3UGOA 1BR4A 1JOGA 2YLIA 1A7VA 3RKOF 2X0CA 1VB5A 3WG7C 4FX5A 2D4UA 2CYDA 2DB4A 3CAXA 1N1CA 2YL1A 3QZCA 3NYMA 3C7JA 4OINF 2WVQA 2ZXOA 3MFNA 3FOOA 4FESA 4DVZA 1M2OA 4DBRA 2XXAB 4YJWA 2DI3A 4JEBA 1LS4A 5DVWA 3PDMP 2YLDA 3FHDA 2DYSC 5A6KA 3JSEO 3DJUB 4XWJA 1C17M 2L7AA 3Q7GA 3SZRA 1VLTA 2GFHA 4GYTA 2AVKA 4MW3A 3S84A 3NMKA 3GEHA 3KKBA 4U9DA 3IQ6A 1ZW2A 3DAFA 3JRMO 4J30B 4RD9A 2XL6A 4C3BA 4M63A 3FAPB 2A0UA 4NTFA 3RVZA 1CGOA 2ZXRA 2NUPB 2QE9A 4E18A 1U0BB 1RJ9A 3LLIA 4MVOA 1BBHA 1WASA 1E86A 2DGJA 1NSGB 1RKCA 1H9GA 3L0IA 4CIPA 1UG7A 1LE4A 4GEHA 4JJFA 4E0HA 3NKEA 3GM2A 4NQFA 4WGYA 1A0BA 3F47A 3RH3A 1TFKB 4X0RA 2IYLD 5DQTA 2AWYA 1D0ZA 2YRFA 2YEVA 5IY5C 1LIHA 1MQVA 2XLMA 1YA7O 1YZAA 4LDQA 3AQCA 3POVA 1ORSC 2KC3A 5L0JA 4C7OB 5KYYB 1NFOA 1MMNA 4DRJB 3MLGA 3EFOB 2Y3BA 3TOMA 5KYXA 4PJLA 4BJ1A 2HUJA 3ABLC 3QMKA 2VCAA 3V5ZA 3AG1C 4ONSA 2R7XA 1ORJA 1WWPA 2P0NA 4JKVA 4P9TA 4D4NA 4CDYA 4KI2A 3EJNA 4IAOA 1YLMA 2L9JA 2M64A 5COFA 2AP3A 5D91A 2XS8A 1XWJA 3U2LA 3W8IA 1WN0A 3IPMO 3DI5A 1JPJA 1LVKA 3ASNC 2B0HA 3GORA 3NRHA 5COMA 1TWHA 2OEVA 2EIMC 4CIHA 4MQ9F 3FVYA 1M56C 3V5XA 5L0DA 2Q9BA 3OEOA 5KYWB 1PD1A 1CPRA 1QVXA 2L6HA 1HY5A 3TJ5A 4FWVA 1WATA 4LERA 5B1BC 1XZQA 2H7VC 3Q6MA 5EGYA 1BDJB 2ZPAA 2OCCC 3KYIA 2OOCA 1MMDA 1M2VA 3ECSA 4O79A 2J7PD 4KNVA 4K0DA 4EIYA 1SR2A 2RD9A 3W2VA 1T01A 1TR2A 5EHHA 4YT5A 5JS5A 1Q0KA 4XEVA 4PR9A 3ZSUA 1VOMA 2LFDA 1LI7A 1J8MF 2YL3A 5B3SC 5A6JA 5A6AA 3TULA 5FZTA 5B3IA 2GA0A 1DOWA 3I5QA 1AEPA 1G5ZA 1B68A 3KMIA 1PD0A 4LLEA 5JP7A 1FNTc 1NU9C 2Q9AA 4MVMA 2R7UA 1K40A 3LLKA 3RQGA 2R7WA 3UGPA 1A7EA 3L8JA 3GM3A 4OD5A 5AGFA 4CJOA 3DM5A 2QLAA 1QSPA 1RCPA 3NYLA 1M6TA 2ZXWC 3M79A 4IB4A 1F1MA 3AG3C 4BJ6A 4U5BE 2NUTB 2V26A 1Z23A 2KQ9A 2R25A 3ABKC 3DWWA 4LDKA 3TOLA 3VM6A 2LP4A 2VB6A 5HV9A 2C04A 2GAQA 2QY9A 1OW8A 2Q9CA 4U9EA 2LQGA 2YHSA 4I1MA 5F5HA 3UNGC 2EPKX 1I4YA 1QPUA 3JYYA 4JTDB 2PP4A 2XLVA 4E0IA 2XL8A 2ETSA 1JR8A 5T1DB 1OKKA 1YZCA 3EGDB 3N2ZB 3JRTA 1FFHA 1D0YA 3EZIA 1ZHTA 1OCRC 1J8YF 1TWCA 2BC5A 3U8PA 4JW1A 1FTSA 4Z9HA 3GEEA 2ZXPA 3WAQA 1HE9A 2YL7A 2HV6A 3NMJA 3DZAA 1NZEA 4U5DE 4B6IA 3W8HA 4QI0A 1HMDA 3U8VA 2R7OA 4PK4A 2R7VA 3EZHA 1GGQA 2YVKA 4K7BA 4EKWA 3U3BA 2VASA 1VYKA 4I1OB 4PACA 3JTLO 2QTVA 4W8KA 2NUPA 2ASRA 3VRCA 2WVNA 3M4BA 4CBEA 4CDAA 2HSBA 3AOUA 3R2PA 3AGUA 256BA 2Y3HA 3FAJA 4EBBA 3S29A 3IQ5A 3C63A 5D92A 1D1CA 2J0XA 1LI5A 1TWGA 4AL1A 1ZVZA 1YYXA 4DOZA 3JCUQ 2UUIA 3AQBA 3K1HA 4WABA 4CS8C 4YL0A 4YT8A 2CNWA 2J7PA 4MS2A 3RFYA 2NPUA 2HJMA 3I4UA 5AC4A 4CJGA 3IHUA 1JRAA 2D5RB 2YQYA 2YZSA 3M15A 3RYLA 1E83A 3K6BA 2IBFA 3U9MA 1L3PA 3C18A 3K7DA 5KYUB 4P9FA 2LIGA 4O6YA 1FFTC 1YARO 2AU5A 3L8IA 4D4XA 1LPEA 2LK4A 2V3CC 1MMAA 2C03A 3DMDA 1ZYRF 1D0XA 3L1MA 3S28A 3AG4C 1W2WA 1U89A 2AWCA 3T4RA 3T6JA 4C3EA 3LESA 4NTAA 4OIOF 3RQEA 4PJJA 1OCZC 2GDCA 3B9QA 3CSKA 5E33A 2ZD9A 3RIPA 3T6GB 5DLJA 4EBKA 4WGZA 1RMVA 1PCXA 2XLHA 4JCHA 3IQTA 2P1AA 3ABMC 1YJGA 2KSFA 4W8PA 3HLZA 5JUAA 1BR2A 4N06A 5JSLA 5DS5A 1GM5A 4Q7CA 4CX9A 3G4ZA 1Q0MA 3SXZA 3J06A 4DXWA 5E2QA 4MTGA 4PFOA 3B0VC 2IM8A 4O6NA 5F5FA 1WTYA 2H8AA 3U2MA 2RSEB 1G8XA 4YK5A 3QVZA 3H2UA 3UMIA 1V4AA 1JAFA 2XS1A 3GWNA 2KNHA 3ZDLA 2A69F 1K04A 4RBNA 3T9OA 3JT1A 3B71A 3HKKA 4YT4A 2OKUA 1OR3A 1ZZPA 2JPUA 2WZFA 1RKEA 3A11A 2YKZA 4J7YA 3HTKC 3R7CA 4IWBA 3ZTMA 4CDVA 3F46A 3X2QC 4Q4ZF 1RXQA 4YL3A 4LLCA 3BRJA 3CEXA 2CDQA 4K1OA 3NYJA 3W2WA 4IJJA 1QLEC 5BQHA 5JT4A 3ZG1A 4MVZA 1HW1A 4JIOA 2J9VA 3JSZA 3ZIBA 3ZQVA 4L6RA 3EGXA 4ULWA 2OG2A 4JTCB 3QTHA 5COGA 1ZU5A 4DRIB 4BJTA 5K0IA 3DM9B 4HFKB 5DS4A 4NCQA 1RJ9B 2P7VA 3LNMB 2Q00A 4N6CA 4XEFA 5BQGA 4A2NB 1FR0A 3UR3C 3T6BA 1A41A 3EG9A 4C3DA 5L0CA 1NG1A 2Y3GA 4LDRA 4XQ1A 3UMKA 4EUKB 2EIKC 3C62A 1MMGA 1XZPA 4BPMA 1GS9A 4U5FE 1VTMP 3E9VA 3DKAA
chains in the Genus database with same CATH topology
3TULA 1O3UA 2HSBA 1OW7A 3GM2A 4NQFA 3MFNA 1KNYA 4EBKA 3BRJA 1K40A 3RQGA 4R32A 3L8JA 3U3FA 3C8GD 3GM3A 1QVXA 2L6HA 3JZ0A 5F28E 3U0CA 1KTMA 4EBJA 1WOLA 1K05A 1WTYA 3O10A 2JX0A 3C18A 3K7DA 2KK1A 2Q00A 3GM1A 4XEFA 1V4AA 1WWPA 3L8IA 2L6FA 1OW8A 1PV3A 2LK4A 1K04A 2L6GA 2PBEA 1JOGA 1UFBA 2YWAA 3AJMA 4XEKA 3RQFA 3JYYA 3C8GB 3B71A 1OW6A 3RQEA 4XEVA 3S9OA 1ZZPA 2JPUA 3C8GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TUL A;  1O3U A;  2HSB A;  1OW7 A;  3GM2 A;  4NQF A;  3MFN A;  1KNY A;  4EBK A;  3BRJ A;  1K40 A;  3RQG A;  4R32 A;  3L8J A;  3U3F A;  3C8G D;  3GM3 A;  1QVX A;  2L6H A;  3JZ0 A;  5F28 E;  3U0C A;  1KTM A;  4EBJ A;  1WOL A;  1K05 A;  1WTY A;  3O10 A;  2JX0 A;  3C18 A;  3K7D A;  2KK1 A;  2Q00 A;  3GM1 A;  4XEF A;  1V4A A;  1WWP A;  3L8I A;  2L6F A;  1OW8 A;  1PV3 A;  2LK4 A;  1K04 A;  2L6G A;  2PBE A;  1JOG A;  1UFB A;  2YWA A;  3AJM A;  4XEK A;  3RQF A;  3JYY A;  3C8G B;  3B71 A;  1OW6 A;  3RQE A;  4XEV A;  3S9O A;  1ZZP A;  2JPU A;  3C8G A; 
#chains in the Genus database with same CATH topology
 1AVO B;  4RDA A;  4WJ0 A;  4DJ9 A;  3GEI A;  2Q7R A;  5JVE A;  3HNJ A;  4YWQ A;  1BZ4 A;  4Q5S F;  2HJ3 A;  3B0P A;  2PX0 A;  4PJM A;  4I3M A;  4NY3 A;  1C03 A;  3ATP A;  4U5G A;  2JD3 A;  3EGD A;  2PNO A;  3KYJ A;  3LAY A;  1JMW A;  1QKR A;  5EK0 A;  3V7O A;  3K66 A;  3U5S A;  1GQA A;  2NG1 A;  1KU2 A;  4G78 A;  4XPW A;  3UMH A;  3SP1 A;  2W9Y A;  2A68 F;  4HEA J;  4JTA B;  2J45 A;  2P6V A;  1T6U A;  1TQG A;  3SXK A;  1APC A;  4N4W A;  1IZM A;  4JC7 A;  4ULV A;  4CS7 A;  1IW7 F;  2EPM X;  2IXP A;  5BQI A;  4OIQ F;  1UFB A;  4O6M A;  2KYH A;  2X51 A;  1FMW A;  3C8G B;  4AE4 A;  1L7C A;  3LUT B;  2NSF A;  1Z3I X;  2PFD A;  2R02 A;  3MYF A;  1AUE A;  4JEA A;  2J9B A;  1OW7 A;  1SYQ A;  2EIL C;  2HKV A;  2KGO A;  2PX3 A;  3VAY A;  4H54 A;  3VYW A;  2G3K A;  2IXN A;  1Y4C A;  4IAR A;  2MYS A;  2Y69 C;  1CPQ A;  4CS8 A;  2IOQ A;  4MVQ A;  1MND A;  2HMQ A;  5AC5 A;  3N0T A;  2XXA A;  2GWW A;  5L3Q A;  1D1B A;  1TKN A;  1ZHX A;  2LD6 A;  4JJG A;  1G4U S;  4MND A;  1V55 C;  4PJN A;  4MVS A;  5T3T A;  1H9T A;  3BEH A;  5E3A A;  1H6G A;  3C8Z A;  1ST6 A;  4YT2 A;  1D1A A;  1E84 A;  1LKX A;  3QVY A;  1MNE A;  2P61 A;  5CI9 A;  4U5E E;  4MTF A;  2B0J A;  1CGM E;  2J46 A;  2MWQ A;  3AJM A;  1NLX A;  3EH2 A;  2Q4F A;  4ZLC A;  5E3C A;  3S90 A;  3EHM A;  1ZHY A;  4IAQ A;  3S9O A;  2CCY A;  1VYI A;  1O3U A;  3KH2 A;  4KNW A;  5FCL A;  1T6I A;  5A6B D;  5L3V A;  1HE1 A;  3M4C A;  4MVR A;  3EPV A;  3AG2 C;  4QI2 A;  1Q0G A;  2OQM A;  1Z6A A;  2HS5 A;  5GPG B;  1Z7Q c;  2NSG A;  4E17 A;  3Q7L A;  3O6X A;  2PF4 E;  3K1I C;  3U3F A;  3C8G D;  2J9U A;  5L0I A;  1ZW3 A;  2OJQ A;  4C7O A;  2YLG A;  3GOD A;  2G3V A;  2HFI A;  3U9J A;  2R7Q A;  1K05 A;  2QUP A;  4YN0 B;  2JX0 A;  1SF8 A;  5KYY A;  3E70 C;  3EFO A;  2I15 A;  4BJ5 C;  2L6F A;  2I8B A;  3HNI A;  1JPN A;  1V54 C;  4XEK A;  2YWA A;  4CSA C;  3RQF A;  2R03 A;  1U6H A;  2CW0 F;  3RVY A;  1V74 B;  2A0B A;  4GQH A;  5DQZ A;  1OW6 A;  2XM0 A;  2OJE D;  4R32 A;  2CGE A;  4JE9 A;  3A9C A;  3CZ6 A;  3K33 A;  1LM3 B;  1OR2 A;  1R5I D;  4G0H A;  4UDV A;  2R9R B;  2ICW G;  1NU7 D;  4MVU A;  1HW2 A;  1Q0D A;  4A4A A;  3DD7 A;  1LE2 A;  2G62 A;  1ORY A;  4XPY A;  2M4E A;  1Z5Z A;  1YA9 A;  1EA8 A;  4JZA A;  1YYJ A;  4XLP F;  1TFO B;  2UUH A;  1KTM A;  3GAN A;  2R05 A;  4MW8 A;  4P6I C;  1I4Z A;  3NMI A;  5KYW A;  3RW0 A;  1CGN A;  1OQC A;  1VLS A;  3GWL A;  3MBG A;  2XL4 A;  4HFF B;  2LSE A;  1I5N A;  1EQ1 A;  2R7S A;  4CS9 C;  3NDB B;  2R7T A;  2WL8 A;  4U5C E;  2FAP B;  2BL2 A;  4J7T A;  3LEV A;  4DRH B;  3B0U X;  1FAP B;  2W45 A;  3M1C B;  2OU6 A;  1KNY A;  2EIN C;  3WHN A;  2Y3D A;  5L0H A;  1S05 A;  3ZVR A;  2H7O A;  3HNL A;  4YL1 A;  3EH1 A;  2XRH A;  3MYI A;  2MHR A;  2Y39 A;  1OKK D;  2J9W A;  4JVS A;  5BUO A;  5F28 E;  4N6H A;  1M57 C;  3G4X A;  2QNL A;  1NFN A;  4LAC B;  2KW3 C;  2A6H F;  3QW0 A;  3TD7 A;  4EBJ A;  4BEJ A;  4O7G A;  1FMV A;  4JCZ A;  4Z9J A;  4DVY P;  4BEM J;  1SMY F;  2FFH A;  4KC9 A;  4U5H A;  2OEX A;  3SNH A;  2WZG A;  2XLE A;  1NBB A;  5A6B A;  2NUT A;  3IEE A;  1VK5 A;  4FAP B;  1R4T A;  2J8W A;  1T5O A;  2A1D D;  3DE8 A;  5TJ5 E;  3NKD A;  3ZWI A;  2A6E F;  4QDL A;  3DJN B;  3SYN A;  3VF0 A;  1Y6D A;  2F22 A;  2XLD A;  3C8G A;  3IQC A;  3LJB A;  3O55 A;  4PFP A;  4F4B A;  5DS6 A;  1YDI A;  3PHF 2;  3RF3 A;  2W4B A;  3ZQY A;  3EQL F;  4H4K C;  1OCC C;  4OIR F;  2O9X A;  3HJC A;  3LS0 A;  2Z15 A;  2J0W A;  3CQZ A;  2TMV P;  2WVO A;  1YVI A;  2EPN A;  3LNR A;  5KYX B;  1YAU O;  2R7R A;  3U0C A;  4ANJ A;  3FMS A;  1T9K A;  1H7I A;  3TK0 A;  2HV7 A;  1WOL A;  3DXJ F;  3DE9 A;  5JRA A;  4ER9 A;  2KJG A;  4EWC A;  4IGG A;  1VMA A;  3FXH A;  3GM1 A;  4KBL A;  3V5Y A;  2LCH A;  2CNW D;  4OD4 A;  5JLI A;  1T6Q A;  3X1O A;  1E2X A;  1QZX A;  1RKE B;  2L6G A;  1ZHZ A;  3LS1 A;  3SXM A;  5HSW A;  2HZ8 A;  3WOD F;  3OA1 A;  4G7O F;  3N24 A;  1EKY A;  2HMZ A;  4J32 B;  2XLW A;  5L0G A;  1Q0F A;  4MTO A;  3QW1 A;  2WB7 A;  3ZC4 A;  5KYN A;  2VCB A;  3DAG A;  3ITF A;  4E7S A;  3PMR A;  3K1I A;  3ASO C;  3EGX B;  3I5P A;  3AGT A;  1HMO A;  2H7B A;  3W4Y A;  3S0X A;  3FDQ A;  4JRZ A;  3JZ0 A;  1SZI A;  1OXK A;  3H2V A;  4AK9 A;  2EPO A;  4Z9I A;  3EHN A;  3FOP A;  3S27 A;  3EG9 B;  5CIV A;  4NC3 A;  3Q6N A;  3TJ6 A;  4BJ5 A;  1M2V B;  1OCO C;  2KK1 A;  4E7Z A;  3NG1 A;  5B1A C;  4CSA A;  1O5H A;  4XLN F;  3US6 A;  4EHP A;  2E87 A;  1PV3 A;  2PBE A;  5KYU A;  4JUR I;  4XTK A;  3B29 A;  3SEO A;  5A69 A;  3G50 A;  1O87 A;  2BE5 F;  1BR1 A;  4IRU A;  3LEO A;  1A7D A;  4NTB A;  3TQO A;  2VC9 A;  1C02 A;  1EI7 A;  2YL0 A;  3MX3 A;  2XLO A;  2Q3T A;  2VH3 A;  2LFF A;  1TWA A;  4I44 A;  3KPH A;  1ZU4 A;  2W4M A;  3L34 A;  5T3W A;  1QQ3 A;  5L0F A;  3PCV A;  4AL0 A;  1ZHW A;  3SXY A;  1G4W R;  4G7H F;  4ZLD A;  2IXO A;  2XM4 A;  2FGY A;  2EIJ C;  2EPL X;  2L81 A;  3H65 A;  4AX2 A;  5CI8 A;  1S7Z A;  4OIP F;  2DYR C;  2HSQ A;  4XPX A;  3OWT A;  2XSE A;  1WGW A;  2VCC A;  2WZL A;  3O10 A;  3HNK A;  3ZTZ A;  1Z63 A;  2IXM A;  4BG0 A;  1LS1 A;  4BJ6 C;  3JYH A;  4AE4 B;  4CS9 A;  4DBQ A;  1DOV A;  1E85 A;  1OXB A;  3O39 A;  4HE8 D;  3KL4 A;  4G7Z F;  3UGO A;  1BR4 A;  1JOG A;  2YLI A;  1A7V A;  3RKO F;  2X0C A;  1VB5 A;  3WG7 C;  4FX5 A;  2D4U A;  2CYD A;  2DB4 A;  3CAX A;  1N1C A;  2YL1 A;  3QZC A;  3NYM A;  3C7J A;  4OIN F;  2WVQ A;  2ZXO A;  3MFN A;  3FOO A;  4FES A;  4DVZ A;  1M2O A;  4DBR A;  2XXA B;  4YJW A;  2DI3 A;  4JEB A;  1LS4 A;  5DVW A;  3PDM P;  2YLD A;  3FHD A;  2DYS C;  5A6K A;  3JSE O;  3DJU B;  4XWJ A;  1C17 M;  2L7A A;  3Q7G A;  3SZR A;  1VLT A;  2GFH A;  4GYT A;  2AVK A;  4MW3 A;  3S84 A;  3NMK A;  3GEH A;  3KKB A;  4U9D A;  3IQ6 A;  1ZW2 A;  3DAF A;  3JRM O;  4J30 B;  4RD9 A;  2XL6 A;  4C3B A;  4M63 A;  3FAP B;  2A0U A;  4NTF A;  3RVZ A;  1CGO A;  2ZXR A;  2NUP B;  2QE9 A;  4E18 A;  1U0B B;  1RJ9 A;  3LLI A;  4MVO A;  1BBH A;  1WAS A;  1E86 A;  2DGJ A;  1NSG B;  1RKC A;  1H9G A;  3L0I A;  4CIP A;  1UG7 A;  1LE4 A;  4GEH A;  4JJF A;  4E0H A;  3NKE A;  3GM2 A;  4NQF A;  4WGY A;  1A0B A;  3F47 A;  3RH3 A;  1TFK B;  4X0R A;  2IYL D;  5DQT A;  2AWY A;  1D0Z A;  2YRF A;  2YEV A;  5IY5 C;  1LIH A;  1MQV A;  2XLM A;  1YA7 O;  1YZA A;  4LDQ A;  3AQC A;  3POV A;  1ORS C;  2KC3 A;  5L0J A;  4C7O B;  5KYY B;  1NFO A;  1MMN A;  4DRJ B;  3MLG A;  3EFO B;  2Y3B A;  3TOM A;  5KYX A;  4PJL A;  4BJ1 A;  2HUJ A;  3ABL C;  3QMK A;  2VCA A;  3V5Z A;  3AG1 C;  4ONS A;  2R7X A;  1ORJ A;  1WWP A;  2P0N A;  4JKV A;  4P9T A;  4D4N A;  4CDY A;  4KI2 A;  3EJN A;  4IAO A;  1YLM A;  2L9J A;  2M64 A;  5COF A;  2AP3 A;  5D91 A;  2XS8 A;  1XWJ A;  3U2L A;  3W8I A;  1WN0 A;  3IPM O;  3DI5 A;  1JPJ A;  1LVK A;  3ASN C;  2B0H A;  3GOR A;  3NRH A;  5COM A;  1TWH A;  2OEV A;  2EIM C;  4CIH A;  4MQ9 F;  3FVY A;  1M56 C;  3V5X A;  5L0D A;  2Q9B A;  3OEO A;  5KYW B;  1PD1 A;  1CPR A;  1QVX A;  2L6H A;  1HY5 A;  3TJ5 A;  4FWV A;  1WAT A;  4LER A;  5B1B C;  1XZQ A;  2H7V C;  3Q6M A;  5EGY A;  1BDJ B;  2ZPA A;  2OCC C;  3KYI A;  2OOC A;  1MMD A;  1M2V A;  3ECS A;  4O79 A;  2J7P D;  4KNV A;  4K0D A;  4EIY A;  1SR2 A;  2RD9 A;  3W2V A;  1T01 A;  1TR2 A;  5EHH A;  4YT5 A;  5JS5 A;  1Q0K A;  4XEV A;  4PR9 A;  3ZSU A;  1VOM A;  2LFD A;  1LI7 A;  1J8M F;  2YL3 A;  5B3S C;  5A6J A;  5A6A A;  3TUL A;  5FZT A;  5B3I A;  2GA0 A;  1DOW A;  3I5Q A;  1AEP A;  1G5Z A;  1B68 A;  3KMI A;  1PD0 A;  4LLE A;  5JP7 A;  1FNT c;  1NU9 C;  2Q9A A;  4MVM A;  2R7U A;  1K40 A;  3LLK A;  3RQG A;  2R7W A;  3UGP A;  1A7E A;  3L8J A;  3GM3 A;  4OD5 A;  5AGF A;  4CJO A;  3DM5 A;  2QLA A;  1QSP A;  1RCP A;  3NYL A;  1M6T A;  2ZXW C;  3M79 A;  4IB4 A;  1F1M A;  3AG3 C;  4BJ6 A;  4U5B E;  2NUT B;  2V26 A;  1Z23 A;  2KQ9 A;  2R25 A;  3ABK C;  3DWW A;  4LDK A;  3TOL A;  3VM6 A;  2LP4 A;  2VB6 A;  5HV9 A;  2C04 A;  2GAQ A;  2QY9 A;  1OW8 A;  2Q9C A;  4U9E A;  2LQG A;  2YHS A;  4I1M A;  5F5H A;  3UNG C;  2EPK X;  1I4Y A;  1QPU A;  3JYY A;  4JTD B;  2PP4 A;  2XLV A;  4E0I A;  2XL8 A;  2ETS A;  1JR8 A;  5T1D B;  1OKK A;  1YZC A;  3EGD B;  3N2Z B;  3JRT A;  1FFH A;  1D0Y A;  3EZI A;  1ZHT A;  1OCR C;  1J8Y F;  1TWC A;  2BC5 A;  3U8P A;  4JW1 A;  1FTS A;  4Z9H A;  3GEE A;  2ZXP A;  3WAQ A;  1HE9 A;  2YL7 A;  2HV6 A;  3NMJ A;  3DZA A;  1NZE A;  4U5D E;  4B6I A;  3W8H A;  4QI0 A;  1HMD A;  3U8V A;  2R7O A;  4PK4 A;  2R7V A;  3EZH A;  1GGQ A;  2YVK A;  4K7B A;  4EKW A;  3U3B A;  2VAS A;  1VYK A;  4I1O B;  4PAC A;  3JTL O;  2QTV A;  4W8K A;  2NUP A;  2ASR A;  3VRC A;  2WVN A;  3M4B A;  4CBE A;  4CDA A;  2HSB A;  3AOU A;  3R2P A;  3AGU A;  256B A;  2Y3H A;  3FAJ A;  4EBB A;  3S29 A;  3IQ5 A;  3C63 A;  5D92 A;  1D1C A;  2J0X A;  1LI5 A;  1TWG A;  4AL1 A;  1ZVZ A;  1YYX A;  4DOZ A;  3JCU Q;  2UUI A;  3AQB A;  3K1H A;  4WAB A;  4CS8 C;  4YL0 A;  4YT8 A;  2CNW A;  2J7P A;  4MS2 A;  3RFY A;  2NPU A;  2HJM A;  3I4U A;  5AC4 A;  4CJG A;  3IHU A;  1JRA A;  2D5R B;  2YQY A;  2YZS A;  3M15 A;  3RYL A;  1E83 A;  3K6B A;  2IBF A;  3U9M A;  1L3P A;  3C18 A;  3K7D A;  5KYU B;  4P9F A;  2LIG A;  4O6Y A;  1FFT C;  1YAR O;  2AU5 A;  3L8I A;  4D4X A;  1LPE A;  2LK4 A;  2V3C C;  1MMA A;  2C03 A;  3DMD A;  1ZYR F;  1D0X A;  3L1M A;  3S28 A;  3AG4 C;  1W2W A;  1U89 A;  2AWC A;  3T4R A;  3T6J A;  4C3E A;  3LES A;  4NTA A;  4OIO F;  3RQE A;  4PJJ A;  1OCZ C;  2GDC A;  3B9Q A;  3CSK A;  5E33 A;  2ZD9 A;  3RIP A;  3T6G B;  5DLJ A;  4EBK A;  4WGZ A;  1RMV A;  1PCX A;  2XLH A;  4JCH A;  3IQT A;  2P1A A;  3ABM C;  1YJG A;  2KSF A;  4W8P A;  3HLZ A;  5JUA A;  1BR2 A;  4N06 A;  5JSL A;  5DS5 A;  1GM5 A;  4Q7C A;  4CX9 A;  3G4Z A;  1Q0M A;  3SXZ A;  3J06 A;  4DXW A;  5E2Q A;  4MTG A;  4PFO A;  3B0V C;  2IM8 A;  4O6N A;  5F5F A;  1WTY A;  2H8A A;  3U2M A;  2RSE B;  1G8X A;  4YK5 A;  3QVZ A;  3H2U A;  3UMI A;  1V4A A;  1JAF A;  2XS1 A;  3GWN A;  2KNH A;  3ZDL A;  2A69 F;  1K04 A;  4RBN A;  3T9O A;  3JT1 A;  3B71 A;  3HKK A;  4YT4 A;  2OKU A;  1OR3 A;  1ZZP A;  2JPU A;  2WZF A;  1RKE A;  3A11 A;  2YKZ A;  4J7Y A;  3HTK C;  3R7C A;  4IWB A;  3ZTM A;  4CDV A;  3F46 A;  3X2Q C;  4Q4Z F;  1RXQ A;  4YL3 A;  4LLC A;  3BRJ A;  3CEX A;  2CDQ A;  4K1O A;  3NYJ A;  3W2W A;  4IJJ A;  1QLE C;  5BQH A;  5JT4 A;  3ZG1 A;  4MVZ A;  1HW1 A;  4JIO A;  2J9V A;  3JSZ A;  3ZIB A;  3ZQV A;  4L6R A;  3EGX A;  4ULW A;  2OG2 A;  4JTC B;  3QTH A;  5COG A;  1ZU5 A;  4DRI B;  4BJT A;  5K0I A;  3DM9 B;  4HFK B;  5DS4 A;  4NCQ A;  1RJ9 B;  2P7V A;  3LNM B;  2Q00 A;  4N6C A;  4XEF A;  5BQG A;  4A2N B;  1FR0 A;  3UR3 C;  3T6B A;  1A41 A;  3EG9 A;  4C3D A;  5L0C A;  1NG1 A;  2Y3G A;  4LDR A;  4XQ1 A;  3UMK A;  4EUK B;  2EIK C;  3C62 A;  1MMG A;  1XZP A;  4BPM A;  1GS9 A;  4U5F E;  1VTM P;  3E9V A;  3DKA A; 
#chains in the Genus database with same CATH homology
 3TUL A;  1O3U A;  2HSB A;  1OW7 A;  3GM2 A;  4NQF A;  3MFN A;  1KNY A;  4EBK A;  3BRJ A;  1K40 A;  3RQG A;  4R32 A;  3L8J A;  3U3F A;  3C8G D;  3GM3 A;  1QVX A;  2L6H A;  3JZ0 A;  5F28 E;  3U0C A;  1KTM A;  4EBJ A;  1WOL A;  1K05 A;  1WTY A;  3O10 A;  2JX0 A;  3C18 A;  3K7D A;  2KK1 A;  2Q00 A;  3GM1 A;  4XEF A;  1V4A A;  1WWP A;  3L8I A;  2L6F A;  1OW8 A;  1PV3 A;  2LK4 A;  1K04 A;  2L6G A;  2PBE A;  1JOG A;  1UFB A;  2YWA A;  3AJM A;  4XEK A;  3RQF A;  3JYY A;  3C8G B;  3B71 A;  1OW6 A;  3RQE A;  4XEV A;  3S9O A;  1ZZP A;  2JPU A;  3C8G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...