3GM3A

Crystal structure of the focal adhesion targeting (fat) domain of pyk2
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
133
structure length
133
Chain Sequence
NLDRTDDLVYLNVMELVRAVLELKNELAQLPPEGYVVVVKNVGLTLRKLIGSVDDLLPSLPSSSRTEIEGTQKLLNKDLAELINKMRLAQQNAVTSLSEECKRQMLTASHTLAVDAKNLLDAVDQAKVLANLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Protein tyrosine kinase 2 beta
publication title Crystal structures of free and ligand-bound focal adhesion targeting domain of Pyk2
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 55
structure length 133
sequence length 133
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2009-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03623 Focal_AT Focal adhesion targeting region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 3gm3A00
3RQEA 1K04A 2L6GA 2Q00A 1K40A 3L8JA 3L8IA 3C18A 4XEVA 1OW7A 1V4AA 2LK4A 1QVXA 3B71A 3GM1A 3RQGA 3K7DA 2KK1A 2L6HA 1K05A 2HSBA 3GM3A 2L6FA 4NQFA 4EBKA 1KTMA 1UFBA 3U0CA 1OW6A 1WWPA 1ZZPA 5F28E 2JX0A 3S9OA 3GM2A 3O10A 3TULA 1O3UA 3JYYA 3AJMA 1PV3A 4R32A 3MFNA 3BRJA 1KNYA 3C8GB 4XEKA 4XEFA 3U3FA 1OW8A 3C8GD 2YWAA 3RQFA 4EBJA 3C8GA 1JOGA 2JPUA 1WOLA 3JZ0A 1WTYA 2PBEA
chains in the Genus database with same CATH superfamily
2YQYA 3N2ZB 5B1AC 2R7QA 2EPKX 4CX9A 1LI5A 3AOUA 3C18A 4JEBA 4BJ6A 2LK4A 3JTLO 4CJOA 1F1MA 1YLMA 2EILC 1TR2A 4YN0B 4YL0A 3S27A 3EG9A 3SXYA 2XRHA 4J30B 2QE9A 3I5PA 2VASA 1R5ID 1VB5A 1UFBA 2M4EA 4H54A 3ZDLA 5E3CA 4MVUA 4K0DA 3NYJA 2P0NA 3EH1A 2YHSA 2GDCA 4O79A 2QLAA 4LLEA 4HFKB 3MLGA 3DXJF 4EBBA 2P61A 3RVYA 1IZMA 3U3FA 1CGNA 1NFNA 1ORYA 1VYIA 2ZXPA 5BUOA 5A6BD 1SMYF 3GODA 1NG1A 2NUTA 4AX2A 5DQZA 5B3IA 2FGYA 3DKAA 4Z9HA 4NTFA 4G7OF 1RKCA 2YRFA 3CSKA 3KYIA 4MW3A 3UNGC 2CNWA 1I4ZA 3BEHA 2EPNA 3IEEA 1GS9A 4JTDB 2A68F 4EHPA 3ZIBA 2OU6A 1JR8A 3NKDA 2P6VA 5KYYB 3QMKA 2HS5A 3NG1A 4DRIB 1ZHZA 2XS1A 1HY5A 3S9OA 2J8WA 1C17M 4U9DA 1JPJA 1TWCA 5L0IA 3DM5A 2OQMA 3ZTZA 3PDMP 3Q7GA 3F47A 4LLCA 2WVNA 5KYNA 2IBFA 1JMWA 1RMVA 4C3BA 1L3PA 1D0ZA 3R2PA 3WG7C 1WTYA 2E87A 2LCHA 1G8XA 3JSEO 2XLMA 3LNMB 2Y3BA 1A7EA 1D0YA 1H6GA 1M2VB 2NG1A 2NPUA 5T1DB 3L8IA 3POVA 1HW2A 1OW7A 1NZEA 4LDKA 1LPEA 4YK5A 3OWTA 3HTKC 3ABKC 3KMIA 1EI7A 3DZAA 2QTVA 3C63A 3LAYA 3ZWIA 5L0DA 4J7TA 5A69A 2AWYA 3VM6A 4WABA 2L9JA 4MTOA 3QVYA 1OW6A 2DGJA 1ZZPA 1N1CA 2KYHA 4U5GA 3AG4C 3NYLA 5COFA 3E70C 1PV3A 2QY9A 1ZHWA 1KNYA 2ETSA 4NTAA 4PR9A 4XPXA 1NU9C 3EHNA 2RD9A 3O55A 4MNDA 1YJGA 3M15A 4PACA 1LS1A 1RXQA 4YL1A 4BJ5C 3EZIA 3FMSA 4A4AA 2WZFA 2JPUA 1W2WA 3NMIA 4PJLA 2PBEA 3IPMO 3TK0A 1AUEA 5EGYA 2HZ8A 1A7DA 4Q4ZF 1H7IA 1Z7Qc 3J06A 4FAPB 1PCXA 3SYNA 2Q00A 1U89A 3IQCA 3U2MA 4NY3A 2VCAA 4Z9IA 2ASRA 3IQ5A 5L3VA 2YLDA 3ITFA 2AP3A 3EG9B 1OQCA 1VLSA 2XLOA 3M79A 1J8MF 4MW8A 4ONSA 3TD7A 2HSBA 3HNLA 1G4WR 3ZSUA 1Q0KA 4EBKA 1LI7A 2Y3GA 3U0CA 2R7UA 3KYJA 3FDQA 1M6TA 1OCOC 3JRMO 4JCZA 3B9QA 2X0CA 1RKEB 5EK0A 3G50A 4CIPA 2H7BA 2OJQA 3LS0A 1TFKB 3SP1A 3V5ZA 2KQ9A 1ZHXA 2NUTB 5FZTA 5HSWA 3RQFA 2MWQA 1NSGB 3HNJA 1CPQA 3RFYA 4EBJA 5E2QA 3E9VA 2OG2A 1T6IA 3FOOA 1YYJA 4MS2A 5KYXA 2J45A 3O6XA 2VCCA 5BQHA 2W9YA 2Q7RA 3ZTMA 1SYQA 2V26A 1GM5A 1V4AA 1BBHA 3WHNA 2R03A 3LLKA 3LLIA 3GEHA 1D1CA 1FR0A 4CDYA 1TWAA 2HJ3A 3LUTB 2GAQA 1T5OA 1QZXA 2NSFA 4YWQA 5F5HA 2UUHA 4XWJA 3UR3C 2W4MA 5GPGB 5BQGA 1TFOB 3ZG1A 1D1BA 1AEPA 3S29A 3SXMA 1Z63A 1ORJA 4MTFA 2YL7A 2EPMX 4MVMA 5DQTA 3HKKA 4BJ5A 4C3EA 2EPLX 2R7RA 1VLTA 1ZVZA 3LEVA 4IAQA 4XEKA 4EWCA 1BDJB 3IHUA 4OD5A 5COGA 4G7HF 5BQIA 2NSGA 2YWAA 1KU2A 3Q6NA 4AL0A 1ZU5A 4QDLA 3W2WA 4BPMA 1I4YA 2I15A 3SXZA 4LERA 5JRAA 4MVZA 4E18A 1RJ9A 2WL8A 2XS8A 4XEVA 1Z23A 2CNWD 3QW1A 4DRHB 1M2OA 3EQLF 1YA9A 2IOQA 2MHRA 2YKZA 1SF8A 2XLEA 3SXKA 1MMNA 3JCUQ 1T01A 2ZXOA 1TWGA 4DVZA 4K1OA 3GEIA 4JVSA 1IW7F 3K1IC 2VC9A 5DLJA 5KYWA 4G7ZF 2QUPA 3JYYA 2WVQA 3MYFA 2Y3HA 4R32A 4CSAA 4J7YA 1MNEA 4GYTA 3MX3A 3R7CA 2DYRC 1LE2A 256BA 2IXPA 4A2NB 1PD0A 2IXNA 2OJED 1RKEA 2JD3A 2RSEB 3DE8A 1APCA 2L81A 2KGOA 5JVEA 1QPUA 1VYKA 2A69F 1V54C 2KSFA 2GWWA 3DAGA 4JTCB 2EIKC 1ZHTA 4JTAB 1H9TA 2WZGA 1YZCA 1WATA 2XLWA 3C62A 4LDRA 2OEXA 1MQVA 4ANJA 2A0UA 5L0GA 4FX5A 5CI8A 4IRUA 1EKYA 4WJ0A 3ZC4A 3KKBA 1YAUO 1B68A 1U6HA 1TQGA 2HFIA 5E3AA 3EHMA 2XL8A 3CQZA 2G3KA 3RW0A 2IM8A 4XPWA 2OOCA 2Q9CA 5HV9A 3C8ZA 1Z5ZA 3FVYA 2WVOA 2NUPA 3V5XA 2R25A 4CBEA 3M1CB 3W8HA 1M56C 4HFFB 1BZ4A 4P6IC 1D1AA 2B0JA 4Q7CA 2J0WA 5KYXB 2PX0A 2J7PA 3EFOB 4JKVA 1BR1A 4D4NA 2D5RB 1RCPA 2ZXWC 4G0HA 4JZAA 2H7VC 5TJ5E 3T6BA 3DJUB 4JCHA 4JURI 3EPVA 1I5NA 1Q0MA 1K40A 1FFTC 2R7SA 1QVXA 4U5BE 1VMAA 3VRCA 2GFHA 2HMQA 1OXKA 2HV7A 3FXHA 2DYSC 4O6MA 4YJWA 4XLNF 1LS4A 3K1IA 1FNTc 1NFOA 1LE4A 1BR4A 3C7JA 3H2VA 3NMJA 2EINC 2JX0A 3SZRA 3T9OA 3U8PA 3TULA 2V3CC 3HJCA 4H4KC 4XLPF 3K6BA 3C8GB 3N0TA 2AVKA 4E17A 4XTKA 5DS6A 1JRAA 1YDIA 4N6HA 1TKNA 5B3SC 4JEAA 4JJGA 2QNLA 1RJ9B 1MMGA 3IQTA 4KNWA 1XZQA 4OINF 3RH3A 3B29A 2LP4A 4K7BA 3Q6MA 3S90A 4O6NA 5JS5A 2KJGA 3FHDA 1XZPA 4ULWA 3HNKA 3QTHA 1OCZC 3GWLA 2R7XA 2GA0A 3U8VA 5KYWB 1ZW2A 1VTMP 3MBGA 4IGGA 2WZLA 4YT5A 3I4UA 3GM2A 3OA1A 1HE1A 1BR2A 3JRTA 4MTGA 4ULVA 4DJ9A 3K1HA 1V74B 3ECSA 3RKOF 3ASNC 3CAXA 4DBRA 3V5YA 3DE9A 3U3BA 3LS1A 1E83A 2Q3TA 2J9UA 3CEXA 3K66A 4ZLCA 2W4BA 2HJMA 4HEAJ 4N06A 4OIRF 2YL3A 1Z6AA 5EHHA 4PJMA 1FMVA 2ICWG 3EFOA 3OEOA 1MMAA 1QLEC 3KH2A 1O87A 3K33A 3M4BA 2KW3C 4NCQA 3ZQVA 3A9CA 3ABLC 3NKEA 4NTBA 5K0IA 3T6JA 4XQ1A 3NMKA 4O7GA 4HE8D 1HMOA 4B6IA 4FESA 3QZCA 2PFDA 3VAYA 4CS8C 2EIMC 4YL3A 4F4BA 5A6KA 2TMVP 3RYLA 1OKKA 3TJ6A 3SNHA 5F28E 1LKXA 2NUPB 3WAQA 5JT4A 2LFDA 1E2XA 3DI5A 1A0BA 2J46A 4BG0A 3S0XA 2R9RB 3UGPA 3F46A 1WN0A 1WGWA 4CIHA 4CDVA 4WGYA 3UMHA 1EA8A 2IXMA 4YT8A 2BL2A 2D4UA 5JUAA 3C8GA 1JOGA 4FWVA 1WOLA 2ZPAA 1FTSA 4U5HA 3AQBA 3L1MA 3RF3A 1Q0GA 3EGDA 2R7VA 2O9XA 3AG1C 1YZAA 4JE9A 4MQ9F 1ORSC 2LSEA 4DXWA 3O39A 4P9FA 2R7WA 1ZYRF 1Y6DA 4U5CE 1A41A 1R4TA 1WASA 4DBQA 4ZLDA 2R05A 4O6YA 3B0PA 3GM3A 2L6FA 1V55C 4PJNA 4RBNA 5KYUA 4DOZA 4I3MA 4OIPF 5CIVA 5D92A 2DB4A 3ATPA 5DVWA 1JPNA 1FMWA 2A0BA 1OR2A 2KC3A 4W8PA 3W8IA 4XPYA 3ZQYA 2PP4A 1M57C 3DD7A 1MMDA 3PHF2 5DS5A 2H8AA 2CYDA 3X1OA 1D0XA 2Q4FA 1T6UA 3DJNB 2J7PD 2CCYA 1S7ZA 1ZW3A 4MVRA 3JZ0A 4Z9JA 4ER9A 2PNOA 1FFHA 1YYXA 3I5QA 4OIOF 5L0CA 4CS9C 2Z15A 4I1MA 1O5HA 2J9WA 3U9JA 4U5FE 4E0HA 3GORA 3L8JA 4BJTA 2AWCA 2OEVA 3B71A 2YEVA 3L0IA 5AGFA 3EJNA 3SEOA 1HE9A 2W45A 3G4ZA 4AK9A 4CS8A 4L6RA 4IWBA 4AL1A 2YL1A 5A6JA 4NQFA 1EQ1A 4CDAA 3B0VC 5JP7A 4Q5SF 5COMA 1L7CA 4U9EA 4CS7A 1U0BB 1G5ZA 4DRJB 2XSEA 1GGQA 4CJGA 2Y3DA 4C7OB 1O3UA 4GQHA 1OR3A 2OKUA 2XLDA 2WB7A 4JC7A 4N6CA 4IB4A 4I44A 4NC3A 2LD6A 1S05A 3S28A 4E7ZA 1HW1A 3QVZA 1VOMA 5AC4A 5A6AA 1LM3B 2J9VA 5CI9A 3TOLA 3UMIA 1LIHA 4PK4A 1YARO 1E84A 4J32B 3KPHA 4KC9A 1C02A 4U5DE 4EUKB 5L3QA 1AVOB 3RQGA 5L0JA 4OIQF 4AE4A 3EGXA 4PFPA 1Y4CA 3B0UX 1OCRC 2L6HA 2VB6A 1K05A 3LJBA 5T3WA 2MYSA 3TJ5A 2XLVA 4MVQA 1LVKA 4E0IA 3M4CA 3CZ6A 3FAPB 1NU7D 2VH3A 3LESA 1KTMA 1DOWA 2A1DD 2HUJA 4IARA 3DAFA 4WGZA 4BEJA 1SR2A 4LACB 5IY5C 1CPRA 3G4XA 4PFOA 3AJMA 4JRZA 4QI0A 3UMKA 3GANA 3FAJA 2J9BA 5B1BC 2HKVA 2XXAA 3A11A 4IAOA 1J8YF 1HMDA 5F5FA 1OW8A 2P1AA 3GWNA 3V7OA 1C03A 1NBBA 4CS9A 3EGDB 3EZHA 3S84A 5A6BA 2LFFA 5JLIA 2C04A 2YVKA 3DM9B 3Q7LA 3X2QC 3NYMA 2A6EF 3LEOA 3N24A 3RQEA 3JT1A 2F22A 3RIPA 1E85A 2L6GA 1DOVA 1ZU4A 4YT2A 1QSPA 4UDVA 5L0HA 3U9MA 2R02A 4RD9A 2CGEA 2Q9BA 4N4WA 2HSQA 5JSLA 5KYUB 3HLZA 3LNRA 3WODF 2R7OA 1OKKD 4KNVA 2IXOA 5T3TA 1H9GA 4D4XA 4MVOA 4DVYP 3AQCA 2XL4A 2AU5A 4X0RA 3RVZA 3ZVRA 1OXBA 2EPOA 4PJJA 3BRJA 3KL4A 4XEFA 1YVIA 2YLIA 3C8GD 1GQAA 1VK5A 2C03A 4LDQA 3T4RA 2FAPB 2R7TA 1Z3IX 4EKWA 3AGUA 4E7SA 3T6GB 2FFHA 2CW0F 2HV6A 2XL6A 4OD4A 4EIYA 1ZHYA 1K04A 5FCLA 2ZD9A 3PMRA 2X51A 1UG7A 1JAFA 3PCVA 5AC5A 3K7DA 4BJ6C 1QKRA 3AG3C 3HNIA 4C3DA 1T6QA 1CGME 1T9KA 1MNDA 4I1OB 2CDQA 5KYYA 3NDBB 3W2VA 3O10A 2KNHA 4IJJA 2YZSA 2BC5A 2J0XA 4JIOA 1A7VA 4BJ1A 5DS4A 3AG2C 4G78A 4CSAC 1Q0FA 3QW0A 2YLGA 2G62A 3DWWA 3VF0A 3W4YA 1TWHA 4GEHA 4KI2A 2PF4E 4M63A 3US6A 3ASOC 2OCCC 2BE5F 4MVSA 2M64A 3H2UA 2XM0A 3JSZA 4JJFA 3FOPA 5E33A 1SZIA 3TQOA 2IYLD 4RDAA 4QI2A 1Q0DA 1YA7O 3DMDA 3UGOA 2Q9AA 2Y39A 2G3VA 2XLHA 3ABMC 4AE4B 1ST6A 2LIGA 2A6HF 3EGXB 4BEMJ 3GM1A 1M2VA 3GEEA 1PD1A 1XWJA 2LQGA 3NRHA 4KBLA 3MYIA 3IQ6A 4U5EE 1G4US 2KK1A 2YL0A 1NLXA 2H7OA 2P7VA 3U5SA 5L0FA 2DI3A 5D91A 4P9TA 3TOMA 1FAPB 3H65A 2Y69C 3AGTA 1WWPA 3JYHA 1E86A 2UUIA 2B0HA 2XXAB 1CGOA 2PX3A 2I8BA 3MFNA 2EIJC 3VYWA 2VCBA 2L7AA 3EH2A 4C7OA 2HMZA 3L34A 2XM4A 1QQ3A 4W8KA 4YT4A 3U2LA 2ZXRA 4JW1A 1OCCC
chains in the Genus database with same CATH topology
3RQEA 1K04A 2L6GA 2Q00A 1K40A 3L8JA 3L8IA 3C18A 4XEVA 1OW7A 1V4AA 2LK4A 1QVXA 3B71A 3GM1A 3RQGA 3K7DA 2KK1A 2L6HA 1K05A 2HSBA 3GM3A 2L6FA 4NQFA 4EBKA 1KTMA 1UFBA 3U0CA 1OW6A 1WWPA 1ZZPA 5F28E 2JX0A 3S9OA 3GM2A 3O10A 3TULA 1O3UA 3JYYA 3AJMA 1PV3A 4R32A 3MFNA 3BRJA 1KNYA 3C8GB 4XEKA 4XEFA 3U3FA 1OW8A 3C8GD 2YWAA 3RQFA 4EBJA 3C8GA 1JOGA 2JPUA 1WOLA 3JZ0A 1WTYA 2PBEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RQE A;  1K04 A;  2L6G A;  2Q00 A;  1K40 A;  3L8J A;  3L8I A;  3C18 A;  4XEV A;  1OW7 A;  1V4A A;  2LK4 A;  1QVX A;  3B71 A;  3GM1 A;  3RQG A;  3K7D A;  2KK1 A;  2L6H A;  1K05 A;  2HSB A;  3GM3 A;  2L6F A;  4NQF A;  4EBK A;  1KTM A;  1UFB A;  3U0C A;  1OW6 A;  1WWP A;  1ZZP A;  5F28 E;  2JX0 A;  3S9O A;  3GM2 A;  3O10 A;  3TUL A;  1O3U A;  3JYY A;  3AJM A;  1PV3 A;  4R32 A;  3MFN A;  3BRJ A;  1KNY A;  3C8G B;  4XEK A;  4XEF A;  3U3F A;  1OW8 A;  3C8G D;  2YWA A;  3RQF A;  4EBJ A;  3C8G A;  1JOG A;  2JPU A;  1WOL A;  3JZ0 A;  1WTY A;  2PBE A; 
#chains in the Genus database with same CATH topology
 2YQY A;  3N2Z B;  5B1A C;  2R7Q A;  2EPK X;  4CX9 A;  1LI5 A;  3AOU A;  3C18 A;  4JEB A;  4BJ6 A;  2LK4 A;  3JTL O;  4CJO A;  1F1M A;  1YLM A;  2EIL C;  1TR2 A;  4YN0 B;  4YL0 A;  3S27 A;  3EG9 A;  3SXY A;  2XRH A;  4J30 B;  2QE9 A;  3I5P A;  2VAS A;  1R5I D;  1VB5 A;  1UFB A;  2M4E A;  4H54 A;  3ZDL A;  5E3C A;  4MVU A;  4K0D A;  3NYJ A;  2P0N A;  3EH1 A;  2YHS A;  2GDC A;  4O79 A;  2QLA A;  4LLE A;  4HFK B;  3MLG A;  3DXJ F;  4EBB A;  2P61 A;  3RVY A;  1IZM A;  3U3F A;  1CGN A;  1NFN A;  1ORY A;  1VYI A;  2ZXP A;  5BUO A;  5A6B D;  1SMY F;  3GOD A;  1NG1 A;  2NUT A;  4AX2 A;  5DQZ A;  5B3I A;  2FGY A;  3DKA A;  4Z9H A;  4NTF A;  4G7O F;  1RKC A;  2YRF A;  3CSK A;  3KYI A;  4MW3 A;  3UNG C;  2CNW A;  1I4Z A;  3BEH A;  2EPN A;  3IEE A;  1GS9 A;  4JTD B;  2A68 F;  4EHP A;  3ZIB A;  2OU6 A;  1JR8 A;  3NKD A;  2P6V A;  5KYY B;  3QMK A;  2HS5 A;  3NG1 A;  4DRI B;  1ZHZ A;  2XS1 A;  1HY5 A;  3S9O A;  2J8W A;  1C17 M;  4U9D A;  1JPJ A;  1TWC A;  5L0I A;  3DM5 A;  2OQM A;  3ZTZ A;  3PDM P;  3Q7G A;  3F47 A;  4LLC A;  2WVN A;  5KYN A;  2IBF A;  1JMW A;  1RMV A;  4C3B A;  1L3P A;  1D0Z A;  3R2P A;  3WG7 C;  1WTY A;  2E87 A;  2LCH A;  1G8X A;  3JSE O;  2XLM A;  3LNM B;  2Y3B A;  1A7E A;  1D0Y A;  1H6G A;  1M2V B;  2NG1 A;  2NPU A;  5T1D B;  3L8I A;  3POV A;  1HW2 A;  1OW7 A;  1NZE A;  4LDK A;  1LPE A;  4YK5 A;  3OWT A;  3HTK C;  3ABK C;  3KMI A;  1EI7 A;  3DZA A;  2QTV A;  3C63 A;  3LAY A;  3ZWI A;  5L0D A;  4J7T A;  5A69 A;  2AWY A;  3VM6 A;  4WAB A;  2L9J A;  4MTO A;  3QVY A;  1OW6 A;  2DGJ A;  1ZZP A;  1N1C A;  2KYH A;  4U5G A;  3AG4 C;  3NYL A;  5COF A;  3E70 C;  1PV3 A;  2QY9 A;  1ZHW A;  1KNY A;  2ETS A;  4NTA A;  4PR9 A;  4XPX A;  1NU9 C;  3EHN A;  2RD9 A;  3O55 A;  4MND A;  1YJG A;  3M15 A;  4PAC A;  1LS1 A;  1RXQ A;  4YL1 A;  4BJ5 C;  3EZI A;  3FMS A;  4A4A A;  2WZF A;  2JPU A;  1W2W A;  3NMI A;  4PJL A;  2PBE A;  3IPM O;  3TK0 A;  1AUE A;  5EGY A;  2HZ8 A;  1A7D A;  4Q4Z F;  1H7I A;  1Z7Q c;  3J06 A;  4FAP B;  1PCX A;  3SYN A;  2Q00 A;  1U89 A;  3IQC A;  3U2M A;  4NY3 A;  2VCA A;  4Z9I A;  2ASR A;  3IQ5 A;  5L3V A;  2YLD A;  3ITF A;  2AP3 A;  3EG9 B;  1OQC A;  1VLS A;  2XLO A;  3M79 A;  1J8M F;  4MW8 A;  4ONS A;  3TD7 A;  2HSB A;  3HNL A;  1G4W R;  3ZSU A;  1Q0K A;  4EBK A;  1LI7 A;  2Y3G A;  3U0C A;  2R7U A;  3KYJ A;  3FDQ A;  1M6T A;  1OCO C;  3JRM O;  4JCZ A;  3B9Q A;  2X0C A;  1RKE B;  5EK0 A;  3G50 A;  4CIP A;  2H7B A;  2OJQ A;  3LS0 A;  1TFK B;  3SP1 A;  3V5Z A;  2KQ9 A;  1ZHX A;  2NUT B;  5FZT A;  5HSW A;  3RQF A;  2MWQ A;  1NSG B;  3HNJ A;  1CPQ A;  3RFY A;  4EBJ A;  5E2Q A;  3E9V A;  2OG2 A;  1T6I A;  3FOO A;  1YYJ A;  4MS2 A;  5KYX A;  2J45 A;  3O6X A;  2VCC A;  5BQH A;  2W9Y A;  2Q7R A;  3ZTM A;  1SYQ A;  2V26 A;  1GM5 A;  1V4A A;  1BBH A;  3WHN A;  2R03 A;  3LLK A;  3LLI A;  3GEH A;  1D1C A;  1FR0 A;  4CDY A;  1TWA A;  2HJ3 A;  3LUT B;  2GAQ A;  1T5O A;  1QZX A;  2NSF A;  4YWQ A;  5F5H A;  2UUH A;  4XWJ A;  3UR3 C;  2W4M A;  5GPG B;  5BQG A;  1TFO B;  3ZG1 A;  1D1B A;  1AEP A;  3S29 A;  3SXM A;  1Z63 A;  1ORJ A;  4MTF A;  2YL7 A;  2EPM X;  4MVM A;  5DQT A;  3HKK A;  4BJ5 A;  4C3E A;  2EPL X;  2R7R A;  1VLT A;  1ZVZ A;  3LEV A;  4IAQ A;  4XEK A;  4EWC A;  1BDJ B;  3IHU A;  4OD5 A;  5COG A;  4G7H F;  5BQI A;  2NSG A;  2YWA A;  1KU2 A;  3Q6N A;  4AL0 A;  1ZU5 A;  4QDL A;  3W2W A;  4BPM A;  1I4Y A;  2I15 A;  3SXZ A;  4LER A;  5JRA A;  4MVZ A;  4E18 A;  1RJ9 A;  2WL8 A;  2XS8 A;  4XEV A;  1Z23 A;  2CNW D;  3QW1 A;  4DRH B;  1M2O A;  3EQL F;  1YA9 A;  2IOQ A;  2MHR A;  2YKZ A;  1SF8 A;  2XLE A;  3SXK A;  1MMN A;  3JCU Q;  1T01 A;  2ZXO A;  1TWG A;  4DVZ A;  4K1O A;  3GEI A;  4JVS A;  1IW7 F;  3K1I C;  2VC9 A;  5DLJ A;  5KYW A;  4G7Z F;  2QUP A;  3JYY A;  2WVQ A;  3MYF A;  2Y3H A;  4R32 A;  4CSA A;  4J7Y A;  1MNE A;  4GYT A;  3MX3 A;  3R7C A;  2DYR C;  1LE2 A;  256B A;  2IXP A;  4A2N B;  1PD0 A;  2IXN A;  2OJE D;  1RKE A;  2JD3 A;  2RSE B;  3DE8 A;  1APC A;  2L81 A;  2KGO A;  5JVE A;  1QPU A;  1VYK A;  2A69 F;  1V54 C;  2KSF A;  2GWW A;  3DAG A;  4JTC B;  2EIK C;  1ZHT A;  4JTA B;  1H9T A;  2WZG A;  1YZC A;  1WAT A;  2XLW A;  3C62 A;  4LDR A;  2OEX A;  1MQV A;  4ANJ A;  2A0U A;  5L0G A;  4FX5 A;  5CI8 A;  4IRU A;  1EKY A;  4WJ0 A;  3ZC4 A;  3KKB A;  1YAU O;  1B68 A;  1U6H A;  1TQG A;  2HFI A;  5E3A A;  3EHM A;  2XL8 A;  3CQZ A;  2G3K A;  3RW0 A;  2IM8 A;  4XPW A;  2OOC A;  2Q9C A;  5HV9 A;  3C8Z A;  1Z5Z A;  3FVY A;  2WVO A;  2NUP A;  3V5X A;  2R25 A;  4CBE A;  3M1C B;  3W8H A;  1M56 C;  4HFF B;  1BZ4 A;  4P6I C;  1D1A A;  2B0J A;  4Q7C A;  2J0W A;  5KYX B;  2PX0 A;  2J7P A;  3EFO B;  4JKV A;  1BR1 A;  4D4N A;  2D5R B;  1RCP A;  2ZXW C;  4G0H A;  4JZA A;  2H7V C;  5TJ5 E;  3T6B A;  3DJU B;  4JCH A;  4JUR I;  3EPV A;  1I5N A;  1Q0M A;  1K40 A;  1FFT C;  2R7S A;  1QVX A;  4U5B E;  1VMA A;  3VRC A;  2GFH A;  2HMQ A;  1OXK A;  2HV7 A;  3FXH A;  2DYS C;  4O6M A;  4YJW A;  4XLN F;  1LS4 A;  3K1I A;  1FNT c;  1NFO A;  1LE4 A;  1BR4 A;  3C7J A;  3H2V A;  3NMJ A;  2EIN C;  2JX0 A;  3SZR A;  3T9O A;  3U8P A;  3TUL A;  2V3C C;  3HJC A;  4H4K C;  4XLP F;  3K6B A;  3C8G B;  3N0T A;  2AVK A;  4E17 A;  4XTK A;  5DS6 A;  1JRA A;  1YDI A;  4N6H A;  1TKN A;  5B3S C;  4JEA A;  4JJG A;  2QNL A;  1RJ9 B;  1MMG A;  3IQT A;  4KNW A;  1XZQ A;  4OIN F;  3RH3 A;  3B29 A;  2LP4 A;  4K7B A;  3Q6M A;  3S90 A;  4O6N A;  5JS5 A;  2KJG A;  3FHD A;  1XZP A;  4ULW A;  3HNK A;  3QTH A;  1OCZ C;  3GWL A;  2R7X A;  2GA0 A;  3U8V A;  5KYW B;  1ZW2 A;  1VTM P;  3MBG A;  4IGG A;  2WZL A;  4YT5 A;  3I4U A;  3GM2 A;  3OA1 A;  1HE1 A;  1BR2 A;  3JRT A;  4MTG A;  4ULV A;  4DJ9 A;  3K1H A;  1V74 B;  3ECS A;  3RKO F;  3ASN C;  3CAX A;  4DBR A;  3V5Y A;  3DE9 A;  3U3B A;  3LS1 A;  1E83 A;  2Q3T A;  2J9U A;  3CEX A;  3K66 A;  4ZLC A;  2W4B A;  2HJM A;  4HEA J;  4N06 A;  4OIR F;  2YL3 A;  1Z6A A;  5EHH A;  4PJM A;  1FMV A;  2ICW G;  3EFO A;  3OEO A;  1MMA A;  1QLE C;  3KH2 A;  1O87 A;  3K33 A;  3M4B A;  2KW3 C;  4NCQ A;  3ZQV A;  3A9C A;  3ABL C;  3NKE A;  4NTB A;  5K0I A;  3T6J A;  4XQ1 A;  3NMK A;  4O7G A;  4HE8 D;  1HMO A;  4B6I A;  4FES A;  3QZC A;  2PFD A;  3VAY A;  4CS8 C;  2EIM C;  4YL3 A;  4F4B A;  5A6K A;  2TMV P;  3RYL A;  1OKK A;  3TJ6 A;  3SNH A;  5F28 E;  1LKX A;  2NUP B;  3WAQ A;  5JT4 A;  2LFD A;  1E2X A;  3DI5 A;  1A0B A;  2J46 A;  4BG0 A;  3S0X A;  2R9R B;  3UGP A;  3F46 A;  1WN0 A;  1WGW A;  4CIH A;  4CDV A;  4WGY A;  3UMH A;  1EA8 A;  2IXM A;  4YT8 A;  2BL2 A;  2D4U A;  5JUA A;  3C8G A;  1JOG A;  4FWV A;  1WOL A;  2ZPA A;  1FTS A;  4U5H A;  3AQB A;  3L1M A;  3RF3 A;  1Q0G A;  3EGD A;  2R7V A;  2O9X A;  3AG1 C;  1YZA A;  4JE9 A;  4MQ9 F;  1ORS C;  2LSE A;  4DXW A;  3O39 A;  4P9F A;  2R7W A;  1ZYR F;  1Y6D A;  4U5C E;  1A41 A;  1R4T A;  1WAS A;  4DBQ A;  4ZLD A;  2R05 A;  4O6Y A;  3B0P A;  3GM3 A;  2L6F A;  1V55 C;  4PJN A;  4RBN A;  5KYU A;  4DOZ A;  4I3M A;  4OIP F;  5CIV A;  5D92 A;  2DB4 A;  3ATP A;  5DVW A;  1JPN A;  1FMW A;  2A0B A;  1OR2 A;  2KC3 A;  4W8P A;  3W8I A;  4XPY A;  3ZQY A;  2PP4 A;  1M57 C;  3DD7 A;  1MMD A;  3PHF 2;  5DS5 A;  2H8A A;  2CYD A;  3X1O A;  1D0X A;  2Q4F A;  1T6U A;  3DJN B;  2J7P D;  2CCY A;  1S7Z A;  1ZW3 A;  4MVR A;  3JZ0 A;  4Z9J A;  4ER9 A;  2PNO A;  1FFH A;  1YYX A;  3I5Q A;  4OIO F;  5L0C A;  4CS9 C;  2Z15 A;  4I1M A;  1O5H A;  2J9W A;  3U9J A;  4U5F E;  4E0H A;  3GOR A;  3L8J A;  4BJT A;  2AWC A;  2OEV A;  3B71 A;  2YEV A;  3L0I A;  5AGF A;  3EJN A;  3SEO A;  1HE9 A;  2W45 A;  3G4Z A;  4AK9 A;  4CS8 A;  4L6R A;  4IWB A;  4AL1 A;  2YL1 A;  5A6J A;  4NQF A;  1EQ1 A;  4CDA A;  3B0V C;  5JP7 A;  4Q5S F;  5COM A;  1L7C A;  4U9E A;  4CS7 A;  1U0B B;  1G5Z A;  4DRJ B;  2XSE A;  1GGQ A;  4CJG A;  2Y3D A;  4C7O B;  1O3U A;  4GQH A;  1OR3 A;  2OKU A;  2XLD A;  2WB7 A;  4JC7 A;  4N6C A;  4IB4 A;  4I44 A;  4NC3 A;  2LD6 A;  1S05 A;  3S28 A;  4E7Z A;  1HW1 A;  3QVZ A;  1VOM A;  5AC4 A;  5A6A A;  1LM3 B;  2J9V A;  5CI9 A;  3TOL A;  3UMI A;  1LIH A;  4PK4 A;  1YAR O;  1E84 A;  4J32 B;  3KPH A;  4KC9 A;  1C02 A;  4U5D E;  4EUK B;  5L3Q A;  1AVO B;  3RQG A;  5L0J A;  4OIQ F;  4AE4 A;  3EGX A;  4PFP A;  1Y4C A;  3B0U X;  1OCR C;  2L6H A;  2VB6 A;  1K05 A;  3LJB A;  5T3W A;  2MYS A;  3TJ5 A;  2XLV A;  4MVQ A;  1LVK A;  4E0I A;  3M4C A;  3CZ6 A;  3FAP B;  1NU7 D;  2VH3 A;  3LES A;  1KTM A;  1DOW A;  2A1D D;  2HUJ A;  4IAR A;  3DAF A;  4WGZ A;  4BEJ A;  1SR2 A;  4LAC B;  5IY5 C;  1CPR A;  3G4X A;  4PFO A;  3AJM A;  4JRZ A;  4QI0 A;  3UMK A;  3GAN A;  3FAJ A;  2J9B A;  5B1B C;  2HKV A;  2XXA A;  3A11 A;  4IAO A;  1J8Y F;  1HMD A;  5F5F A;  1OW8 A;  2P1A A;  3GWN A;  3V7O A;  1C03 A;  1NBB A;  4CS9 A;  3EGD B;  3EZH A;  3S84 A;  5A6B A;  2LFF A;  5JLI A;  2C04 A;  2YVK A;  3DM9 B;  3Q7L A;  3X2Q C;  3NYM A;  2A6E F;  3LEO A;  3N24 A;  3RQE A;  3JT1 A;  2F22 A;  3RIP A;  1E85 A;  2L6G A;  1DOV A;  1ZU4 A;  4YT2 A;  1QSP A;  4UDV A;  5L0H A;  3U9M A;  2R02 A;  4RD9 A;  2CGE A;  2Q9B A;  4N4W A;  2HSQ A;  5JSL A;  5KYU B;  3HLZ A;  3LNR A;  3WOD F;  2R7O A;  1OKK D;  4KNV A;  2IXO A;  5T3T A;  1H9G A;  4D4X A;  4MVO A;  4DVY P;  3AQC A;  2XL4 A;  2AU5 A;  4X0R A;  3RVZ A;  3ZVR A;  1OXB A;  2EPO A;  4PJJ A;  3BRJ A;  3KL4 A;  4XEF A;  1YVI A;  2YLI A;  3C8G D;  1GQA A;  1VK5 A;  2C03 A;  4LDQ A;  3T4R A;  2FAP B;  2R7T A;  1Z3I X;  4EKW A;  3AGU A;  4E7S A;  3T6G B;  2FFH A;  2CW0 F;  2HV6 A;  2XL6 A;  4OD4 A;  4EIY A;  1ZHY A;  1K04 A;  5FCL A;  2ZD9 A;  3PMR A;  2X51 A;  1UG7 A;  1JAF A;  3PCV A;  5AC5 A;  3K7D A;  4BJ6 C;  1QKR A;  3AG3 C;  3HNI A;  4C3D A;  1T6Q A;  1CGM E;  1T9K A;  1MND A;  4I1O B;  2CDQ A;  5KYY A;  3NDB B;  3W2V A;  3O10 A;  2KNH A;  4IJJ A;  2YZS A;  2BC5 A;  2J0X A;  4JIO A;  1A7V A;  4BJ1 A;  5DS4 A;  3AG2 C;  4G78 A;  4CSA C;  1Q0F A;  3QW0 A;  2YLG A;  2G62 A;  3DWW A;  3VF0 A;  3W4Y A;  1TWH A;  4GEH A;  4KI2 A;  2PF4 E;  4M63 A;  3US6 A;  3ASO C;  2OCC C;  2BE5 F;  4MVS A;  2M64 A;  3H2U A;  2XM0 A;  3JSZ A;  4JJF A;  3FOP A;  5E33 A;  1SZI A;  3TQO A;  2IYL D;  4RDA A;  4QI2 A;  1Q0D A;  1YA7 O;  3DMD A;  3UGO A;  2Q9A A;  2Y39 A;  2G3V A;  2XLH A;  3ABM C;  4AE4 B;  1ST6 A;  2LIG A;  2A6H F;  3EGX B;  4BEM J;  3GM1 A;  1M2V A;  3GEE A;  1PD1 A;  1XWJ A;  2LQG A;  3NRH A;  4KBL A;  3MYI A;  3IQ6 A;  4U5E E;  1G4U S;  2KK1 A;  2YL0 A;  1NLX A;  2H7O A;  2P7V A;  3U5S A;  5L0F A;  2DI3 A;  5D91 A;  4P9T A;  3TOM A;  1FAP B;  3H65 A;  2Y69 C;  3AGT A;  1WWP A;  3JYH A;  1E86 A;  2UUI A;  2B0H A;  2XXA B;  1CGO A;  2PX3 A;  2I8B A;  3MFN A;  2EIJ C;  3VYW A;  2VCB A;  2L7A A;  3EH2 A;  4C7O A;  2HMZ A;  3L34 A;  2XM4 A;  1QQ3 A;  4W8K A;  4YT4 A;  3U2L A;  2ZXR A;  4JW1 A;  1OCC C; 
#chains in the Genus database with same CATH homology
 3RQE A;  1K04 A;  2L6G A;  2Q00 A;  1K40 A;  3L8J A;  3L8I A;  3C18 A;  4XEV A;  1OW7 A;  1V4A A;  2LK4 A;  1QVX A;  3B71 A;  3GM1 A;  3RQG A;  3K7D A;  2KK1 A;  2L6H A;  1K05 A;  2HSB A;  3GM3 A;  2L6F A;  4NQF A;  4EBK A;  1KTM A;  1UFB A;  3U0C A;  1OW6 A;  1WWP A;  1ZZP A;  5F28 E;  2JX0 A;  3S9O A;  3GM2 A;  3O10 A;  3TUL A;  1O3U A;  3JYY A;  3AJM A;  1PV3 A;  4R32 A;  3MFN A;  3BRJ A;  1KNY A;  3C8G B;  4XEK A;  4XEF A;  3U3F A;  1OW8 A;  3C8G D;  2YWA A;  3RQF A;  4EBJ A;  3C8G A;  1JOG A;  2JPU A;  1WOL A;  3JZ0 A;  1WTY A;  2PBE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...