3GM3A

Crystal structure of the focal adhesion targeting (fat) domain of pyk2
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
133
structure length
133
Chain Sequence
NLDRTDDLVYLNVMELVRAVLELKNELAQLPPEGYVVVVKNVGLTLRKLIGSVDDLLPSLPSSSRTEIEGTQKLLNKDLAELINKMRLAQQNAVTSLSEECKRQMLTASHTLAVDAKNLLDAVDQAKVLANLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structures of free and ligand-bound focal adhesion targeting domain of Pyk2
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Protein tyrosine kinase 2 beta
total genus 55
structure length 133
sequence length 133
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2009-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03623 Focal_AT Focal adhesion targeting region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 3gm3A00
1JOGA 2L6HA 4NQFA 3RQFA 1V4AA 2PBEA 1PV3A 1KNYA 1OW8A 1UFBA 1O3UA 1WOLA 1ZZPA 2YWAA 1K04A 4EBJA 1K40A 2L6GA 3AJMA 1QVXA 2LK4A 2KK1A 3JYYA 2HSBA 3C8GD 4XEKA 3U0CA 2JPUA 3BRJA 3RQEA 3C18A 2JX0A 2L6FA 4XEVA 3JZ0A 5F28E 1WTYA 3L8JA 1WWPA 3MFNA 4R32A 1OW7A 3GM1A 3L8IA 4EBKA 3TULA 3B71A 3C8GA 3GM2A 3RQGA 1K05A 1OW6A 4XEFA 3S9OA 2Q00A 1KTMA 3GM3A 3C8GB 3K7DA 3U3FA 3O10A
chains in the Genus database with same CATH superfamily
4PJNA 2IYLD 4C3EA 1L3PA 1GQAA 2EPLX 1HMOA 1O3UA 2J0XA 2OQMA 4WJ0A 3UGPA 2R7OA 2OEVA 3CAXA 3GEEA 3GORA 4U5FE 4IGGA 2YL3A 2J9UA 5L0IA 4OIQF 3LS1A 1WASA 3DE9A 3ZG1A 4ZLDA 3SXZA 2FAPB 4MS2A 3RQEA 1V55C 3K66A 4BPMA 3U8PA 4AL0A 1TWCA 4N4WA 5A69A 1T6IA 2YLIA 3OEOA 4CDYA 4XPYA 4FESA 2E87A 2EIJC 3L8IA 4G78A 5F5HA 3U5SA 1ZVZA 4PK4A 2P0NA 1RXQA 1LE2A 4EHPA 3FXHA 3L0IA 2VCBA 3J06A 4EUKB 2GAQA 1Z7Qc 2WB7A 1A41A 2UUIA 3KL4A 5JUAA 4E18A 3MYIA 5KYYA 2HKVA 3NMJA 1OR2A 3JRTA 4WABA 1KNYA 3CSKA 3M15A 1AEPA 2UUHA 4E0IA 4YT4A 1XZPA 2PP4A 4IRUA 5T3WA 3UMIA 1EKYA 2QY9A 1OCZC 1ZW2A 3JYYA 2R05A 4MVSA 2LIGA 1Z23A 3GODA 3BRJA 2R7XA 5EHHA 5FCLA 4YJWA 1I4YA 3EHMA 3V5XA 3IQCA 3QTHA 2HS5A 5JRAA 3PHF2 1RMVA 3EGDA 2QE9A 2IXNA 3I4UA 1RKEB 1Y4CA 3EG9A 1H9GA 4YK5A 2M4EA 2QNLA 5JVEA 3IPMO 4CJOA 1U0BB 2JD3A 2HV6A 2YVKA 3ZIBA 4YT5A 2WVQA 2PX0A 3DZAA 4XPXA 2D5RB 1SR2A 3S9OA 4O79A 3CZ6A 2WVNA 5CIVA 4QI2A 3L1MA 4JEBA 2W45A 4ANJA 3FHDA 1A0BA 2P7VA 2YL1A 1Q0MA 3NG1A 3RIPA 1NLXA 2EPOA 2WZFA 2HMQA 2R02A 1QQ3A 1T01A 1YZCA 3AG2C 2HUJA 3H65A 3OA1A 3DAFA 4DOZA 3QZCA 5A6BA 1JPNA 2AP3A 4A4AA 4ONSA 1LVKA 3R7CA 1HW1A 1N1CA 2HSQA 1BR1A 2ZD9A 2NUTB 3FVYA 3KMIA 4U5EE 5F28E 5DQZA 3ASNC 2LQGA 1FTSA 2YLDA 3G50A 4HFFB 5COGA 1EQ1A 3KH2A 2L9JA 2IM8A 2Q9BA 4PACA 2ZXPA 2Q9AA 2CDQA 2OCCC 5B1AC 1BR2A 3LNMB 1MQVA 2XLDA 2Y3GA 4N6HA 1SZIA 4ZLCA 4BG0A 2V3CC 1VMAA 1VYKA 4MNDA 5HV9A 2XXAB 5KYWB 2EINC 3TJ6A 4H54A 3WG7C 2DYRC 4CDVA 1WOLA 2H7VC 3C7JA 3X2QC 3Q6NA 1QLEC 5DS5A 1OCOC 3NMIA 2XLWA 4JURI 1G4WR 2MYSA 3H2UA 2BE5F 5JP7A 5K0IA 1LS1A 3RVYA 4XEVA 2IBFA 1LIHA 2OU6A 2XL6A 3ITFA 4J30B 3NRHA 2HJ3A 4JTDB 4ULVA 2KQ9A 3H2VA 4XLNF 4DRJB 2BL2A 2NUPA 3FAPB 3B0UX 1FFTC 2IXMA 4U5BE 2OKUA 3EQLF 1WWPA 5D91A 4IWBA 5L0HA 5L3VA 5KYNA 3C63A 4C7OA 5E2QA 1LI5A 3SXMA 4NCQA 1ZHXA 2KNHA 1YAUO 2OJQA 2OEXA 3T6GB 3RVZA 2ASRA 1OW6A 1HE9A 2NUPB 2VCAA 4K1OA 4U9EA 1RJ9B 2EPMX 3E9VA 3GANA 4CS8A 3IEEA 3US6A 2LFDA 1V4AA 5AC4A 1WN0A 3SEOA 3K1IC 2HMZA 3IQ6A 3QVYA 2V26A 3DAGA 4MW3A 5CI8A 4C3BA 3ZWIA 4AX2A 4JTAB 4CJGA 5BUOA 2NPUA 4G7OF 2CCYA 4Z9IA 1G4US 3JYHA 3I5PA 3TOLA 2XXAA 4GEHA 3ASOC 2J9WA 1DOVA 4P9TA 2R7WA 2A68F 5GPGB 1OKKA 1OXBA 2A1DD 3DM5A 3SP1A 3UR3C 2W4BA 4EBKA 3Q7GA 2Y39A 3B9QA 3FOOA 3W8IA 4P9FA 1Z6AA 2RSEB 4J7YA 2TMVP 3W2WA 1D0ZA 2ETSA 3UMKA 4JJGA 4YL1A 3ZDLA 5AC5A 1OXKA 2J9VA 1FFHA 1FAPB 4MVUA 2NUTA 5COFA 4KI2A 2F22A 2KSFA 3SNHA 2I15A 1YYXA 3O10A 3T4RA 1TWHA 1JAFA 1HE1A 4NQFA 3PDMP 4GYTA 1BR4A 4YL3A 3U8VA 3W8HA 4EBJA 2W4MA 1RKEA 3EG9B 1CGOA 3LUTB 4CIPA 3S84A 2BC5A 2G3VA 4BEMJ 1APCA 2J8WA 3UGOA 1CGME 256BA 4CSAC 2CNWD 4YL0A 3M1CB 3U2LA 3JZ0A 4CS9A 1VLSA 4NC3A 1WTYA 3S0XA 2A69F 4MTGA 4QDLA 5HSWA 4AK9A 5L3QA 3TOMA 1O5HA 1BDJB 1TFKB 3KYIA 4FAPB 1NZEA 3ZTZA 5KYXA 3S27A 3EGDB 3ZC4A 3EFOA 2YRFA 3M4CA 1FMWA 1VLTA 4AE4B 3TK0A 4GQHA 2WZGA 2P61A 3HLZA 3O39A 1PCXA 3JSEO 2XSEA 2ZXOA 1WATA 2PF4E 3NDBB 1ZU4A 1QPUA 4DJ9A 5E3AA 3V5ZA 2RD9A 4LERA 4O6YA 3EHNA 3AG4C 5A6KA 5JLIA 5KYYB 1LI7A 2JX0A 5E3CA 2HV7A 1IW7F 1RJ9A 1W2WA 1ZHWA 4HFKB 4G0HA 4KBLA 3JTLO 5T3TA 4E0HA 2OOCA 4G7ZF 1T6QA 3B0VC 5L0CA 2ZPAA 3C8ZA 3ABKC 3M79A 2AWYA 4XWJA 3ABMC 3LAYA 4D4XA 1SF8A 3C8GA 3C8GB 1PD1A 1QSPA 3LNRA 5B1BC 5TJ5E 4CIHA 4CSAA 2PX3A 3WODF 3V5YA 3R2PA 2Q00A 2YKZA 5KYUB 3DJUB 2CGEA 1M57C 2C04A 1AUEA 1M2VA 3IHUA 3JT1A 3WAQA 1JRAA 1OW8A 2VCCA 4DVZA 3AGTA 4E17A 2IXOA 4ER9A 1H9TA 4JTCB 4E7SA 1ZU5A 3DD7A 1EA8A 1EI7A 2A0BA 3EGXB 3FAJA 5B3IA 2J0WA 1TWGA 1E83A 2R7QA 4JZAA 3O6XA 5COMA 3VM6A 1FMVA 1A7DA 1ST6A 3JCUQ 2Q9CA 5KYWA 4JCHA 4CBEA 5F5FA 3UNGC 4I1OB 3HKKA 3DJNB 4DBRA 4Z9JA 1C02A 1A7VA 2R7RA 3NKEA 2XS8A 1H6GA 1ZHZA 2FGYA 3VRCA 1E86A 1XWJA 1DOWA 5DVWA 3W2VA 1T5OA 3F47A 3RKOF 4E7ZA 1G8XA 4O7GA 2VH3A 4LDQA 3CEXA 3FDQA 1K05A 1UG7A 3K1IA 3KYJA 4OINF 4BJTA 2XS1A 1QKRA 2KJGA 2J45A 3U9JA 4JIOA 2DI3A 4AE4A 4U9DA 3N24A 1SMYF 1MNEA 3AGUA 3RF3A 3O55A 4JVSA 5KYXB 1V74B 4JCZA 5L0FA 2GDCA 4QI0A 1E85A 2HSBA 2ICWG 2R03A 2XLOA 1J8YF 2JPUA 3N0TA 3N2ZB 3ZTMA 3EJNA 4CDAA 2LFFA 3TQOA 5DS4A 1ORYA 2NSGA 5EK0A 3L34A 2XLHA 1L7CA 1ZHYA 4LDKA 3L8JA 4MQ9F 2EILC 3POVA 4K0DA 4CS8C 2EPKX 4I1MA 5DS6A 4DRHB 3A9CA 2YHSA 1OR3A 4XEFA 5L0DA 3MX3A 4PJLA 4NTBA 3NYMA 3VYWA 1PD0A 4JEAA 4EIYA 4MVQA 4XEKA 2J9BA 2L6HA 1NG1A 3AG3C 3RFYA 4Q5SF 2NSFA 5A6BD 2XM0A 4UDVA 1ORJA 5L0GA 3LJBA 1D0XA 1Z63A 4OD5A 3RH3A 1YYJA 1ORSC 3C62A 1JPJA 3KKBA 4FWVA 4U5DE 2DB4A 2KW3C 1YVIA 2L6FA 3NYLA 4N06A 4PJMA 4I44A 2J7PA 4M63A 4CS7A 1OW7A 2R7TA 3S28A 4YT2A 4X0RA 1S7ZA 2C03A 2I8BA 2XL8A 3LEVA 4AL1A 3FOPA 3GM2A 1HY5A 4A2NB 1T6UA 1Z3IX 3LS0A 4U5CE 4ULWA 5D92A 4PJJA 3GWNA 5BQGA 4EWCA 4MTFA 1Q0DA 2MWQA 1T9KA 2PNOA 2QUPA 3BEHA 4RDAA 1YZAA 2CW0F 3RQFA 1PV3A 1A7EA 2Y3BA 1UFBA 3G4XA 1ZZPA 3PCVA 4XQ1A 1K04A 3T6JA 2W9YA 1GS9A 3I5QA 2L6GA 1TFOB 4W8PA 1MMNA 4BJ5C 2Z15A 4EBBA 4K7BA 4BJ6C 4HEAJ 4U5GA 2KYHA 1TR2A 3Q6MA 3EGXA 1VOMA 3QVZA 2NG1A 1C17M 2Q4FA 3QMKA 4L6RA 1JMWA 3DXJF 3U9MA 1GGQA 2ZXWC 3GM1A 2H7OA 4IB4A 4JC7A 1V54C 2MHRA 5DQTA 4JRZA 4BJ1A 4CX9A 3SXYA 1D0YA 2OG2A 3DE8A 2Q3TA 1I4ZA 1NFNA 3AOUA 2G62A 3DWWA 2B0JA 4JE9A 5FZTA 1U89A 3GM3A 1AVOB 3K6BA 2ZXRA 3RQGA 4MVMA 3U3FA 1NU7D 4PFOA 4PFPA 2HJMA 3JRMO 3DKAA 2R7UA 1LE4A 2IXPA 1OKKD 2P6VA 2LP4A 3AQCA 2YQYA 4CS9C 1RKCA 3NMKA 3U0CA 1OCRC 1HW2A 4OD4A 3IQTA 3VAYA 1GM5A 1CPQA 2HZ8A 4DRIB 1I5NA 4BJ6A 1S05A 4W8KA 1Q0KA 3HJCA 3PMRA 4BJ5A 3HNKA 1C03A 2XM4A 4MVZA 3ABLC 4R32A 1MMDA 1M56C 1LPEA 4EKWA 3QW0A 2FFHA 4N6CA 4WGYA 4YWQA 1H7IA 1SYQA 4XLPF 2R9RB 2Q7RA 3ZVRA 1E2XA 5A6AA 2XLVA 1OQCA 3DI5A 1FR0A 1VYIA 3K7DA 4J7TA 3DM9B 1JOGA 3EH1A 2R7VA 2R25A 4IAQA 3K1HA 3T9OA 2YWAA 2Y3DA 2GFHA 4Q7CA 2LD6A 1CGNA 2XLMA 4Z9HA 1QVXA 1Q0GA 3LEOA 4C3DA 1BZ4A 1IZMA 1YDIA 2J46A 3ATPA 3HNLA 4I3MA 1JR8A 4RBNA 3FMSA 2VASA 2WL8A 1ZYRF 4J32B 3U2MA 2H8AA 4WGZA 4YN0B 4HE8D 3SZRA 2D4UA 4P6IC 4KC9A 2YL7A 2IOQA 3A11A 5DLJA 4DVYP 1M2VB 4D4NA 2XL4A 3AG1C 3LESA 2B0HA 1B68A 4F4BA 1O87A 4IARA 1M6TA 2A0UA 1XZQA 2QLAA 1LM3B 4LACB 2A6HF 3EZHA 5AGFA 3OWTA 1NFOA 3RW0A 2AU5A 2LSEA 1F1MA 5E33A 5JS5A 3MLGA 4Q4ZF 1D1BA 3GWLA 4FX5A 5JSLA 3S90A 3EPVA 1YLMA 1D1AA 2P1AA 4IJJA 1CPRA 4JKVA 3C18A 5T1DB 3UMHA 1WGWA 4O6MA 3RYLA 3IQ5A 3U3BA 2LCHA 1TKNA 1VB5A 2L7AA 3B0PA 1YA9A 2L81A 2KGOA 4XPWA 3W4YA 2CNWA 1QZXA 3MFNA 5L0JA 4B6IA 2OJED 2YEVA 4YT8A 2EPNA 3ZQVA 4LLCA 2M64A 3SXKA 4DXWA 3CQZA 2WZLA 3V7OA 4G7HF 1LKXA 1FNTc 3EH2A 3NYJA 3EFOB 3NKDA 3LLKA 1VTMP 4LDRA 1MNDA 2VB6A 1Q0FA 4C7OB 1OCCC 1D1CA 1YA7O 2WVOA 1LS4A 2PBEA 3KPHA 3X1OA 2DGJA 2QTVA 3E70C 5B3SC 1HMDA 4U5HA 3AJMA 2X0CA 2LK4A 2KK1A 4IAOA 2XRHA 2CYDA 4KNVA 1Y6DA 4OIOF 3B29A 2GA0A 1NBBA 1TWAA 2EIMC 3MBGA 4MVRA 3Q7LA 4NY3A 4RD9A 3TD7A 3GEHA 4KNWA 5BQHA 3TULA 4O6NA 4XTKA 3JSZA 2EIKC 1R4TA 3S29A 4OIRF 2H7BA 3T6BA 3TJ5A 3GEIA 1ZHTA 2HFIA 2X51A 3HNIA 3M4BA 1VK5A 2J7PD 3LLIA 4LLEA 4BEJA 4DBQA 5IY5C 1E84A 1KTMA 3C8GD 3G4ZA 1R5ID 1M2OA 2Y3HA 1NSGB 3WHNA 3HTKC 1BBHA 4MTOA 4NTAA 2AWCA 5EGYA 5CI9A 3ZSUA 1K40A 3ECSA 2AVKA 4PR9A 2GWWA 4MVOA 3VF0A 4JW1A 2PFDA 1TQGA 3ZQYA 3QW1A 4OIPF 4H4KC 1KU2A 3EZIA 3F46A 2R7SA 1YJGA 5BQIA 1NU9C 2YZSA 2KC3A 3MYFA 3DMDA 3SYNA 2DYSC 2G3KA 2VC9A 1MMGA 1RCPA 2A6EF 1MMAA 3HNJA 2YLGA 2O9XA 4JJFA 2YL0A 1U6HA 3B71A 5KYUA 1J8MF 1G5ZA 1YARO 3K33A 5JT4A 4MW8A 4NTFA 1ZW3A 1Z5ZA 5A6JA 2Y69C 2XLEA 3AQBA
chains in the Genus database with same CATH topology
1JOGA 2L6HA 4NQFA 3RQFA 1V4AA 2PBEA 1PV3A 1KNYA 1OW8A 1UFBA 1O3UA 1WOLA 1ZZPA 2YWAA 1K04A 4EBJA 1K40A 2L6GA 3AJMA 1QVXA 2LK4A 2KK1A 3JYYA 2HSBA 3C8GD 4XEKA 3U0CA 2JPUA 3BRJA 3RQEA 3C18A 2JX0A 2L6FA 4XEVA 3JZ0A 5F28E 1WTYA 3L8JA 1WWPA 3MFNA 4R32A 1OW7A 3GM1A 3L8IA 4EBKA 3TULA 3B71A 3C8GA 3GM2A 3RQGA 1K05A 1OW6A 4XEFA 3S9OA 2Q00A 1KTMA 3GM3A 3C8GB 3K7DA 3U3FA 3O10A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JOG A;  2L6H A;  4NQF A;  3RQF A;  1V4A A;  2PBE A;  1PV3 A;  1KNY A;  1OW8 A;  1UFB A;  1O3U A;  1WOL A;  1ZZP A;  2YWA A;  1K04 A;  4EBJ A;  1K40 A;  2L6G A;  3AJM A;  1QVX A;  2LK4 A;  2KK1 A;  3JYY A;  2HSB A;  3C8G D;  4XEK A;  3U0C A;  2JPU A;  3BRJ A;  3RQE A;  3C18 A;  2JX0 A;  2L6F A;  4XEV A;  3JZ0 A;  5F28 E;  1WTY A;  3L8J A;  1WWP A;  3MFN A;  4R32 A;  1OW7 A;  3GM1 A;  3L8I A;  4EBK A;  3TUL A;  3B71 A;  3C8G A;  3GM2 A;  3RQG A;  1K05 A;  1OW6 A;  4XEF A;  3S9O A;  2Q00 A;  1KTM A;  3GM3 A;  3C8G B;  3K7D A;  3U3F A;  3O10 A; 
#chains in the Genus database with same CATH topology
 4PJN A;  2IYL D;  4C3E A;  1L3P A;  1GQA A;  2EPL X;  1HMO A;  1O3U A;  2J0X A;  2OQM A;  4WJ0 A;  3UGP A;  2R7O A;  2OEV A;  3CAX A;  3GEE A;  3GOR A;  4U5F E;  4IGG A;  2YL3 A;  2J9U A;  5L0I A;  4OIQ F;  3LS1 A;  1WAS A;  3DE9 A;  3ZG1 A;  4ZLD A;  3SXZ A;  2FAP B;  4MS2 A;  3RQE A;  1V55 C;  3K66 A;  4BPM A;  3U8P A;  4AL0 A;  1TWC A;  4N4W A;  5A69 A;  1T6I A;  2YLI A;  3OEO A;  4CDY A;  4XPY A;  4FES A;  2E87 A;  2EIJ C;  3L8I A;  4G78 A;  5F5H A;  3U5S A;  1ZVZ A;  4PK4 A;  2P0N A;  1RXQ A;  1LE2 A;  4EHP A;  3FXH A;  3L0I A;  2VCB A;  3J06 A;  4EUK B;  2GAQ A;  1Z7Q c;  2WB7 A;  1A41 A;  2UUI A;  3KL4 A;  5JUA A;  4E18 A;  3MYI A;  5KYY A;  2HKV A;  3NMJ A;  1OR2 A;  3JRT A;  4WAB A;  1KNY A;  3CSK A;  3M15 A;  1AEP A;  2UUH A;  4E0I A;  4YT4 A;  1XZP A;  2PP4 A;  4IRU A;  5T3W A;  3UMI A;  1EKY A;  2QY9 A;  1OCZ C;  1ZW2 A;  3JYY A;  2R05 A;  4MVS A;  2LIG A;  1Z23 A;  3GOD A;  3BRJ A;  2R7X A;  5EHH A;  5FCL A;  4YJW A;  1I4Y A;  3EHM A;  3V5X A;  3IQC A;  3QTH A;  2HS5 A;  5JRA A;  3PHF 2;  1RMV A;  3EGD A;  2QE9 A;  2IXN A;  3I4U A;  1RKE B;  1Y4C A;  3EG9 A;  1H9G A;  4YK5 A;  2M4E A;  2QNL A;  5JVE A;  3IPM O;  4CJO A;  1U0B B;  2JD3 A;  2HV6 A;  2YVK A;  3ZIB A;  4YT5 A;  2WVQ A;  2PX0 A;  3DZA A;  4XPX A;  2D5R B;  1SR2 A;  3S9O A;  4O79 A;  3CZ6 A;  2WVN A;  5CIV A;  4QI2 A;  3L1M A;  4JEB A;  2W45 A;  4ANJ A;  3FHD A;  1A0B A;  2P7V A;  2YL1 A;  1Q0M A;  3NG1 A;  3RIP A;  1NLX A;  2EPO A;  2WZF A;  2HMQ A;  2R02 A;  1QQ3 A;  1T01 A;  1YZC A;  3AG2 C;  2HUJ A;  3H65 A;  3OA1 A;  3DAF A;  4DOZ A;  3QZC A;  5A6B A;  1JPN A;  2AP3 A;  4A4A A;  4ONS A;  1LVK A;  3R7C A;  1HW1 A;  1N1C A;  2HSQ A;  1BR1 A;  2ZD9 A;  2NUT B;  3FVY A;  3KMI A;  4U5E E;  5F28 E;  5DQZ A;  3ASN C;  2LQG A;  1FTS A;  2YLD A;  3G50 A;  4HFF B;  5COG A;  1EQ1 A;  3KH2 A;  2L9J A;  2IM8 A;  2Q9B A;  4PAC A;  2ZXP A;  2Q9A A;  2CDQ A;  2OCC C;  5B1A C;  1BR2 A;  3LNM B;  1MQV A;  2XLD A;  2Y3G A;  4N6H A;  1SZI A;  4ZLC A;  4BG0 A;  2V3C C;  1VMA A;  1VYK A;  4MND A;  5HV9 A;  2XXA B;  5KYW B;  2EIN C;  3TJ6 A;  4H54 A;  3WG7 C;  2DYR C;  4CDV A;  1WOL A;  2H7V C;  3C7J A;  3X2Q C;  3Q6N A;  1QLE C;  5DS5 A;  1OCO C;  3NMI A;  2XLW A;  4JUR I;  1G4W R;  2MYS A;  3H2U A;  2BE5 F;  5JP7 A;  5K0I A;  1LS1 A;  3RVY A;  4XEV A;  2IBF A;  1LIH A;  2OU6 A;  2XL6 A;  3ITF A;  4J30 B;  3NRH A;  2HJ3 A;  4JTD B;  4ULV A;  2KQ9 A;  3H2V A;  4XLN F;  4DRJ B;  2BL2 A;  2NUP A;  3FAP B;  3B0U X;  1FFT C;  2IXM A;  4U5B E;  2OKU A;  3EQL F;  1WWP A;  5D91 A;  4IWB A;  5L0H A;  5L3V A;  5KYN A;  3C63 A;  4C7O A;  5E2Q A;  1LI5 A;  3SXM A;  4NCQ A;  1ZHX A;  2KNH A;  1YAU O;  2OJQ A;  2OEX A;  3T6G B;  3RVZ A;  2ASR A;  1OW6 A;  1HE9 A;  2NUP B;  2VCA A;  4K1O A;  4U9E A;  1RJ9 B;  2EPM X;  3E9V A;  3GAN A;  4CS8 A;  3IEE A;  3US6 A;  2LFD A;  1V4A A;  5AC4 A;  1WN0 A;  3SEO A;  3K1I C;  2HMZ A;  3IQ6 A;  3QVY A;  2V26 A;  3DAG A;  4MW3 A;  5CI8 A;  4C3B A;  3ZWI A;  4AX2 A;  4JTA B;  4CJG A;  5BUO A;  2NPU A;  4G7O F;  2CCY A;  4Z9I A;  1G4U S;  3JYH A;  3I5P A;  3TOL A;  2XXA A;  4GEH A;  3ASO C;  2J9W A;  1DOV A;  4P9T A;  2R7W A;  2A68 F;  5GPG B;  1OKK A;  1OXB A;  2A1D D;  3DM5 A;  3SP1 A;  3UR3 C;  2W4B A;  4EBK A;  3Q7G A;  2Y39 A;  3B9Q A;  3FOO A;  3W8I A;  4P9F A;  1Z6A A;  2RSE B;  4J7Y A;  2TMV P;  3W2W A;  1D0Z A;  2ETS A;  3UMK A;  4JJG A;  4YL1 A;  3ZDL A;  5AC5 A;  1OXK A;  2J9V A;  1FFH A;  1FAP B;  4MVU A;  2NUT A;  5COF A;  4KI2 A;  2F22 A;  2KSF A;  3SNH A;  2I15 A;  1YYX A;  3O10 A;  3T4R A;  1TWH A;  1JAF A;  1HE1 A;  4NQF A;  3PDM P;  4GYT A;  1BR4 A;  4YL3 A;  3U8V A;  3W8H A;  4EBJ A;  2W4M A;  1RKE A;  3EG9 B;  1CGO A;  3LUT B;  4CIP A;  3S84 A;  2BC5 A;  2G3V A;  4BEM J;  1APC A;  2J8W A;  3UGO A;  1CGM E;  256B A;  4CSA C;  2CNW D;  4YL0 A;  3M1C B;  3U2L A;  3JZ0 A;  4CS9 A;  1VLS A;  4NC3 A;  1WTY A;  3S0X A;  2A69 F;  4MTG A;  4QDL A;  5HSW A;  4AK9 A;  5L3Q A;  3TOM A;  1O5H A;  1BDJ B;  1TFK B;  3KYI A;  4FAP B;  1NZE A;  3ZTZ A;  5KYX A;  3S27 A;  3EGD B;  3ZC4 A;  3EFO A;  2YRF A;  3M4C A;  1FMW A;  1VLT A;  4AE4 B;  3TK0 A;  4GQH A;  2WZG A;  2P61 A;  3HLZ A;  3O39 A;  1PCX A;  3JSE O;  2XSE A;  2ZXO A;  1WAT A;  2PF4 E;  3NDB B;  1ZU4 A;  1QPU A;  4DJ9 A;  5E3A A;  3V5Z A;  2RD9 A;  4LER A;  4O6Y A;  3EHN A;  3AG4 C;  5A6K A;  5JLI A;  5KYY B;  1LI7 A;  2JX0 A;  5E3C A;  2HV7 A;  1IW7 F;  1RJ9 A;  1W2W A;  1ZHW A;  4HFK B;  4G0H A;  4KBL A;  3JTL O;  5T3T A;  4E0H A;  2OOC A;  4G7Z F;  1T6Q A;  3B0V C;  5L0C A;  2ZPA A;  3C8Z A;  3ABK C;  3M79 A;  2AWY A;  4XWJ A;  3ABM C;  3LAY A;  4D4X A;  1SF8 A;  3C8G A;  3C8G B;  1PD1 A;  1QSP A;  3LNR A;  5B1B C;  5TJ5 E;  4CIH A;  4CSA A;  2PX3 A;  3WOD F;  3V5Y A;  3R2P A;  2Q00 A;  2YKZ A;  5KYU B;  3DJU B;  2CGE A;  1M57 C;  2C04 A;  1AUE A;  1M2V A;  3IHU A;  3JT1 A;  3WAQ A;  1JRA A;  1OW8 A;  2VCC A;  4DVZ A;  3AGT A;  4E17 A;  2IXO A;  4ER9 A;  1H9T A;  4JTC B;  4E7S A;  1ZU5 A;  3DD7 A;  1EA8 A;  1EI7 A;  2A0B A;  3EGX B;  3FAJ A;  5B3I A;  2J0W A;  1TWG A;  1E83 A;  2R7Q A;  4JZA A;  3O6X A;  5COM A;  3VM6 A;  1FMV A;  1A7D A;  1ST6 A;  3JCU Q;  2Q9C A;  5KYW A;  4JCH A;  4CBE A;  5F5F A;  3UNG C;  4I1O B;  3HKK A;  3DJN B;  4DBR A;  4Z9J A;  1C02 A;  1A7V A;  2R7R A;  3NKE A;  2XS8 A;  1H6G A;  1ZHZ A;  2FGY A;  3VRC A;  1E86 A;  1XWJ A;  1DOW A;  5DVW A;  3W2V A;  1T5O A;  3F47 A;  3RKO F;  4E7Z A;  1G8X A;  4O7G A;  2VH3 A;  4LDQ A;  3CEX A;  3FDQ A;  1K05 A;  1UG7 A;  3K1I A;  3KYJ A;  4OIN F;  4BJT A;  2XS1 A;  1QKR A;  2KJG A;  2J45 A;  3U9J A;  4JIO A;  2DI3 A;  4AE4 A;  4U9D A;  3N24 A;  1SMY F;  1MNE A;  3AGU A;  3RF3 A;  3O55 A;  4JVS A;  5KYX B;  1V74 B;  4JCZ A;  5L0F A;  2GDC A;  4QI0 A;  1E85 A;  2HSB A;  2ICW G;  2R03 A;  2XLO A;  1J8Y F;  2JPU A;  3N0T A;  3N2Z B;  3ZTM A;  3EJN A;  4CDA A;  2LFF A;  3TQO A;  5DS4 A;  1ORY A;  2NSG A;  5EK0 A;  3L34 A;  2XLH A;  1L7C A;  1ZHY A;  4LDK A;  3L8J A;  4MQ9 F;  2EIL C;  3POV A;  4K0D A;  4CS8 C;  2EPK X;  4I1M A;  5DS6 A;  4DRH B;  3A9C A;  2YHS A;  1OR3 A;  4XEF A;  5L0D A;  3MX3 A;  4PJL A;  4NTB A;  3NYM A;  3VYW A;  1PD0 A;  4JEA A;  4EIY A;  4MVQ A;  4XEK A;  2J9B A;  2L6H A;  1NG1 A;  3AG3 C;  3RFY A;  4Q5S F;  2NSF A;  5A6B D;  2XM0 A;  4UDV A;  1ORJ A;  5L0G A;  3LJB A;  1D0X A;  1Z63 A;  4OD5 A;  3RH3 A;  1YYJ A;  1ORS C;  3C62 A;  1JPJ A;  3KKB A;  4FWV A;  4U5D E;  2DB4 A;  2KW3 C;  1YVI A;  2L6F A;  3NYL A;  4N06 A;  4PJM A;  4I44 A;  2J7P A;  4M63 A;  4CS7 A;  1OW7 A;  2R7T A;  3S28 A;  4YT2 A;  4X0R A;  1S7Z A;  2C03 A;  2I8B A;  2XL8 A;  3LEV A;  4AL1 A;  3FOP A;  3GM2 A;  1HY5 A;  4A2N B;  1T6U A;  1Z3I X;  3LS0 A;  4U5C E;  4ULW A;  5D92 A;  4PJJ A;  3GWN A;  5BQG A;  4EWC A;  4MTF A;  1Q0D A;  2MWQ A;  1T9K A;  2PNO A;  2QUP A;  3BEH A;  4RDA A;  1YZA A;  2CW0 F;  3RQF A;  1PV3 A;  1A7E A;  2Y3B A;  1UFB A;  3G4X A;  1ZZP A;  3PCV A;  4XQ1 A;  1K04 A;  3T6J A;  2W9Y A;  1GS9 A;  3I5Q A;  2L6G A;  1TFO B;  4W8P A;  1MMN A;  4BJ5 C;  2Z15 A;  4EBB A;  4K7B A;  4BJ6 C;  4HEA J;  4U5G A;  2KYH A;  1TR2 A;  3Q6M A;  3EGX A;  1VOM A;  3QVZ A;  2NG1 A;  1C17 M;  2Q4F A;  3QMK A;  4L6R A;  1JMW A;  3DXJ F;  3U9M A;  1GGQ A;  2ZXW C;  3GM1 A;  2H7O A;  4IB4 A;  4JC7 A;  1V54 C;  2MHR A;  5DQT A;  4JRZ A;  4BJ1 A;  4CX9 A;  3SXY A;  1D0Y A;  2OG2 A;  3DE8 A;  2Q3T A;  1I4Z A;  1NFN A;  3AOU A;  2G62 A;  3DWW A;  2B0J A;  4JE9 A;  5FZT A;  1U89 A;  3GM3 A;  1AVO B;  3K6B A;  2ZXR A;  3RQG A;  4MVM A;  3U3F A;  1NU7 D;  4PFO A;  4PFP A;  2HJM A;  3JRM O;  3DKA A;  2R7U A;  1LE4 A;  2IXP A;  1OKK D;  2P6V A;  2LP4 A;  3AQC A;  2YQY A;  4CS9 C;  1RKC A;  3NMK A;  3U0C A;  1OCR C;  1HW2 A;  4OD4 A;  3IQT A;  3VAY A;  1GM5 A;  1CPQ A;  2HZ8 A;  4DRI B;  1I5N A;  4BJ6 A;  1S05 A;  4W8K A;  1Q0K A;  3HJC A;  3PMR A;  4BJ5 A;  3HNK A;  1C03 A;  2XM4 A;  4MVZ A;  3ABL C;  4R32 A;  1MMD A;  1M56 C;  1LPE A;  4EKW A;  3QW0 A;  2FFH A;  4N6C A;  4WGY A;  4YWQ A;  1H7I A;  1SYQ A;  4XLP F;  2R9R B;  2Q7R A;  3ZVR A;  1E2X A;  5A6A A;  2XLV A;  1OQC A;  3DI5 A;  1FR0 A;  1VYI A;  3K7D A;  4J7T A;  3DM9 B;  1JOG A;  3EH1 A;  2R7V A;  2R25 A;  4IAQ A;  3K1H A;  3T9O A;  2YWA A;  2Y3D A;  2GFH A;  4Q7C A;  2LD6 A;  1CGN A;  2XLM A;  4Z9H A;  1QVX A;  1Q0G A;  3LEO A;  4C3D A;  1BZ4 A;  1IZM A;  1YDI A;  2J46 A;  3ATP A;  3HNL A;  4I3M A;  1JR8 A;  4RBN A;  3FMS A;  2VAS A;  2WL8 A;  1ZYR F;  4J32 B;  3U2M A;  2H8A A;  4WGZ A;  4YN0 B;  4HE8 D;  3SZR A;  2D4U A;  4P6I C;  4KC9 A;  2YL7 A;  2IOQ A;  3A11 A;  5DLJ A;  4DVY P;  1M2V B;  4D4N A;  2XL4 A;  3AG1 C;  3LES A;  2B0H A;  1B68 A;  4F4B A;  1O87 A;  4IAR A;  1M6T A;  2A0U A;  1XZQ A;  2QLA A;  1LM3 B;  4LAC B;  2A6H F;  3EZH A;  5AGF A;  3OWT A;  1NFO A;  3RW0 A;  2AU5 A;  2LSE A;  1F1M A;  5E33 A;  5JS5 A;  3MLG A;  4Q4Z F;  1D1B A;  3GWL A;  4FX5 A;  5JSL A;  3S90 A;  3EPV A;  1YLM A;  1D1A A;  2P1A A;  4IJJ A;  1CPR A;  4JKV A;  3C18 A;  5T1D B;  3UMH A;  1WGW A;  4O6M A;  3RYL A;  3IQ5 A;  3U3B A;  2LCH A;  1TKN A;  1VB5 A;  2L7A A;  3B0P A;  1YA9 A;  2L81 A;  2KGO A;  4XPW A;  3W4Y A;  2CNW A;  1QZX A;  3MFN A;  5L0J A;  4B6I A;  2OJE D;  2YEV A;  4YT8 A;  2EPN A;  3ZQV A;  4LLC A;  2M64 A;  3SXK A;  4DXW A;  3CQZ A;  2WZL A;  3V7O A;  4G7H F;  1LKX A;  1FNT c;  3EH2 A;  3NYJ A;  3EFO B;  3NKD A;  3LLK A;  1VTM P;  4LDR A;  1MND A;  2VB6 A;  1Q0F A;  4C7O B;  1OCC C;  1D1C A;  1YA7 O;  2WVO A;  1LS4 A;  2PBE A;  3KPH A;  3X1O A;  2DGJ A;  2QTV A;  3E70 C;  5B3S C;  1HMD A;  4U5H A;  3AJM A;  2X0C A;  2LK4 A;  2KK1 A;  4IAO A;  2XRH A;  2CYD A;  4KNV A;  1Y6D A;  4OIO F;  3B29 A;  2GA0 A;  1NBB A;  1TWA A;  2EIM C;  3MBG A;  4MVR A;  3Q7L A;  4NY3 A;  4RD9 A;  3TD7 A;  3GEH A;  4KNW A;  5BQH A;  3TUL A;  4O6N A;  4XTK A;  3JSZ A;  2EIK C;  1R4T A;  3S29 A;  4OIR F;  2H7B A;  3T6B A;  3TJ5 A;  3GEI A;  1ZHT A;  2HFI A;  2X51 A;  3HNI A;  3M4B A;  1VK5 A;  2J7P D;  3LLI A;  4LLE A;  4BEJ A;  4DBQ A;  5IY5 C;  1E84 A;  1KTM A;  3C8G D;  3G4Z A;  1R5I D;  1M2O A;  2Y3H A;  1NSG B;  3WHN A;  3HTK C;  1BBH A;  4MTO A;  4NTA A;  2AWC A;  5EGY A;  5CI9 A;  3ZSU A;  1K40 A;  3ECS A;  2AVK A;  4PR9 A;  2GWW A;  4MVO A;  3VF0 A;  4JW1 A;  2PFD A;  1TQG A;  3ZQY A;  3QW1 A;  4OIP F;  4H4K C;  1KU2 A;  3EZI A;  3F46 A;  2R7S A;  1YJG A;  5BQI A;  1NU9 C;  2YZS A;  2KC3 A;  3MYF A;  3DMD A;  3SYN A;  2DYS C;  2G3K A;  2VC9 A;  1MMG A;  1RCP A;  2A6E F;  1MMA A;  3HNJ A;  2YLG A;  2O9X A;  4JJF A;  2YL0 A;  1U6H A;  3B71 A;  5KYU A;  1J8M F;  1G5Z A;  1YAR O;  3K33 A;  5JT4 A;  4MW8 A;  4NTF A;  1ZW3 A;  1Z5Z A;  5A6J A;  2Y69 C;  2XLE A;  3AQB A; 
#chains in the Genus database with same CATH homology
 1JOG A;  2L6H A;  4NQF A;  3RQF A;  1V4A A;  2PBE A;  1PV3 A;  1KNY A;  1OW8 A;  1UFB A;  1O3U A;  1WOL A;  1ZZP A;  2YWA A;  1K04 A;  4EBJ A;  1K40 A;  2L6G A;  3AJM A;  1QVX A;  2LK4 A;  2KK1 A;  3JYY A;  2HSB A;  3C8G D;  4XEK A;  3U0C A;  2JPU A;  3BRJ A;  3RQE A;  3C18 A;  2JX0 A;  2L6F A;  4XEV A;  3JZ0 A;  5F28 E;  1WTY A;  3L8J A;  1WWP A;  3MFN A;  4R32 A;  1OW7 A;  3GM1 A;  3L8I A;  4EBK A;  3TUL A;  3B71 A;  3C8G A;  3GM2 A;  3RQG A;  1K05 A;  1OW6 A;  4XEF A;  3S9O A;  2Q00 A;  1KTM A;  3GM3 A;  3C8G B;  3K7D A;  3U3F A;  3O10 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...