2LFFA

Solution structure of diiron protein in presence of 8 eq zn2+, northeast structural genomics consortium target or21
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
115
structure length
115
Chain Sequence
MDELRELLKAEQQGIKILKEVLKKAKEGDEQELARLNQEIVKAEKQGVKVYKEAAEKARNPEKRQVIDKILEDEEKHIEWHKAASKQGNAEQFASLVQQHLQDEQRHVEEIEKKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Diiron protein
publication title Solution structure of Diiron protein in presence of 8 eq Zn2+
rcsb
source organism Escherichia coli
molecule tags De novo protein
total genus 52
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2011-06-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.660 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) IL-4 antagonist (De novo design) like domain 2lffA00
1Y4CA 2LFFA 2LFDA 3U8VA 2HZ8A
chains in the Genus database with same CATH superfamily
2LFFA 4E7ZA 5KYYB 3F47A 1OKKA 2OQMA 3AGUA 4MNDA 4JJFA 2L81A 2WVOA 3E70C 1N1CA 4YWQA 3QW0A 5T1DB 1LI5A 1OXBA 4ONSA 4C3EA 1Z7Qc 3U8VA 5JVEA 3RVZA 3US6A 4HEAJ 5CI8A 4PFOA 3AG4C 3IQCA 1Q0KA 2NSFA 3JRTA 3ZWIA 2MWQA 2R7OA 3LLKA 4C3DA 1A7DA 2YQYA 5E33A 4AL1A 3M4CA 1ZW3A 3S29A 4YL3A 1QVXA 2NSGA 3QW1A 2KSFA 2PF4E 5JP7A 1YAUO 1PCXA 3L1MA 3ZTMA 2B0HA 2HZ8A 4JVSA 3UNGC 3AG2C 3H2UA 3K1IA 5DQTA 1QLEC 2AWCA 1TWCA 1AVOB 3EG9A 3LS0A 4L6RA 4PR9A 1ZHWA 3DWWA 2L7AA 1YA7O 1NG1A 1J8MF 3LESA 3N2ZB 4JRZA 4O6YA 3DKAA 5JSLA 5CIVA 1D1CA 4RBNA 2Q3TA 3Q7LA 3CAXA 3POVA 4HFKB 3RQEA 2YL3A 3O6XA 1ZW2A 1GM5A 3ABMC 2J7PA 5KYUA 4EBBA 4XPXA 3RVYA 4G7OF 2AWYA 2GAQA 2XM0A 3ZIBA 3KYIA 4CDAA 1Y4CA 5T3WA 4MTGA 4I1MA 2YEVA 3SNHA 4CIPA 4J7TA 1QSPA 2A1DD 2CNWA 1M57C 1C17M 4JEAA 4Q7CA 5L0GA 4C7OB 1F1MA 1OCOC 3R2PA 3N0TA 4JW1A 4IGGA 3KMIA 3N24A 4IJJA 2DYRC 1IW7F 3JYHA 2Q9AA 2Y69C 1TWGA 2XLDA 2G62A 2IOQA 3BEHA 3G4ZA 3H65A 3S28A 2YWAA 2P1AA 3DI5A 2J9UA 3T9OA 1D0ZA 1YZCA 2C04A 3TULA 3UGOA 2R05A 1EA8A 1LS4A 4U5BE 3UR3C 4NTAA 4P6IC 3U8PA 4RD9A 3UGPA 3DAGA 1RKEB 2Y3BA 3TK0A 4EBJA 3SEOA 3S27A 3TJ5A 4MVZA 1M2VB 4P9FA 3RIPA 4PJLA 3WG7C 2FAPB 4BJ5A 4LLEA 5AC5A 5BQHA 1YA9A 2QNLA 2R7TA 2R7VA 1LS1A 1HW1A 1RCPA 2ZD9A 2KGOA 1WTYA 1ZU4A 2D4UA 2W4BA 1SYQA 2R7SA 4IB4A 1LKXA 5DS5A 4YT4A 2VCCA 3EHMA 3FAJA 4U5FE 4MW3A 2OG2A 4OIOF 2YLDA 2NUTA 4XTKA 2R7QA 3SXZA 5DQZA 1WATA 1R5ID 2Y3DA 4BJTA 3FOPA 3V7OA 4YN0B 3T6BA 4MVQA 2A6HF 4Z9JA 3U9JA 2KC3A 1FNTc 3B0UX 4AX2A 2OJED 2HMQA 4XEFA 4KBLA 4FWVA 3ZSUA 2VC9A 2DI3A 4K1OA 2YKZA 3L8IA 3JZ0A 3WHNA 1G5ZA 4ER9A 2GA0A 3KPHA 1HY5A 3W2VA 4LDRA 3RFYA 5KYUB 1EI7A 2XLOA 2YLIA 3AG3C 3RH3A 2XXAB 4C3BA 1FMWA 1J8YF 3M15A 5COFA 1FMVA 4DVZA 3KKBA 5K0IA 2E87A 4YK5A 3SYNA 1SZIA 2IXOA 2Y3GA 1VB5A 3G4XA 3FAPB 3JYYA 1H9TA 3J06A 2XL8A 4OIQF 3WODF 1TFKB 4GQHA 3NDBB 3HNJA 1YJGA 2YL1A 4R32A 1GQAA 4Z9HA 4DRJB 1K05A 1HE1A 1PV3A 1APCA 2J9VA 1ORYA 2XS8A 2YVKA 4YJWA 3ZVRA 4CDYA 1XZQA 3IHUA 2HJMA 5IY5C 2Q4FA 4BJ6A 1OR3A 5E2QA 2NUPA 3HLZA 3LNRA 3QVZA 2XLEA 4W8KA 4U5EE 1TWAA 4AK9A 1YDIA 3SZRA 1OCZC 4JEBA 1Z63A 1YZAA 1ZYRF 2YRFA 2Q00A 3LEVA 4J32B 4BEMJ 5JS5A 2NPUA 1TQGA 4U5CE 3K6BA 4IRUA 1XWJA 2IXPA 2PX3A 3W4YA 1RJ9A 1V74B 3NMKA 2CDQA 4DJ9A 4E7SA 4Q5SF 4ULVA 5A6BA 3JTLO 1WGWA 1NSGB 2J0WA 1B68A 1JPNA 4NY3A 3S90A 3OWTA 3HNKA 3HKKA 4D4XA 3PDMP 2NUTB 1VOMA 2HMZA 1H6GA 3GORA 2IXMA 4JURI 4MVMA 2VCBA 3M4BA 1FFTC 2CGEA 2HSQA 3AGTA 2A68F 1Q0GA 4RDAA 3ABLC 3AQCA 2BL2A 4CS8A 2XRHA 4W8PA 5HV9A 2LQGA 2M64A 5JT4A 2A0BA 2KQ9A 2OKUA 2JX0A 3U9MA 3UMIA 1H9GA 4N6CA 2A6EF 1YARO 3HNLA 4I44A 1OR2A 4BPMA 1QQ3A 1U89A 2J8WA 4MVSA 3VYWA 1AUEA 3ZG1A 4CIHA 3ZQVA 5D91A 2A69F 1OW8A 2P61A 4I1OB 4JZAA 1M6TA 4DRHB 2W4MA 2WZGA 4JE9A 3GM3A 4N06A 4YL1A 3TOLA 2ICWG 4CJOA 4KNVA 2LD6A 3VAYA 2EIMC 1Q0MA 1FAPB 1O87A 4MTOA 4JTDB 3GEHA 4CSAA 2QE9A 2R25A 4CX9A 1ZHZA 2I15A 2M4EA 3SP1A 5L0FA 3K1IC 4ZLDA 2OU6A 1JMWA 2LSEA 1RKCA 2MHRA 4NCQA 3ECSA 1SMYF 1PD1A 2ZPAA 3C62A 3G50A 5DLJA 5JRAA 2NUPB 5EK0A 2WZLA 3FXHA 2OEXA 4O79A 3U2MA 1Z3IX 1E85A 1L7CA 2J9WA 5AC4A 2YHSA 4DBRA 4PK4A 2EILC 3GODA 4XPWA 3T6GB 2PP4A 1JRAA 2HUJA 4DBQA 2GFHA 1WASA 1RJ9B 4P9TA 2WZFA 1OKKD 2RSEB 2L6GA 4LDQA 2HV7A 3FHDA 1Q0FA 5D92A 4AE4A 5AGFA 2EPKX 4IAOA 5JLIA 2H8AA 2KW3C 2G3KA 3SXYA 3W2WA 4OINF 2YL7A 5A6JA 5EHHA 3KYJA 3H2VA 1CPRA 1SR2A 2L6FA 2DYSC 4ANJA 2JD3A 2LCHA 4J7YA 3X2QC 1ST6A 1H7IA 4PJMA 4XEKA 2UUIA 2GWWA 3EHNA 4FAPB 3U3FA 5HSWA 1D0XA 4CS7A 4EWCA 3HJCA 3RF3A 1ORJA 5L0JA 3M1CB 5A6KA 1O3UA 3C63A 3KL4A 3TD7A 5BQIA 2R7UA 3DJNB 3EGXA 4N4WA 1OXKA 4GEHA 4CDVA 4BG0A 4CJGA 1EQ1A 4LLCA 2KNHA 3BRJA 4QI0A 5L0IA 2IBFA 1JPJA 1L3PA 3NRHA 3U5SA 3ZTZA 4CS9C 1NFOA 1YLMA 1W2WA 3JCUQ 4YT2A 1ZZPA 3B9QA 2BE5F 5EGYA 5B3SC 2WB7A 2QTVA 1NU9C 5KYXA 3U2LA 5BQGA 2OCCC 3LNMB 4EUKB 2CCYA 2IXNA 3EG9B 3PMRA 4DXWA 1CGNA 1ORSC 1R4TA 1D1BA 1MMAA 2H7OA 2J7PD 1ZHYA 3F46A 4HFFB 4Z9IA 1VYIA 4PFPA 1LVKA 1OW7A 3ABKC 3CEXA 4MS2A 5T3TA 4HE8D 4MVUA 2QY9A 2R9RB 1UFBA 2ETSA 5DS6A 2KJGA 2VH3A 3IEEA 1T01A 1I4ZA 2CNWD 1LI7A 3QZCA 3RKOF 4O7GA 1K04A 3CZ6A 3T4RA 1HW2A 3L0IA 2H7BA 5A6AA 3GEIA 4XWJA 5DVWA 3C8GA 2DGJA 2XL4A 3PCVA 4X0RA 4FESA 3ZDLA 1VYKA 1ZHTA 2WL8A 3B0VC 4U5HA 4XLPF 1WOLA 4JIOA 3CQZA 4EHPA 5KYWA 5FZTA 1E83A 5KYYA 5KYNA 4O6NA 3NG1A 3EH1A 1FR0A 4NTBA 1NBBA 2Y39A 5L3QA 1SF8A 3VM6A 3UMKA 1JR8A 4G0HA 5B3IA 1E2XA 3FOOA 2L9JA 5F28E 2CYDA 1RMVA 3WAQA 3JT1A 4K7BA 2X51A 5COMA 2Q9BA 3V5XA 3I5QA 1KNYA 2A0UA 4NTFA 2FGYA 1OCRC 1VTMP 2AU5A 2P0NA 2R02A 3ZQYA 2QUPA 4BJ6C 2ZXOA 2PX0A 3ATPA 4MVOA 2CW0F 3ZC4A 2J46A 4E17A 2YL0A 3NYLA 3EGXB 2H7VC 3O55A 1I4YA 3K7DA 1MNEA 1OW6A 2XLWA 2TMVP 3HTKC 3K33A 4N6HA 4YT5A 3LAYA 4EKWA 1E86A 3R7CA 1KTMA 1A41A 4G7ZF 1U6HA 1LE4A 1RXQA 2D5RB 1D0YA 4KC9A 5KYXB 3ASOC 3O39A 2R03A 2EIKC 2VCAA 2Q9CA 3FMSA 3GM2A 1QKRA 5CI9A 1NZEA 1CGOA 1PD0A 3FDQA 1TFOB 4JKVA 1D1AA 2AVKA 1XZPA 1WN0A 3L34A 4IARA 3SXKA 3DZAA 2C03A 3QTHA 2XM4A 3L8JA 5COGA 4BEJA 1E84A 3C8GB 2EPLX 2PNOA 4JCZA 4MTFA 4CS8C 4U5DE 4LDKA 2IM8A 3AOUA 2F22A 3NMJA 3IQ5A 4PJJA 5KYWB 4YL0A 2OOCA 2KYHA 3GANA 1G8XA 2P7VA 1VLTA 4O6MA 3U3BA 3GEEA 4UDVA 4G78A 4B6IA 1ZHXA 2EIJC 3EQLF 1IZMA 1G4US 1LE2A 2MYSA 2ZXRA 3NYJA 1V4AA 4WGYA 3DM9B 1RKEA 4DOZA 1QZXA 2XSEA 3A11A 4QI2A 1M2VA 3DXJF 3A9CA 4GYTA 4CSAC 2ZXWC 1YVIA 1GS9A 3NKDA 4BJ1A 4MVRA 3S84A 1VLSA 5L0HA 1JOGA 1OCCC 4J30B 1LM3B 2LFDA 5BUOA 1DOWA 2JPUA 3W8HA 3O10A 5A6BD 4QDLA 2J45A 1BR2A 1V55C 1U0BB 4DVYP 2RD9A 1TWHA 2G3VA 1T6IA 3IPMO 3RQGA 1TKNA 3RYLA 1S7ZA 4IWBA 1MNDA 2XLHA 1BR1A 2Y3HA 3OA1A 4JC7A 4KI2A 2PFDA 3ASNC 4MW8A 1A0BA 3AJMA 4EIYA 3LEOA 4JCHA 4E18A 4E0IA 1WWPA 3EGDA 3EZHA 3EZIA 4LERA 3SXMA 1CPQA 1OQCA 1VK5A 3DJUB 5E3AA 2YZSA 3W8IA 1KU2A 4DRIB 3LJBA 1EKYA 1TR2A 2XXAA 1MMNA 3AG1C 3TJ6A 1Z23A 2LIGA 4OD5A 4WJ0A 2L6HA 3EPVA 2Q7RA 3ITFA 1LPEA 2HFIA 256BA 4E0HA 1FTSA 3EFOA 4AL0A 3B0PA 3TQOA 5F5HA 1JAFA 1HMOA 1DOVA 3I4UA 3MLGA 4OIPF 2W9YA 2OJQA 4NC3A 2LP4A 1BZ4A 1YYXA 2EPMX 3B71A 2XS1A 3V5YA 4XEVA 3LS1A 3DMDA 1O5HA 4BJ5C 1VMAA 2J0XA 1C02A 3JSZA 4PJNA 3RQFA 3VF0A 2HS5A 5E3CA 3C8ZA 4I3MA 1BDJB 1Z5ZA 4U5GA 2EINC 3T6JA 2BC5A 3JSEO 3AQBA 1AEPA 4A4AA 1LIHA 3RW0A 3DE9A 1G4WR 1T5OA 4CS9A 3QMKA 1ZVZA 4OD4A 1NFNA 2XL6A 4A2NB 3GWNA 4M63A 1HMDA 1M56C 2IYLD 2B0JA 2O9XA 1CGME 1A7EA 2AP3A 5JUAA 3TOMA 5L3VA 4K0DA 2R7XA 1T6UA 4OIRF 3IQTA 2VASA 3MYFA 3EH2A 2V26A 1BBHA 3V5ZA 1ZU5A 4JJGA 3B29A 3OEOA 4G7HF 1GGQA 3X1OA 1FFHA 4D4NA 5L0DA 4H4KC 4AE4B 1M2OA 5B1BC 5GPGB 2Z15A 3DAFA 3IQ6A 1A7VA 1Z6AA 2GDCA 3Q6MA 4KNWA 4EBKA 4U9DA 2ASRA 3EGDB 2I8BA 3E9VA 4XPYA 4CBEA 3K66A 2QLAA 4JTCB 2LK4A 2YLGA 2P6VA 1QPUA 1BR4A 4H54A 2EPOA 2KK1A 3KH2A 1Y6DA 3MX3A 2NG1A 1C03A 2HV6A 3EJNA 4IAQA 1Q0DA 2W45A 1MQVA 3NKEA 2HKVA 1T9KA 3EFOB 3QVYA 2X0CA 1NLXA 3Q7GA 2PBEA 3UMHA 5DS4A 2DB4A 2EPNA 4LACB 3DE8A 4PACA 4XQ1A 2UUHA 4MQ9F 4Q4ZF 3DD7A 3DM5A 2R7RA 3S0XA 1HE9A 4ZLCA 1YYJA 2XLVA 2VB6A 4WGZA 4YT8A 4F4BA 3NYMA 2OEVA 3Q6NA 5TJ5E 1MMDA 3MBGA 5FCLA 3HNIA 3VRCA 4XLNF 1S05A 3PHF2 3C8GD 2WVQA 3FVYA 4JTAB 3GM1A 3I5PA 2XLMA 2J9BA 5A69A 1I5NA 4NQFA 1K40A 3GWLA 3K1HA 3U0CA 3LUTB 3M79A 3NMIA 5F5FA 2WVNA 3MYIA 4C7OA 4U9EA 2ZXPA 3S9OA 3C18A 3CSKA 2FFHA 1UG7A 4WABA 2HJ3A 3C7JA 3MFNA 3LLIA 5L0CA 4FX5A 2R7WA 5B1AC 2HSBA 1NU7D 1MMGA 1V54C 4ULWA 2V3CC 3JRMO 1T6QA
chains in the Genus database with same CATH topology
1Y4CA 2LFFA 2LFDA 3U8VA 2HZ8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y4C A;  2LFF A;  2LFD A;  3U8V A;  2HZ8 A; 
#chains in the Genus database with same CATH topology
 2LFF A;  4E7Z A;  5KYY B;  3F47 A;  1OKK A;  2OQM A;  3AGU A;  4MND A;  4JJF A;  2L81 A;  2WVO A;  3E70 C;  1N1C A;  4YWQ A;  3QW0 A;  5T1D B;  1LI5 A;  1OXB A;  4ONS A;  4C3E A;  1Z7Q c;  3U8V A;  5JVE A;  3RVZ A;  3US6 A;  4HEA J;  5CI8 A;  4PFO A;  3AG4 C;  3IQC A;  1Q0K A;  2NSF A;  3JRT A;  3ZWI A;  2MWQ A;  2R7O A;  3LLK A;  4C3D A;  1A7D A;  2YQY A;  5E33 A;  4AL1 A;  3M4C A;  1ZW3 A;  3S29 A;  4YL3 A;  1QVX A;  2NSG A;  3QW1 A;  2KSF A;  2PF4 E;  5JP7 A;  1YAU O;  1PCX A;  3L1M A;  3ZTM A;  2B0H A;  2HZ8 A;  4JVS A;  3UNG C;  3AG2 C;  3H2U A;  3K1I A;  5DQT A;  1QLE C;  2AWC A;  1TWC A;  1AVO B;  3EG9 A;  3LS0 A;  4L6R A;  4PR9 A;  1ZHW A;  3DWW A;  2L7A A;  1YA7 O;  1NG1 A;  1J8M F;  3LES A;  3N2Z B;  4JRZ A;  4O6Y A;  3DKA A;  5JSL A;  5CIV A;  1D1C A;  4RBN A;  2Q3T A;  3Q7L A;  3CAX A;  3POV A;  4HFK B;  3RQE A;  2YL3 A;  3O6X A;  1ZW2 A;  1GM5 A;  3ABM C;  2J7P A;  5KYU A;  4EBB A;  4XPX A;  3RVY A;  4G7O F;  2AWY A;  2GAQ A;  2XM0 A;  3ZIB A;  3KYI A;  4CDA A;  1Y4C A;  5T3W A;  4MTG A;  4I1M A;  2YEV A;  3SNH A;  4CIP A;  4J7T A;  1QSP A;  2A1D D;  2CNW A;  1M57 C;  1C17 M;  4JEA A;  4Q7C A;  5L0G A;  4C7O B;  1F1M A;  1OCO C;  3R2P A;  3N0T A;  4JW1 A;  4IGG A;  3KMI A;  3N24 A;  4IJJ A;  2DYR C;  1IW7 F;  3JYH A;  2Q9A A;  2Y69 C;  1TWG A;  2XLD A;  2G62 A;  2IOQ A;  3BEH A;  3G4Z A;  3H65 A;  3S28 A;  2YWA A;  2P1A A;  3DI5 A;  2J9U A;  3T9O A;  1D0Z A;  1YZC A;  2C04 A;  3TUL A;  3UGO A;  2R05 A;  1EA8 A;  1LS4 A;  4U5B E;  3UR3 C;  4NTA A;  4P6I C;  3U8P A;  4RD9 A;  3UGP A;  3DAG A;  1RKE B;  2Y3B A;  3TK0 A;  4EBJ A;  3SEO A;  3S27 A;  3TJ5 A;  4MVZ A;  1M2V B;  4P9F A;  3RIP A;  4PJL A;  3WG7 C;  2FAP B;  4BJ5 A;  4LLE A;  5AC5 A;  5BQH A;  1YA9 A;  2QNL A;  2R7T A;  2R7V A;  1LS1 A;  1HW1 A;  1RCP A;  2ZD9 A;  2KGO A;  1WTY A;  1ZU4 A;  2D4U A;  2W4B A;  1SYQ A;  2R7S A;  4IB4 A;  1LKX A;  5DS5 A;  4YT4 A;  2VCC A;  3EHM A;  3FAJ A;  4U5F E;  4MW3 A;  2OG2 A;  4OIO F;  2YLD A;  2NUT A;  4XTK A;  2R7Q A;  3SXZ A;  5DQZ A;  1WAT A;  1R5I D;  2Y3D A;  4BJT A;  3FOP A;  3V7O A;  4YN0 B;  3T6B A;  4MVQ A;  2A6H F;  4Z9J A;  3U9J A;  2KC3 A;  1FNT c;  3B0U X;  4AX2 A;  2OJE D;  2HMQ A;  4XEF A;  4KBL A;  4FWV A;  3ZSU A;  2VC9 A;  2DI3 A;  4K1O A;  2YKZ A;  3L8I A;  3JZ0 A;  3WHN A;  1G5Z A;  4ER9 A;  2GA0 A;  3KPH A;  1HY5 A;  3W2V A;  4LDR A;  3RFY A;  5KYU B;  1EI7 A;  2XLO A;  2YLI A;  3AG3 C;  3RH3 A;  2XXA B;  4C3B A;  1FMW A;  1J8Y F;  3M15 A;  5COF A;  1FMV A;  4DVZ A;  3KKB A;  5K0I A;  2E87 A;  4YK5 A;  3SYN A;  1SZI A;  2IXO A;  2Y3G A;  1VB5 A;  3G4X A;  3FAP B;  3JYY A;  1H9T A;  3J06 A;  2XL8 A;  4OIQ F;  3WOD F;  1TFK B;  4GQH A;  3NDB B;  3HNJ A;  1YJG A;  2YL1 A;  4R32 A;  1GQA A;  4Z9H A;  4DRJ B;  1K05 A;  1HE1 A;  1PV3 A;  1APC A;  2J9V A;  1ORY A;  2XS8 A;  2YVK A;  4YJW A;  3ZVR A;  4CDY A;  1XZQ A;  3IHU A;  2HJM A;  5IY5 C;  2Q4F A;  4BJ6 A;  1OR3 A;  5E2Q A;  2NUP A;  3HLZ A;  3LNR A;  3QVZ A;  2XLE A;  4W8K A;  4U5E E;  1TWA A;  4AK9 A;  1YDI A;  3SZR A;  1OCZ C;  4JEB A;  1Z63 A;  1YZA A;  1ZYR F;  2YRF A;  2Q00 A;  3LEV A;  4J32 B;  4BEM J;  5JS5 A;  2NPU A;  1TQG A;  4U5C E;  3K6B A;  4IRU A;  1XWJ A;  2IXP A;  2PX3 A;  3W4Y A;  1RJ9 A;  1V74 B;  3NMK A;  2CDQ A;  4DJ9 A;  4E7S A;  4Q5S F;  4ULV A;  5A6B A;  3JTL O;  1WGW A;  1NSG B;  2J0W A;  1B68 A;  1JPN A;  4NY3 A;  3S90 A;  3OWT A;  3HNK A;  3HKK A;  4D4X A;  3PDM P;  2NUT B;  1VOM A;  2HMZ A;  1H6G A;  3GOR A;  2IXM A;  4JUR I;  4MVM A;  2VCB A;  3M4B A;  1FFT C;  2CGE A;  2HSQ A;  3AGT A;  2A68 F;  1Q0G A;  4RDA A;  3ABL C;  3AQC A;  2BL2 A;  4CS8 A;  2XRH A;  4W8P A;  5HV9 A;  2LQG A;  2M64 A;  5JT4 A;  2A0B A;  2KQ9 A;  2OKU A;  2JX0 A;  3U9M A;  3UMI A;  1H9G A;  4N6C A;  2A6E F;  1YAR O;  3HNL A;  4I44 A;  1OR2 A;  4BPM A;  1QQ3 A;  1U89 A;  2J8W A;  4MVS A;  3VYW A;  1AUE A;  3ZG1 A;  4CIH A;  3ZQV A;  5D91 A;  2A69 F;  1OW8 A;  2P61 A;  4I1O B;  4JZA A;  1M6T A;  4DRH B;  2W4M A;  2WZG A;  4JE9 A;  3GM3 A;  4N06 A;  4YL1 A;  3TOL A;  2ICW G;  4CJO A;  4KNV A;  2LD6 A;  3VAY A;  2EIM C;  1Q0M A;  1FAP B;  1O87 A;  4MTO A;  4JTD B;  3GEH A;  4CSA A;  2QE9 A;  2R25 A;  4CX9 A;  1ZHZ A;  2I15 A;  2M4E A;  3SP1 A;  5L0F A;  3K1I C;  4ZLD A;  2OU6 A;  1JMW A;  2LSE A;  1RKC A;  2MHR A;  4NCQ A;  3ECS A;  1SMY F;  1PD1 A;  2ZPA A;  3C62 A;  3G50 A;  5DLJ A;  5JRA A;  2NUP B;  5EK0 A;  2WZL A;  3FXH A;  2OEX A;  4O79 A;  3U2M A;  1Z3I X;  1E85 A;  1L7C A;  2J9W A;  5AC4 A;  2YHS A;  4DBR A;  4PK4 A;  2EIL C;  3GOD A;  4XPW A;  3T6G B;  2PP4 A;  1JRA A;  2HUJ A;  4DBQ A;  2GFH A;  1WAS A;  1RJ9 B;  4P9T A;  2WZF A;  1OKK D;  2RSE B;  2L6G A;  4LDQ A;  2HV7 A;  3FHD A;  1Q0F A;  5D92 A;  4AE4 A;  5AGF A;  2EPK X;  4IAO A;  5JLI A;  2H8A A;  2KW3 C;  2G3K A;  3SXY A;  3W2W A;  4OIN F;  2YL7 A;  5A6J A;  5EHH A;  3KYJ A;  3H2V A;  1CPR A;  1SR2 A;  2L6F A;  2DYS C;  4ANJ A;  2JD3 A;  2LCH A;  4J7Y A;  3X2Q C;  1ST6 A;  1H7I A;  4PJM A;  4XEK A;  2UUI A;  2GWW A;  3EHN A;  4FAP B;  3U3F A;  5HSW A;  1D0X A;  4CS7 A;  4EWC A;  3HJC A;  3RF3 A;  1ORJ A;  5L0J A;  3M1C B;  5A6K A;  1O3U A;  3C63 A;  3KL4 A;  3TD7 A;  5BQI A;  2R7U A;  3DJN B;  3EGX A;  4N4W A;  1OXK A;  4GEH A;  4CDV A;  4BG0 A;  4CJG A;  1EQ1 A;  4LLC A;  2KNH A;  3BRJ A;  4QI0 A;  5L0I A;  2IBF A;  1JPJ A;  1L3P A;  3NRH A;  3U5S A;  3ZTZ A;  4CS9 C;  1NFO A;  1YLM A;  1W2W A;  3JCU Q;  4YT2 A;  1ZZP A;  3B9Q A;  2BE5 F;  5EGY A;  5B3S C;  2WB7 A;  2QTV A;  1NU9 C;  5KYX A;  3U2L A;  5BQG A;  2OCC C;  3LNM B;  4EUK B;  2CCY A;  2IXN A;  3EG9 B;  3PMR A;  4DXW A;  1CGN A;  1ORS C;  1R4T A;  1D1B A;  1MMA A;  2H7O A;  2J7P D;  1ZHY A;  3F46 A;  4HFF B;  4Z9I A;  1VYI A;  4PFP A;  1LVK A;  1OW7 A;  3ABK C;  3CEX A;  4MS2 A;  5T3T A;  4HE8 D;  4MVU A;  2QY9 A;  2R9R B;  1UFB A;  2ETS A;  5DS6 A;  2KJG A;  2VH3 A;  3IEE A;  1T01 A;  1I4Z A;  2CNW D;  1LI7 A;  3QZC A;  3RKO F;  4O7G A;  1K04 A;  3CZ6 A;  3T4R A;  1HW2 A;  3L0I A;  2H7B A;  5A6A A;  3GEI A;  4XWJ A;  5DVW A;  3C8G A;  2DGJ A;  2XL4 A;  3PCV A;  4X0R A;  4FES A;  3ZDL A;  1VYK A;  1ZHT A;  2WL8 A;  3B0V C;  4U5H A;  4XLP F;  1WOL A;  4JIO A;  3CQZ A;  4EHP A;  5KYW A;  5FZT A;  1E83 A;  5KYY A;  5KYN A;  4O6N A;  3NG1 A;  3EH1 A;  1FR0 A;  4NTB A;  1NBB A;  2Y39 A;  5L3Q A;  1SF8 A;  3VM6 A;  3UMK A;  1JR8 A;  4G0H A;  5B3I A;  1E2X A;  3FOO A;  2L9J A;  5F28 E;  2CYD A;  1RMV A;  3WAQ A;  3JT1 A;  4K7B A;  2X51 A;  5COM A;  2Q9B A;  3V5X A;  3I5Q A;  1KNY A;  2A0U A;  4NTF A;  2FGY A;  1OCR C;  1VTM P;  2AU5 A;  2P0N A;  2R02 A;  3ZQY A;  2QUP A;  4BJ6 C;  2ZXO A;  2PX0 A;  3ATP A;  4MVO A;  2CW0 F;  3ZC4 A;  2J46 A;  4E17 A;  2YL0 A;  3NYL A;  3EGX B;  2H7V C;  3O55 A;  1I4Y A;  3K7D A;  1MNE A;  1OW6 A;  2XLW A;  2TMV P;  3HTK C;  3K33 A;  4N6H A;  4YT5 A;  3LAY A;  4EKW A;  1E86 A;  3R7C A;  1KTM A;  1A41 A;  4G7Z F;  1U6H A;  1LE4 A;  1RXQ A;  2D5R B;  1D0Y A;  4KC9 A;  5KYX B;  3ASO C;  3O39 A;  2R03 A;  2EIK C;  2VCA A;  2Q9C A;  3FMS A;  3GM2 A;  1QKR A;  5CI9 A;  1NZE A;  1CGO A;  1PD0 A;  3FDQ A;  1TFO B;  4JKV A;  1D1A A;  2AVK A;  1XZP A;  1WN0 A;  3L34 A;  4IAR A;  3SXK A;  3DZA A;  2C03 A;  3QTH A;  2XM4 A;  3L8J A;  5COG A;  4BEJ A;  1E84 A;  3C8G B;  2EPL X;  2PNO A;  4JCZ A;  4MTF A;  4CS8 C;  4U5D E;  4LDK A;  2IM8 A;  3AOU A;  2F22 A;  3NMJ A;  3IQ5 A;  4PJJ A;  5KYW B;  4YL0 A;  2OOC A;  2KYH A;  3GAN A;  1G8X A;  2P7V A;  1VLT A;  4O6M A;  3U3B A;  3GEE A;  4UDV A;  4G78 A;  4B6I A;  1ZHX A;  2EIJ C;  3EQL F;  1IZM A;  1G4U S;  1LE2 A;  2MYS A;  2ZXR A;  3NYJ A;  1V4A A;  4WGY A;  3DM9 B;  1RKE A;  4DOZ A;  1QZX A;  2XSE A;  3A11 A;  4QI2 A;  1M2V A;  3DXJ F;  3A9C A;  4GYT A;  4CSA C;  2ZXW C;  1YVI A;  1GS9 A;  3NKD A;  4BJ1 A;  4MVR A;  3S84 A;  1VLS A;  5L0H A;  1JOG A;  1OCC C;  4J30 B;  1LM3 B;  2LFD A;  5BUO A;  1DOW A;  2JPU A;  3W8H A;  3O10 A;  5A6B D;  4QDL A;  2J45 A;  1BR2 A;  1V55 C;  1U0B B;  4DVY P;  2RD9 A;  1TWH A;  2G3V A;  1T6I A;  3IPM O;  3RQG A;  1TKN A;  3RYL A;  1S7Z A;  4IWB A;  1MND A;  2XLH A;  1BR1 A;  2Y3H A;  3OA1 A;  4JC7 A;  4KI2 A;  2PFD A;  3ASN C;  4MW8 A;  1A0B A;  3AJM A;  4EIY A;  3LEO A;  4JCH A;  4E18 A;  4E0I A;  1WWP A;  3EGD A;  3EZH A;  3EZI A;  4LER A;  3SXM A;  1CPQ A;  1OQC A;  1VK5 A;  3DJU B;  5E3A A;  2YZS A;  3W8I A;  1KU2 A;  4DRI B;  3LJB A;  1EKY A;  1TR2 A;  2XXA A;  1MMN A;  3AG1 C;  3TJ6 A;  1Z23 A;  2LIG A;  4OD5 A;  4WJ0 A;  2L6H A;  3EPV A;  2Q7R A;  3ITF A;  1LPE A;  2HFI A;  256B A;  4E0H A;  1FTS A;  3EFO A;  4AL0 A;  3B0P A;  3TQO A;  5F5H A;  1JAF A;  1HMO A;  1DOV A;  3I4U A;  3MLG A;  4OIP F;  2W9Y A;  2OJQ A;  4NC3 A;  2LP4 A;  1BZ4 A;  1YYX A;  2EPM X;  3B71 A;  2XS1 A;  3V5Y A;  4XEV A;  3LS1 A;  3DMD A;  1O5H A;  4BJ5 C;  1VMA A;  2J0X A;  1C02 A;  3JSZ A;  4PJN A;  3RQF A;  3VF0 A;  2HS5 A;  5E3C A;  3C8Z A;  4I3M A;  1BDJ B;  1Z5Z A;  4U5G A;  2EIN C;  3T6J A;  2BC5 A;  3JSE O;  3AQB A;  1AEP A;  4A4A A;  1LIH A;  3RW0 A;  3DE9 A;  1G4W R;  1T5O A;  4CS9 A;  3QMK A;  1ZVZ A;  4OD4 A;  1NFN A;  2XL6 A;  4A2N B;  3GWN A;  4M63 A;  1HMD A;  1M56 C;  2IYL D;  2B0J A;  2O9X A;  1CGM E;  1A7E A;  2AP3 A;  5JUA A;  3TOM A;  5L3V A;  4K0D A;  2R7X A;  1T6U A;  4OIR F;  3IQT A;  2VAS A;  3MYF A;  3EH2 A;  2V26 A;  1BBH A;  3V5Z A;  1ZU5 A;  4JJG A;  3B29 A;  3OEO A;  4G7H F;  1GGQ A;  3X1O A;  1FFH A;  4D4N A;  5L0D A;  4H4K C;  4AE4 B;  1M2O A;  5B1B C;  5GPG B;  2Z15 A;  3DAF A;  3IQ6 A;  1A7V A;  1Z6A A;  2GDC A;  3Q6M A;  4KNW A;  4EBK A;  4U9D A;  2ASR A;  3EGD B;  2I8B A;  3E9V A;  4XPY A;  4CBE A;  3K66 A;  2QLA A;  4JTC B;  2LK4 A;  2YLG A;  2P6V A;  1QPU A;  1BR4 A;  4H54 A;  2EPO A;  2KK1 A;  3KH2 A;  1Y6D A;  3MX3 A;  2NG1 A;  1C03 A;  2HV6 A;  3EJN A;  4IAQ A;  1Q0D A;  2W45 A;  1MQV A;  3NKE A;  2HKV A;  1T9K A;  3EFO B;  3QVY A;  2X0C A;  1NLX A;  3Q7G A;  2PBE A;  3UMH A;  5DS4 A;  2DB4 A;  2EPN A;  4LAC B;  3DE8 A;  4PAC A;  4XQ1 A;  2UUH A;  4MQ9 F;  4Q4Z F;  3DD7 A;  3DM5 A;  2R7R A;  3S0X A;  1HE9 A;  4ZLC A;  1YYJ A;  2XLV A;  2VB6 A;  4WGZ A;  4YT8 A;  4F4B A;  3NYM A;  2OEV A;  3Q6N A;  5TJ5 E;  1MMD A;  3MBG A;  5FCL A;  3HNI A;  3VRC A;  4XLN F;  1S05 A;  3PHF 2;  3C8G D;  2WVQ A;  3FVY A;  4JTA B;  3GM1 A;  3I5P A;  2XLM A;  2J9B A;  5A69 A;  1I5N A;  4NQF A;  1K40 A;  3GWL A;  3K1H A;  3U0C A;  3LUT B;  3M79 A;  3NMI A;  5F5F A;  2WVN A;  3MYI A;  4C7O A;  4U9E A;  2ZXP A;  3S9O A;  3C18 A;  3CSK A;  2FFH A;  1UG7 A;  4WAB A;  2HJ3 A;  3C7J A;  3MFN A;  3LLI A;  5L0C A;  4FX5 A;  2R7W A;  5B1A C;  2HSB A;  1NU7 D;  1MMG A;  1V54 C;  4ULW A;  2V3C C;  3JRM O;  1T6Q A; 
#chains in the Genus database with same CATH homology
 1Y4C A;  2LFF A;  2LFD A;  3U8V A;  2HZ8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...