2LFFA

Solution structure of diiron protein in presence of 8 eq zn2+, northeast structural genomics consortium target or21
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
115
structure length
115
Chain Sequence
MDELRELLKAEQQGIKILKEVLKKAKEGDEQELARLNQEIVKAEKQGVKVYKEAAEKARNPEKRQVIDKILEDEEKHIEWHKAASKQGNAEQFASLVQQHLQDEQRHVEEIEKKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags De novo protein
molecule keywords Diiron protein
publication title Solution structure of Diiron protein in presence of 8 eq Zn2+
rcsb
source organism Escherichia coli
total genus 52
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2011-06-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.660 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) IL-4 antagonist (De novo design) like domain 2lffA00
2LFDA 1Y4CA 3U8VA 2LFFA 2HZ8A
chains in the Genus database with same CATH superfamily
4YK5A 2W4MA 3N2ZB 2PP4A 4PFOA 1VK5A 1OXBA 4U5EE 5COGA 3EZHA 3N24A 4U5BE 2A69F 2P1AA 4U5HA 3DJNB 256BA 3K1HA 2GA0A 3ASOC 3MX3A 4P9FA 2NUTB 2QTVA 3RFYA 3ZIBA 3DMDA 4G7HF 3W2WA 3WG7C 3U5SA 2KQ9A 3SXMA 1DOWA 3NYJA 1BR1A 2A6EF 3JSEO 2Q3TA 1NZEA 3IQ5A 3EGXA 1YARO 3H2VA 4K1OA 3X1OA 4EWCA 1JPNA 3HKKA 2ZD9A 3MBGA 4B6IA 4DBQA 2Q9CA 3S29A 2WZFA 1OCZC 2L9JA 3GWNA 1Q0FA 2KNHA 3DM9B 4P6IC 3S0XA 3IQCA 4BJTA 1QSPA 3BEHA 3KL4A 2XRHA 4JJFA 4DRIB 2Y3HA 4JJGA 3E9VA 4KNVA 3R7CA 2ETSA 3DJUB 3S27A 1V54C 1B68A 4J32B 4N06A 2WVQA 1VMAA 4AE4A 4E7SA 3SXZA 2IYLD 3JZ0A 5BQGA 3DE9A 4PJJA 2AVKA 3R2PA 3FHDA 1BR4A 1U6HA 3AQBA 1EKYA 4G0HA 2D5RB 1IW7F 1D0YA 4X0RA 1LS1A 1TWAA 2H7OA 2Z15A 1NBBA 1FTSA 2XXAA 4I3MA 3G50A 1MNEA 1Y6DA 1YYXA 3ECSA 5FZTA 4F4BA 3OA1A 5JT4A 1VYKA 3TULA 1OKKA 3DKAA 1M6TA 4AE4B 3X2QC 4E0HA 3HNIA 3LNMB 4XQ1A 2R7RA 5KYXA 4U9EA 4O6YA 2QNLA 3B71A 1HE1A 2YHSA 4PJMA 1L7CA 1O87A 2R9RB 3GEIA 3GWLA 4YN0B 2HJMA 1RJ9B 1FMWA 2LQGA 2DYRC 2Y3BA 2YQYA 4XLPF 3J06A 3BRJA 2YRFA 4JIOA 1ZHTA 2EPKX 4IARA 5A6KA 4MW8A 2HSQA 3Q7GA 2H7VC 3EGDB 3W2VA 2KC3A 1JR8A 2UUIA 2YL0A 5AGFA 1T6IA 4XEFA 2Q9AA 3MFNA 4D4XA 4I44A 4MNDA 1GM5A 1H7IA 1SYQA 1AUEA 1HY5A 3LLKA 4DJ9A 1I4ZA 4G7OF 4I1OB 5FCLA 1A7EA 1YJGA 3NYMA 4C7OB 2YWAA 1FR0A 3LEOA 2OJED 2G3VA 2WZLA 2KJGA 2HZ8A 2R7SA 2HSBA 3SXYA 5JRAA 3M4BA 3GODA 4FAPB 1L3PA 2NSFA 4GEHA 1A0BA 3QMKA 1M2OA 1J8YF 4MVMA 1UFBA 1RXQA 1O5HA 4JTAB 2R7OA 2ZXWC 5COFA 4BJ1A 3EG9A 4AK9A 5L0FA 1T9KA 3O55A 2C04A 2YL1A 1K05A 3ASNC 2F22A 4D4NA 2GFHA 1E2XA 2WVOA 4A2NB 4BEJA 4EKWA 1M2VA 4XPXA 1C03A 3ZC4A 3RH3A 2HV6A 4OD5A 4XTKA 1PCXA 2Y3GA 3IEEA 1VOMA 4JRZA 3IPMO 3JRTA 4PR9A 1RKEA 4Q5SF 2Y39A 1CPRA 1ZU5A 2OQMA 3V5ZA 1LIHA 2YLGA 3EG9B 2DGJA 2EINC 2XM4A 3GEEA 4CS8C 4IJJA 3T9OA 3MYIA 4BJ6A 5CI8A 1Z23A 2J7PA 2HMQA 3QTHA 4RBNA 1D1AA 1WTYA 4G7ZF 1FNTc 1K40A 3UGOA 1TKNA 1E85A 3AG4C 2JX0A 3LEVA 3SEOA 1HMDA 4ULWA 4IAOA 4OINF 2P0NA 3HNKA 3KYIA 3DD7A 3K1IC 4Z9IA 2L6GA 1RMVA 2L7AA 1WATA 1A7DA 2XLMA 4YJWA 3FDQA 1KTMA 3EZIA 2ICWG 2LFFA 2P7VA 4HE8D 2MWQA 5KYUA 2ZXPA 5E3CA 2HFIA 2J0XA 5D91A 5GPGB 1ZU4A 1XZPA 2PFDA 5E3AA 3W8HA 2NUPA 2NPUA 3KPHA 3U9MA 2XLWA 3OWTA 3ZG1A 1J8MF 1TQGA 2EILC 3EJNA 2OCCC 1YA9A 3RKOF 3U3BA 5DS5A 5B1AC 4MVQA 2H7BA 1T6QA 4LERA 4OIPF 4JTDB 4O7GA 4E18A 3DM5A 4E7ZA 3FOPA 2X0CA 3ZVRA 1WWPA 1D1CA 2HJ3A 2Q4FA 3ZDLA 1Z5ZA 4N4WA 4W8PA 4CDAA 1JPJA 5KYUB 1OCRC 5F28E 4YT4A 4FX5A 1IZMA 1K04A 2LCHA 3C18A 5TJ5E 2OJQA 1G4US 2EIJC 2M4EA 2Y3DA 3PMRA 3U9JA 1MMNA 2X51A 1FAPB 1T01A 2KYHA 2WB7A 1OW7A 1QPUA 1OCOC 3PCVA 5T1DB 5CI9A 2W45A 2P61A 5JS5A 3QW0A 3K66A 3IHUA 4LACB 2DI3A 2XLDA 3HLZA 3RQFA 3UR3C 4FESA 3M4CA 4ULVA 4FWVA 1JOGA 1EA8A 1YZAA 5T3TA 3C8GA 4BEMJ 2XL4A 4JCZA 2G62A 4MVOA 4CIPA 1SF8A 1H9TA 2CYDA 3FAJA 3MLGA 2XL8A 1EQ1A 3U0CA 1H6GA 3EGXB 4P9TA 2FAPB 3EHNA 4C3BA 4EBJA 3VAYA 2IXPA 2WL8A 3JTLO 4I1MA 1Q0GA 3T6GB 2J7PD 4JEBA 5HV9A 2GWWA 4KBLA 3QZCA 4JTCB 3VF0A 5F5HA 4DRJB 2LK4A 4IGGA 2TMVP 3SXKA 1ZYRF 5COMA 3HJCA 2MYSA 4CSAC 4U5CE 1YA7O 2B0HA 2KGOA 4AL0A 2ASRA 4JZAA 2IXOA 1OR2A 4IRUA 4PK4A 3WAQA 3KYJA 4YL3A 3TQOA 4HFKB 4L6RA 4YT5A 4OIQF 3L8JA 3LS1A 2BL2A 3KKBA 1APCA 1QQ3A 1F1MA 4XPWA 5BUOA 1LM3B 2QY9A 1PV3A 1ZHZA 1ZHXA 3JCUQ 1DOVA 5DS6A 2NG1A 4ONSA 3ZWIA 3PDMP 2A1DD 3M79A 1XWJA 2YEVA 2OKUA 3VYWA 5AC4A 2J46A 2PX0A 2DYSC 4AL1A 3ZTMA 3B0VC 3O39A 4DRHB 2GAQA 1O3UA 3C63A 3SYNA 3A11A 5KYWA 2VB6A 2ZPAA 2OEVA 4NTAA 2XXAB 2L6HA 1S7ZA 2MHRA 3F46A 5D92A 4MVSA 4K7BA 4IWBA 4U5GA 4QI0A 3RW0A 3VRCA 1A41A 1NG1A 5E33A 2QLAA 4BJ6C 1YAUO 3L1MA 3K6BA 5KYXB 4W8KA 3NKEA 1AEPA 4XLNF 3U2MA 2EPLX 2Y69C 1YYJA 4CJOA 1NLXA 1HW1A 4EUKB 4LLEA 2ZXRA 3RIPA 1TFKB 2EPMX 2HS5A 4NTBA 3AQCA 2Q9BA 3C8GD 5A6BD 2O9XA 3T6JA 3DXJF 1QVXA 1Z6AA 2LD6A 2OU6A 3DE8A 4NC3A 4CS8A 2NSGA 4NY3A 5L0CA 3WHNA 2XLEA 2C03A 4MW3A 4CS9C 1FFHA 2XS8A 2LFDA 2J9WA 4JCHA 4PACA 1MMAA 5DQTA 2R25A 4NCQA 2EPNA 2OEXA 3LNRA 4XPYA 2CW0F 4XEKA 3UGPA 5B1BC 5KYYA 3K1IA 3EPVA 4WGYA 1VTMP 3CSKA 3DZAA 2W9YA 1OCCC 3JRMO 3IQ6A 1PD1A 2I15A 4QDLA 5HSWA 2DB4A 3TD7A 4BJ5C 2YZSA 2L6FA 4K0DA 5B3SC 3L0IA 2YL7A 1Q0KA 4R32A 4CDYA 3WODF 4YT2A 4ZLDA 5JLIA 3I4UA 3AG2C 1D0XA 3CAXA 1MQVA 1E84A 3KH2A 4MVUA 1XZQA 1OXKA 1TR2A 2JPUA 2XSEA 1M57C 4EBKA 1TWCA 2JD3A 5IY5C 1JAFA 3FAPB 3HNLA 4N6CA 3S28A 1HMOA 4O79A 1T6UA 3TOMA 4Z9HA 3UMHA 1M2VB 4WGZA 3QVYA 3ABKC 3S90A 4CX9A 2CCYA 4EIYA 1KNYA 2VASA 2RD9A 5L0IA 2A68F 5K0IA 1BBHA 5DS4A 2W4BA 2VC9A 2HKVA 3AG1C 3DWWA 4JURI 4OIRF 1RKEB 5L0DA 2KK1A 1NU9C 3G4XA 3W8IA 3ABLC 1G8XA 2EPOA 2CGEA 2J8WA 3T6BA 2YKZA 3V5YA 2BC5A 4GYTA 1WOLA 1G5ZA 2XM0A 1M56C 4DVZA 2YL3A 1ST6A 5BQHA 3B29A 3U2LA 1LE4A 1GQAA 1LVKA 3B9QA 4CJGA 2LP4A 2I8BA 2L81A 4EBBA 4U5DE 1PD0A 1NFNA 1U89A 1ZHWA 2EIKC 2R03A 1C17M 2Q00A 4J7YA 4C3EA 4LDQA 3DAFA 1G4WR 3LESA 5L3VA 5CIVA 3K7DA 4CBEA 3M1CB 1UG7A 2ZXOA 4H54A 1E86A 4QI2A 4MVZA 5JVEA 3UMIA 1ZW3A 3NKDA 1VLSA 2PBEA 4MTFA 1Z63A 1TWGA 3O6XA 2NUPB 1CGOA 4J7TA 1LS4A 3EFOA 1C02A 4RDAA 3RQEA 2PF4E 2A6HF 3U8PA 4WABA 4ER9A 2D4UA 2E87A 3FMSA 4AX2A 4CSAA 2LSEA 1Y4CA 4MQ9F 1OW8A 3LS0A 2FFHA 4H4KC 1QZXA 4DOZA 2AU5A 3C7JA 3SP1A 3DAGA 3TK0A 1GGQA 3B0PA 2M64A 3US6A 4N6HA 5A6BA 1CPQA 5EK0A 4NTFA 2R02A 3KMIA 3EH1A 3AOUA 2IBFA 4Z9JA 3EFOB 3Q7LA 2J45A 3RYLA 1ZZPA 1W2WA 1Z3IX 1JRAA 1ORSC 2QE9A 3GM1A 1AVOB 2HV7A 2LIGA 3JT1A 3W4YA 1A7VA 2R7VA 3ZTZA 3L34A 2XL6A 2QUPA 3LAYA 4NQFA 4YT8A 2CNWA 3FXHA 4HEAJ 1QLEC 2KW3C 4M63A 2A0BA 1R5ID 3HNJA 4JC7A 4JVSA 3T4RA 3LJBA 3ZQYA 4YWQA 1V55C 3C8GB 3G4ZA 3LLIA 5JP7A 2R7XA 3U8VA 3ABMC 3Q6NA 4EHPA 3LUTB 1OQCA 4GQHA 4ZLCA 4U9DA 3H2UA 2IXMA 5L3QA 1TWHA 3TJ6A 1ZW2A 1MMGA 1YVIA 4Q7CA 1WN0A 5T3WA 1SMYF 2VH3A 1ZHYA 2VCBA 3S9OA 3ZSUA 4UDVA 4J30B 2AWYA 4E0IA 1RJ9A 3MYFA 4A4AA 3POVA 2A0UA 1OW6A 5A6AA 2J9BA 1EI7A 4E17A 4RD9A 1T5OA 2IXNA 1CGNA 3CQZA 3V5XA 4CS9A 3ZQVA 3EGDA 2IOQA 2VCCA 2AWCA 3CEXA 1I5NA 2R7QA 5L0GA 3NRHA 1KU2A 5JSLA 1QKRA 1Z7Qc 1NU7D 3JYYA 5BQIA 1MNDA 3EQLF 1NFOA 2J0WA 4BPMA 2H8AA 4YL1A 2V3CC 4BG0A 4C7OA 3H65A 4IAQA 2G3KA 3ATPA 4KNWA 3E70C 3GORA 3GM2A 3L8IA 5B3IA 2GDCA 4BJ5A 4JE9A 5AC5A 3EHMA 1LKXA 3OEOA 4OD4A 5E2QA 2R7TA 1BZ4A 3AG3C 4LDKA 5KYWB 2XLOA 3GEHA 3FVYA 3QVZA 4PFPA 5EGYA 5KYNA 3B0UX 1R4TA 2J9UA 2RSEB 4C3DA 1Q0MA 2PNOA 1YDIA 3K33A 4PJLA 1WGWA 3TJ5A 5A6JA 1CGME 2R7UA 3NMKA 4CIHA 3ITFA 1JMWA 3DI5A 3UNGC 4JEAA 3GM3A 4JW1A 4YL0A 2CNWD 3RVZA 1WASA 2CDQA 4JKVA 4HFFB 1BDJB 4XWJA 3NMJA 3O10A 3QW1A 4ANJA 3NDBB 3HTKC 3FOOA 3RF3A 3RVYA 2YLIA 1LPEA 2AP3A 3V7OA 4G78A 3SNHA 5JUAA 4LLCA 1Q0DA 4CDVA 2R05A 3M15A 2EIMC 2YLDA 4U5FE 4MTGA 3Q6MA 3SZRA 3U3FA 4DBRA 1FMVA 2XS1A 2HMZA 1GS9A 5L0HA 4PJNA 1I4YA 4MTOA 1FFTC 2BE5F 3IQTA 3NG1A 5KYYB 4MVRA 3PHF2 2UUHA 3AGUA 1VLTA 3VM6A 3UMKA 1SR2A 4XEVA 4DVYP 1N1CA 4KI2A 3C8ZA 1OR3A 2XLHA 2HUJA 3NMIA 4IB4A 1H9GA 1V4AA 1ZVZA 2YVKA 5DVWA 2WVNA 2OG2A 5EHHA 2J9VA 1RCPA 2WZGA 3NYLA 2B0JA 1YLMA 2IM8A 1D0ZA 1OKKD 3A9CA 2Q7RA 3GANA 5DQZA 3CZ6A 1VYIA 1VB5A 2PX3A 4OIOF 3AGTA 3C62A 3RQGA 3N0TA 1TFOB 4KC9A 1ORYA 1LI7A 1E83A 1HE9A 1U0BB 4O6NA 1MMDA 5F5FA 1LE2A 2P6VA 5L0JA 4WJ0A 3EH2A 2NUTA 2KSFA 1SZIA 4O6MA 5A69A 3I5QA 1HW2A 2VCAA 1LI5A 3S84A 4Q4ZF 4LDRA 3JYHA 3TOLA 1RKCA 4DXWA 2R7WA 1ORJA 1S05A 3I5PA 1NSGB 1D1BA 1YZCA 2FGYA 2OOCA 2XLVA 3JSZA 1BR2A 1V74B 3F47A 2V26A 4MS2A 4CS7A 3AJMA 5DLJA
chains in the Genus database with same CATH topology
2LFDA 1Y4CA 3U8VA 2LFFA 2HZ8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LFD A;  1Y4C A;  3U8V A;  2LFF A;  2HZ8 A; 
#chains in the Genus database with same CATH topology
 4YK5 A;  2W4M A;  3N2Z B;  2PP4 A;  4PFO A;  1VK5 A;  1OXB A;  4U5E E;  5COG A;  3EZH A;  3N24 A;  4U5B E;  2A69 F;  2P1A A;  4U5H A;  3DJN B;  256B A;  3K1H A;  2GA0 A;  3ASO C;  3MX3 A;  4P9F A;  2NUT B;  2QTV A;  3RFY A;  3ZIB A;  3DMD A;  4G7H F;  3W2W A;  3WG7 C;  3U5S A;  2KQ9 A;  3SXM A;  1DOW A;  3NYJ A;  1BR1 A;  2A6E F;  3JSE O;  2Q3T A;  1NZE A;  3IQ5 A;  3EGX A;  1YAR O;  3H2V A;  4K1O A;  3X1O A;  4EWC A;  1JPN A;  3HKK A;  2ZD9 A;  3MBG A;  4B6I A;  4DBQ A;  2Q9C A;  3S29 A;  2WZF A;  1OCZ C;  2L9J A;  3GWN A;  1Q0F A;  2KNH A;  3DM9 B;  4P6I C;  3S0X A;  3IQC A;  4BJT A;  1QSP A;  3BEH A;  3KL4 A;  2XRH A;  4JJF A;  4DRI B;  2Y3H A;  4JJG A;  3E9V A;  4KNV A;  3R7C A;  2ETS A;  3DJU B;  3S27 A;  1V54 C;  1B68 A;  4J32 B;  4N06 A;  2WVQ A;  1VMA A;  4AE4 A;  4E7S A;  3SXZ A;  2IYL D;  3JZ0 A;  5BQG A;  3DE9 A;  4PJJ A;  2AVK A;  3R2P A;  3FHD A;  1BR4 A;  1U6H A;  3AQB A;  1EKY A;  4G0H A;  2D5R B;  1IW7 F;  1D0Y A;  4X0R A;  1LS1 A;  1TWA A;  2H7O A;  2Z15 A;  1NBB A;  1FTS A;  2XXA A;  4I3M A;  3G50 A;  1MNE A;  1Y6D A;  1YYX A;  3ECS A;  5FZT A;  4F4B A;  3OA1 A;  5JT4 A;  1VYK A;  3TUL A;  1OKK A;  3DKA A;  1M6T A;  4AE4 B;  3X2Q C;  4E0H A;  3HNI A;  3LNM B;  4XQ1 A;  2R7R A;  5KYX A;  4U9E A;  4O6Y A;  2QNL A;  3B71 A;  1HE1 A;  2YHS A;  4PJM A;  1L7C A;  1O87 A;  2R9R B;  3GEI A;  3GWL A;  4YN0 B;  2HJM A;  1RJ9 B;  1FMW A;  2LQG A;  2DYR C;  2Y3B A;  2YQY A;  4XLP F;  3J06 A;  3BRJ A;  2YRF A;  4JIO A;  1ZHT A;  2EPK X;  4IAR A;  5A6K A;  4MW8 A;  2HSQ A;  3Q7G A;  2H7V C;  3EGD B;  3W2V A;  2KC3 A;  1JR8 A;  2UUI A;  2YL0 A;  5AGF A;  1T6I A;  4XEF A;  2Q9A A;  3MFN A;  4D4X A;  4I44 A;  4MND A;  1GM5 A;  1H7I A;  1SYQ A;  1AUE A;  1HY5 A;  3LLK A;  4DJ9 A;  1I4Z A;  4G7O F;  4I1O B;  5FCL A;  1A7E A;  1YJG A;  3NYM A;  4C7O B;  2YWA A;  1FR0 A;  3LEO A;  2OJE D;  2G3V A;  2WZL A;  2KJG A;  2HZ8 A;  2R7S A;  2HSB A;  3SXY A;  5JRA A;  3M4B A;  3GOD A;  4FAP B;  1L3P A;  2NSF A;  4GEH A;  1A0B A;  3QMK A;  1M2O A;  1J8Y F;  4MVM A;  1UFB A;  1RXQ A;  1O5H A;  4JTA B;  2R7O A;  2ZXW C;  5COF A;  4BJ1 A;  3EG9 A;  4AK9 A;  5L0F A;  1T9K A;  3O55 A;  2C04 A;  2YL1 A;  1K05 A;  3ASN C;  2F22 A;  4D4N A;  2GFH A;  1E2X A;  2WVO A;  4A2N B;  4BEJ A;  4EKW A;  1M2V A;  4XPX A;  1C03 A;  3ZC4 A;  3RH3 A;  2HV6 A;  4OD5 A;  4XTK A;  1PCX A;  2Y3G A;  3IEE A;  1VOM A;  4JRZ A;  3IPM O;  3JRT A;  4PR9 A;  1RKE A;  4Q5S F;  2Y39 A;  1CPR A;  1ZU5 A;  2OQM A;  3V5Z A;  1LIH A;  2YLG A;  3EG9 B;  2DGJ A;  2EIN C;  2XM4 A;  3GEE A;  4CS8 C;  4IJJ A;  3T9O A;  3MYI A;  4BJ6 A;  5CI8 A;  1Z23 A;  2J7P A;  2HMQ A;  3QTH A;  4RBN A;  1D1A A;  1WTY A;  4G7Z F;  1FNT c;  1K40 A;  3UGO A;  1TKN A;  1E85 A;  3AG4 C;  2JX0 A;  3LEV A;  3SEO A;  1HMD A;  4ULW A;  4IAO A;  4OIN F;  2P0N A;  3HNK A;  3KYI A;  3DD7 A;  3K1I C;  4Z9I A;  2L6G A;  1RMV A;  2L7A A;  1WAT A;  1A7D A;  2XLM A;  4YJW A;  3FDQ A;  1KTM A;  3EZI A;  2ICW G;  2LFF A;  2P7V A;  4HE8 D;  2MWQ A;  5KYU A;  2ZXP A;  5E3C A;  2HFI A;  2J0X A;  5D91 A;  5GPG B;  1ZU4 A;  1XZP A;  2PFD A;  5E3A A;  3W8H A;  2NUP A;  2NPU A;  3KPH A;  3U9M A;  2XLW A;  3OWT A;  3ZG1 A;  1J8M F;  1TQG A;  2EIL C;  3EJN A;  2OCC C;  1YA9 A;  3RKO F;  3U3B A;  5DS5 A;  5B1A C;  4MVQ A;  2H7B A;  1T6Q A;  4LER A;  4OIP F;  4JTD B;  4O7G A;  4E18 A;  3DM5 A;  4E7Z A;  3FOP A;  2X0C A;  3ZVR A;  1WWP A;  1D1C A;  2HJ3 A;  2Q4F A;  3ZDL A;  1Z5Z A;  4N4W A;  4W8P A;  4CDA A;  1JPJ A;  5KYU B;  1OCR C;  5F28 E;  4YT4 A;  4FX5 A;  1IZM A;  1K04 A;  2LCH A;  3C18 A;  5TJ5 E;  2OJQ A;  1G4U S;  2EIJ C;  2M4E A;  2Y3D A;  3PMR A;  3U9J A;  1MMN A;  2X51 A;  1FAP B;  1T01 A;  2KYH A;  2WB7 A;  1OW7 A;  1QPU A;  1OCO C;  3PCV A;  5T1D B;  5CI9 A;  2W45 A;  2P61 A;  5JS5 A;  3QW0 A;  3K66 A;  3IHU A;  4LAC B;  2DI3 A;  2XLD A;  3HLZ A;  3RQF A;  3UR3 C;  4FES A;  3M4C A;  4ULV A;  4FWV A;  1JOG A;  1EA8 A;  1YZA A;  5T3T A;  3C8G A;  4BEM J;  2XL4 A;  4JCZ A;  2G62 A;  4MVO A;  4CIP A;  1SF8 A;  1H9T A;  2CYD A;  3FAJ A;  3MLG A;  2XL8 A;  1EQ1 A;  3U0C A;  1H6G A;  3EGX B;  4P9T A;  2FAP B;  3EHN A;  4C3B A;  4EBJ A;  3VAY A;  2IXP A;  2WL8 A;  3JTL O;  4I1M A;  1Q0G A;  3T6G B;  2J7P D;  4JEB A;  5HV9 A;  2GWW A;  4KBL A;  3QZC A;  4JTC B;  3VF0 A;  5F5H A;  4DRJ B;  2LK4 A;  4IGG A;  2TMV P;  3SXK A;  1ZYR F;  5COM A;  3HJC A;  2MYS A;  4CSA C;  4U5C E;  1YA7 O;  2B0H A;  2KGO A;  4AL0 A;  2ASR A;  4JZA A;  2IXO A;  1OR2 A;  4IRU A;  4PK4 A;  3WAQ A;  3KYJ A;  4YL3 A;  3TQO A;  4HFK B;  4L6R A;  4YT5 A;  4OIQ F;  3L8J A;  3LS1 A;  2BL2 A;  3KKB A;  1APC A;  1QQ3 A;  1F1M A;  4XPW A;  5BUO A;  1LM3 B;  2QY9 A;  1PV3 A;  1ZHZ A;  1ZHX A;  3JCU Q;  1DOV A;  5DS6 A;  2NG1 A;  4ONS A;  3ZWI A;  3PDM P;  2A1D D;  3M79 A;  1XWJ A;  2YEV A;  2OKU A;  3VYW A;  5AC4 A;  2J46 A;  2PX0 A;  2DYS C;  4AL1 A;  3ZTM A;  3B0V C;  3O39 A;  4DRH B;  2GAQ A;  1O3U A;  3C63 A;  3SYN A;  3A11 A;  5KYW A;  2VB6 A;  2ZPA A;  2OEV A;  4NTA A;  2XXA B;  2L6H A;  1S7Z A;  2MHR A;  3F46 A;  5D92 A;  4MVS A;  4K7B A;  4IWB A;  4U5G A;  4QI0 A;  3RW0 A;  3VRC A;  1A41 A;  1NG1 A;  5E33 A;  2QLA A;  4BJ6 C;  1YAU O;  3L1M A;  3K6B A;  5KYX B;  4W8K A;  3NKE A;  1AEP A;  4XLN F;  3U2M A;  2EPL X;  2Y69 C;  1YYJ A;  4CJO A;  1NLX A;  1HW1 A;  4EUK B;  4LLE A;  2ZXR A;  3RIP A;  1TFK B;  2EPM X;  2HS5 A;  4NTB A;  3AQC A;  2Q9B A;  3C8G D;  5A6B D;  2O9X A;  3T6J A;  3DXJ F;  1QVX A;  1Z6A A;  2LD6 A;  2OU6 A;  3DE8 A;  4NC3 A;  4CS8 A;  2NSG A;  4NY3 A;  5L0C A;  3WHN A;  2XLE A;  2C03 A;  4MW3 A;  4CS9 C;  1FFH A;  2XS8 A;  2LFD A;  2J9W A;  4JCH A;  4PAC A;  1MMA A;  5DQT A;  2R25 A;  4NCQ A;  2EPN A;  2OEX A;  3LNR A;  4XPY A;  2CW0 F;  4XEK A;  3UGP A;  5B1B C;  5KYY A;  3K1I A;  3EPV A;  4WGY A;  1VTM P;  3CSK A;  3DZA A;  2W9Y A;  1OCC C;  3JRM O;  3IQ6 A;  1PD1 A;  2I15 A;  4QDL A;  5HSW A;  2DB4 A;  3TD7 A;  4BJ5 C;  2YZS A;  2L6F A;  4K0D A;  5B3S C;  3L0I A;  2YL7 A;  1Q0K A;  4R32 A;  4CDY A;  3WOD F;  4YT2 A;  4ZLD A;  5JLI A;  3I4U A;  3AG2 C;  1D0X A;  3CAX A;  1MQV A;  1E84 A;  3KH2 A;  4MVU A;  1XZQ A;  1OXK A;  1TR2 A;  2JPU A;  2XSE A;  1M57 C;  4EBK A;  1TWC A;  2JD3 A;  5IY5 C;  1JAF A;  3FAP B;  3HNL A;  4N6C A;  3S28 A;  1HMO A;  4O79 A;  1T6U A;  3TOM A;  4Z9H A;  3UMH A;  1M2V B;  4WGZ A;  3QVY A;  3ABK C;  3S90 A;  4CX9 A;  2CCY A;  4EIY A;  1KNY A;  2VAS A;  2RD9 A;  5L0I A;  2A68 F;  5K0I A;  1BBH A;  5DS4 A;  2W4B A;  2VC9 A;  2HKV A;  3AG1 C;  3DWW A;  4JUR I;  4OIR F;  1RKE B;  5L0D A;  2KK1 A;  1NU9 C;  3G4X A;  3W8I A;  3ABL C;  1G8X A;  2EPO A;  2CGE A;  2J8W A;  3T6B A;  2YKZ A;  3V5Y A;  2BC5 A;  4GYT A;  1WOL A;  1G5Z A;  2XM0 A;  1M56 C;  4DVZ A;  2YL3 A;  1ST6 A;  5BQH A;  3B29 A;  3U2L A;  1LE4 A;  1GQA A;  1LVK A;  3B9Q A;  4CJG A;  2LP4 A;  2I8B A;  2L81 A;  4EBB A;  4U5D E;  1PD0 A;  1NFN A;  1U89 A;  1ZHW A;  2EIK C;  2R03 A;  1C17 M;  2Q00 A;  4J7Y A;  4C3E A;  4LDQ A;  3DAF A;  1G4W R;  3LES A;  5L3V A;  5CIV A;  3K7D A;  4CBE A;  3M1C B;  1UG7 A;  2ZXO A;  4H54 A;  1E86 A;  4QI2 A;  4MVZ A;  5JVE A;  3UMI A;  1ZW3 A;  3NKD A;  1VLS A;  2PBE A;  4MTF A;  1Z63 A;  1TWG A;  3O6X A;  2NUP B;  1CGO A;  4J7T A;  1LS4 A;  3EFO A;  1C02 A;  4RDA A;  3RQE A;  2PF4 E;  2A6H F;  3U8P A;  4WAB A;  4ER9 A;  2D4U A;  2E87 A;  3FMS A;  4AX2 A;  4CSA A;  2LSE A;  1Y4C A;  4MQ9 F;  1OW8 A;  3LS0 A;  2FFH A;  4H4K C;  1QZX A;  4DOZ A;  2AU5 A;  3C7J A;  3SP1 A;  3DAG A;  3TK0 A;  1GGQ A;  3B0P A;  2M64 A;  3US6 A;  4N6H A;  5A6B A;  1CPQ A;  5EK0 A;  4NTF A;  2R02 A;  3KMI A;  3EH1 A;  3AOU A;  2IBF A;  4Z9J A;  3EFO B;  3Q7L A;  2J45 A;  3RYL A;  1ZZP A;  1W2W A;  1Z3I X;  1JRA A;  1ORS C;  2QE9 A;  3GM1 A;  1AVO B;  2HV7 A;  2LIG A;  3JT1 A;  3W4Y A;  1A7V A;  2R7V A;  3ZTZ A;  3L34 A;  2XL6 A;  2QUP A;  3LAY A;  4NQF A;  4YT8 A;  2CNW A;  3FXH A;  4HEA J;  1QLE C;  2KW3 C;  4M63 A;  2A0B A;  1R5I D;  3HNJ A;  4JC7 A;  4JVS A;  3T4R A;  3LJB A;  3ZQY A;  4YWQ A;  1V55 C;  3C8G B;  3G4Z A;  3LLI A;  5JP7 A;  2R7X A;  3U8V A;  3ABM C;  3Q6N A;  4EHP A;  3LUT B;  1OQC A;  4GQH A;  4ZLC A;  4U9D A;  3H2U A;  2IXM A;  5L3Q A;  1TWH A;  3TJ6 A;  1ZW2 A;  1MMG A;  1YVI A;  4Q7C A;  1WN0 A;  5T3W A;  1SMY F;  2VH3 A;  1ZHY A;  2VCB A;  3S9O A;  3ZSU A;  4UDV A;  4J30 B;  2AWY A;  4E0I A;  1RJ9 A;  3MYF A;  4A4A A;  3POV A;  2A0U A;  1OW6 A;  5A6A A;  2J9B A;  1EI7 A;  4E17 A;  4RD9 A;  1T5O A;  2IXN A;  1CGN A;  3CQZ A;  3V5X A;  4CS9 A;  3ZQV A;  3EGD A;  2IOQ A;  2VCC A;  2AWC A;  3CEX A;  1I5N A;  2R7Q A;  5L0G A;  3NRH A;  1KU2 A;  5JSL A;  1QKR A;  1Z7Q c;  1NU7 D;  3JYY A;  5BQI A;  1MND A;  3EQL F;  1NFO A;  2J0W A;  4BPM A;  2H8A A;  4YL1 A;  2V3C C;  4BG0 A;  4C7O A;  3H65 A;  4IAQ A;  2G3K A;  3ATP A;  4KNW A;  3E70 C;  3GOR A;  3GM2 A;  3L8I A;  5B3I A;  2GDC A;  4BJ5 A;  4JE9 A;  5AC5 A;  3EHM A;  1LKX A;  3OEO A;  4OD4 A;  5E2Q A;  2R7T A;  1BZ4 A;  3AG3 C;  4LDK A;  5KYW B;  2XLO A;  3GEH A;  3FVY A;  3QVZ A;  4PFP A;  5EGY A;  5KYN A;  3B0U X;  1R4T A;  2J9U A;  2RSE B;  4C3D A;  1Q0M A;  2PNO A;  1YDI A;  3K33 A;  4PJL A;  1WGW A;  3TJ5 A;  5A6J A;  1CGM E;  2R7U A;  3NMK A;  4CIH A;  3ITF A;  1JMW A;  3DI5 A;  3UNG C;  4JEA A;  3GM3 A;  4JW1 A;  4YL0 A;  2CNW D;  3RVZ A;  1WAS A;  2CDQ A;  4JKV A;  4HFF B;  1BDJ B;  4XWJ A;  3NMJ A;  3O10 A;  3QW1 A;  4ANJ A;  3NDB B;  3HTK C;  3FOO A;  3RF3 A;  3RVY A;  2YLI A;  1LPE A;  2AP3 A;  3V7O A;  4G78 A;  3SNH A;  5JUA A;  4LLC A;  1Q0D A;  4CDV A;  2R05 A;  3M15 A;  2EIM C;  2YLD A;  4U5F E;  4MTG A;  3Q6M A;  3SZR A;  3U3F A;  4DBR A;  1FMV A;  2XS1 A;  2HMZ A;  1GS9 A;  5L0H A;  4PJN A;  1I4Y A;  4MTO A;  1FFT C;  2BE5 F;  3IQT A;  3NG1 A;  5KYY B;  4MVR A;  3PHF 2;  2UUH A;  3AGU A;  1VLT A;  3VM6 A;  3UMK A;  1SR2 A;  4XEV A;  4DVY P;  1N1C A;  4KI2 A;  3C8Z A;  1OR3 A;  2XLH A;  2HUJ A;  3NMI A;  4IB4 A;  1H9G A;  1V4A A;  1ZVZ A;  2YVK A;  5DVW A;  2WVN A;  2OG2 A;  5EHH A;  2J9V A;  1RCP A;  2WZG A;  3NYL A;  2B0J A;  1YLM A;  2IM8 A;  1D0Z A;  1OKK D;  3A9C A;  2Q7R A;  3GAN A;  5DQZ A;  3CZ6 A;  1VYI A;  1VB5 A;  2PX3 A;  4OIO F;  3AGT A;  3C62 A;  3RQG A;  3N0T A;  1TFO B;  4KC9 A;  1ORY A;  1LI7 A;  1E83 A;  1HE9 A;  1U0B B;  4O6N A;  1MMD A;  5F5F A;  1LE2 A;  2P6V A;  5L0J A;  4WJ0 A;  3EH2 A;  2NUT A;  2KSF A;  1SZI A;  4O6M A;  5A69 A;  3I5Q A;  1HW2 A;  2VCA A;  1LI5 A;  3S84 A;  4Q4Z F;  4LDR A;  3JYH A;  3TOL A;  1RKC A;  4DXW A;  2R7W A;  1ORJ A;  1S05 A;  3I5P A;  1NSG B;  1D1B A;  1YZC A;  2FGY A;  2OOC A;  2XLV A;  3JSZ A;  1BR2 A;  1V74 B;  3F47 A;  2V26 A;  4MS2 A;  4CS7 A;  3AJM A;  5DLJ A; 
#chains in the Genus database with same CATH homology
 2LFD A;  1Y4C A;  3U8V A;  2LFF A;  2HZ8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...