1JRAA

Crystal structure of erv2p
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
106
structure length
106
Chain Sequence
DDKVKKEVGRASWKYFHTLLARFPDEPTPEEREKLHTFIGLYAELYPCGECSYHFVKLIEKYPVQTSSRTAAAMWGCHIHNKVNEYLKKDIYDCATILEDYDCGCS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords ERV2 PROTEIN, MITOCHONDRIAL
publication title A new FAD-binding fold and intersubunit disulfide shuttle in the thiol oxidase Erv2p.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 42
structure length 106
sequence length 106
chains with identical sequence B, C, D
ec nomenclature ec 1.8.3.2: Thiol oxidase.
pdb deposition date 2001-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04777 Evr1_Alr Erv1 / Alr family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.310 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) ERV/ALR sulfhydryl oxidase domain 1jraA00
3U2LA 3U5SA 3TK0A 1OQCA 3W4YA 3TD7A 3LLKA 4E0IA 3U2MA 1JR8A 3LLIA 3R7CA 2HJ3A 3O55A 4LDKA 1JRAA 3MBGA 4E0HA 3GWNA 3GWLA
chains in the Genus database with same CATH superfamily
4C7OB 5L0HA 5DLJA 2EIMC 1N1CA 2B0HA 3HKKA 1WASA 2O9XA 2LCHA 3ABLC 3GEIA 3KH2A 5KYXB 4CSAC 3J06A 1V74B 4BEMJ 4EKWA 2YZSA 3IEEA 1D0YA 1H9GA 5BQHA 1UFBA 3ECSA 2OQMA 4CS9A 4BJ1A 2BL2A 2XLMA 4X0RA 1LI5A 3B29A 5IY5C 5HSWA 4P9TA 4R32A 2J46A 2Y3GA 3LEOA 3Q6NA 4K1OA 3ZTMA 4I1OB 2GAQA 4E7ZA 1HMDA 4ZLDA 1Q0DA 1TFKB 3LEVA 4E0HA 2V3CC 1ST6A 3NMJA 3O6XA 3U3BA 1MMDA 2DGJA 4XLNF 4XPYA 1APCA 2A6HF 2R02A 5K0IA 4PJNA 4CDYA 2J0WA 1FR0A 1CGNA 1WGWA 2J9UA 3T4RA 1WN0A 2OEVA 5CI8A 3I5PA 5B3IA 3ABKC 4QI0A 2L81A 2PF4E 1J8MF 1A7DA 2IXOA 4MVRA 1I4ZA 5B3SC 1CPQA 5CIVA 4G78A 1M56C 3ZDLA 4O6YA 3V5ZA 4IARA 2NPUA 3QZCA 5JRAA 3PHF2 3NYMA 3AQBA 1LPEA 4JKVA 4OIPF 3O55A 4XEFA 3K1HA 4LDRA 2XM0A 2YL3A 3JZ0A 2J9BA 1TWCA 4XPWA 4AE4A 3DMDA 3A9CA 1FMWA 2D5RB 4JEAA 2GWWA 1C03A 4XEKA 2JX0A 3RF3A 2MHRA 2HUJA 1OR3A 1Q0GA 3CEXA 3FOOA 3GEHA 4WABA 5B1BC 2R7WA 1OXBA 2J7PD 2YWAA 3C8GA 1G4US 1YARO 3U3FA 2P6VA 3CAXA 1A41A 2XLHA 2Y3HA 2YL7A 4P9FA 3V5XA 3W2WA 4D4XA 2ZXOA 4ZLCA 2A6EF 4MW3A 4EWCA 4NTBA 3W8IA 5AGFA 5EHHA 1L7CA 2PX0A 2VCAA 4JCHA 2D4UA 3LAYA 2EPOA 3K33A 4DOZA 1OCCC 5L3QA 2LK4A 3SXZA 4PACA 5L0DA 2HMQA 2J45A 2J7PA 3L34A 4J7YA 3EZHA 1GQAA 2BE5F 2RD9A 4Z9IA 1WATA 2NUPB 3MX3A 1FMVA 1E86A 4ONSA 4N06A 1QQ3A 2XL4A 2C03A 3AGUA 2NG1A 2GFHA 4ULVA 5BUOA 2FGYA 3C8ZA 3AG4C 2R25A 4W8KA 5DQTA 2P7VA 2R7OA 3AJMA 3O39A 4JE9A 4OD5A 2Q4FA 4XTKA 1S05A 3QVYA 1ZHTA 4YWQA 5DS6A 3S90A 3SP1A 1WWPA 3UGPA 2WZGA 3DXJF 3I5QA 4J32B 1NU7D 1HW1A 2OJED 2DB4A 3FDQA 4OD4A 2A0BA 3KYIA 2HJMA 2XLEA 2YHSA 2ZXWC 4MW8A 1TKNA 4QDLA 2YVKA 3ZQYA 3ZTZA 3E70C 5KYUB 1YYJA 4U5CE 1YLMA 2G62A 4YJWA 1M2OA 3LLIA 5COFA 2R7TA 3Q7LA 3DM5A 1KNYA 4RBNA 4PFOA 4DRIB 3IHUA 2ZXPA 2QY9A 4BG0A 3E9VA 1O87A 2QNLA 5E33A 3AG3C 4MS2A 3T6JA 1NFNA 2XS8A 1ZHZA 4K7BA 2J9VA 4PK4A 5CI9A 2J8WA 3JYHA 3KL4A 4LLEA 3EZIA 2NSFA 3WODF 1HY5A 2AU5A 4YL3A 3TOLA 4BJTA 3RVYA 3U9MA 4CDAA 4FAPB 5T3WA 3ZQVA 1GM5A 4JCZA 1ZVZA 2JPUA 1VK5A 1XZPA 2ZPAA 4FX5A 1QSPA 3W4YA 4BJ6C 5L0FA 2Z15A 2NSGA 4CS7A 3FMSA 2G3KA 4Z9JA 4NCQA 3VM6A 4WJ0A 3K66A 3L8JA 5T3TA 3SXYA 4BJ5A 1H6GA 5JSLA 4PJMA 5KYWB 2W9YA 2XXAB 2Y39A 4AX2A 3TOMA 3RQFA 2GA0A 5DS5A 3K1IA 1TFOB 3HNLA 3JSZA 1OW8A 4EBJA 2QLAA 2PFDA 3WHNA 2A1DD 1HMOA 1OW6A 1JRAA 1T6IA 2HMZA 3KYJA 2PP4A 2V26A 3DJUB 3LS1A 4KBLA 4RD9A 3U9JA 3QTHA 3S27A 2YKZA 2I8BA 3ZC4A 1A0BA 5A6BD 4E18A 1MNEA 2H7BA 2VCBA 1CGME 2WZLA 1MNDA 3FAPB 3DE8A 2CGEA 2WL8A 4I3MA 3NYJA 1C17M 4KNWA 1RXQA 2EINC 1V55C 1Z5ZA 2ICWG 3DKAA 3RQEA 1ORYA 3S28A 4HFKB 2H7OA 2F22A 1G8XA 4CSAA 2OOCA 5A6BA 1D1BA 1O3UA 4MNDA 3R7CA 2WVNA 5A69A 5KYYB 1RKEB 3EH2A 3GM1A 3T6GB 2HV7A 2X0CA 4PR9A 2IBFA 3RW0A 4J7TA 2OG2A 2L6FA 4RDAA 5BQGA 2KYHA 3JRMO 3ZWIA 4OIQF 4IAQA 1U89A 4N4WA 3TULA 4DVZA 3OA1A 4IGGA 3LESA 5BQIA 3I4UA 2M4EA 2Q00A 3EGXA 4DBQA 4JTDB 5A6KA 3N0TA 1RJ9B 2OKUA 4O6NA 2NUPA 4CS8C 1PCXA 2KGOA 1UG7A 4CX9A 1Z63A 1IW7F 3B9QA 1E85A 4E0IA 4LLCA 3QW1A 2LSEA 2GDCA 3UMKA 4YN0B 2KSFA 1M6TA 3K6BA 2J0XA 1JOGA 4XWJA 3KMIA 4CIHA 1T9KA 2DI3A 3DAFA 3W8HA 1PD0A 3IQCA 1AEPA 3NRHA 4KC9A 1HE9A 3C7JA 4MVSA 3B0VC 1JPNA 4G7ZF 1TWGA 2R9RB 1T6UA 1V4AA 2XLOA 4JTAB 3EG9B 3ZG1A 1EQ1A 3HTKC 1W2WA 2YLGA 4IAOA 4J30B 1OCRC 1HE1A 3EH1A 3A11A 2R7RA 4G7HF 2I15A 4AK9A 3B71A 4IWBA 2NUTA 4MTOA 2XRHA 3ASNC 4ANJA 4JC7A 3U5SA 1A7EA 3DZAA 1YYXA 4BEJA 4IRUA 5GPGB 1OKKD 4EIYA 1LE4A 1MQVA 2L9JA 3VRCA 1ZW3A 2PNOA 5JUAA 4A2NB 3PDMP 5B1AC 4C3DA 1KTMA 3F46A 4JJFA 2R7UA 1M2VB 2XL8A 3LUTB 3QMKA 3UNGC 1B68A 2W4BA 2YL0A 2FAPB 2XLDA 2P0NA 4WGYA 3SXMA 4E17A 1T01A 4AL0A 1LIHA 2PX3A 3GANA 3ITFA 4MVUA 4L6RA 3V7OA 1RCPA 1GGQA 1OKKA 3EFOA 3ZIBA 1MMAA 3TJ5A 3UMIA 4LACB 4U9EA 3TJ6A 2LP4A 1Z6AA 5A6JA 2HFIA 1E2XA 3GWLA 4OIRF 4Q4ZF 2LFDA 2YL1A 1VTMP 4CJGA 1FFTC 1RMVA 1BZ4A 3B0UX 2AVKA 1XZQA 2ASRA 3TK0A 2H7VC 1TWHA 2WVQA 3DD7A 3JCUQ 1T5OA 2LD6A 3K7DA 2KK1A 4EHPA 3VF0A 2P1AA 2XL6A 4NTFA 1VLSA 3S0XA 1QVXA 3U0CA 1SR2A 3G50A 2HS5A 4G0HA 4UDVA 1ZZPA 4ER9A 4C7OA 5E3AA 3SZRA 1SZIA 2HKVA 2W4MA 3GEEA 5FCLA 1LS1A 4LDKA 3R2PA 2EPKX 3GM2A 1Q0MA 3HJCA 1YZCA 2CDQA 4N6CA 2XSEA 3H65A 4M63A 3IQTA 2C04A 4P6IC 5EK0A 5TJ5E 5KYXA 1E83A 1AUEA 1ZHXA 3S9OA 5EGYA 5L0CA 1ZHYA 4MVOA 4U5GA 3ASOC 2WZFA 2OU6A 1Z7Qc 5HV9A 1RKEA 1Y6DA 1AVOB 4JIOA 2CNWD 3AG2C 4W8PA 1OQCA 2Y3DA 3TQOA 4FWVA 4GYTA 1YZAA 2KQ9A 2G3VA 1DOWA 3LLKA 4JJGA 1SF8A 2LQGA 3RH3A 4BJ6A 1LKXA 3C8GB 1QLEC 3C62A 4U9DA 2L7AA 1CPRA 1R5ID 4OINF 2LFFA 1I4YA 1EA8A 1PD1A 3FVYA 2EIJC 2CYDA 1G5ZA 3CZ6A 3O10A 2L6HA 4GQHA 4XPXA 1YJGA 3JSEO 4Z9HA 3IQ5A 4HEAJ 5F5HA 1QKRA 4H54A 4MTFA 1CGOA 4DRJB 2CNWA 1FNTc 1O5HA 4DVYP 3DE9A 1Q0FA 3U8VA 2VH3A 4I44A 4JRZA 2Q9AA 3RFYA 1F1MA 2DYSC 2WVOA 3M79A 2MYSA 5DQZA 4QI2A 3QVZA 4EUKB 1LE2A 2IXMA 2R7QA 3L8IA 4XQ1A 3AG1C 1LS4A 2R05A 3MLGA 1QZXA 1VB5A 1RKCA 3HLZA 3IQ6A 2EILC 5JLIA 4U5HA 5KYNA 5AC5A 2R7XA 1OCZC 4IB4A 3EG9A 4D4NA 4DBRA 3NG1A 1FTSA 3EQLF 1MMGA 3U2MA 1D0ZA 2YRFA 2KJGA 3AGTA 4YK5A 4K0DA 5JT4A 2Y69C 3X1OA 4N6HA 1OR2A 5FZTA 2AP3A 1TR2A 2OJQA 3DJNB 5L0IA 1GS9A 1WOLA 4U5EE 4LERA 2BC5A 4C3EA 1U0BB 2IXNA 2A68F 2YQYA 4JEBA 1NSGB 4Q7CA 5E3CA 3T9OA 3WAQA 5DS4A 2CCYA 1H9TA 3Q6MA 1NLXA 3SYNA 3FOPA 3OWTA 2XM4A 1M2VA 4PFPA 3MYIA 2VASA 4CDVA 4JW1A 2YEVA 1YAUO 3DWWA 1ORJA 4DXWA 1L3PA 4MQ9F 1Y4CA 4YL0A 4YT2A 3HNKA 2CW0F 1U6HA 3EGDB 2A0UA 1KU2A 2YLDA 3GM3A 2R7SA 3KPHA 4KI2A 2HSQA 3UR3C 3LJBA 2HSBA 2Q9CA 2VCCA 4CS8A 1SYQA 4MVZA 4NY3A 4CS9C 3SNHA 5D91A 3RYLA 2L6GA 1A7VA 1BBHA 1D0XA 3N2ZB 4YT4A 3BEHA 2PBEA 3RQGA 2HJ3A 2IM8A 4CJOA 2VB6A 3F47A 3GODA 1PV3A 5AC4A 1OXKA 4IJJA 1ZYRF 3B0PA 2M64A 1NFOA 1LM3B 3LNMB 2LIGA 3NDBB 2KW3C 4FESA 4H4KC 2J9WA 4E7SA 4XLPF 3POVA 2XS1A 2OCCC 5KYUA 3ZVRA 2VC9A 2ZD9A 5JS5A 3RKOF 1NG1A 2WB7A 2TMVP 2W45A 2QUPA 4KNVA 3U2LA 1VYIA 3HNIA 2YLIA 2X51A 4CIPA 2E87A 1NBBA 2EPNA 3C8GD 3FHDA 3G4ZA 4NTAA 1BDJB 2KC3A 1R4TA 1BR2A 1Z23A 3C63A 3SXKA 1VOMA 3W2VA 4U5FE 3AQCA 2EIKC 5JVEA 3H2UA 1EKYA 3Q7GA 1FAPB 3EPVA 3NMKA 2KNHA 2QE9A 5D92A 3T6BA 4BPMA 3LS0A 1ZU4A 1BR1A 2IYLD 1YA9A 5T1DB 3ATPA 2A69F 2FFHA 1BR4A 1EI7A 2UUIA 2HV6A 3G4XA 2IXPA 3M4BA 1V54C 3EHNA 4U5DE 2XXAA 2MWQA 3FAJA 3FXHA 5KYWA 1VYKA 2Y3BA 3MFNA 2P61A 5DVWA 4AL1A 4MTGA 4DJ9A 3NMIA 5F5FA 3ZSUA 2AWYA 1QPUA 2R03A 4PJLA 4WGZA 3VYWA 3S84A 4JTCB 2JD3A 4C3BA 1LVKA 4B6IA 4JZAA 1WTYA 5L0GA 4CBEA 1JR8A 3NKDA 2RSEB 4YT5A 5F28E 5COGA 4MVQA 3EGXB 5L0JA 1TWAA 4OIOF 1ORSC 1ZU5A 3QW0A 5L3VA 3DI5A 3LNRA 2Q9BA 3NKEA 4MVMA 1OCOC 1H7IA 1S7ZA 1MMNA 1JAFA 1Z3IX 3S29A 3DAGA 4JVSA 3WG7C 2EPLX 1ZHWA 3JT1A 3IPMO 1D1CA 1K05A 3X2QC 1FFHA 3BRJA 5KYYA 1HW2A 4HE8D 4AE4B 2ZXRA 3TD7A 4G7OF 4EBBA 4F4BA 3KKBA 1E84A 3UGOA 1VMAA 4O79A 4ULWA 3SEOA 4YT8A 1SMYF 3AOUA 3M15A 3HNJA 3MYFA 2HZ8A 1G4WR 3L0IA 1K04A 1T6QA 2NUTB 4PJJA 1XWJA 4DRHB 3EGDA 1RJ9A 2OEXA 2Q3TA 1M57C 3EHMA 3H2VA 2AWCA 256BA 4O7GA 5COMA 3MBGA 4A4AA 1J8YF 1NZEA 3EJNA 3PCVA 2QTVA 1K40A 3DM9B 4JURI 3M4CA 3N24A 4LDQA 3GORA 4NC3A 4O6MA 1I5NA 3ABMC 3RIPA 3VAYA 4EBKA 5E2QA 4Q5SF 1VLTA 4GEHA 3RVZA 2H8AA 2UUHA 3JTLO 1JPJA 3M1CB 4U5BE 3UMHA 1NU9C 3EFOB 4HFFB 2XLWA 3US6A 1OW7A 4BJ5C 1YDIA 2IOQA 4I1MA 2B0JA 4XEVA 3U8PA 1DOVA 2XLVA 3V5YA 3CQZA 3K1IC 3CSKA 3C18A 3JRTA 1D1AA 4YL1A 2R7VA 2DYRC 3JYYA 5A6AA 1C02A 1YA7O 4NQFA 2EPMX 2Q7RA 1Q0KA 3PMRA 5JP7A 1IZMA 3L1MA 1JMWA 2ETSA 3GWNA 1ZW2A 1YVIA 3NYLA 1LI7A 1TQGA 3OEOA
chains in the Genus database with same CATH topology
3U2LA 3U5SA 3TK0A 1OQCA 3W4YA 3TD7A 3LLKA 4E0IA 3U2MA 1JR8A 3LLIA 3R7CA 2HJ3A 3O55A 4LDKA 1JRAA 3MBGA 4E0HA 3GWNA 3GWLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U2L A;  3U5S A;  3TK0 A;  1OQC A;  3W4Y A;  3TD7 A;  3LLK A;  4E0I A;  3U2M A;  1JR8 A;  3LLI A;  3R7C A;  2HJ3 A;  3O55 A;  4LDK A;  1JRA A;  3MBG A;  4E0H A;  3GWN A;  3GWL A; 
#chains in the Genus database with same CATH topology
 4C7O B;  5L0H A;  5DLJ A;  2EIM C;  1N1C A;  2B0H A;  3HKK A;  1WAS A;  2O9X A;  2LCH A;  3ABL C;  3GEI A;  3KH2 A;  5KYX B;  4CSA C;  3J06 A;  1V74 B;  4BEM J;  4EKW A;  2YZS A;  3IEE A;  1D0Y A;  1H9G A;  5BQH A;  1UFB A;  3ECS A;  2OQM A;  4CS9 A;  4BJ1 A;  2BL2 A;  2XLM A;  4X0R A;  1LI5 A;  3B29 A;  5IY5 C;  5HSW A;  4P9T A;  4R32 A;  2J46 A;  2Y3G A;  3LEO A;  3Q6N A;  4K1O A;  3ZTM A;  4I1O B;  2GAQ A;  4E7Z A;  1HMD A;  4ZLD A;  1Q0D A;  1TFK B;  3LEV A;  4E0H A;  2V3C C;  1ST6 A;  3NMJ A;  3O6X A;  3U3B A;  1MMD A;  2DGJ A;  4XLN F;  4XPY A;  1APC A;  2A6H F;  2R02 A;  5K0I A;  4PJN A;  4CDY A;  2J0W A;  1FR0 A;  1CGN A;  1WGW A;  2J9U A;  3T4R A;  1WN0 A;  2OEV A;  5CI8 A;  3I5P A;  5B3I A;  3ABK C;  4QI0 A;  2L81 A;  2PF4 E;  1J8M F;  1A7D A;  2IXO A;  4MVR A;  1I4Z A;  5B3S C;  1CPQ A;  5CIV A;  4G78 A;  1M56 C;  3ZDL A;  4O6Y A;  3V5Z A;  4IAR A;  2NPU A;  3QZC A;  5JRA A;  3PHF 2;  3NYM A;  3AQB A;  1LPE A;  4JKV A;  4OIP F;  3O55 A;  4XEF A;  3K1H A;  4LDR A;  2XM0 A;  2YL3 A;  3JZ0 A;  2J9B A;  1TWC A;  4XPW A;  4AE4 A;  3DMD A;  3A9C A;  1FMW A;  2D5R B;  4JEA A;  2GWW A;  1C03 A;  4XEK A;  2JX0 A;  3RF3 A;  2MHR A;  2HUJ A;  1OR3 A;  1Q0G A;  3CEX A;  3FOO A;  3GEH A;  4WAB A;  5B1B C;  2R7W A;  1OXB A;  2J7P D;  2YWA A;  3C8G A;  1G4U S;  1YAR O;  3U3F A;  2P6V A;  3CAX A;  1A41 A;  2XLH A;  2Y3H A;  2YL7 A;  4P9F A;  3V5X A;  3W2W A;  4D4X A;  2ZXO A;  4ZLC A;  2A6E F;  4MW3 A;  4EWC A;  4NTB A;  3W8I A;  5AGF A;  5EHH A;  1L7C A;  2PX0 A;  2VCA A;  4JCH A;  2D4U A;  3LAY A;  2EPO A;  3K33 A;  4DOZ A;  1OCC C;  5L3Q A;  2LK4 A;  3SXZ A;  4PAC A;  5L0D A;  2HMQ A;  2J45 A;  2J7P A;  3L34 A;  4J7Y A;  3EZH A;  1GQA A;  2BE5 F;  2RD9 A;  4Z9I A;  1WAT A;  2NUP B;  3MX3 A;  1FMV A;  1E86 A;  4ONS A;  4N06 A;  1QQ3 A;  2XL4 A;  2C03 A;  3AGU A;  2NG1 A;  2GFH A;  4ULV A;  5BUO A;  2FGY A;  3C8Z A;  3AG4 C;  2R25 A;  4W8K A;  5DQT A;  2P7V A;  2R7O A;  3AJM A;  3O39 A;  4JE9 A;  4OD5 A;  2Q4F A;  4XTK A;  1S05 A;  3QVY A;  1ZHT A;  4YWQ A;  5DS6 A;  3S90 A;  3SP1 A;  1WWP A;  3UGP A;  2WZG A;  3DXJ F;  3I5Q A;  4J32 B;  1NU7 D;  1HW1 A;  2OJE D;  2DB4 A;  3FDQ A;  4OD4 A;  2A0B A;  3KYI A;  2HJM A;  2XLE A;  2YHS A;  2ZXW C;  4MW8 A;  1TKN A;  4QDL A;  2YVK A;  3ZQY A;  3ZTZ A;  3E70 C;  5KYU B;  1YYJ A;  4U5C E;  1YLM A;  2G62 A;  4YJW A;  1M2O A;  3LLI A;  5COF A;  2R7T A;  3Q7L A;  3DM5 A;  1KNY A;  4RBN A;  4PFO A;  4DRI B;  3IHU A;  2ZXP A;  2QY9 A;  4BG0 A;  3E9V A;  1O87 A;  2QNL A;  5E33 A;  3AG3 C;  4MS2 A;  3T6J A;  1NFN A;  2XS8 A;  1ZHZ A;  4K7B A;  2J9V A;  4PK4 A;  5CI9 A;  2J8W A;  3JYH A;  3KL4 A;  4LLE A;  3EZI A;  2NSF A;  3WOD F;  1HY5 A;  2AU5 A;  4YL3 A;  3TOL A;  4BJT A;  3RVY A;  3U9M A;  4CDA A;  4FAP B;  5T3W A;  3ZQV A;  1GM5 A;  4JCZ A;  1ZVZ A;  2JPU A;  1VK5 A;  1XZP A;  2ZPA A;  4FX5 A;  1QSP A;  3W4Y A;  4BJ6 C;  5L0F A;  2Z15 A;  2NSG A;  4CS7 A;  3FMS A;  2G3K A;  4Z9J A;  4NCQ A;  3VM6 A;  4WJ0 A;  3K66 A;  3L8J A;  5T3T A;  3SXY A;  4BJ5 A;  1H6G A;  5JSL A;  4PJM A;  5KYW B;  2W9Y A;  2XXA B;  2Y39 A;  4AX2 A;  3TOM A;  3RQF A;  2GA0 A;  5DS5 A;  3K1I A;  1TFO B;  3HNL A;  3JSZ A;  1OW8 A;  4EBJ A;  2QLA A;  2PFD A;  3WHN A;  2A1D D;  1HMO A;  1OW6 A;  1JRA A;  1T6I A;  2HMZ A;  3KYJ A;  2PP4 A;  2V26 A;  3DJU B;  3LS1 A;  4KBL A;  4RD9 A;  3U9J A;  3QTH A;  3S27 A;  2YKZ A;  2I8B A;  3ZC4 A;  1A0B A;  5A6B D;  4E18 A;  1MNE A;  2H7B A;  2VCB A;  1CGM E;  2WZL A;  1MND A;  3FAP B;  3DE8 A;  2CGE A;  2WL8 A;  4I3M A;  3NYJ A;  1C17 M;  4KNW A;  1RXQ A;  2EIN C;  1V55 C;  1Z5Z A;  2ICW G;  3DKA A;  3RQE A;  1ORY A;  3S28 A;  4HFK B;  2H7O A;  2F22 A;  1G8X A;  4CSA A;  2OOC A;  5A6B A;  1D1B A;  1O3U A;  4MND A;  3R7C A;  2WVN A;  5A69 A;  5KYY B;  1RKE B;  3EH2 A;  3GM1 A;  3T6G B;  2HV7 A;  2X0C A;  4PR9 A;  2IBF A;  3RW0 A;  4J7T A;  2OG2 A;  2L6F A;  4RDA A;  5BQG A;  2KYH A;  3JRM O;  3ZWI A;  4OIQ F;  4IAQ A;  1U89 A;  4N4W A;  3TUL A;  4DVZ A;  3OA1 A;  4IGG A;  3LES A;  5BQI A;  3I4U A;  2M4E A;  2Q00 A;  3EGX A;  4DBQ A;  4JTD B;  5A6K A;  3N0T A;  1RJ9 B;  2OKU A;  4O6N A;  2NUP A;  4CS8 C;  1PCX A;  2KGO A;  1UG7 A;  4CX9 A;  1Z63 A;  1IW7 F;  3B9Q A;  1E85 A;  4E0I A;  4LLC A;  3QW1 A;  2LSE A;  2GDC A;  3UMK A;  4YN0 B;  2KSF A;  1M6T A;  3K6B A;  2J0X A;  1JOG A;  4XWJ A;  3KMI A;  4CIH A;  1T9K A;  2DI3 A;  3DAF A;  3W8H A;  1PD0 A;  3IQC A;  1AEP A;  3NRH A;  4KC9 A;  1HE9 A;  3C7J A;  4MVS A;  3B0V C;  1JPN A;  4G7Z F;  1TWG A;  2R9R B;  1T6U A;  1V4A A;  2XLO A;  4JTA B;  3EG9 B;  3ZG1 A;  1EQ1 A;  3HTK C;  1W2W A;  2YLG A;  4IAO A;  4J30 B;  1OCR C;  1HE1 A;  3EH1 A;  3A11 A;  2R7R A;  4G7H F;  2I15 A;  4AK9 A;  3B71 A;  4IWB A;  2NUT A;  4MTO A;  2XRH A;  3ASN C;  4ANJ A;  4JC7 A;  3U5S A;  1A7E A;  3DZA A;  1YYX A;  4BEJ A;  4IRU A;  5GPG B;  1OKK D;  4EIY A;  1LE4 A;  1MQV A;  2L9J A;  3VRC A;  1ZW3 A;  2PNO A;  5JUA A;  4A2N B;  3PDM P;  5B1A C;  4C3D A;  1KTM A;  3F46 A;  4JJF A;  2R7U A;  1M2V B;  2XL8 A;  3LUT B;  3QMK A;  3UNG C;  1B68 A;  2W4B A;  2YL0 A;  2FAP B;  2XLD A;  2P0N A;  4WGY A;  3SXM A;  4E17 A;  1T01 A;  4AL0 A;  1LIH A;  2PX3 A;  3GAN A;  3ITF A;  4MVU A;  4L6R A;  3V7O A;  1RCP A;  1GGQ A;  1OKK A;  3EFO A;  3ZIB A;  1MMA A;  3TJ5 A;  3UMI A;  4LAC B;  4U9E A;  3TJ6 A;  2LP4 A;  1Z6A A;  5A6J A;  2HFI A;  1E2X A;  3GWL A;  4OIR F;  4Q4Z F;  2LFD A;  2YL1 A;  1VTM P;  4CJG A;  1FFT C;  1RMV A;  1BZ4 A;  3B0U X;  2AVK A;  1XZQ A;  2ASR A;  3TK0 A;  2H7V C;  1TWH A;  2WVQ A;  3DD7 A;  3JCU Q;  1T5O A;  2LD6 A;  3K7D A;  2KK1 A;  4EHP A;  3VF0 A;  2P1A A;  2XL6 A;  4NTF A;  1VLS A;  3S0X A;  1QVX A;  3U0C A;  1SR2 A;  3G50 A;  2HS5 A;  4G0H A;  4UDV A;  1ZZP A;  4ER9 A;  4C7O A;  5E3A A;  3SZR A;  1SZI A;  2HKV A;  2W4M A;  3GEE A;  5FCL A;  1LS1 A;  4LDK A;  3R2P A;  2EPK X;  3GM2 A;  1Q0M A;  3HJC A;  1YZC A;  2CDQ A;  4N6C A;  2XSE A;  3H65 A;  4M63 A;  3IQT A;  2C04 A;  4P6I C;  5EK0 A;  5TJ5 E;  5KYX A;  1E83 A;  1AUE A;  1ZHX A;  3S9O A;  5EGY A;  5L0C A;  1ZHY A;  4MVO A;  4U5G A;  3ASO C;  2WZF A;  2OU6 A;  1Z7Q c;  5HV9 A;  1RKE A;  1Y6D A;  1AVO B;  4JIO A;  2CNW D;  3AG2 C;  4W8P A;  1OQC A;  2Y3D A;  3TQO A;  4FWV A;  4GYT A;  1YZA A;  2KQ9 A;  2G3V A;  1DOW A;  3LLK A;  4JJG A;  1SF8 A;  2LQG A;  3RH3 A;  4BJ6 A;  1LKX A;  3C8G B;  1QLE C;  3C62 A;  4U9D A;  2L7A A;  1CPR A;  1R5I D;  4OIN F;  2LFF A;  1I4Y A;  1EA8 A;  1PD1 A;  3FVY A;  2EIJ C;  2CYD A;  1G5Z A;  3CZ6 A;  3O10 A;  2L6H A;  4GQH A;  4XPX A;  1YJG A;  3JSE O;  4Z9H A;  3IQ5 A;  4HEA J;  5F5H A;  1QKR A;  4H54 A;  4MTF A;  1CGO A;  4DRJ B;  2CNW A;  1FNT c;  1O5H A;  4DVY P;  3DE9 A;  1Q0F A;  3U8V A;  2VH3 A;  4I44 A;  4JRZ A;  2Q9A A;  3RFY A;  1F1M A;  2DYS C;  2WVO A;  3M79 A;  2MYS A;  5DQZ A;  4QI2 A;  3QVZ A;  4EUK B;  1LE2 A;  2IXM A;  2R7Q A;  3L8I A;  4XQ1 A;  3AG1 C;  1LS4 A;  2R05 A;  3MLG A;  1QZX A;  1VB5 A;  1RKC A;  3HLZ A;  3IQ6 A;  2EIL C;  5JLI A;  4U5H A;  5KYN A;  5AC5 A;  2R7X A;  1OCZ C;  4IB4 A;  3EG9 A;  4D4N A;  4DBR A;  3NG1 A;  1FTS A;  3EQL F;  1MMG A;  3U2M A;  1D0Z A;  2YRF A;  2KJG A;  3AGT A;  4YK5 A;  4K0D A;  5JT4 A;  2Y69 C;  3X1O A;  4N6H A;  1OR2 A;  5FZT A;  2AP3 A;  1TR2 A;  2OJQ A;  3DJN B;  5L0I A;  1GS9 A;  1WOL A;  4U5E E;  4LER A;  2BC5 A;  4C3E A;  1U0B B;  2IXN A;  2A68 F;  2YQY A;  4JEB A;  1NSG B;  4Q7C A;  5E3C A;  3T9O A;  3WAQ A;  5DS4 A;  2CCY A;  1H9T A;  3Q6M A;  1NLX A;  3SYN A;  3FOP A;  3OWT A;  2XM4 A;  1M2V A;  4PFP A;  3MYI A;  2VAS A;  4CDV A;  4JW1 A;  2YEV A;  1YAU O;  3DWW A;  1ORJ A;  4DXW A;  1L3P A;  4MQ9 F;  1Y4C A;  4YL0 A;  4YT2 A;  3HNK A;  2CW0 F;  1U6H A;  3EGD B;  2A0U A;  1KU2 A;  2YLD A;  3GM3 A;  2R7S A;  3KPH A;  4KI2 A;  2HSQ A;  3UR3 C;  3LJB A;  2HSB A;  2Q9C A;  2VCC A;  4CS8 A;  1SYQ A;  4MVZ A;  4NY3 A;  4CS9 C;  3SNH A;  5D91 A;  3RYL A;  2L6G A;  1A7V A;  1BBH A;  1D0X A;  3N2Z B;  4YT4 A;  3BEH A;  2PBE A;  3RQG A;  2HJ3 A;  2IM8 A;  4CJO A;  2VB6 A;  3F47 A;  3GOD A;  1PV3 A;  5AC4 A;  1OXK A;  4IJJ A;  1ZYR F;  3B0P A;  2M64 A;  1NFO A;  1LM3 B;  3LNM B;  2LIG A;  3NDB B;  2KW3 C;  4FES A;  4H4K C;  2J9W A;  4E7S A;  4XLP F;  3POV A;  2XS1 A;  2OCC C;  5KYU A;  3ZVR A;  2VC9 A;  2ZD9 A;  5JS5 A;  3RKO F;  1NG1 A;  2WB7 A;  2TMV P;  2W45 A;  2QUP A;  4KNV A;  3U2L A;  1VYI A;  3HNI A;  2YLI A;  2X51 A;  4CIP A;  2E87 A;  1NBB A;  2EPN A;  3C8G D;  3FHD A;  3G4Z A;  4NTA A;  1BDJ B;  2KC3 A;  1R4T A;  1BR2 A;  1Z23 A;  3C63 A;  3SXK A;  1VOM A;  3W2V A;  4U5F E;  3AQC A;  2EIK C;  5JVE A;  3H2U A;  1EKY A;  3Q7G A;  1FAP B;  3EPV A;  3NMK A;  2KNH A;  2QE9 A;  5D92 A;  3T6B A;  4BPM A;  3LS0 A;  1ZU4 A;  1BR1 A;  2IYL D;  1YA9 A;  5T1D B;  3ATP A;  2A69 F;  2FFH A;  1BR4 A;  1EI7 A;  2UUI A;  2HV6 A;  3G4X A;  2IXP A;  3M4B A;  1V54 C;  3EHN A;  4U5D E;  2XXA A;  2MWQ A;  3FAJ A;  3FXH A;  5KYW A;  1VYK A;  2Y3B A;  3MFN A;  2P61 A;  5DVW A;  4AL1 A;  4MTG A;  4DJ9 A;  3NMI A;  5F5F A;  3ZSU A;  2AWY A;  1QPU A;  2R03 A;  4PJL A;  4WGZ A;  3VYW A;  3S84 A;  4JTC B;  2JD3 A;  4C3B A;  1LVK A;  4B6I A;  4JZA A;  1WTY A;  5L0G A;  4CBE A;  1JR8 A;  3NKD A;  2RSE B;  4YT5 A;  5F28 E;  5COG A;  4MVQ A;  3EGX B;  5L0J A;  1TWA A;  4OIO F;  1ORS C;  1ZU5 A;  3QW0 A;  5L3V A;  3DI5 A;  3LNR A;  2Q9B A;  3NKE A;  4MVM A;  1OCO C;  1H7I A;  1S7Z A;  1MMN A;  1JAF A;  1Z3I X;  3S29 A;  3DAG A;  4JVS A;  3WG7 C;  2EPL X;  1ZHW A;  3JT1 A;  3IPM O;  1D1C A;  1K05 A;  3X2Q C;  1FFH A;  3BRJ A;  5KYY A;  1HW2 A;  4HE8 D;  4AE4 B;  2ZXR A;  3TD7 A;  4G7O F;  4EBB A;  4F4B A;  3KKB A;  1E84 A;  3UGO A;  1VMA A;  4O79 A;  4ULW A;  3SEO A;  4YT8 A;  1SMY F;  3AOU A;  3M15 A;  3HNJ A;  3MYF A;  2HZ8 A;  1G4W R;  3L0I A;  1K04 A;  1T6Q A;  2NUT B;  4PJJ A;  1XWJ A;  4DRH B;  3EGD A;  1RJ9 A;  2OEX A;  2Q3T A;  1M57 C;  3EHM A;  3H2V A;  2AWC A;  256B A;  4O7G A;  5COM A;  3MBG A;  4A4A A;  1J8Y F;  1NZE A;  3EJN A;  3PCV A;  2QTV A;  1K40 A;  3DM9 B;  4JUR I;  3M4C A;  3N24 A;  4LDQ A;  3GOR A;  4NC3 A;  4O6M A;  1I5N A;  3ABM C;  3RIP A;  3VAY A;  4EBK A;  5E2Q A;  4Q5S F;  1VLT A;  4GEH A;  3RVZ A;  2H8A A;  2UUH A;  3JTL O;  1JPJ A;  3M1C B;  4U5B E;  3UMH A;  1NU9 C;  3EFO B;  4HFF B;  2XLW A;  3US6 A;  1OW7 A;  4BJ5 C;  1YDI A;  2IOQ A;  4I1M A;  2B0J A;  4XEV A;  3U8P A;  1DOV A;  2XLV A;  3V5Y A;  3CQZ A;  3K1I C;  3CSK A;  3C18 A;  3JRT A;  1D1A A;  4YL1 A;  2R7V A;  2DYR C;  3JYY A;  5A6A A;  1C02 A;  1YA7 O;  4NQF A;  2EPM X;  2Q7R A;  1Q0K A;  3PMR A;  5JP7 A;  1IZM A;  3L1M A;  1JMW A;  2ETS A;  3GWN A;  1ZW2 A;  1YVI A;  3NYL A;  1LI7 A;  1TQG A;  3OEO A; 
#chains in the Genus database with same CATH homology
 3U2L A;  3U5S A;  3TK0 A;  1OQC A;  3W4Y A;  3TD7 A;  3LLK A;  4E0I A;  3U2M A;  1JR8 A;  3LLI A;  3R7C A;  2HJ3 A;  3O55 A;  4LDK A;  1JRA A;  3MBG A;  4E0H A;  3GWN A;  3GWL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...