1JRAA

Crystal structure of erv2p
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
106
structure length
106
Chain Sequence
DDKVKKEVGRASWKYFHTLLARFPDEPTPEEREKLHTFIGLYAELYPCGECSYHFVKLIEKYPVQTSSRTAAAMWGCHIHNKVNEYLKKDIYDCATILEDYDCGCS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A new FAD-binding fold and intersubunit disulfide shuttle in the thiol oxidase Erv2p.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Oxidoreductase
molecule keywords ERV2 PROTEIN, MITOCHONDRIAL
total genus 42
structure length 106
sequence length 106
chains with identical sequence B, C, D
ec nomenclature ec 1.8.3.2: Thiol oxidase.
pdb deposition date 2001-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04777 Evr1_Alr Erv1 / Alr family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.310 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) ERV/ALR sulfhydryl oxidase domain 1jraA00
1OQCA 3LLKA 4E0IA 2HJ3A 3GWLA 1JR8A 3R7CA 1JRAA 3O55A 3TK0A 3GWNA 3TD7A 3LLIA 3W4YA 3U2LA 4E0HA 3U5SA 3U2MA 3MBGA 4LDKA
chains in the Genus database with same CATH superfamily
2A6EF 2HKVA 5E3AA 4Q5SF 1JRAA 3EHMA 3QW1A 4W8KA 2IXNA 1G4WR 1FMWA 2HV7A 4XLPF 4UDVA 2R03A 3LS1A 1MMDA 4WGYA 1ZHXA 3WG7C 3HNIA 4YK5A 4XWJA 4B6IA 1RKEB 3RVYA 5DVWA 1CPQA 4U5FE 1H9GA 2HSQA 3EH2A 5F5FA 1HW1A 2J9BA 1A41A 2J45A 4JJGA 4CIHA 3KMIA 3KKBA 1PD1A 2ICWG 2BL2A 1VTMP 3N24A 3NKEA 3W4YA 2XLOA 4DRJB 1FFHA 1RKEA 3JZ0A 5B1BC 4DBRA 1C03A 1LS1A 1OKKD 1V54C 3JRTA 4N6HA 2NSFA 2H7OA 1YAUO 4IARA 1LE4A 2LFDA 2P61A 3FDQA 1L3PA 3B0PA 3UGPA 3FHDA 3O10A 1K40A 3DM9B 3KYIA 1T9KA 4BJ5C 4DOZA 5CI8A 5FCLA 3T6JA 3TOLA 3JSEO 2PF4E 3M4BA 5BQIA 1CGME 3LNMB 3WHNA 2Q9BA 3L0IA 2YLGA 5L0GA 2KW3C 4JE9A 3NKDA 2A1DD 3OA1A 1OW7A 1FTSA 2A6HF 4LDRA 4I1OB 3SP1A 1KU2A 3TJ6A 3FVYA 1OW8A 2XM0A 3ASOC 4RBNA 5A6BD 2B0JA 3K6BA 3HTKC 2V3CC 2EIKC 1SZIA 2D5RB 2PX3A 1S05A 4RD9A 3X1OA 4CS9A 2EPMX 1VLTA 2CYDA 2WZLA 1MNDA 3AQBA 1QVXA 3OEOA 1Z7Qc 3ZSUA 3EG9A 1GQAA 4LDKA 4EKWA 3N0TA 4CDAA 3JYHA 3C8GD 3T6GB 5FZTA 3F46A 3KPHA 3E9VA 3NMIA 4GEHA 5D92A 2Q3TA 2YLDA 5L0JA 4OIOF 5AC4A 3CSKA 5A69A 1LIHA 2AWCA 5JS5A 2DGJA 1SR2A 3GODA 2M64A 4YT4A 5TJ5E 4P6IC 2W4BA 3AJMA 3SXKA 3U9JA 2IYLD 3DJNB 1JMWA 5KYUA 4I44A 2YL7A 3PDMP 1ZW2A 3S9OA 4U9DA 4JTAB 4XPYA 1JAFA 2VCBA 3LJBA 1V55C 3LAYA 3SYNA 1NZEA 4XEVA 1BBHA 4YL0A 5AC5A 3RVZA 3B29A 4C3EA 2L81A 3K1IA 3RH3A 1OCCC 1ZW3A 4LLEA 5F5HA 1OCZC 4ONSA 3RQFA 3TQOA 4AK9A 2TMVP 1ORYA 4U5CE 3GWLA 1JR8A 3MYIA 1G4US 1G5ZA 2NUPB 4G78A 2KNHA 3NYJA 3JYYA 1WOLA 3LLIA 3K1IC 4LDQA 4MTOA 1TWGA 3AGUA 2OEXA 1NU7D 2NG1A 4PJMA 1RCPA 2MWQA 1EKYA 3LLKA 3J06A 1LKXA 3C18A 2FFHA 2W9YA 1I4ZA 2O9XA 2YQYA 3U8VA 5COGA 1GM5A 3W8HA 2NUPA 2KQ9A 3ABKC 1EQ1A 2KJGA 3KL4A 1AVOB 3GM1A 2PP4A 1OR2A 1VLSA 2J0WA 1K04A 1SF8A 3EPVA 3H65A 4U5EE 4IAQA 1AEPA 3LESA 3U2LA 4XTKA 3C8ZA 1NLXA 3S90A 4G7ZF 4JEAA 4E17A 2YL3A 1FR0A 2YHSA 3QVYA 1KNYA 2FGYA 2NSGA 3W8IA 2R7VA 2MYSA 3K66A 1M57C 4LLCA 4HFKB 1TWAA 4K1OA 1TWHA 2D4UA 4D4XA 3K1HA 5BQGA 4YT8A 1LS4A 1ZU5A 3JRMO 4CJOA 2KGOA 1R4TA 3JTLO 4JC7A 3TK0A 1E83A 4EHPA 2A69F 3DI5A 3AGTA 4O6YA 1L7CA 2J9WA 1ZVZA 3A9CA 1M2OA 3OWTA 5F28E 3B0VC 2BE5F 3VF0A 1E84A 3E70C 1CGOA 1OXKA 1BR2A 1N1CA 2R9RB 1TQGA 3NYLA 1ZHYA 2HUJA 2XXAA 1MMAA 2QUPA 1C02A 2OU6A 1FFTC 3SXYA 2Z15A 4NY3A 4U5BE 2HMQA 4DJ9A 1ZHWA 4KNWA 4A2NB 4ER9A 4HE8D 3TOMA 1LVKA 3HKKA 3M4CA 4XEKA 1I4YA 3NYMA 3I4UA 1A0BA 3AG2C 2CW0F 2VCCA 1TWCA 3RIPA 2L9JA 1IZMA 2NUTB 4E18A 1GS9A 1VYIA 2R7TA 4AE4A 2LIGA 2OJQA 3N2ZB 4JKVA 1MMGA 3RF3A 3S27A 4BG0A 3U5SA 1BDJB 3EQLF 4JZAA 4J7TA 3IQ5A 5DQTA 3EH1A 3SEOA 1CPRA 1D0YA 4LERA 2Q00A 2OQMA 5DS4A 4PJJA 2KC3A 4Z9HA 1Q0GA 1M56C 1Z3IX 3R2PA 1T6QA 2HZ8A 4PJLA 3ZTMA 4ZLCA 1WGWA 1J8MF 4ULVA 4QI0A 2R05A 4JCHA 3O6XA 2WZGA 3AQCA 3S28A 4YN0B 3C62A 4XLNF 2IXPA 1OCOC 2LFFA 5JLIA 1JOGA 1G8XA 2AP3A 3CAXA 3C8GA 4IGGA 4GQHA 4XEFA 3RYLA 4BJ5A 2J7PA 4IB4A 5L3VA 3EG9B 4E7ZA 2OKUA 2LK4A 5JSLA 4CS8A 3HLZA 2QY9A 3SXZA 2CGEA 2XLEA 2JX0A 4MW8A 2YWAA 3DZAA 4A4AA 3RQEA 1D1BA 4EBJA 1M2VA 1YZCA 4MQ9F 2VCAA 4PFOA 3FAPB 2I15A 3HNKA 5CI9A 3VM6A 2NUTA 4FAPB 3AG1C 3LS0A 1D0ZA 5T1DB 3RW0A 2KSFA 5D91A 4FX5A 2P1AA 2EIJC 2ZXRA 1Q0FA 3EHNA 3QMKA 3TD7A 4IAOA 2A0UA 5L0CA 4JRZA 1A7VA 4BEMJ 3DMDA 1Q0DA 1MMNA 4KI2A 4JW1A 3ASNC 3IPMO 2AVKA 4PK4A 3GM2A 3ZQVA 1Z23A 1RMVA 1QQ3A 1I5NA 4CS8C 2RSEB 2R7QA 3LEOA 3EGDA 2YL1A 2ETSA 1QSPA 1DOWA 5E2QA 3M79A 4E0HA 2J0XA 1A7EA 1C17M 3MYFA 3I5PA 3JSZA 1U89A 2J7PD 4NTAA 1KTMA 1BR4A 2YKZA 2HFIA 5A6JA 1O87A 4P9TA 4YT2A 4OD5A 4QI2A 4EUKB 2OJED 2H7BA 2W4MA 4CX9A 4MVOA 4MTGA 3ABLC 4IRUA 3FAJA 2MHRA 3TJ5A 4OIPF 5COFA 1JPJA 1GGQA 2DYRC 2EILC 3FOPA 3V5YA 2R7WA 5KYYA 2H7VC 3JCUQ 4JJFA 1VK5A 4MVUA 4AL0A 2WZFA 3U2MA 4WJ0A 4F4BA 3L1MA 5A6BA 3BEHA 4QDLA 4OIRF 5JT4A 4H4KC 4O79A 3DKAA 1HY5A 3S84A 2R25A 2BC5A 2M4EA 1OXBA 2Q9CA 4XPXA 2J8WA 2XLHA 4KNVA 5DQZA 3G50A 3ZVRA 256BA 1YZAA 3CZ6A 3EZIA 2V26A 3Q6MA 1V4AA 1H6GA 2F22A 2GFHA 3ZDLA 2XLDA 4YJWA 1LPEA 3MBGA 4CS9C 1WASA 3JT1A 3K33A 3NRHA 1E86A 5DS5A 2Q4FA 3IQTA 3GEEA 3ECSA 3I5QA 4WGZA 5DS6A 4O6NA 2CNWA 2E87A 1OKKA 2IOQA 1VOMA 3PCVA 4LACB 5KYWB 4OIQF 2X51A 4DRIB 2Y3DA 1NSGB 4G0HA 3M15A 5JUAA 1LE2A 3Q7LA 2WB7A 1T5OA 3DXJF 2WL8A 3DE9A 4O6MA 3VYWA 1PCXA 1HMDA 1YARO 3UNGC 2PNOA 2YEVA 1T01A 2I8BA 2XLMA 4MNDA 1SMYF 2DB4A 2XL4A 4O7GA 5B3SC 4EIYA 1FMVA 4NQFA 2AWYA 2FAPB 1BR1A 1UG7A 2IXOA 3KYJA 3PMRA 4RDAA 3B0UX 1QKRA 2LCHA 1LI5A 3BRJA 3M1CB 3U0CA 1OCRC 1V74B 4MVRA 3ZTZA 4MVQA 2WVQA 3MX3A 2C03A 5KYXB 1HE1A 5JRAA 2JD3A 2Q9AA 4ANJA 3RKOF 5KYWA 2IXMA 2DI3A 3ABMC 2UUHA 2XL8A 3H2VA 3QTHA 4J32B 2EPLX 1S7ZA 5BQHA 4WABA 3NDBB 3IQCA 4GYTA 2L6GA 2Y69C 2OCCC 1D1AA 2B0HA 3MFNA 4K0DA 4J7YA 3U3FA 4CJGA 2J9VA 3V5ZA 2YVKA 3L34A 3LNRA 5DLJA 3H2UA 3NMKA 1NU9C 1NG1A 3AG4C 3L8IA 1Z63A 3ZG1A 2UUIA 4EWCA 5L3QA 3T4RA 3DJUB 5EGYA 2GA0A 2XS1A 3EZHA 4MVSA 1YYXA 3LUTB 2WVOA 4PR9A 4U9EA 3RQGA 1Q0KA 1IW7F 5CIVA 4JURI 3GANA 3ZWIA 3Q7GA 2PX0A 3HJCA 2RD9A 4CIPA 5HV9A 1QZXA 3C63A 1ORSC 3K7DA 4Z9IA 4Z9JA 3KH2A 3FMSA 4I1MA 2VC9A 4NC3A 1YA9A 2EPNA 1EI7A 1M6TA 1ZU4A 3LEVA 3G4XA 4DRHB 1Z5ZA 2C04A 1O5HA 1Y4CA 4D4NA 2CCYA 2X0CA 4L6RA 3ZC4A 2Q7RA 2XXAB 1BZ4A 5L0FA 2P6VA 1YLMA 4HFFB 2GAQA 4DXWA 3SNHA 5KYUB 2VASA 2XM4A 4BJ6C 4IJJA 3L8JA 1WWPA 2XLWA 4NTBA 2XSEA 3IHUA 4PJNA 1LM3B 2QLAA 4PFPA 3U3BA 2EINC 4G7OF 4MS2A 3SZRA 5E33A 1H7IA 1NFNA 1O3UA 2PFDA 3X2QC 1PD0A 4E7SA 2EPKX 1FAPB 2CDQA 1SYQA 1F1MA 2XRHA 3FOOA 3DE8A 1VYKA 4H54A 2OEVA 1TKNA 2HV6A 1T6IA 3T9OA 1E85A 1ZZPA 4C3DA 3CQZA 2R7XA 4OINF 2QE9A 4C7OA 1VMAA 4K7BA 4U5HA 3V7OA 3AOUA 2YZSA 3US6A 3O39A 3POVA 4CSAC 4ZLDA 2P0NA 1WATA 4YT5A 2XS8A 1RJ9A 1XZQA 2R7SA 1ORJA 1W2WA 3AG3C 3DD7A 3GEIA 4EBKA 1XZPA 4Q4ZF 4MVZA 4NTFA 4BJTA 5IY5C 4JVSA 4E0IA 2J9UA 5BUOA 3ZIBA 1RJ9B 3Q6NA 1H9TA 1ZHZA 4R32A 5E3CA 3MLGA 1M2VB 2KK1A 1K05A 2LD6A 2H8AA 4JIOA 4Q7CA 4CDYA 2R7UA 1RKCA 5KYYB 2GWWA 3HNJA 1TFOB 3UGOA 1OQCA 4MW3A 1YYJA 2ZXPA 3G4ZA 1LI7A 1HE9A 5KYNA 4J30B 1YJGA 3ZQYA 5EK0A 5A6AA 1QPUA 2HMZA 5JVEA 1VB5A 2Y3BA 4YL1A 1Y6DA 3GWNA 4ULWA 5B3IA 3EFOA 3QZCA 4AL1A 4C3BA 3QVZA 2J46A 4XQ1A 2HJ3A 3HNLA 3QW0A 1R5ID 2EPOA 1A7DA 3A11A 2DYSC 3R7CA 2R7RA 1NBBA 4JEBA 4M63A 2OG2A 2LSEA 2VH3A 1XWJA 4HEAJ 2ASRA 2L7AA 1TR2A 2ZXWC 5T3WA 4FWVA 3S29A 5L0DA 4FESA 2A68F 4P9FA 1YA7O 3C8GB 3UMIA 4AX2A 4CDVA 4KC9A 2QNLA 4U5GA 5K0IA 2HJMA 3DAGA 1NFOA 2Y39A 3NG1A 3EJNA 4JTCB 4MTFA 1DOVA 1ZYRF 4BPMA 5L0HA 4PACA 1Z6AA 2HS5A 5A6KA 4YWQA 3UR3C 4IWBA 1RXQA 2WVNA 4DBQA 4DVZA 1HW2A 1TFKB 2G62A 3NMJA 3PHF2 4N6CA 1UFBA 3B9QA 1OW6A 4XPWA 2IBFA 2KYHA 3CEXA 5EHHA 1YVIA 2AU5A 4W8PA 2HSBA 4CBEA 1JPNA 1U6HA 2L6HA 2EIMC 3WAQA 4BJ6A 5KYXA 4JTDB 3C7JA 3GEHA 3DAFA 5T3TA 4EBBA 3TULA 2R02A 2G3KA 1APCA 5AGFA 2IM8A 3ATPA 3IEEA 2VB6A 3O55A 4OD4A 1YDIA 2LP4A 3SXMA 1FNTc 4I3MA 2ZD9A 2W45A 5HSWA 2Y3HA 2OOCA 1OR3A 1D1CA 2JPUA 4AE4B 4BJ1A 4YL3A 2ZPAA 4U5DE 3EGXA 2LQGA 1WTYA 1ZHTA 2A0BA 3UMKA 3VAYA 4BEJA 5L0IA 4CS7A 4CSAA 2QTVA 3W2WA 3V5XA 2PBEA 1E2XA 3F47A 3W2VA 2XLVA 1Q0MA 3EGDB 4G7HF 3DWWA 2L6FA 3B71A 4NCQA 3EFOB 3VRCA 4DVYP 3GM3A 1T6UA 2YLIA 3RFYA 3U9MA 3T6BA 4C7OB 4X0RA 2CNWD 2NPUA 1ST6A 1PV3A 5GPGB 5COMA 2Y3GA 1D0XA 2XL6A 1J8YF 1B68A 2YRFA 3S0XA 3GORA 5B1AC 1QLEC 2G3VA 1MQVA 2R7OA 3DM5A 1WN0A 1HMOA 5JP7A 3U8PA 4N4WA 1EA8A 2GDCA 1MNEA 1AUEA 3UMHA 3WODF 4JCZA 4KBLA 3FXHA 3EGXB 3IQ6A 4N06A 3ITFA 4MVMA 2ZXOA 2P7VA 1CGNA 2YL0A 1U0BB
chains in the Genus database with same CATH topology
1OQCA 3LLKA 4E0IA 2HJ3A 3GWLA 1JR8A 3R7CA 1JRAA 3O55A 3TK0A 3GWNA 3TD7A 3LLIA 3W4YA 3U2LA 4E0HA 3U5SA 3U2MA 3MBGA 4LDKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OQC A;  3LLK A;  4E0I A;  2HJ3 A;  3GWL A;  1JR8 A;  3R7C A;  1JRA A;  3O55 A;  3TK0 A;  3GWN A;  3TD7 A;  3LLI A;  3W4Y A;  3U2L A;  4E0H A;  3U5S A;  3U2M A;  3MBG A;  4LDK A; 
#chains in the Genus database with same CATH topology
 2A6E F;  2HKV A;  5E3A A;  4Q5S F;  1JRA A;  3EHM A;  3QW1 A;  4W8K A;  2IXN A;  1G4W R;  1FMW A;  2HV7 A;  4XLP F;  4UDV A;  2R03 A;  3LS1 A;  1MMD A;  4WGY A;  1ZHX A;  3WG7 C;  3HNI A;  4YK5 A;  4XWJ A;  4B6I A;  1RKE B;  3RVY A;  5DVW A;  1CPQ A;  4U5F E;  1H9G A;  2HSQ A;  3EH2 A;  5F5F A;  1HW1 A;  2J9B A;  1A41 A;  2J45 A;  4JJG A;  4CIH A;  3KMI A;  3KKB A;  1PD1 A;  2ICW G;  2BL2 A;  1VTM P;  3N24 A;  3NKE A;  3W4Y A;  2XLO A;  4DRJ B;  1FFH A;  1RKE A;  3JZ0 A;  5B1B C;  4DBR A;  1C03 A;  1LS1 A;  1OKK D;  1V54 C;  3JRT A;  4N6H A;  2NSF A;  2H7O A;  1YAU O;  4IAR A;  1LE4 A;  2LFD A;  2P61 A;  3FDQ A;  1L3P A;  3B0P A;  3UGP A;  3FHD A;  3O10 A;  1K40 A;  3DM9 B;  3KYI A;  1T9K A;  4BJ5 C;  4DOZ A;  5CI8 A;  5FCL A;  3T6J A;  3TOL A;  3JSE O;  2PF4 E;  3M4B A;  5BQI A;  1CGM E;  3LNM B;  3WHN A;  2Q9B A;  3L0I A;  2YLG A;  5L0G A;  2KW3 C;  4JE9 A;  3NKD A;  2A1D D;  3OA1 A;  1OW7 A;  1FTS A;  2A6H F;  4LDR A;  4I1O B;  3SP1 A;  1KU2 A;  3TJ6 A;  3FVY A;  1OW8 A;  2XM0 A;  3ASO C;  4RBN A;  5A6B D;  2B0J A;  3K6B A;  3HTK C;  2V3C C;  2EIK C;  1SZI A;  2D5R B;  2PX3 A;  1S05 A;  4RD9 A;  3X1O A;  4CS9 A;  2EPM X;  1VLT A;  2CYD A;  2WZL A;  1MND A;  3AQB A;  1QVX A;  3OEO A;  1Z7Q c;  3ZSU A;  3EG9 A;  1GQA A;  4LDK A;  4EKW A;  3N0T A;  4CDA A;  3JYH A;  3C8G D;  3T6G B;  5FZT A;  3F46 A;  3KPH A;  3E9V A;  3NMI A;  4GEH A;  5D92 A;  2Q3T A;  2YLD A;  5L0J A;  4OIO F;  5AC4 A;  3CSK A;  5A69 A;  1LIH A;  2AWC A;  5JS5 A;  2DGJ A;  1SR2 A;  3GOD A;  2M64 A;  4YT4 A;  5TJ5 E;  4P6I C;  2W4B A;  3AJM A;  3SXK A;  3U9J A;  2IYL D;  3DJN B;  1JMW A;  5KYU A;  4I44 A;  2YL7 A;  3PDM P;  1ZW2 A;  3S9O A;  4U9D A;  4JTA B;  4XPY A;  1JAF A;  2VCB A;  3LJB A;  1V55 C;  3LAY A;  3SYN A;  1NZE A;  4XEV A;  1BBH A;  4YL0 A;  5AC5 A;  3RVZ A;  3B29 A;  4C3E A;  2L81 A;  3K1I A;  3RH3 A;  1OCC C;  1ZW3 A;  4LLE A;  5F5H A;  1OCZ C;  4ONS A;  3RQF A;  3TQO A;  4AK9 A;  2TMV P;  1ORY A;  4U5C E;  3GWL A;  1JR8 A;  3MYI A;  1G4U S;  1G5Z A;  2NUP B;  4G78 A;  2KNH A;  3NYJ A;  3JYY A;  1WOL A;  3LLI A;  3K1I C;  4LDQ A;  4MTO A;  1TWG A;  3AGU A;  2OEX A;  1NU7 D;  2NG1 A;  4PJM A;  1RCP A;  2MWQ A;  1EKY A;  3LLK A;  3J06 A;  1LKX A;  3C18 A;  2FFH A;  2W9Y A;  1I4Z A;  2O9X A;  2YQY A;  3U8V A;  5COG A;  1GM5 A;  3W8H A;  2NUP A;  2KQ9 A;  3ABK C;  1EQ1 A;  2KJG A;  3KL4 A;  1AVO B;  3GM1 A;  2PP4 A;  1OR2 A;  1VLS A;  2J0W A;  1K04 A;  1SF8 A;  3EPV A;  3H65 A;  4U5E E;  4IAQ A;  1AEP A;  3LES A;  3U2L A;  4XTK A;  3C8Z A;  1NLX A;  3S90 A;  4G7Z F;  4JEA A;  4E17 A;  2YL3 A;  1FR0 A;  2YHS A;  3QVY A;  1KNY A;  2FGY A;  2NSG A;  3W8I A;  2R7V A;  2MYS A;  3K66 A;  1M57 C;  4LLC A;  4HFK B;  1TWA A;  4K1O A;  1TWH A;  2D4U A;  4D4X A;  3K1H A;  5BQG A;  4YT8 A;  1LS4 A;  1ZU5 A;  3JRM O;  4CJO A;  2KGO A;  1R4T A;  3JTL O;  4JC7 A;  3TK0 A;  1E83 A;  4EHP A;  2A69 F;  3DI5 A;  3AGT A;  4O6Y A;  1L7C A;  2J9W A;  1ZVZ A;  3A9C A;  1M2O A;  3OWT A;  5F28 E;  3B0V C;  2BE5 F;  3VF0 A;  1E84 A;  3E70 C;  1CGO A;  1OXK A;  1BR2 A;  1N1C A;  2R9R B;  1TQG A;  3NYL A;  1ZHY A;  2HUJ A;  2XXA A;  1MMA A;  2QUP A;  1C02 A;  2OU6 A;  1FFT C;  3SXY A;  2Z15 A;  4NY3 A;  4U5B E;  2HMQ A;  4DJ9 A;  1ZHW A;  4KNW A;  4A2N B;  4ER9 A;  4HE8 D;  3TOM A;  1LVK A;  3HKK A;  3M4C A;  4XEK A;  1I4Y A;  3NYM A;  3I4U A;  1A0B A;  3AG2 C;  2CW0 F;  2VCC A;  1TWC A;  3RIP A;  2L9J A;  1IZM A;  2NUT B;  4E18 A;  1GS9 A;  1VYI A;  2R7T A;  4AE4 A;  2LIG A;  2OJQ A;  3N2Z B;  4JKV A;  1MMG A;  3RF3 A;  3S27 A;  4BG0 A;  3U5S A;  1BDJ B;  3EQL F;  4JZA A;  4J7T A;  3IQ5 A;  5DQT A;  3EH1 A;  3SEO A;  1CPR A;  1D0Y A;  4LER A;  2Q00 A;  2OQM A;  5DS4 A;  4PJJ A;  2KC3 A;  4Z9H A;  1Q0G A;  1M56 C;  1Z3I X;  3R2P A;  1T6Q A;  2HZ8 A;  4PJL A;  3ZTM A;  4ZLC A;  1WGW A;  1J8M F;  4ULV A;  4QI0 A;  2R05 A;  4JCH A;  3O6X A;  2WZG A;  3AQC A;  3S28 A;  4YN0 B;  3C62 A;  4XLN F;  2IXP A;  1OCO C;  2LFF A;  5JLI A;  1JOG A;  1G8X A;  2AP3 A;  3CAX A;  3C8G A;  4IGG A;  4GQH A;  4XEF A;  3RYL A;  4BJ5 A;  2J7P A;  4IB4 A;  5L3V A;  3EG9 B;  4E7Z A;  2OKU A;  2LK4 A;  5JSL A;  4CS8 A;  3HLZ A;  2QY9 A;  3SXZ A;  2CGE A;  2XLE A;  2JX0 A;  4MW8 A;  2YWA A;  3DZA A;  4A4A A;  3RQE A;  1D1B A;  4EBJ A;  1M2V A;  1YZC A;  4MQ9 F;  2VCA A;  4PFO A;  3FAP B;  2I15 A;  3HNK A;  5CI9 A;  3VM6 A;  2NUT A;  4FAP B;  3AG1 C;  3LS0 A;  1D0Z A;  5T1D B;  3RW0 A;  2KSF A;  5D91 A;  4FX5 A;  2P1A A;  2EIJ C;  2ZXR A;  1Q0F A;  3EHN A;  3QMK A;  3TD7 A;  4IAO A;  2A0U A;  5L0C A;  4JRZ A;  1A7V A;  4BEM J;  3DMD A;  1Q0D A;  1MMN A;  4KI2 A;  4JW1 A;  3ASN C;  3IPM O;  2AVK A;  4PK4 A;  3GM2 A;  3ZQV A;  1Z23 A;  1RMV A;  1QQ3 A;  1I5N A;  4CS8 C;  2RSE B;  2R7Q A;  3LEO A;  3EGD A;  2YL1 A;  2ETS A;  1QSP A;  1DOW A;  5E2Q A;  3M79 A;  4E0H A;  2J0X A;  1A7E A;  1C17 M;  3MYF A;  3I5P A;  3JSZ A;  1U89 A;  2J7P D;  4NTA A;  1KTM A;  1BR4 A;  2YKZ A;  2HFI A;  5A6J A;  1O87 A;  4P9T A;  4YT2 A;  4OD5 A;  4QI2 A;  4EUK B;  2OJE D;  2H7B A;  2W4M A;  4CX9 A;  4MVO A;  4MTG A;  3ABL C;  4IRU A;  3FAJ A;  2MHR A;  3TJ5 A;  4OIP F;  5COF A;  1JPJ A;  1GGQ A;  2DYR C;  2EIL C;  3FOP A;  3V5Y A;  2R7W A;  5KYY A;  2H7V C;  3JCU Q;  4JJF A;  1VK5 A;  4MVU A;  4AL0 A;  2WZF A;  3U2M A;  4WJ0 A;  4F4B A;  3L1M A;  5A6B A;  3BEH A;  4QDL A;  4OIR F;  5JT4 A;  4H4K C;  4O79 A;  3DKA A;  1HY5 A;  3S84 A;  2R25 A;  2BC5 A;  2M4E A;  1OXB A;  2Q9C A;  4XPX A;  2J8W A;  2XLH A;  4KNV A;  5DQZ A;  3G50 A;  3ZVR A;  256B A;  1YZA A;  3CZ6 A;  3EZI A;  2V26 A;  3Q6M A;  1V4A A;  1H6G A;  2F22 A;  2GFH A;  3ZDL A;  2XLD A;  4YJW A;  1LPE A;  3MBG A;  4CS9 C;  1WAS A;  3JT1 A;  3K33 A;  3NRH A;  1E86 A;  5DS5 A;  2Q4F A;  3IQT A;  3GEE A;  3ECS A;  3I5Q A;  4WGZ A;  5DS6 A;  4O6N A;  2CNW A;  2E87 A;  1OKK A;  2IOQ A;  1VOM A;  3PCV A;  4LAC B;  5KYW B;  4OIQ F;  2X51 A;  4DRI B;  2Y3D A;  1NSG B;  4G0H A;  3M15 A;  5JUA A;  1LE2 A;  3Q7L A;  2WB7 A;  1T5O A;  3DXJ F;  2WL8 A;  3DE9 A;  4O6M A;  3VYW A;  1PCX A;  1HMD A;  1YAR O;  3UNG C;  2PNO A;  2YEV A;  1T01 A;  2I8B A;  2XLM A;  4MND A;  1SMY F;  2DB4 A;  2XL4 A;  4O7G A;  5B3S C;  4EIY A;  1FMV A;  4NQF A;  2AWY A;  2FAP B;  1BR1 A;  1UG7 A;  2IXO A;  3KYJ A;  3PMR A;  4RDA A;  3B0U X;  1QKR A;  2LCH A;  1LI5 A;  3BRJ A;  3M1C B;  3U0C A;  1OCR C;  1V74 B;  4MVR A;  3ZTZ A;  4MVQ A;  2WVQ A;  3MX3 A;  2C03 A;  5KYX B;  1HE1 A;  5JRA A;  2JD3 A;  2Q9A A;  4ANJ A;  3RKO F;  5KYW A;  2IXM A;  2DI3 A;  3ABM C;  2UUH A;  2XL8 A;  3H2V A;  3QTH A;  4J32 B;  2EPL X;  1S7Z A;  5BQH A;  4WAB A;  3NDB B;  3IQC A;  4GYT A;  2L6G A;  2Y69 C;  2OCC C;  1D1A A;  2B0H A;  3MFN A;  4K0D A;  4J7Y A;  3U3F A;  4CJG A;  2J9V A;  3V5Z A;  2YVK A;  3L34 A;  3LNR A;  5DLJ A;  3H2U A;  3NMK A;  1NU9 C;  1NG1 A;  3AG4 C;  3L8I A;  1Z63 A;  3ZG1 A;  2UUI A;  4EWC A;  5L3Q A;  3T4R A;  3DJU B;  5EGY A;  2GA0 A;  2XS1 A;  3EZH A;  4MVS A;  1YYX A;  3LUT B;  2WVO A;  4PR9 A;  4U9E A;  3RQG A;  1Q0K A;  1IW7 F;  5CIV A;  4JUR I;  3GAN A;  3ZWI A;  3Q7G A;  2PX0 A;  3HJC A;  2RD9 A;  4CIP A;  5HV9 A;  1QZX A;  3C63 A;  1ORS C;  3K7D A;  4Z9I A;  4Z9J A;  3KH2 A;  3FMS A;  4I1M A;  2VC9 A;  4NC3 A;  1YA9 A;  2EPN A;  1EI7 A;  1M6T A;  1ZU4 A;  3LEV A;  3G4X A;  4DRH B;  1Z5Z A;  2C04 A;  1O5H A;  1Y4C A;  4D4N A;  2CCY A;  2X0C A;  4L6R A;  3ZC4 A;  2Q7R A;  2XXA B;  1BZ4 A;  5L0F A;  2P6V A;  1YLM A;  4HFF B;  2GAQ A;  4DXW A;  3SNH A;  5KYU B;  2VAS A;  2XM4 A;  4BJ6 C;  4IJJ A;  3L8J A;  1WWP A;  2XLW A;  4NTB A;  2XSE A;  3IHU A;  4PJN A;  1LM3 B;  2QLA A;  4PFP A;  3U3B A;  2EIN C;  4G7O F;  4MS2 A;  3SZR A;  5E33 A;  1H7I A;  1NFN A;  1O3U A;  2PFD A;  3X2Q C;  1PD0 A;  4E7S A;  2EPK X;  1FAP B;  2CDQ A;  1SYQ A;  1F1M A;  2XRH A;  3FOO A;  3DE8 A;  1VYK A;  4H54 A;  2OEV A;  1TKN A;  2HV6 A;  1T6I A;  3T9O A;  1E85 A;  1ZZP A;  4C3D A;  3CQZ A;  2R7X A;  4OIN F;  2QE9 A;  4C7O A;  1VMA A;  4K7B A;  4U5H A;  3V7O A;  3AOU A;  2YZS A;  3US6 A;  3O39 A;  3POV A;  4CSA C;  4ZLD A;  2P0N A;  1WAT A;  4YT5 A;  2XS8 A;  1RJ9 A;  1XZQ A;  2R7S A;  1ORJ A;  1W2W A;  3AG3 C;  3DD7 A;  3GEI A;  4EBK A;  1XZP A;  4Q4Z F;  4MVZ A;  4NTF A;  4BJT A;  5IY5 C;  4JVS A;  4E0I A;  2J9U A;  5BUO A;  3ZIB A;  1RJ9 B;  3Q6N A;  1H9T A;  1ZHZ A;  4R32 A;  5E3C A;  3MLG A;  1M2V B;  2KK1 A;  1K05 A;  2LD6 A;  2H8A A;  4JIO A;  4Q7C A;  4CDY A;  2R7U A;  1RKC A;  5KYY B;  2GWW A;  3HNJ A;  1TFO B;  3UGO A;  1OQC A;  4MW3 A;  1YYJ A;  2ZXP A;  3G4Z A;  1LI7 A;  1HE9 A;  5KYN A;  4J30 B;  1YJG A;  3ZQY A;  5EK0 A;  5A6A A;  1QPU A;  2HMZ A;  5JVE A;  1VB5 A;  2Y3B A;  4YL1 A;  1Y6D A;  3GWN A;  4ULW A;  5B3I A;  3EFO A;  3QZC A;  4AL1 A;  4C3B A;  3QVZ A;  2J46 A;  4XQ1 A;  2HJ3 A;  3HNL A;  3QW0 A;  1R5I D;  2EPO A;  1A7D A;  3A11 A;  2DYS C;  3R7C A;  2R7R A;  1NBB A;  4JEB A;  4M63 A;  2OG2 A;  2LSE A;  2VH3 A;  1XWJ A;  4HEA J;  2ASR A;  2L7A A;  1TR2 A;  2ZXW C;  5T3W A;  4FWV A;  3S29 A;  5L0D A;  4FES A;  2A68 F;  4P9F A;  1YA7 O;  3C8G B;  3UMI A;  4AX2 A;  4CDV A;  4KC9 A;  2QNL A;  4U5G A;  5K0I A;  2HJM A;  3DAG A;  1NFO A;  2Y39 A;  3NG1 A;  3EJN A;  4JTC B;  4MTF A;  1DOV A;  1ZYR F;  4BPM A;  5L0H A;  4PAC A;  1Z6A A;  2HS5 A;  5A6K A;  4YWQ A;  3UR3 C;  4IWB A;  1RXQ A;  2WVN A;  4DBQ A;  4DVZ A;  1HW2 A;  1TFK B;  2G62 A;  3NMJ A;  3PHF 2;  4N6C A;  1UFB A;  3B9Q A;  1OW6 A;  4XPW A;  2IBF A;  2KYH A;  3CEX A;  5EHH A;  1YVI A;  2AU5 A;  4W8P A;  2HSB A;  4CBE A;  1JPN A;  1U6H A;  2L6H A;  2EIM C;  3WAQ A;  4BJ6 A;  5KYX A;  4JTD B;  3C7J A;  3GEH A;  3DAF A;  5T3T A;  4EBB A;  3TUL A;  2R02 A;  2G3K A;  1APC A;  5AGF A;  2IM8 A;  3ATP A;  3IEE A;  2VB6 A;  3O55 A;  4OD4 A;  1YDI A;  2LP4 A;  3SXM A;  1FNT c;  4I3M A;  2ZD9 A;  2W45 A;  5HSW A;  2Y3H A;  2OOC A;  1OR3 A;  1D1C A;  2JPU A;  4AE4 B;  4BJ1 A;  4YL3 A;  2ZPA A;  4U5D E;  3EGX A;  2LQG A;  1WTY A;  1ZHT A;  2A0B A;  3UMK A;  3VAY A;  4BEJ A;  5L0I A;  4CS7 A;  4CSA A;  2QTV A;  3W2W A;  3V5X A;  2PBE A;  1E2X A;  3F47 A;  3W2V A;  2XLV A;  1Q0M A;  3EGD B;  4G7H F;  3DWW A;  2L6F A;  3B71 A;  4NCQ A;  3EFO B;  3VRC A;  4DVY P;  3GM3 A;  1T6U A;  2YLI A;  3RFY A;  3U9M A;  3T6B A;  4C7O B;  4X0R A;  2CNW D;  2NPU A;  1ST6 A;  1PV3 A;  5GPG B;  5COM A;  2Y3G A;  1D0X A;  2XL6 A;  1J8Y F;  1B68 A;  2YRF A;  3S0X A;  3GOR A;  5B1A C;  1QLE C;  2G3V A;  1MQV A;  2R7O A;  3DM5 A;  1WN0 A;  1HMO A;  5JP7 A;  3U8P A;  4N4W A;  1EA8 A;  2GDC A;  1MNE A;  1AUE A;  3UMH A;  3WOD F;  4JCZ A;  4KBL A;  3FXH A;  3EGX B;  3IQ6 A;  4N06 A;  3ITF A;  4MVM A;  2ZXO A;  2P7V A;  1CGN A;  2YL0 A;  1U0B B; 
#chains in the Genus database with same CATH homology
 1OQC A;  3LLK A;  4E0I A;  2HJ3 A;  3GWL A;  1JR8 A;  3R7C A;  1JRA A;  3O55 A;  3TK0 A;  3GWN A;  3TD7 A;  3LLI A;  3W4Y A;  3U2L A;  4E0H A;  3U5S A;  3U2M A;  3MBG A;  4LDK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...