1JRAA

Crystal structure of erv2p
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
106
structure length
106
Chain Sequence
DDKVKKEVGRASWKYFHTLLARFPDEPTPEEREKLHTFIGLYAELYPCGECSYHFVKLIEKYPVQTSSRTAAAMWGCHIHNKVNEYLKKDIYDCATILEDYDCGCS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ERV2 PROTEIN, MITOCHONDRIAL
publication title A new FAD-binding fold and intersubunit disulfide shuttle in the thiol oxidase Erv2p.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Oxidoreductase
total genus 42
structure length 106
sequence length 106
chains with identical sequence B, C, D
ec nomenclature ec 1.8.3.2: Thiol oxidase.
pdb deposition date 2001-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04777 Evr1_Alr Erv1 / Alr family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.310 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) ERV/ALR sulfhydryl oxidase domain 1jraA00
4E0IA 3LLKA 3U2LA 3GWNA 4E0HA 3TK0A 1JRAA 3U2MA 1JR8A 3R7CA 3TD7A 3LLIA 3W4YA 1OQCA 2HJ3A 3O55A 3MBGA 3U5SA 3GWLA 4LDKA
chains in the Genus database with same CATH superfamily
3DM5A 3C8ZA 4P9TA 3A11A 5A6KA 4O7GA 2AWCA 4FWVA 3G50A 1LKXA 3IEEA 3KL4A 4LLEA 1G4US 4MVQA 4PJMA 1EQ1A 3WODF 4LDQA 1H6GA 1AUEA 4BJ6C 4CS9C 5B3IA 2CCYA 1J8MF 4OIQF 1VLTA 1VOMA 1BR4A 2KSFA 4U5BE 5AC5A 5L0DA 1TWGA 2PNOA 2R05A 1SMYF 3ZQYA 1TFOB 2AU5A 3LJBA 3HLZA 1FR0A 3QW1A 3LEVA 1QVXA 5KYUA 1XZQA 4XLNF 4E18A 1OR2A 1LE4A 1H9GA 3AG2C 5HSWA 1E84A 1M57C 2Y3GA 3SYNA 4ONSA 5KYYA 2Q3TA 3HKKA 4U5EE 1RMVA 3Q6NA 1T6UA 1YA9A 4Z9IA 2RD9A 2IOQA 3AG3C 3ZVRA 5E33A 3S84A 4PJLA 2ASRA 1Y6DA 1MMGA 4FESA 1E85A 3AOUA 5A6JA 5L0GA 4G7ZF 2PX0A 4DJ9A 3U9JA 3KYIA 2YL0A 3B71A 2VCBA 1S05A 3GM3A 3K6BA 2WZFA 4NY3A 3GODA 1ZHWA 3B9QA 3VYWA 3EGXB 2AP3A 1BBHA 1ZHXA 3SXKA 3E70C 3EG9A 2ZXOA 5B1AC 4OD4A 3E9VA 1M56C 4U9DA 4YK5A 2JD3A 3W8IA 3ASOC 2HMZA 1PV3A 4PK4A 4C3DA 3V5XA 1NBBA 3LNMB 4YJWA 3NMKA 2XLEA 2HFIA 4CX9A 2B0JA 4JRZA 2HUJA 2Q9CA 1Z5ZA 5JUAA 2WVOA 4XEFA 1N1CA 3B29A 1QZXA 2ETSA 2X51A 3IQTA 3QMKA 4L6RA 4C7OB 4YL1A 1G4WR 3M79A 3RYLA 4BG0A 4BPMA 3RQFA 4ER9A 1H9TA 4P9FA 3C18A 4U9EA 4D4XA 4EWCA 1GGQA 2M64A 3IHUA 5CI9A 1SYQA 1G8XA 1LVKA 2G62A 5AGFA 2EPNA 1L7CA 4JCZA 5L0JA 3N0TA 3PCVA 1O3UA 2R7UA 4HEAJ 4ZLDA 1YZAA 1Z7Qc 2VC9A 4PJJA 4OIPF 3NMJA 1HW1A 1TR2A 1HY5A 1PD1A 2QLAA 2YLGA 1ZW3A 3A9CA 3FOPA 2HV7A 1IW7F 3RKOF 3ZTMA 1C03A 2HSQA 2IYLD 3DI5A 4PACA 2IXPA 5JT4A 4X0RA 1R5ID 2BE5F 2MHRA 2ZXPA 4LDKA 3I5QA 2GA0A 2XM0A 2V26A 2J45A 2Z15A 3X1OA 2PX3A 4CS8C 3ABMC 4E0IA 5DS4A 2R7WA 2R9RB 3F47A 5D91A 4AX2A 3FHDA 1UFBA 4GYTA 2OU6A 4C3BA 5A6AA 2J9BA 2WB7A 1E83A 2R7XA 1Q0DA 2ZPAA 1U6HA 2XL4A 1FMWA 1LIHA 2AVKA 2J46A 3S0XA 1M2VA 2KNHA 2QUPA 1YJGA 4FX5A 4EUKB 4YWQA 2NUTA 2CNWD 4H4KC 4QI2A 3C8GA 3QVYA 2YVKA 4KI2A 1NLXA 1T9KA 5E3AA 3TOLA 5COFA 1R4TA 4MW3A 2VH3A 2YHSA 1CGOA 2VASA 4I44A 3L8IA 5L0CA 3S27A 1DOVA 3GWLA 1WWPA 1WTYA 2HSBA 3SXYA 2KW3C 3FMSA 1FTSA 1FFTC 5A69A 4N6HA 1VYIA 3WG7C 2LSEA 4AE4B 1JMWA 4Z9HA 4YL0A 3SNHA 3ZIBA 3J06A 2XS1A 4JKVA 3NYMA 4ULWA 3CSKA 3ASNC 2R7OA 4MVOA 2A68F 4BJ6A 1WASA 5D92A 4CS9A 2IXOA 4DRHB 5K0IA 4E7ZA 1QKRA 3SEOA 4D4NA 4U5FE 2R7TA 4JE9A 5AC4A 2CW0F 2A69F 3JZ0A 1K05A 1LI5A 2FGYA 3LESA 5KYXA 2DI3A 3H2UA 4G78A 2QY9A 3Q6MA 2Q4FA 3BEHA 4IGGA 3U5SA 4CDYA 1HE9A 2EPMX 2MYSA 1JPJA 1YA7O 3US6A 3W2VA 3FDQA 1NU7D 3FAJA 4XEVA 3LS0A 1WOLA 4O6YA 2P0NA 1M2OA 1RKEA 1V74B 4PR9A 3DKAA 5BQIA 2HS5A 1LM3B 2NUPB 3UMHA 2XXAB 1KNYA 2XL8A 3KMIA 4YT2A 2YZSA 3B0UX 2KGOA 3ZWIA 3NYLA 4JEBA 5L3VA 2YL3A 2CYDA 5DS5A 1Z6AA 2YLDA 4NTFA 1NG1A 1ZZPA 3EZIA 2GDCA 2IBFA 3HNIA 3NG1A 3PDMP 2QNLA 3SXMA 3B0PA 1AEPA 5L3QA 2ICWG 2LFDA 4XPYA 4CS7A 1CPRA 1GQAA 2DB4A 3GM1A 3ABLC 2VCAA 3TOMA 2H7BA 3S28A 4C3EA 1IZMA 3C62A 4OD5A 4GQHA 3NMIA 4IJJA 3OEOA 2NSGA 3EHNA 1SZIA 4AL1A 3H65A 5T3TA 3S29A 2JX0A 3ZC4A 3NKDA 2DYSC 1KU2A 2CGEA 4K0DA 1T6IA 3AQCA 1OKKA 2BL2A 2ZXRA 3IQCA 4YN0B 3L34A 3V7OA 3WAQA 1RJ9B 4BJ5C 1HW2A 3AG1C 3DAGA 4NTAA 5KYWB 3EFOB 1QQ3A 1JPNA 3O39A 3CEXA 3C63A 1OR3A 1Z23A 2TMVP 4G7OF 1ZVZA 4KBLA 3EHMA 5JSLA 3TJ6A 3JYHA 2YL1A 3N2ZB 2OEXA 3EPVA 4NQFA 3R7CA 3QZCA 2XSEA 1YYXA 1YVIA 1Z3IX 5FCLA 1ORYA 3K7DA 4K1OA 1OXBA 3HNLA 3JCUQ 3K33A 4KNWA 4MVSA 2XL6A 2NPUA 2A1DD 2WL8A 2Y3HA 3RQGA 5L0FA 3FAPB 1QSPA 2OKUA 3LS1A 3O10A 5FZTA 4A4AA 4JZAA 4BJ1A 3L1MA 1F1MA 3PMRA 5DS6A 5E2QA 4CSAC 4OIRF 1CGNA 4N06A 4P6IC 3U2LA 3UR3C 1B68A 3JSZA 3TK0A 2GFHA 2LCHA 3L0IA 3M4BA 2BC5A 1ORSC 4RDAA 2D4UA 1LS4A 5BQGA 3U2MA 4BJTA 3S90A 4UDVA 1YZCA 1W2WA 2FAPB 4W8PA 2HZ8A 2HV6A 3FOOA 4MVRA 2W4BA 2I8BA 4J32B 1CPQA 3TD7A 3ABKC 4JJGA 1CGME 3W8HA 1V54C 3LUTB 3LAYA 4JJFA 5BQHA 3RQEA 1ORJA 2WVNA 1FMVA 4U5DE 1ZU5A 2X0CA 3FVYA 2P7VA 2LK4A 4WJ0A 5KYUB 3KYJA 1K40A 5GPGB 2LD6A 1XZPA 3QTHA 4LACB 1FFHA 2L7AA 3ZDLA 3EGDA 4JIOA 4E0HA 2AWYA 2GWWA 2EPKX 3GM2A 4FAPB 1UG7A 2NG1A 3DZAA 1YAUO 5CIVA 3GANA 3GORA 3CZ6A 3DD7A 1JRAA 3V5YA 2XLMA 2R7RA 3T4RA 3N24A 3UNGC 1D1BA 4JTCB 3OA1A 4N4WA 3VM6A 256BA 4Q7CA 1I4YA 1T01A 2XLWA 3UMKA 1FNTc 1E86A 3LLIA 4NC3A 1G5ZA 3Q7GA 1TWAA 4O6MA 4MTGA 4XEKA 1MNEA 2LQGA 2UUHA 4Q5SF 1Y4CA 5T3WA 4K7BA 4EKWA 1BDJB 1TWHA 3EG9B 4MQ9F 1A0BA 2XLOA 3I5PA 2YL7A 1HMOA 5A6BA 5JVEA 4M63A 4CDVA 2OCCC 3RW0A 2F22A 4LDRA 2J0XA 2P6VA 1VLSA 3W2WA 2QTVA 1Q0FA 2P61A 3GWNA 1Q0GA 3RH3A 4J7YA 2J7PA 3U3BA 2NSFA 4KC9A 5DQTA 2J0WA 1NU9C 2KJGA 3H2VA 3IQ6A 3MYIA 3PHF2 4MTOA 4F4BA 1RKCA 2C04A 3RFYA 4N6CA 4DVZA 3LNRA 1ZHTA 5B3SC 2QE9A 2EPOA 1WGWA 2W4MA 2LFFA 4YT8A 3EH1A 4EHPA 2YEVA 2L9JA 2P1AA 2ZD9A 3CQZA 3KH2A 3ZTZA 1KTMA 2Q7RA 3DE8A 3POVA 1OQCA 2YWAA 2LP4A 4WGZA 5EGYA 1SF8A 3RVZA 1J8YF 4MVMA 2YLIA 2W9YA 3ATPA 4IAOA 1ZW2A 1D0YA 1O5HA 3EGXA 3JSEO 3QVZA 1MMDA 2OG2A 4CDAA 2G3KA 2WZLA 3ZG1A 4EIYA 4E7SA 4OIOF 1EI7A 1OXKA 3M15A 4G0HA 4MW8A 4B6IA 3LEOA 4DRIB 3NKEA 3HTKC 2Q9BA 3S9OA 2J9UA 2G3VA 4XQ1A 4BJ5A 5T1DB 4I1MA 3O6XA 2R03A 3Q7LA 4BEMJ 2R7VA 2HJMA 3DE9A 2B0HA 1VMAA 2Q00A 4JVSA 4MTFA 3T6GB 3K1IC 5DQZA 3DAFA 5COMA 4DVYP 3G4ZA 3SXZA 1LE2A 3U8PA 1YLMA 1V4AA 1FAPB 4A2NB 1NZEA 2H7VC 1M2VB 3V5ZA 2HJ3A 4C7OA 2A6HF 2J9WA 1GS9A 4YL3A 1DOWA 3G4XA 2KK1A 1C02A 1XWJA 1A7VA 2NUTB 2XLDA 3AGTA 2R02A 4HE8D 1WN0A 3AJMA 3C7JA 3SZRA 3DJUB 2EIJC 3C8GB 3T6JA 2PFDA 4W8KA 4H54A 2IXNA 5BUOA 5L0IA 4IRUA 1HMDA 2V3CC 4XPXA 5L0HA 2M4EA 2DGJA 3MFNA 4DXWA 3GEEA 1VYKA 3QW0A 4JCHA 1YDIA 2Y69C 3DJNB 3EH2A 3JRTA 5F28E 3U8VA 4CSAA 2WVQA 3T6BA 1D1CA 2OEVA 2E87A 4HFFB 4LERA 4JC7A 4LLCA 2CNWA 3NRHA 5B1BC 2XRHA 3AQBA 3MLGA 4CJGA 3C8GD 3DMDA 4J30B 3JRMO 4EBKA 1S7ZA 3L8JA 2IM8A 3BRJA 2R25A 4GEHA 2R7QA 4JEAA 3U0CA 2EIKC 3EJNA 4XPWA 1JAFA 2XLHA 1I4ZA 3SP1A 2WZGA 1NSGB 5DLJA 5A6BD 4WABA 4CIPA 1PD0A 5F5HA 2D5RB 1YYJA 5KYXB 1U0BB 1OCZC 3ECSA 1APCA 3K66A 1EA8A 2I15A 4NTBA 4CJOA 3X2QC 4JTDB 4QDLA 1VB5A 1LPEA 3GEIA 3I4UA 4MVZA 3AGUA 1OCRC 1VK5A 2J7PD 2OOCA 2PF4E 1BR1A 4CS8A 5TJ5E 2IXMA 2EINC 1ZYRF 3IPMO 1RKEB 2A0UA 1A41A 4PJNA 4XWJA 1QPUA 4EBBA 3VAYA 2LIGA 5HV9A 1TFKB 4DOZA 2J9VA 4DBRA 1A7DA 1TKNA 1LI7A 1Z63A 3KKBA 5CI8A 2CDQA 3FXHA 3O55A 2Y3BA 4AE4A 2L6FA 3HNJA 1I5NA 1MQVA 4XTKA 4ANJA 1VTMP 1T5OA 2YQYA 5KYYB 2HMQA 3DWWA 1O87A 1ST6A 1TWCA 1K04A 1OW8A 3AG4C 4O6NA 2R7SA 3LLKA 3RF3A 1PCXA 2DYRC 3JT1A 3RIPA 4U5CE 1TQGA 1OCCC 1WATA 3U9MA 4Q4ZF 4G7HF 2Y39A 4I3MA 1GM5A 4IWBA 4O79A 4PFOA 4JW1A 1D0XA 2A0BA 4HFKB 2OJQA 2XLVA 1ZHYA 2J8WA 4RBNA 4YT4A 4AK9A 4J7TA 3WHNA 2W45A 3DM9B 4E17A 4IB4A 3GEHA 5JP7A 4DRJB 4IAQA 4CBEA 4PFPA 2NUPA 4Z9JA 2XXAA 1E2XA 4AL0A 3R2PA 3ZQVA 1RCPA 5E3CA 3TJ5A 5IY5C 5JRAA 2L81A 2OJED 4ZLCA 1H7IA 1MMAA 3MX3A 4WGYA 3KPHA 4R32A 1AVOB 1ZHZA 2PP4A 4MVUA 2GAQA 1BR2A 2FFHA 1EKYA 3CAXA 1OKKD 3MYFA 5F5FA 4U5GA 3JYYA 2HKVA 3M1CB 1JOGA 1A7EA 3DXJF 5JS5A 1Q0MA 3F46A 1OW7A 2L6HA 2RSEB 4JURI 4DBQA 5EHHA 3EQLF 1RXQA 3HJCA 3M4CA 3K1IA 2OQMA 1Q0KA 5COGA 4KNVA 2KYHA 2EPLX 3MBGA 3TULA 4IARA 4XLPF 4I1OB 3K1HA 1OW6A 3NDBB 5DVWA 1RJ9A 2XM4A 4MNDA 4OINF 2EILC 5JLIA 1C17M 5KYWA 2UUIA 2JPUA 3EFOA 5KYNA 1OCOC 1L3PA 2O9XA 4U5HA 1D0ZA 1ZU4A 2C03A 4YT5A 1LS1A 3IQ5A 1D1AA 3JTLO 3T9OA 3B0VC 2Q9AA 2VB6A 3RVYA 3ZSUA 2YRFA 2H8AA 1BZ4A 2MWQA 2KC3A 3OWTA 3UGOA 1V55C 2VCCA 2YKZA 3NYJA 1JR8A 2EIMC 4MS2A 3EGDB 1YARO 2KQ9A 2A6EF 3VF0A 4NCQA 1SR2A 4RD9A 3TQOA 3VRCA 2L6GA 3U3FA 3W4YA 1U89A 4QI0A 1HE1A 3HNKA 4ULVA 1MNDA 1NFNA 2H7OA 2XS8A 2ZXWC 4CIHA 2Y3DA 3EZHA 3UGPA 1MMNA 4BEJA 2PBEA 3ITFA 1T6QA 4JTAB 5EK0A 1QLEC 1NFOA 3UMIA 1M6TA 4EBJA
chains in the Genus database with same CATH topology
4E0IA 3LLKA 3U2LA 3GWNA 4E0HA 3TK0A 1JRAA 3U2MA 1JR8A 3R7CA 3TD7A 3LLIA 3W4YA 1OQCA 2HJ3A 3O55A 3MBGA 3U5SA 3GWLA 4LDKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4E0I A;  3LLK A;  3U2L A;  3GWN A;  4E0H A;  3TK0 A;  1JRA A;  3U2M A;  1JR8 A;  3R7C A;  3TD7 A;  3LLI A;  3W4Y A;  1OQC A;  2HJ3 A;  3O55 A;  3MBG A;  3U5S A;  3GWL A;  4LDK A; 
#chains in the Genus database with same CATH topology
 3DM5 A;  3C8Z A;  4P9T A;  3A11 A;  5A6K A;  4O7G A;  2AWC A;  4FWV A;  3G50 A;  1LKX A;  3IEE A;  3KL4 A;  4LLE A;  1G4U S;  4MVQ A;  4PJM A;  1EQ1 A;  3WOD F;  4LDQ A;  1H6G A;  1AUE A;  4BJ6 C;  4CS9 C;  5B3I A;  2CCY A;  1J8M F;  4OIQ F;  1VLT A;  1VOM A;  1BR4 A;  2KSF A;  4U5B E;  5AC5 A;  5L0D A;  1TWG A;  2PNO A;  2R05 A;  1SMY F;  3ZQY A;  1TFO B;  2AU5 A;  3LJB A;  3HLZ A;  1FR0 A;  3QW1 A;  3LEV A;  1QVX A;  5KYU A;  1XZQ A;  4XLN F;  4E18 A;  1OR2 A;  1LE4 A;  1H9G A;  3AG2 C;  5HSW A;  1E84 A;  1M57 C;  2Y3G A;  3SYN A;  4ONS A;  5KYY A;  2Q3T A;  3HKK A;  4U5E E;  1RMV A;  3Q6N A;  1T6U A;  1YA9 A;  4Z9I A;  2RD9 A;  2IOQ A;  3AG3 C;  3ZVR A;  5E33 A;  3S84 A;  4PJL A;  2ASR A;  1Y6D A;  1MMG A;  4FES A;  1E85 A;  3AOU A;  5A6J A;  5L0G A;  4G7Z F;  2PX0 A;  4DJ9 A;  3U9J A;  3KYI A;  2YL0 A;  3B71 A;  2VCB A;  1S05 A;  3GM3 A;  3K6B A;  2WZF A;  4NY3 A;  3GOD A;  1ZHW A;  3B9Q A;  3VYW A;  3EGX B;  2AP3 A;  1BBH A;  1ZHX A;  3SXK A;  3E70 C;  3EG9 A;  2ZXO A;  5B1A C;  4OD4 A;  3E9V A;  1M56 C;  4U9D A;  4YK5 A;  2JD3 A;  3W8I A;  3ASO C;  2HMZ A;  1PV3 A;  4PK4 A;  4C3D A;  3V5X A;  1NBB A;  3LNM B;  4YJW A;  3NMK A;  2XLE A;  2HFI A;  4CX9 A;  2B0J A;  4JRZ A;  2HUJ A;  2Q9C A;  1Z5Z A;  5JUA A;  2WVO A;  4XEF A;  1N1C A;  3B29 A;  1QZX A;  2ETS A;  2X51 A;  3IQT A;  3QMK A;  4L6R A;  4C7O B;  4YL1 A;  1G4W R;  3M79 A;  3RYL A;  4BG0 A;  4BPM A;  3RQF A;  4ER9 A;  1H9T A;  4P9F A;  3C18 A;  4U9E A;  4D4X A;  4EWC A;  1GGQ A;  2M64 A;  3IHU A;  5CI9 A;  1SYQ A;  1G8X A;  1LVK A;  2G62 A;  5AGF A;  2EPN A;  1L7C A;  4JCZ A;  5L0J A;  3N0T A;  3PCV A;  1O3U A;  2R7U A;  4HEA J;  4ZLD A;  1YZA A;  1Z7Q c;  2VC9 A;  4PJJ A;  4OIP F;  3NMJ A;  1HW1 A;  1TR2 A;  1HY5 A;  1PD1 A;  2QLA A;  2YLG A;  1ZW3 A;  3A9C A;  3FOP A;  2HV7 A;  1IW7 F;  3RKO F;  3ZTM A;  1C03 A;  2HSQ A;  2IYL D;  3DI5 A;  4PAC A;  2IXP A;  5JT4 A;  4X0R A;  1R5I D;  2BE5 F;  2MHR A;  2ZXP A;  4LDK A;  3I5Q A;  2GA0 A;  2XM0 A;  2V26 A;  2J45 A;  2Z15 A;  3X1O A;  2PX3 A;  4CS8 C;  3ABM C;  4E0I A;  5DS4 A;  2R7W A;  2R9R B;  3F47 A;  5D91 A;  4AX2 A;  3FHD A;  1UFB A;  4GYT A;  2OU6 A;  4C3B A;  5A6A A;  2J9B A;  2WB7 A;  1E83 A;  2R7X A;  1Q0D A;  2ZPA A;  1U6H A;  2XL4 A;  1FMW A;  1LIH A;  2AVK A;  2J46 A;  3S0X A;  1M2V A;  2KNH A;  2QUP A;  1YJG A;  4FX5 A;  4EUK B;  4YWQ A;  2NUT A;  2CNW D;  4H4K C;  4QI2 A;  3C8G A;  3QVY A;  2YVK A;  4KI2 A;  1NLX A;  1T9K A;  5E3A A;  3TOL A;  5COF A;  1R4T A;  4MW3 A;  2VH3 A;  2YHS A;  1CGO A;  2VAS A;  4I44 A;  3L8I A;  5L0C A;  3S27 A;  1DOV A;  3GWL A;  1WWP A;  1WTY A;  2HSB A;  3SXY A;  2KW3 C;  3FMS A;  1FTS A;  1FFT C;  5A69 A;  4N6H A;  1VYI A;  3WG7 C;  2LSE A;  4AE4 B;  1JMW A;  4Z9H A;  4YL0 A;  3SNH A;  3ZIB A;  3J06 A;  2XS1 A;  4JKV A;  3NYM A;  4ULW A;  3CSK A;  3ASN C;  2R7O A;  4MVO A;  2A68 F;  4BJ6 A;  1WAS A;  5D92 A;  4CS9 A;  2IXO A;  4DRH B;  5K0I A;  4E7Z A;  1QKR A;  3SEO A;  4D4N A;  4U5F E;  2R7T A;  4JE9 A;  5AC4 A;  2CW0 F;  2A69 F;  3JZ0 A;  1K05 A;  1LI5 A;  2FGY A;  3LES A;  5KYX A;  2DI3 A;  3H2U A;  4G78 A;  2QY9 A;  3Q6M A;  2Q4F A;  3BEH A;  4IGG A;  3U5S A;  4CDY A;  1HE9 A;  2EPM X;  2MYS A;  1JPJ A;  1YA7 O;  3US6 A;  3W2V A;  3FDQ A;  1NU7 D;  3FAJ A;  4XEV A;  3LS0 A;  1WOL A;  4O6Y A;  2P0N A;  1M2O A;  1RKE A;  1V74 B;  4PR9 A;  3DKA A;  5BQI A;  2HS5 A;  1LM3 B;  2NUP B;  3UMH A;  2XXA B;  1KNY A;  2XL8 A;  3KMI A;  4YT2 A;  2YZS A;  3B0U X;  2KGO A;  3ZWI A;  3NYL A;  4JEB A;  5L3V A;  2YL3 A;  2CYD A;  5DS5 A;  1Z6A A;  2YLD A;  4NTF A;  1NG1 A;  1ZZP A;  3EZI A;  2GDC A;  2IBF A;  3HNI A;  3NG1 A;  3PDM P;  2QNL A;  3SXM A;  3B0P A;  1AEP A;  5L3Q A;  2ICW G;  2LFD A;  4XPY A;  4CS7 A;  1CPR A;  1GQA A;  2DB4 A;  3GM1 A;  3ABL C;  2VCA A;  3TOM A;  2H7B A;  3S28 A;  4C3E A;  1IZM A;  3C62 A;  4OD5 A;  4GQH A;  3NMI A;  4IJJ A;  3OEO A;  2NSG A;  3EHN A;  1SZI A;  4AL1 A;  3H65 A;  5T3T A;  3S29 A;  2JX0 A;  3ZC4 A;  3NKD A;  2DYS C;  1KU2 A;  2CGE A;  4K0D A;  1T6I A;  3AQC A;  1OKK A;  2BL2 A;  2ZXR A;  3IQC A;  4YN0 B;  3L34 A;  3V7O A;  3WAQ A;  1RJ9 B;  4BJ5 C;  1HW2 A;  3AG1 C;  3DAG A;  4NTA A;  5KYW B;  3EFO B;  1QQ3 A;  1JPN A;  3O39 A;  3CEX A;  3C63 A;  1OR3 A;  1Z23 A;  2TMV P;  4G7O F;  1ZVZ A;  4KBL A;  3EHM A;  5JSL A;  3TJ6 A;  3JYH A;  2YL1 A;  3N2Z B;  2OEX A;  3EPV A;  4NQF A;  3R7C A;  3QZC A;  2XSE A;  1YYX A;  1YVI A;  1Z3I X;  5FCL A;  1ORY A;  3K7D A;  4K1O A;  1OXB A;  3HNL A;  3JCU Q;  3K33 A;  4KNW A;  4MVS A;  2XL6 A;  2NPU A;  2A1D D;  2WL8 A;  2Y3H A;  3RQG A;  5L0F A;  3FAP B;  1QSP A;  2OKU A;  3LS1 A;  3O10 A;  5FZT A;  4A4A A;  4JZA A;  4BJ1 A;  3L1M A;  1F1M A;  3PMR A;  5DS6 A;  5E2Q A;  4CSA C;  4OIR F;  1CGN A;  4N06 A;  4P6I C;  3U2L A;  3UR3 C;  1B68 A;  3JSZ A;  3TK0 A;  2GFH A;  2LCH A;  3L0I A;  3M4B A;  2BC5 A;  1ORS C;  4RDA A;  2D4U A;  1LS4 A;  5BQG A;  3U2M A;  4BJT A;  3S90 A;  4UDV A;  1YZC A;  1W2W A;  2FAP B;  4W8P A;  2HZ8 A;  2HV6 A;  3FOO A;  4MVR A;  2W4B A;  2I8B A;  4J32 B;  1CPQ A;  3TD7 A;  3ABK C;  4JJG A;  1CGM E;  3W8H A;  1V54 C;  3LUT B;  3LAY A;  4JJF A;  5BQH A;  3RQE A;  1ORJ A;  2WVN A;  1FMV A;  4U5D E;  1ZU5 A;  2X0C A;  3FVY A;  2P7V A;  2LK4 A;  4WJ0 A;  5KYU B;  3KYJ A;  1K40 A;  5GPG B;  2LD6 A;  1XZP A;  3QTH A;  4LAC B;  1FFH A;  2L7A A;  3ZDL A;  3EGD A;  4JIO A;  4E0H A;  2AWY A;  2GWW A;  2EPK X;  3GM2 A;  4FAP B;  1UG7 A;  2NG1 A;  3DZA A;  1YAU O;  5CIV A;  3GAN A;  3GOR A;  3CZ6 A;  3DD7 A;  1JRA A;  3V5Y A;  2XLM A;  2R7R A;  3T4R A;  3N24 A;  3UNG C;  1D1B A;  4JTC B;  3OA1 A;  4N4W A;  3VM6 A;  256B A;  4Q7C A;  1I4Y A;  1T01 A;  2XLW A;  3UMK A;  1FNT c;  1E86 A;  3LLI A;  4NC3 A;  1G5Z A;  3Q7G A;  1TWA A;  4O6M A;  4MTG A;  4XEK A;  1MNE A;  2LQG A;  2UUH A;  4Q5S F;  1Y4C A;  5T3W A;  4K7B A;  4EKW A;  1BDJ B;  1TWH A;  3EG9 B;  4MQ9 F;  1A0B A;  2XLO A;  3I5P A;  2YL7 A;  1HMO A;  5A6B A;  5JVE A;  4M63 A;  4CDV A;  2OCC C;  3RW0 A;  2F22 A;  4LDR A;  2J0X A;  2P6V A;  1VLS A;  3W2W A;  2QTV A;  1Q0F A;  2P61 A;  3GWN A;  1Q0G A;  3RH3 A;  4J7Y A;  2J7P A;  3U3B A;  2NSF A;  4KC9 A;  5DQT A;  2J0W A;  1NU9 C;  2KJG A;  3H2V A;  3IQ6 A;  3MYI A;  3PHF 2;  4MTO A;  4F4B A;  1RKC A;  2C04 A;  3RFY A;  4N6C A;  4DVZ A;  3LNR A;  1ZHT A;  5B3S C;  2QE9 A;  2EPO A;  1WGW A;  2W4M A;  2LFF A;  4YT8 A;  3EH1 A;  4EHP A;  2YEV A;  2L9J A;  2P1A A;  2ZD9 A;  3CQZ A;  3KH2 A;  3ZTZ A;  1KTM A;  2Q7R A;  3DE8 A;  3POV A;  1OQC A;  2YWA A;  2LP4 A;  4WGZ A;  5EGY A;  1SF8 A;  3RVZ A;  1J8Y F;  4MVM A;  2YLI A;  2W9Y A;  3ATP A;  4IAO A;  1ZW2 A;  1D0Y A;  1O5H A;  3EGX A;  3JSE O;  3QVZ A;  1MMD A;  2OG2 A;  4CDA A;  2G3K A;  2WZL A;  3ZG1 A;  4EIY A;  4E7S A;  4OIO F;  1EI7 A;  1OXK A;  3M15 A;  4G0H A;  4MW8 A;  4B6I A;  3LEO A;  4DRI B;  3NKE A;  3HTK C;  2Q9B A;  3S9O A;  2J9U A;  2G3V A;  4XQ1 A;  4BJ5 A;  5T1D B;  4I1M A;  3O6X A;  2R03 A;  3Q7L A;  4BEM J;  2R7V A;  2HJM A;  3DE9 A;  2B0H A;  1VMA A;  2Q00 A;  4JVS A;  4MTF A;  3T6G B;  3K1I C;  5DQZ A;  3DAF A;  5COM A;  4DVY P;  3G4Z A;  3SXZ A;  1LE2 A;  3U8P A;  1YLM A;  1V4A A;  1FAP B;  4A2N B;  1NZE A;  2H7V C;  1M2V B;  3V5Z A;  2HJ3 A;  4C7O A;  2A6H F;  2J9W A;  1GS9 A;  4YL3 A;  1DOW A;  3G4X A;  2KK1 A;  1C02 A;  1XWJ A;  1A7V A;  2NUT B;  2XLD A;  3AGT A;  2R02 A;  4HE8 D;  1WN0 A;  3AJM A;  3C7J A;  3SZR A;  3DJU B;  2EIJ C;  3C8G B;  3T6J A;  2PFD A;  4W8K A;  4H54 A;  2IXN A;  5BUO A;  5L0I A;  4IRU A;  1HMD A;  2V3C C;  4XPX A;  5L0H A;  2M4E A;  2DGJ A;  3MFN A;  4DXW A;  3GEE A;  1VYK A;  3QW0 A;  4JCH A;  1YDI A;  2Y69 C;  3DJN B;  3EH2 A;  3JRT A;  5F28 E;  3U8V A;  4CSA A;  2WVQ A;  3T6B A;  1D1C A;  2OEV A;  2E87 A;  4HFF B;  4LER A;  4JC7 A;  4LLC A;  2CNW A;  3NRH A;  5B1B C;  2XRH A;  3AQB A;  3MLG A;  4CJG A;  3C8G D;  3DMD A;  4J30 B;  3JRM O;  4EBK A;  1S7Z A;  3L8J A;  2IM8 A;  3BRJ A;  2R25 A;  4GEH A;  2R7Q A;  4JEA A;  3U0C A;  2EIK C;  3EJN A;  4XPW A;  1JAF A;  2XLH A;  1I4Z A;  3SP1 A;  2WZG A;  1NSG B;  5DLJ A;  5A6B D;  4WAB A;  4CIP A;  1PD0 A;  5F5H A;  2D5R B;  1YYJ A;  5KYX B;  1U0B B;  1OCZ C;  3ECS A;  1APC A;  3K66 A;  1EA8 A;  2I15 A;  4NTB A;  4CJO A;  3X2Q C;  4JTD B;  4QDL A;  1VB5 A;  1LPE A;  3GEI A;  3I4U A;  4MVZ A;  3AGU A;  1OCR C;  1VK5 A;  2J7P D;  2OOC A;  2PF4 E;  1BR1 A;  4CS8 A;  5TJ5 E;  2IXM A;  2EIN C;  1ZYR F;  3IPM O;  1RKE B;  2A0U A;  1A41 A;  4PJN A;  4XWJ A;  1QPU A;  4EBB A;  3VAY A;  2LIG A;  5HV9 A;  1TFK B;  4DOZ A;  2J9V A;  4DBR A;  1A7D A;  1TKN A;  1LI7 A;  1Z63 A;  3KKB A;  5CI8 A;  2CDQ A;  3FXH A;  3O55 A;  2Y3B A;  4AE4 A;  2L6F A;  3HNJ A;  1I5N A;  1MQV A;  4XTK A;  4ANJ A;  1VTM P;  1T5O A;  2YQY A;  5KYY B;  2HMQ A;  3DWW A;  1O87 A;  1ST6 A;  1TWC A;  1K04 A;  1OW8 A;  3AG4 C;  4O6N A;  2R7S A;  3LLK A;  3RF3 A;  1PCX A;  2DYR C;  3JT1 A;  3RIP A;  4U5C E;  1TQG A;  1OCC C;  1WAT A;  3U9M A;  4Q4Z F;  4G7H F;  2Y39 A;  4I3M A;  1GM5 A;  4IWB A;  4O79 A;  4PFO A;  4JW1 A;  1D0X A;  2A0B A;  4HFK B;  2OJQ A;  2XLV A;  1ZHY A;  2J8W A;  4RBN A;  4YT4 A;  4AK9 A;  4J7T A;  3WHN A;  2W45 A;  3DM9 B;  4E17 A;  4IB4 A;  3GEH A;  5JP7 A;  4DRJ B;  4IAQ A;  4CBE A;  4PFP A;  2NUP A;  4Z9J A;  2XXA A;  1E2X A;  4AL0 A;  3R2P A;  3ZQV A;  1RCP A;  5E3C A;  3TJ5 A;  5IY5 C;  5JRA A;  2L81 A;  2OJE D;  4ZLC A;  1H7I A;  1MMA A;  3MX3 A;  4WGY A;  3KPH A;  4R32 A;  1AVO B;  1ZHZ A;  2PP4 A;  4MVU A;  2GAQ A;  1BR2 A;  2FFH A;  1EKY A;  3CAX A;  1OKK D;  3MYF A;  5F5F A;  4U5G A;  3JYY A;  2HKV A;  3M1C B;  1JOG A;  1A7E A;  3DXJ F;  5JS5 A;  1Q0M A;  3F46 A;  1OW7 A;  2L6H A;  2RSE B;  4JUR I;  4DBQ A;  5EHH A;  3EQL F;  1RXQ A;  3HJC A;  3M4C A;  3K1I A;  2OQM A;  1Q0K A;  5COG A;  4KNV A;  2KYH A;  2EPL X;  3MBG A;  3TUL A;  4IAR A;  4XLP F;  4I1O B;  3K1H A;  1OW6 A;  3NDB B;  5DVW A;  1RJ9 A;  2XM4 A;  4MND A;  4OIN F;  2EIL C;  5JLI A;  1C17 M;  5KYW A;  2UUI A;  2JPU A;  3EFO A;  5KYN A;  1OCO C;  1L3P A;  2O9X A;  4U5H A;  1D0Z A;  1ZU4 A;  2C03 A;  4YT5 A;  1LS1 A;  3IQ5 A;  1D1A A;  3JTL O;  3T9O A;  3B0V C;  2Q9A A;  2VB6 A;  3RVY A;  3ZSU A;  2YRF A;  2H8A A;  1BZ4 A;  2MWQ A;  2KC3 A;  3OWT A;  3UGO A;  1V55 C;  2VCC A;  2YKZ A;  3NYJ A;  1JR8 A;  2EIM C;  4MS2 A;  3EGD B;  1YAR O;  2KQ9 A;  2A6E F;  3VF0 A;  4NCQ A;  1SR2 A;  4RD9 A;  3TQO A;  3VRC A;  2L6G A;  3U3F A;  3W4Y A;  1U89 A;  4QI0 A;  1HE1 A;  3HNK A;  4ULV A;  1MND A;  1NFN A;  2H7O A;  2XS8 A;  2ZXW C;  4CIH A;  2Y3D A;  3EZH A;  3UGP A;  1MMN A;  4BEJ A;  2PBE A;  3ITF A;  1T6Q A;  4JTA B;  5EK0 A;  1QLE C;  1NFO A;  3UMI A;  1M6T A;  4EBJ A; 
#chains in the Genus database with same CATH homology
 4E0I A;  3LLK A;  3U2L A;  3GWN A;  4E0H A;  3TK0 A;  1JRA A;  3U2M A;  1JR8 A;  3R7C A;  3TD7 A;  3LLI A;  3W4Y A;  1OQC A;  2HJ3 A;  3O55 A;  3MBG A;  3U5S A;  3GWL A;  4LDK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...