1UG7A

Solution structure of four helical up-and-down bundle domain of the hypothetical protein 2610208m17rik similar to the protein flj12806
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
128
structure length
128
Chain Sequence
GSSGSSGMSEVTRSLLQRWGASLRRGADFDSWGQLVEAIDEYQILARHLQKEAQAQHNNSEFTEEQKKTIGKIATCLELRSAALQSTQSQEEFKLEDLKKLEPILKNILTYNKEFPFDVQPISGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of four helical up-and-down bundle domain of the hypothetical protein 2610208M17Rik similar to the protein FLJ12806
rcsb
source organism Mus musculus
molecule tags Structural genomics, unknown function
molecule keywords 2610208M17Rik protein
total genus 31
structure length 128
sequence length 128
ec nomenclature
pdb deposition date 2003-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08910 Aida_N Aida N-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.360 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Axin interactor, dorsalization-associated protein, N-terminal domain 1ug7A00
1UG7A
chains in the Genus database with same CATH superfamily
4JCHA 3L8JA 1Z7Qc 1APCA 1GS9A 2HJ3A 2CGEA 1YJGA 3GM2A 3KKBA 3O6XA 4U5EE 1H6GA 2YEVA 3ABLC 3EGXA 3L8IA 1CGOA 4N06A 2HFIA 4MVQA 4P6IC 2ZXOA 2CNWA 3LJBA 4KI2A 2H7BA 3I4UA 1ZVZA 2W45A 1M2VB 2L6GA 3J06A 1A0BA 3GEEA 4ULWA 1Y6DA 1FMWA 3RFYA 3RW0A 3V5YA 2NPUA 4AL0A 2MYSA 3LAYA 1QQ3A 1A7EA 3W2VA 2QY9A 2A0BA 1QKRA 3LESA 2WZLA 2CYDA 2LK4A 3UMKA 3FMSA 3K6BA 2HS5A 3HKKA 4BJ6C 1V55C 2XM0A 1Z63A 1OKKD 4PJNA 1WASA 5BUOA 1L7CA 3C8GA 4CDYA 4HEAJ 5DVWA 3AG3C 1OCOC 2CNWD 2H7OA 2KJGA 2EPOA 2HMZA 1D1CA 2XM4A 4FAPB 4H54A 4YL0A 2VC9A 4HE8D 3Q7GA 256BA 2AP3A 4XTKA 4XWJA 1MMDA 2IYLD 3UGOA 3U2MA 2NSFA 4DBRA 2J9VA 2J9WA 3TOMA 1K05A 3ZTMA 1JAFA 1NSGB 1ORSC 2IXMA 2XLEA 2Y3DA 4P9FA 3S27A 3ZDLA 1T6QA 3K33A 1JPNA 3SYNA 1ZU4A 3RVYA 2JD3A 3ZQVA 4CS8A 5KYXA 2PF4E 2WB7A 3EG9B 3QVZA 3T6JA 1EA8A 3N0TA 3VRCA 2GA0A 2HKVA 2WL8A 1UFBA 2J46A 3AQCA 3DAFA 3LLIA 2C04A 3G4XA 1PD0A 2IM8A 3LLKA 1T5OA 4BJ1A 4MTGA 3K1IA 1LE2A 3ZG1A 2OKUA 4OD4A 3S28A 3U5SA 4ER9A 2R7RA 3NKEA 1OCCC 5DS5A 4PACA 3RQEA 1TWAA 2B0HA 2XLWA 4X0RA 2XS1A 1DOWA 3LNRA 3SP1A 3NKDA 4O6YA 3TD7A 4YT5A 3W4YA 3LS1A 3DAGA 3GM1A 1RJ9A 3W2WA 1FAPB 3LEOA 3C8ZA 5E3AA 3ZIBA 5B1BC 1YVIA 2CCYA 4KBLA 4BJ5C 3EHNA 2G3VA 1OW6A 2A68F 4CIHA 2YQYA 4XPXA 5FZTA 1DOVA 2YLDA 4YK5A 4AE4A 1Q0DA 1YZAA 2VH3A 3UMIA 1JOGA 1SF8A 4DRHB 2JX0A 1TWGA 3RKOF 2J9BA 4YT8A 2WZFA 2R7VA 3IHUA 3OEOA 3RQFA 3BEHA 4JEBA 4L6RA 2J45A 1TFOB 3EHMA 1ZYRF 5EHHA 3RIPA 3AJMA 2KYHA 2XLHA 2HV7A 3ASOC 3JRTA 2DYRC 2YRFA 3K1IC 1G4WR 3L1MA 4XEKA 2R9RB 3EH1A 1ZZPA 2EIKC 3KYIA 5JSLA 3TJ5A 3W8HA 5DLJA 4ANJA 1I4YA 4YT4A 2XLMA 2DI3A 4DBQA 2DYSC 2KNHA 5EGYA 3GM3A 1YZCA 1AUEA 1WOLA 2HUJA 3HNIA 4CS8C 2GAQA 2I15A 2BE5F 2A1DD 3VAYA 4EWCA 5KYXB 4YT2A 4JRZA 1ST6A 1OXBA 3EPVA 3B71A 5F5FA 4G0HA 4GEHA 1OQCA 4XLNF 2L6FA 4YL3A 5KYWB 1FR0A 2DGJA 1QSPA 3FVYA 3TK0A 4MS2A 1YA9A 3FXHA 3S0XA 4CJOA 1RJ9B 5BQGA 1SMYF 4XPYA 4YN0B 1YYXA 3T9OA 1Z23A 4JURI 3T6GB 5HV9A 1ORYA 1Q0MA 1BR2A 2GDCA 2W4BA 4N6HA 1LIHA 1ZW3A 4EHPA 5JLIA 2ZXWC 4LERA 4AX2A 1L3PA 3RF3A 3B0UX 2W4MA 3KMIA 1S7ZA 1XZPA 5AGFA 1U6HA 2Y39A 1GQAA 2P7VA 2R05A 2J0WA 4XEFA 1VLSA 4JE9A 2EINC 3HNLA 4JCZA 4CIPA 2L6HA 5L0IA 4GQHA 4JIOA 1B68A 3B9QA 3Q6MA 3WHNA 2I8BA 1O3UA 3EG9A 2LIGA 2YZSA 4U9DA 4E18A 1ZHZA 4I1OB 1KTMA 2M4EA 2YL1A 1LI7A 3KH2A 2NG1A 3GANA 3V5ZA 4BPMA 1I4ZA 1NZEA 3GEHA 3JYHA 2R7TA 1MMGA 1SZIA 3AG2C 2EILC 3EFOA 3HTKC 5A6BA 1YYJA 3ABMC 3C18A 4XLPF 2XLDA 3K7DA 1A7VA 4Q7CA 1CGNA 3X1OA 3C63A 3HJCA 4EUKB 2F22A 2OEXA 4DRJB 1KNYA 2Q9AA 3H2VA 4I44A 4JTDB 1M6TA 4PR9A 1EI7A 3UR3C 3IPMO 3DJUB 3C7JA 2VASA 1O87A 1YA7O 3CSKA 4PFOA 3DJNB 3KYJA 3V5XA 4PFPA 5CI8A 3M4CA 4C3DA 3NMJA 4DVYP 1I5NA 4E0IA 1Z3IX 4UDVA 5D91A 2ZD9A 3G50A 3JTLO 1U89A 2G3KA 1WWPA 3JYYA 4E7SA 1K40A 4J32B 4OIOF 4I1MA 3O10A 3NG1A 5A6BD 1YAUO 2NUPA 5FCLA 1IZMA 2M64A 2R7WA 4M63A 2Y69C 3JT1A 3K66A 1VYIA 4MNDA 4W8KA 4CX9A 1TFKB 1IW7F 5L0DA 4AL1A 1JRAA 1OW7A 1D0XA 2Q3TA 3EQLF 1VOMA 3DM5A 4MVMA 2AVKA 1VYKA 4JW1A 5F5HA 4F4BA 3ABKC 2PFDA 5BQIA 3ECSA 4MW8A 3N24A 2LP4A 2X0CA 3DD7A 3MLGA 5B1AC 1C02A 2XSEA 5A6JA 1PV3A 4NY3A 2R7OA 2EIJC 2Y3BA 4RD9A 5COGA 1WTYA 2QNLA 1G4US 4U5GA 4OIQF 2R02A 1GM5A 3E70C 3MBGA 2R25A 1NG1A 3SNHA 3NRHA 3RQGA 4J7TA 1HMOA 2J0XA 4IJJA 1MMNA 3M1CB 5K0IA 3DI5A 1TKNA 5COFA 4AE4B 1BZ4A 4MVUA 4U5FE 2LFDA 2OCCC 3DZAA 2XRHA 4XQ1A 4BEJA 3JCUQ 4RBNA 2LFFA 3B29A 4MTFA 3DWWA 2Q4FA 5A6KA 2D5RB 2KC3A 2CDQA 1NLXA 3NYMA 4XPWA 1D0ZA 3V7OA 4OIPF 1ZHWA 3FOPA 5IY5C 1ZHYA 3QW0A 3U9MA 1MNDA 5E33A 3VM6A 1JR8A 3SXKA 2J8WA 4XEVA 2KQ9A 3AGUA 5E3CA 4Z9IA 4H4KC 3SXZA 4DVZA 3B0VC 4YWQA 3DXJF 3LNMB 1HY5A 3RYLA 3KL4A 1T6IA 5GPGB 2LD6A 2E87A 1QVXA 3KPHA 5DS6A 2Y3HA 2V3CC 1NBBA 4JTCB 4O79A 1W2WA 3JZ0A 3U8VA 1HE1A 1VTMP 1VMAA 3S90A 2H7VC 2Q9CA 2ETSA 1PCXA 3F47A 3HNJA 4FX5A 2VB6A 1T01A 4C3EA 5F28E 3CZ6A 3DE8A 3I5PA 1K04A 1PD1A 3JSEO 3TULA 2WVOA 2YWAA 2HMQA 3M4BA 3MFNA 2UUIA 5E2QA 3U8PA 1HE9A 1JPJA 1RKEB 2TMVP 3C62A 3EH2A 3NMIA 3UMHA 4NC3A 4YJWA 3U3BA 4G7OF 1YLMA 4PJMA 3RH3A 4D4XA 4DRIB 2EPNA 2X51A 1ZHTA 2QE9A 2IOQA 2ZXPA 3EGDB 4G78A 1NFOA 3TOLA 3FAPB 3CAXA 1LVKA 2C03A 4KC9A 1FNTc 1G8XA 3GODA 3ASNC 3C8GB 2EPLX 1R5ID 4AK9A 3AQBA 1OR3A 4D4NA 5AC5A 4U5DE 1TWCA 5KYYA 5DQTA 1OCZC 3K1HA 3U9JA 5JS5A 4Q5SF 1C17M 2RD9A 1OKKA 4JJFA 1D1AA 3I5QA 3AG1C 3EGXB 1E2XA 4BEMJ 3ITFA 4HFFB 2W9YA 4Q4ZF 1N1CA 2YLIA 3NMKA 5JVEA 2P6VA 2DB4A 2KGOA 2LQGA 1MQVA 3EFOB 4E7ZA 3CEXA 5L3QA 4R32A 2YKZA 2O9XA 1OW8A 2XLVA 4A2NB 1CGME 3VF0A 4CSAC 1AEPA 1H7IA 1T6UA 3TJ6A 4N6CA 1M56C 4DJ9A 2OEVA 1YDIA 4EKWA 2VCCA 3R2PA 4JZAA 4ULVA 4WABA 2JPUA 4ZLCA 5L0CA 2G62A 5CIVA 4IB4A 4NTBA 4P9TA 2QTVA 5D92A 2ZXRA 4JEAA 4CS9C 4U5BE 2MHRA 1Q0FA 3PMRA 2HZ8A 4G7ZF 4GYTA 5COMA 2YL7A 4DOZA 3R7CA 1QPUA 4U9EA 1VB5A 1C03A 2R03A 1Z6AA 2BC5A 4C7OB 5JT4A 1NU9C 2KSFA 1RMVA 2Y3GA 2P1AA 2EPMX 4E0HA 1MNEA 1O5HA 2IBFA 3AGTA 2VCBA 4ZLDA 4BJ5A 2OJED 4B6IA 1EKYA 3A11A 3EGDA 2WZGA 4WGYA 5T3WA 3U2LA 3S84A 1T9KA 5BQHA 1NU7D 2PP4A 3GORA 3FOOA 3L34A 4IGGA 1QLEC 1LPEA 4NQFA 4O7GA 2Q9BA 2GWWA 2J9UA 2Q7RA 4IRUA 1WN0A 4K0DA 4LDKA 1F1MA 3DE9A 3X2QC 4CS9A 5L0HA 4MTOA 1CPRA 4C3BA 4I3MA 3US6A 5A6AA 5KYNA 1BR1A 1HW1A 1RCPA 1H9TA 1R4TA 1HW2A 1V74B 1SYQA 1TQGA 1OR2A 4MVOA 3B0PA 1S05A 3L0IA 3DKAA 3C8GD 2P61A 4NTFA 4QI2A 4CDVA 2YL3A 2VCAA 1FMVA 1LM3B 2EPKX 2PNOA 3ZC4A 4OINF 3ZQYA 5L0JA 2XXAA 2FAPB 3ZVRA 4Z9HA 3SXMA 2NUPB 4IWBA 3H2UA 4LDQA 3H65A 4MVSA 5JUAA 3DM9B 1TR2A 2QLAA 3PCVA 4HFKB 5L0FA 1G5ZA 1WATA 4NCQA 2D4UA 2NUTB 3SZRA 3ZWIA 3S29A 3UGPA 3SEOA 1KU2A 3S9OA 1A41A 3QW1A 5JRAA 4NTAA 2OQMA 3Q7LA 4O6NA 2GFHA 1BR4A 2MWQA 2OOCA 3RVZA 5A69A 3U0CA 4FWVA 2PX0A 1A7DA 3QTHA 3EJNA 1V4AA 4BG0A 2H8AA 4JVSA 1NFNA 2XXAB 4C7OA 2WVNA 4BJ6A 2KW3C 2OU6A 5L3VA 1BBHA 3ZSUA 1RKEA 5L0GA 3IQCA 4ONSA 1ZU5A 4E17A 1OXKA 4J7YA 3HLZA 5T3TA 5TJ5E 1E86A 2A6HF 2A69F 2PX3A 2R7QA 4EBJA 2R7UA 4EBBA 4MVRA 1FFTC 2A6EF 2Q00A 3LS0A 3QVYA 1M57C 1JMWA 2AWCA 5T1DB 1D0YA 3NYJA 4KNVA 5B3IA 3HNKA 3LEVA 5AC4A 4RDAA 2L7AA 4U5CE 2XL8A 3EZIA 4EBKA 1LE4A 2AU5A 2P0NA 3FHDA 5DQZA 4DXWA 3NDBB 1YARO 5EK0A 3IQ6A 3PHF2 2B0JA 3WODF 1OCRC 4CBEA 3MX3A 3BRJA 3QZCA 2ZPAA 4IAOA 3Q6NA 2A0UA 3IEEA 3EZHA 4YL1A 1GGQA 3VYWA 3GEIA 4O6MA 3N2ZB 4K1OA 4MQ9F 3WAQA 2XLOA 1Y4CA 4OD5A 4CJGA 5KYYB 2XL4A 5HSWA 1EQ1A 1J8YF 1Q0KA 1QZXA 1RXQA 3IQ5A 2IXPA 4LACB 1HMDA 1FTSA 3FDQA 2QUPA 1E85A 1ZW2A 2IXNA 2ICWG 1VK5A 1BDJB 2OG2A 2XL6A 4G7HF 1XWJA 1VLTA 3QMKA 3SXYA 3AG4C 3JSZA 4LLCA 2NUTA 4PK4A 1Z5ZA 2LCHA 2YVKA 2PBEA 2YLGA 3AOUA 4JJGA 4Z9JA 5JP7A 2RSEB 4OIRF 3E9VA 3POVA 1LKXA 3MYIA 4WJ0A 1U0BB 2R7XA 1V54C 1UG7A 4PJJA 3WG7C 2V26A 4LLEA 3FAJA 2WVQA 1LI5A 2HV6A 1FFHA 2YHSA 1Q0GA 4IAQA 1WGWA 2XS8A 4CS7A 3NYLA 5CI9A 4CSAA 1J8MF 1ORJA 2HSQA 2IXOA 2UUHA 4IARA 4KNWA 4U5HA 2FFHA 4JKVA 2J7PA 2L9JA 3OA1A 4JTAB 3M79A 3UNGC 3F46A 1CPQA 5DS4A 3T4RA 2FGYA 3CQZA 3OWTA 5KYUB 3IQTA 4N4WA 4WGZA 3U3FA 3JRMO 2NSGA 3GWNA 2J7PD 3G4ZA 4J30B 2BL2A 4MW3A 3DMDA 1SR2A 4EIYA 1ZHXA 1AVOB 2YL0A 3T6BA 2CW0F 2Z15A 4LDRA 1LS1A 3W8IA 2HJMA 1D1BA 2LSEA 4BJTA 3MYFA 1TWHA 5B3SC 2HSBA 3ATPA 1XZQA 2OJQA 4FESA 4W8PA 3O39A 3ZTZA 3GWLA 4CDAA 1MMAA 1E83A 3LUTB 2ASRA 2L81A 3PDMP 2R7SA 5KYWA 3TQOA 4MVZA 5KYUA 2AWYA 1RKCA 2KK1A 4QI0A 1E84A 4QDLA 1H9GA 3M15A 1M2OA 3O55A 4JC7A 2EIMC 4K7BA 4A4AA 4PJLA 3A9CA 1LS4A 1M2VA
chains in the Genus database with same CATH topology
1UG7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UG7 A; 
#chains in the Genus database with same CATH topology
 4JCH A;  3L8J A;  1Z7Q c;  1APC A;  1GS9 A;  2HJ3 A;  2CGE A;  1YJG A;  3GM2 A;  3KKB A;  3O6X A;  4U5E E;  1H6G A;  2YEV A;  3ABL C;  3EGX A;  3L8I A;  1CGO A;  4N06 A;  2HFI A;  4MVQ A;  4P6I C;  2ZXO A;  2CNW A;  3LJB A;  4KI2 A;  2H7B A;  3I4U A;  1ZVZ A;  2W45 A;  1M2V B;  2L6G A;  3J06 A;  1A0B A;  3GEE A;  4ULW A;  1Y6D A;  1FMW A;  3RFY A;  3RW0 A;  3V5Y A;  2NPU A;  4AL0 A;  2MYS A;  3LAY A;  1QQ3 A;  1A7E A;  3W2V A;  2QY9 A;  2A0B A;  1QKR A;  3LES A;  2WZL A;  2CYD A;  2LK4 A;  3UMK A;  3FMS A;  3K6B A;  2HS5 A;  3HKK A;  4BJ6 C;  1V55 C;  2XM0 A;  1Z63 A;  1OKK D;  4PJN A;  1WAS A;  5BUO A;  1L7C A;  3C8G A;  4CDY A;  4HEA J;  5DVW A;  3AG3 C;  1OCO C;  2CNW D;  2H7O A;  2KJG A;  2EPO A;  2HMZ A;  1D1C A;  2XM4 A;  4FAP B;  4H54 A;  4YL0 A;  2VC9 A;  4HE8 D;  3Q7G A;  256B A;  2AP3 A;  4XTK A;  4XWJ A;  1MMD A;  2IYL D;  3UGO A;  3U2M A;  2NSF A;  4DBR A;  2J9V A;  2J9W A;  3TOM A;  1K05 A;  3ZTM A;  1JAF A;  1NSG B;  1ORS C;  2IXM A;  2XLE A;  2Y3D A;  4P9F A;  3S27 A;  3ZDL A;  1T6Q A;  3K33 A;  1JPN A;  3SYN A;  1ZU4 A;  3RVY A;  2JD3 A;  3ZQV A;  4CS8 A;  5KYX A;  2PF4 E;  2WB7 A;  3EG9 B;  3QVZ A;  3T6J A;  1EA8 A;  3N0T A;  3VRC A;  2GA0 A;  2HKV A;  2WL8 A;  1UFB A;  2J46 A;  3AQC A;  3DAF A;  3LLI A;  2C04 A;  3G4X A;  1PD0 A;  2IM8 A;  3LLK A;  1T5O A;  4BJ1 A;  4MTG A;  3K1I A;  1LE2 A;  3ZG1 A;  2OKU A;  4OD4 A;  3S28 A;  3U5S A;  4ER9 A;  2R7R A;  3NKE A;  1OCC C;  5DS5 A;  4PAC A;  3RQE A;  1TWA A;  2B0H A;  2XLW A;  4X0R A;  2XS1 A;  1DOW A;  3LNR A;  3SP1 A;  3NKD A;  4O6Y A;  3TD7 A;  4YT5 A;  3W4Y A;  3LS1 A;  3DAG A;  3GM1 A;  1RJ9 A;  3W2W A;  1FAP B;  3LEO A;  3C8Z A;  5E3A A;  3ZIB A;  5B1B C;  1YVI A;  2CCY A;  4KBL A;  4BJ5 C;  3EHN A;  2G3V A;  1OW6 A;  2A68 F;  4CIH A;  2YQY A;  4XPX A;  5FZT A;  1DOV A;  2YLD A;  4YK5 A;  4AE4 A;  1Q0D A;  1YZA A;  2VH3 A;  3UMI A;  1JOG A;  1SF8 A;  4DRH B;  2JX0 A;  1TWG A;  3RKO F;  2J9B A;  4YT8 A;  2WZF A;  2R7V A;  3IHU A;  3OEO A;  3RQF A;  3BEH A;  4JEB A;  4L6R A;  2J45 A;  1TFO B;  3EHM A;  1ZYR F;  5EHH A;  3RIP A;  3AJM A;  2KYH A;  2XLH A;  2HV7 A;  3ASO C;  3JRT A;  2DYR C;  2YRF A;  3K1I C;  1G4W R;  3L1M A;  4XEK A;  2R9R B;  3EH1 A;  1ZZP A;  2EIK C;  3KYI A;  5JSL A;  3TJ5 A;  3W8H A;  5DLJ A;  4ANJ A;  1I4Y A;  4YT4 A;  2XLM A;  2DI3 A;  4DBQ A;  2DYS C;  2KNH A;  5EGY A;  3GM3 A;  1YZC A;  1AUE A;  1WOL A;  2HUJ A;  3HNI A;  4CS8 C;  2GAQ A;  2I15 A;  2BE5 F;  2A1D D;  3VAY A;  4EWC A;  5KYX B;  4YT2 A;  4JRZ A;  1ST6 A;  1OXB A;  3EPV A;  3B71 A;  5F5F A;  4G0H A;  4GEH A;  1OQC A;  4XLN F;  2L6F A;  4YL3 A;  5KYW B;  1FR0 A;  2DGJ A;  1QSP A;  3FVY A;  3TK0 A;  4MS2 A;  1YA9 A;  3FXH A;  3S0X A;  4CJO A;  1RJ9 B;  5BQG A;  1SMY F;  4XPY A;  4YN0 B;  1YYX A;  3T9O A;  1Z23 A;  4JUR I;  3T6G B;  5HV9 A;  1ORY A;  1Q0M A;  1BR2 A;  2GDC A;  2W4B A;  4N6H A;  1LIH A;  1ZW3 A;  4EHP A;  5JLI A;  2ZXW C;  4LER A;  4AX2 A;  1L3P A;  3RF3 A;  3B0U X;  2W4M A;  3KMI A;  1S7Z A;  1XZP A;  5AGF A;  1U6H A;  2Y39 A;  1GQA A;  2P7V A;  2R05 A;  2J0W A;  4XEF A;  1VLS A;  4JE9 A;  2EIN C;  3HNL A;  4JCZ A;  4CIP A;  2L6H A;  5L0I A;  4GQH A;  4JIO A;  1B68 A;  3B9Q A;  3Q6M A;  3WHN A;  2I8B A;  1O3U A;  3EG9 A;  2LIG A;  2YZS A;  4U9D A;  4E18 A;  1ZHZ A;  4I1O B;  1KTM A;  2M4E A;  2YL1 A;  1LI7 A;  3KH2 A;  2NG1 A;  3GAN A;  3V5Z A;  4BPM A;  1I4Z A;  1NZE A;  3GEH A;  3JYH A;  2R7T A;  1MMG A;  1SZI A;  3AG2 C;  2EIL C;  3EFO A;  3HTK C;  5A6B A;  1YYJ A;  3ABM C;  3C18 A;  4XLP F;  2XLD A;  3K7D A;  1A7V A;  4Q7C A;  1CGN A;  3X1O A;  3C63 A;  3HJC A;  4EUK B;  2F22 A;  2OEX A;  4DRJ B;  1KNY A;  2Q9A A;  3H2V A;  4I44 A;  4JTD B;  1M6T A;  4PR9 A;  1EI7 A;  3UR3 C;  3IPM O;  3DJU B;  3C7J A;  2VAS A;  1O87 A;  1YA7 O;  3CSK A;  4PFO A;  3DJN B;  3KYJ A;  3V5X A;  4PFP A;  5CI8 A;  3M4C A;  4C3D A;  3NMJ A;  4DVY P;  1I5N A;  4E0I A;  1Z3I X;  4UDV A;  5D91 A;  2ZD9 A;  3G50 A;  3JTL O;  1U89 A;  2G3K A;  1WWP A;  3JYY A;  4E7S A;  1K40 A;  4J32 B;  4OIO F;  4I1M A;  3O10 A;  3NG1 A;  5A6B D;  1YAU O;  2NUP A;  5FCL A;  1IZM A;  2M64 A;  2R7W A;  4M63 A;  2Y69 C;  3JT1 A;  3K66 A;  1VYI A;  4MND A;  4W8K A;  4CX9 A;  1TFK B;  1IW7 F;  5L0D A;  4AL1 A;  1JRA A;  1OW7 A;  1D0X A;  2Q3T A;  3EQL F;  1VOM A;  3DM5 A;  4MVM A;  2AVK A;  1VYK A;  4JW1 A;  5F5H A;  4F4B A;  3ABK C;  2PFD A;  5BQI A;  3ECS A;  4MW8 A;  3N24 A;  2LP4 A;  2X0C A;  3DD7 A;  3MLG A;  5B1A C;  1C02 A;  2XSE A;  5A6J A;  1PV3 A;  4NY3 A;  2R7O A;  2EIJ C;  2Y3B A;  4RD9 A;  5COG A;  1WTY A;  2QNL A;  1G4U S;  4U5G A;  4OIQ F;  2R02 A;  1GM5 A;  3E70 C;  3MBG A;  2R25 A;  1NG1 A;  3SNH A;  3NRH A;  3RQG A;  4J7T A;  1HMO A;  2J0X A;  4IJJ A;  1MMN A;  3M1C B;  5K0I A;  3DI5 A;  1TKN A;  5COF A;  4AE4 B;  1BZ4 A;  4MVU A;  4U5F E;  2LFD A;  2OCC C;  3DZA A;  2XRH A;  4XQ1 A;  4BEJ A;  3JCU Q;  4RBN A;  2LFF A;  3B29 A;  4MTF A;  3DWW A;  2Q4F A;  5A6K A;  2D5R B;  2KC3 A;  2CDQ A;  1NLX A;  3NYM A;  4XPW A;  1D0Z A;  3V7O A;  4OIP F;  1ZHW A;  3FOP A;  5IY5 C;  1ZHY A;  3QW0 A;  3U9M A;  1MND A;  5E33 A;  3VM6 A;  1JR8 A;  3SXK A;  2J8W A;  4XEV A;  2KQ9 A;  3AGU A;  5E3C A;  4Z9I A;  4H4K C;  3SXZ A;  4DVZ A;  3B0V C;  4YWQ A;  3DXJ F;  3LNM B;  1HY5 A;  3RYL A;  3KL4 A;  1T6I A;  5GPG B;  2LD6 A;  2E87 A;  1QVX A;  3KPH A;  5DS6 A;  2Y3H A;  2V3C C;  1NBB A;  4JTC B;  4O79 A;  1W2W A;  3JZ0 A;  3U8V A;  1HE1 A;  1VTM P;  1VMA A;  3S90 A;  2H7V C;  2Q9C A;  2ETS A;  1PCX A;  3F47 A;  3HNJ A;  4FX5 A;  2VB6 A;  1T01 A;  4C3E A;  5F28 E;  3CZ6 A;  3DE8 A;  3I5P A;  1K04 A;  1PD1 A;  3JSE O;  3TUL A;  2WVO A;  2YWA A;  2HMQ A;  3M4B A;  3MFN A;  2UUI A;  5E2Q A;  3U8P A;  1HE9 A;  1JPJ A;  1RKE B;  2TMV P;  3C62 A;  3EH2 A;  3NMI A;  3UMH A;  4NC3 A;  4YJW A;  3U3B A;  4G7O F;  1YLM A;  4PJM A;  3RH3 A;  4D4X A;  4DRI B;  2EPN A;  2X51 A;  1ZHT A;  2QE9 A;  2IOQ A;  2ZXP A;  3EGD B;  4G78 A;  1NFO A;  3TOL A;  3FAP B;  3CAX A;  1LVK A;  2C03 A;  4KC9 A;  1FNT c;  1G8X A;  3GOD A;  3ASN C;  3C8G B;  2EPL X;  1R5I D;  4AK9 A;  3AQB A;  1OR3 A;  4D4N A;  5AC5 A;  4U5D E;  1TWC A;  5KYY A;  5DQT A;  1OCZ C;  3K1H A;  3U9J A;  5JS5 A;  4Q5S F;  1C17 M;  2RD9 A;  1OKK A;  4JJF A;  1D1A A;  3I5Q A;  3AG1 C;  3EGX B;  1E2X A;  4BEM J;  3ITF A;  4HFF B;  2W9Y A;  4Q4Z F;  1N1C A;  2YLI A;  3NMK A;  5JVE A;  2P6V A;  2DB4 A;  2KGO A;  2LQG A;  1MQV A;  3EFO B;  4E7Z A;  3CEX A;  5L3Q A;  4R32 A;  2YKZ A;  2O9X A;  1OW8 A;  2XLV A;  4A2N B;  1CGM E;  3VF0 A;  4CSA C;  1AEP A;  1H7I A;  1T6U A;  3TJ6 A;  4N6C A;  1M56 C;  4DJ9 A;  2OEV A;  1YDI A;  4EKW A;  2VCC A;  3R2P A;  4JZA A;  4ULV A;  4WAB A;  2JPU A;  4ZLC A;  5L0C A;  2G62 A;  5CIV A;  4IB4 A;  4NTB A;  4P9T A;  2QTV A;  5D92 A;  2ZXR A;  4JEA A;  4CS9 C;  4U5B E;  2MHR A;  1Q0F A;  3PMR A;  2HZ8 A;  4G7Z F;  4GYT A;  5COM A;  2YL7 A;  4DOZ A;  3R7C A;  1QPU A;  4U9E A;  1VB5 A;  1C03 A;  2R03 A;  1Z6A A;  2BC5 A;  4C7O B;  5JT4 A;  1NU9 C;  2KSF A;  1RMV A;  2Y3G A;  2P1A A;  2EPM X;  4E0H A;  1MNE A;  1O5H A;  2IBF A;  3AGT A;  2VCB A;  4ZLD A;  4BJ5 A;  2OJE D;  4B6I A;  1EKY A;  3A11 A;  3EGD A;  2WZG A;  4WGY A;  5T3W A;  3U2L A;  3S84 A;  1T9K A;  5BQH A;  1NU7 D;  2PP4 A;  3GOR A;  3FOO A;  3L34 A;  4IGG A;  1QLE C;  1LPE A;  4NQF A;  4O7G A;  2Q9B A;  2GWW A;  2J9U A;  2Q7R A;  4IRU A;  1WN0 A;  4K0D A;  4LDK A;  1F1M A;  3DE9 A;  3X2Q C;  4CS9 A;  5L0H A;  4MTO A;  1CPR A;  4C3B A;  4I3M A;  3US6 A;  5A6A A;  5KYN A;  1BR1 A;  1HW1 A;  1RCP A;  1H9T A;  1R4T A;  1HW2 A;  1V74 B;  1SYQ A;  1TQG A;  1OR2 A;  4MVO A;  3B0P A;  1S05 A;  3L0I A;  3DKA A;  3C8G D;  2P61 A;  4NTF A;  4QI2 A;  4CDV A;  2YL3 A;  2VCA A;  1FMV A;  1LM3 B;  2EPK X;  2PNO A;  3ZC4 A;  4OIN F;  3ZQY A;  5L0J A;  2XXA A;  2FAP B;  3ZVR A;  4Z9H A;  3SXM A;  2NUP B;  4IWB A;  3H2U A;  4LDQ A;  3H65 A;  4MVS A;  5JUA A;  3DM9 B;  1TR2 A;  2QLA A;  3PCV A;  4HFK B;  5L0F A;  1G5Z A;  1WAT A;  4NCQ A;  2D4U A;  2NUT B;  3SZR A;  3ZWI A;  3S29 A;  3UGP A;  3SEO A;  1KU2 A;  3S9O A;  1A41 A;  3QW1 A;  5JRA A;  4NTA A;  2OQM A;  3Q7L A;  4O6N A;  2GFH A;  1BR4 A;  2MWQ A;  2OOC A;  3RVZ A;  5A69 A;  3U0C A;  4FWV A;  2PX0 A;  1A7D A;  3QTH A;  3EJN A;  1V4A A;  4BG0 A;  2H8A A;  4JVS A;  1NFN A;  2XXA B;  4C7O A;  2WVN A;  4BJ6 A;  2KW3 C;  2OU6 A;  5L3V A;  1BBH A;  3ZSU A;  1RKE A;  5L0G A;  3IQC A;  4ONS A;  1ZU5 A;  4E17 A;  1OXK A;  4J7Y A;  3HLZ A;  5T3T A;  5TJ5 E;  1E86 A;  2A6H F;  2A69 F;  2PX3 A;  2R7Q A;  4EBJ A;  2R7U A;  4EBB A;  4MVR A;  1FFT C;  2A6E F;  2Q00 A;  3LS0 A;  3QVY A;  1M57 C;  1JMW A;  2AWC A;  5T1D B;  1D0Y A;  3NYJ A;  4KNV A;  5B3I A;  3HNK A;  3LEV A;  5AC4 A;  4RDA A;  2L7A A;  4U5C E;  2XL8 A;  3EZI A;  4EBK A;  1LE4 A;  2AU5 A;  2P0N A;  3FHD A;  5DQZ A;  4DXW A;  3NDB B;  1YAR O;  5EK0 A;  3IQ6 A;  3PHF 2;  2B0J A;  3WOD F;  1OCR C;  4CBE A;  3MX3 A;  3BRJ A;  3QZC A;  2ZPA A;  4IAO A;  3Q6N A;  2A0U A;  3IEE A;  3EZH A;  4YL1 A;  1GGQ A;  3VYW A;  3GEI A;  4O6M A;  3N2Z B;  4K1O A;  4MQ9 F;  3WAQ A;  2XLO A;  1Y4C A;  4OD5 A;  4CJG A;  5KYY B;  2XL4 A;  5HSW A;  1EQ1 A;  1J8Y F;  1Q0K A;  1QZX A;  1RXQ A;  3IQ5 A;  2IXP A;  4LAC B;  1HMD A;  1FTS A;  3FDQ A;  2QUP A;  1E85 A;  1ZW2 A;  2IXN A;  2ICW G;  1VK5 A;  1BDJ B;  2OG2 A;  2XL6 A;  4G7H F;  1XWJ A;  1VLT A;  3QMK A;  3SXY A;  3AG4 C;  3JSZ A;  4LLC A;  2NUT A;  4PK4 A;  1Z5Z A;  2LCH A;  2YVK A;  2PBE A;  2YLG A;  3AOU A;  4JJG A;  4Z9J A;  5JP7 A;  2RSE B;  4OIR F;  3E9V A;  3POV A;  1LKX A;  3MYI A;  4WJ0 A;  1U0B B;  2R7X A;  1V54 C;  1UG7 A;  4PJJ A;  3WG7 C;  2V26 A;  4LLE A;  3FAJ A;  2WVQ A;  1LI5 A;  2HV6 A;  1FFH A;  2YHS A;  1Q0G A;  4IAQ A;  1WGW A;  2XS8 A;  4CS7 A;  3NYL A;  5CI9 A;  4CSA A;  1J8M F;  1ORJ A;  2HSQ A;  2IXO A;  2UUH A;  4IAR A;  4KNW A;  4U5H A;  2FFH A;  4JKV A;  2J7P A;  2L9J A;  3OA1 A;  4JTA B;  3M79 A;  3UNG C;  3F46 A;  1CPQ A;  5DS4 A;  3T4R A;  2FGY A;  3CQZ A;  3OWT A;  5KYU B;  3IQT A;  4N4W A;  4WGZ A;  3U3F A;  3JRM O;  2NSG A;  3GWN A;  2J7P D;  3G4Z A;  4J30 B;  2BL2 A;  4MW3 A;  3DMD A;  1SR2 A;  4EIY A;  1ZHX A;  1AVO B;  2YL0 A;  3T6B A;  2CW0 F;  2Z15 A;  4LDR A;  1LS1 A;  3W8I A;  2HJM A;  1D1B A;  2LSE A;  4BJT A;  3MYF A;  1TWH A;  5B3S C;  2HSB A;  3ATP A;  1XZQ A;  2OJQ A;  4FES A;  4W8P A;  3O39 A;  3ZTZ A;  3GWL A;  4CDA A;  1MMA A;  1E83 A;  3LUT B;  2ASR A;  2L81 A;  3PDM P;  2R7S A;  5KYW A;  3TQO A;  4MVZ A;  5KYU A;  2AWY A;  1RKC A;  2KK1 A;  4QI0 A;  1E84 A;  4QDL A;  1H9G A;  3M15 A;  1M2O A;  3O55 A;  4JC7 A;  2EIM C;  4K7B A;  4A4A A;  4PJL A;  3A9C A;  1LS4 A;  1M2V A; 
#chains in the Genus database with same CATH homology
 1UG7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...