1UG7A

Solution structure of four helical up-and-down bundle domain of the hypothetical protein 2610208m17rik similar to the protein flj12806
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
128
structure length
128
Chain Sequence
GSSGSSGMSEVTRSLLQRWGASLRRGADFDSWGQLVEAIDEYQILARHLQKEAQAQHNNSEFTEEQKKTIGKIATCLELRSAALQSTQSQEEFKLEDLKKLEPILKNILTYNKEFPFDVQPISGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2610208M17Rik protein
publication title Solution structure of four helical up-and-down bundle domain of the hypothetical protein 2610208M17Rik similar to the protein FLJ12806
rcsb
source organism Mus musculus
molecule tags Structural genomics, unknown function
total genus 31
structure length 128
sequence length 128
ec nomenclature
pdb deposition date 2003-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08910 Aida_N Aida N-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.360 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Axin interactor, dorsalization-associated protein, N-terminal domain 1ug7A00
1UG7A
chains in the Genus database with same CATH superfamily
3DMDA 5JRAA 1OKKA 2AWCA 1FNTc 5K0IA 3LEVA 2G3KA 1Z3IX 1VMAA 4J32B 2AVKA 3FAJA 4JJFA 4U9EA 3U9JA 4YL1A 1ZHTA 5CI8A 5BQHA 3DM9B 3EGDA 1ORJA 3QW1A 3AGUA 3NG1A 1J8MF 1O87A 3DZAA 3RFYA 3DD7A 5T1DB 4GYTA 3C7JA 4N6HA 1T9KA 2R05A 2XLDA 1PD0A 3C8GA 4JEAA 2IXOA 3T4RA 4ZLDA 3HNKA 2XLEA 4PFPA 2L6FA 4EUKB 4HFKB 4XTKA 2HUJA 3I5PA 4JC7A 4AE4A 2NG1A 1M6TA 1WTYA 3DJNB 4J7YA 4MVUA 4BJ1A 4XEKA 3E70C 2IYLD 2Q9CA 5F5HA 2KJGA 1PD1A 4WGYA 4NTAA 1BDJB 3SXMA 4B6IA 4Z9HA 2KNHA 4EBBA 1Q0MA 2YKZA 5D92A 1FAPB 4W8KA 5AC4A 2Y39A 3N2ZB 1XZPA 3QW0A 1APCA 4J30B 4D4NA 1QLEC 1VK5A 3R7CA 1ZZPA 3MYIA 1M2VB 2B0JA 3QTHA 2R7UA 1C03A 2CYDA 2PP4A 3HKKA 3S27A 3WHNA 1HW2A 2C04A 1YZAA 2WB7A 3IQCA 4XPXA 3TOLA 1QZXA 4YL0A 2KQ9A 4EWCA 1GQAA 3Q6NA 4WABA 4DJ9A 2KYHA 2ASRA 2PX0A 3E9VA 4PJLA 1I4YA 3EHMA 1TWAA 1ZU4A 1JOGA 3GEEA 3NKEA 5KYUA 3NRHA 5L0HA 3I5QA 3S84A 3MBGA 1LS1A 3FVYA 4JW1A 4H54A 4O7GA 3O6XA 3JRTA 2EINC 3POVA 1KTMA 1JPJA 3GODA 4LDKA 1VYIA 4U5GA 2WVQA 3VF0A 2Y3DA 1FMWA 3FXHA 2IOQA 1YYXA 4QDLA 1OR3A 5AC5A 1ORYA 2LSEA 2P1AA 2OU6A 5CI9A 3ASOC 1FFTC 4IARA 4C7OA 1NFOA 1WATA 3RQFA 2KC3A 3DWWA 1G8XA 4AL1A 3WODF 1VB5A 1K40A 2LIGA 4MVZA 4E17A 2P6VA 3LLIA 2PBEA 1EKYA 4BPMA 2YL7A 1CGNA 1RJ9B 3T6JA 1TR2A 256BA 2R25A 1Q0KA 4PK4A 3ZSUA 5DQTA 3T6GB 2A0UA 2MHRA 4U5CE 2G62A 3VRCA 4Z9IA 4HE8D 2M64A 4OIOF 2ICWG 3K1IA 1V54C 1SMYF 3F46A 1QQ3A 1KNYA 4O6MA 3AG2C 4YL3A 4JTAB 5DVWA 5E3CA 4KI2A 3U8VA 1JRAA 2CNWD 1H7IA 3GWNA 5L3QA 3SNHA 2H7VC 1U89A 5E2QA 2L6HA 2J7PA 3EQLF 1Z7Qc 3M1CB 4ANJA 3PCVA 1JR8A 3JYYA 2GWWA 3ABLC 1RKEB 1U0BB 1ZVZA 3QMKA 4CJGA 1D0XA 3ZDLA 3L8JA 1GS9A 2JD3A 3O55A 1MMDA 2XLMA 1YARO 3U2MA 3DI5A 1Q0DA 1C02A 2V3CC 1YYJA 1F1MA 1EA8A 3JSEO 3C63A 4N06A 2XM0A 3AGTA 3NYJA 1VYKA 3C18A 3DXJF 4P9TA 3J06A 1H6GA 2J9WA 4U5BE 5B3IA 1A7EA 3W8IA 1OXKA 3ZTZA 4DBQA 4P6IC 3VM6A 2HZ8A 2LQGA 3CZ6A 4I44A 4YK5A 5EHHA 4OINF 5A6JA 1QVXA 2XSEA 3ASNC 3HNJA 3TJ6A 3LNMB 2NSFA 2A6EF 1T6IA 1QKRA 4QI0A 2DB4A 2Y3GA 1ZHXA 3JSZA 3LEOA 1EQ1A 2F22A 2IBFA 1JMWA 1T6QA 4CS7A 1MMNA 1XWJA 3T6BA 3GORA 4G0HA 2XM4A 1ZHYA 1M2VA 4JTDB 4RDAA 4A4AA 2L7AA 3EH2A 2XLOA 2Q7RA 1NLXA 3B29A 4HEAJ 1BR2A 2Y3BA 5B1AC 3V5XA 5L0IA 1S05A 3NDBB 2A6HF 2NUTB 1RMVA 1A41A 2DYSC 5A6BA 4NCQA 2X0CA 4CBEA 3UGPA 5L0DA 3BRJA 1MNDA 4NTBA 1OR2A 2GA0A 3EJNA 5T3TA 5KYNA 1YA7O 4KNVA 2EILC 4BJ5A 2WZFA 1G5ZA 2KSFA 4XEFA 3TOMA 4I1OB 2HKVA 5JVEA 4NY3A 4PFOA 3RVYA 4BG0A 2R7TA 2LFFA 2H7OA 4G78A 1YA9A 4IRUA 2OJQA 1NG1A 1ZW3A 1CGOA 2G3VA 4CSAA 2Q4FA 2VB6A 1NU7D 2WVOA 3GEIA 4FWVA 5JS5A 3FDQA 3SXYA 3PHF2 1HMOA 1OW6A 3JCUQ 3LLKA 2R02A 4NQFA 3JTLO 2CCYA 4H4KC 4P9FA 3ZVRA 2EIMC 3SEOA 5A6AA 5IY5C 1Z23A 2VC9A 2LK4A 3EZHA 4BJ6A 3LUTB 1OXBA 1ST6A 4PJJA 5E3AA 3K66A 3RKOF 5KYWB 4EKWA 4CIPA 5BUOA 1QPUA 2KGOA 2CGEA 2J8WA 1M2OA 3DKAA 3TQOA 4LDQA 3X1OA 5BQIA 2W45A 4JE9A 4UDVA 1Q0FA 3A11A 2H8AA 2X51A 5F28E 3ZC4A 4EIYA 3ZTMA 3U5SA 3EGXB 2R9RB 1D1CA 3K1IC 3RH3A 2R7QA 3M4BA 1G4WR 1YDIA 5KYXB 2EPOA 3AQCA 3EG9B 3SYNA 3VYWA 1C17M 2QUPA 5F5FA 4AL0A 2UUIA 2IXNA 1PCXA 4CS8A 3UNGC 4EBJA 2PNOA 1SR2A 1NSGB 4G7HF 4XLPF 1FR0A 2ZXRA 2NPUA 2YEVA 2ZXOA 4O79A 1LKXA 1MMGA 4BJTA 2P7VA 3AQBA 4XQ1A 3OWTA 1TFKB 3OA1A 5JP7A 2E87A 4X0RA 4GEHA 4LERA 3HNIA 5A6KA 3M15A 1ZHZA 1AEPA 1V74B 1MMAA 4FESA 3U3BA 2J9BA 5JUAA 3S90A 1LI5A 3EFOB 3GEHA 2FFHA 2J45A 1TWCA 2HSQA 5COGA 1NBBA 2MYSA 3N24A 3AG3C 1HMDA 2OKUA 4PJNA 4BEJA 1TWHA 3K33A 2BC5A 3KMIA 1WN0A 3RVZA 4MVSA 3RQEA 3GANA 1NFNA 2Q9AA 5DLJA 3SXKA 1YZCA 3NMKA 3FAPB 2AU5A 2OJED 3UR3C 2HFIA 5FCLA 1OKKD 2A1DD 4JEBA 5KYYA 5HV9A 4JCZA 2OCCC 4KNWA 3EGDB 1GGQA 1OW7A 2EIJC 4YWQA 2NUTA 4E7ZA 4JIOA 3ZQYA 1FFHA 4MS2A 2IM8A 3ZQVA 3S29A 1HE1A 1SF8A 1VOMA 2A0BA 3V7OA 1RXQA 3IEEA 3C8GB 1O3UA 4JJGA 4RD9A 3ZG1A 3CQZA 1RCPA 3S9OA 1W2WA 4ULWA 3C8GD 3HNLA 4K7BA 4U5FE 1ORSC 3LNRA 3ECSA 1A0BA 2R7OA 4MTOA 4AE4B 4DVZA 3BEHA 3NMJA 1D1BA 4MNDA 4MTFA 4BJ5C 4KBLA 3NYLA 3UGOA 5DS5A 2D4UA 4M63A 3FMSA 3B71A 2C03A 2NSGA 1S7ZA 2YRFA 3U3FA 4N6CA 2LCHA 1RKCA 2YLDA 3US6A 1E83A 4L6RA 4AK9A 1E84A 4OIRF 4CSAC 4E18A 3GM1A 4IAQA 4Q4ZF 4Q7CA 4EHPA 1G4US 3OEOA 1E85A 3CEXA 1JPNA 1U6HA 2JX0A 3U0CA 4JKVA 1Z63A 2LFDA 1I4ZA 2LP4A 3KL4A 4JCHA 3EZIA 3W4YA 2V26A 1OW8A 4JTCB 1WOLA 4BJ6C 3TJ5A 4N4WA 3GM2A 1L3PA 5EK0A 5B3SC 4OIQF 2BE5F 3LJBA 2ZD9A 4XEVA 2I8BA 1BR4A 3EGXA 3GWLA 1Q0GA 4MW3A 4QI2A 2WVNA 1JAFA 2YVKA 3LAYA 4XPWA 1LM3B 1WWPA 3QVZA 5KYXA 4WGZA 3V5YA 4OD4A 3AG1C 1MQVA 3C62A 3G4XA 4DBRA 2XLHA 4BEMJ 3EHNA 5JT4A 3ZWIA 2R7VA 1DOVA 2HSBA 3CSKA 3KH2A 2O9XA 2RD9A 3PMRA 2R7WA 2CW0F 4C7OB 4C3BA 3NKDA 2PF4E 3ATPA 1VLTA 3U8PA 3N0TA 4YT8A 2DYRC 3RYLA 2NUPB 2AWYA 3LESA 4C3DA 4CS8C 2W4MA 4Z9JA 5A69A 3JZ0A 1H9GA 3L1MA 4YT5A 2EPMX 2EPNA 2I15A 3U2LA 4CX9A 2YLGA 3VAYA 3QVYA 2B0HA 3MYFA 2HJMA 4WJ0A 4CS9A 2EIKC 2R7XA 5GPGB 3KKBA 1CPRA 4HFFB 3ZIBA 1Z5ZA 4MW8A 1OCCC 4C3EA 1FMVA 2ZXPA 2IXPA 1OCZC 1BZ4A 2HS5A 2UUHA 3ITFA 2R7RA 4YT2A 1B68A 2A68F 4I3MA 3Q7GA 1Y6DA 3DE9A 5TJ5E 2PX3A 1RJ9A 5L0FA 4FX5A 4G7ZF 5JSLA 2Z15A 2OQMA 1K04A 3H2UA 2QTVA 3EPVA 1XZQA 2MWQA 5D91A 5BQGA 1NZEA 1HE9A 4NTFA 1VTMP 2J7PD 4YT4A 3W2VA 1IZMA 3UMKA 2W9YA 2LD6A 2CNWA 5L3VA 2A69F 2QLAA 3DJUB 3FOPA 4E7SA 5EGYA 1E86A 1L7CA 3S28A 4K1OA 3CAXA 2YWAA 2HJ3A 2GFHA 4A2NB 4AX2A 2VCCA 4W8PA 1V55C 4U5DE 1RKEA 1SZIA 2OEXA 2XLWA 4IAOA 3RF3A 3L0IA 4ER9A 1KU2A 1E2XA 4KC9A 3H65A 3F47A 5CIVA 2XRHA 2FAPB 2FGYA 2YQYA 2XXAB 2YL0A 4ONSA 4LLEA 2CDQA 4EBKA 2GAQA 4YJWA 3UMHA 1FTSA 2DGJA 1AUEA 4GQHA 1OCOC 3Q7LA 5B1BC 1WASA 1LE4A 2J0WA 4E0IA 2KK1A 3IQ6A 2KW3C 3K7DA 3TD7A 3MX3A 1H9TA 3DAFA 2YLIA 3SXZA 2J0XA 2BL2A 3AJMA 3DAGA 4MVQA 3RIPA 3S0XA 2AP3A 1TKNA 3KYJA 4DRJB 2ETSA 3V5ZA 4CDAA 1Z6AA 2JPUA 3TK0A 1LPEA 1J8YF 2EPKX 1UG7A 2EPLX 3MLGA 2XL8A 2QE9A 4MVOA 4R32A 1OCRC 3O39A 3SZRA 1SYQA 3B0UX 1D0YA 4O6NA 2XL6A 3AG4C 3NYMA 5DS6A 3JT1A 1ZW2A 4I1MA 4PR9A 3JRMO 5A6BD 2D5RB 3W8HA 3GM3A 5DS4A 2HMQA 1HY5A 2XS1A 3ABMC 1BBHA 4O6YA 4DRHB 2WZLA 3A9CA 3SP1A 1LS4A 1I5NA 4K0DA 2OEVA 4JVSA 2OOCA 2GDCA 4ULVA 2H7BA 5T3WA 2HV7A 4MVRA 1ZHWA 1YAUO 4U9DA 1T5OA 1LIHA 3WAQA 1WGWA 3IHUA 2L6GA 2WZGA 1HW1A 3L8IA 3QZCA 4LACB 2OG2A 1T6UA 3B9QA 1O5HA 3R2PA 5HSWA 2W4BA 1LI7A 1Y4CA 2RSEB 1T01A 3C8ZA 1OQCA 2Y69C 3AOUA 3I4UA 2NUPA 4XPYA 1NU9C 2YL3A 3MFNA 5L0JA 1V4AA 1A7VA 2YL1A 2TMVP 3O10A 1EI7A 4U5HA 2L9JA 1M57C 3FOOA 3KPHA 5L0GA 1PV3A 1A7DA 1YVIA 4DVYP 2P0NA 2ZXWC 3UMIA 2J9VA 3W2WA 4OD5A 2XL4A 4MTGA 1D0ZA 4PACA 3JYHA 2Q00A 3DE8A 3M79A 3HTKC 3IQTA 4JURI 4CS9C 4RBNA 2QNLA 3X2QC 5COFA 4E0HA 2M4EA 5DQZA 3K6BA 2PFDA 2L81A 1GM5A 2QY9A 1ZU5A 3WG7C 3KYIA 1BR1A 5KYWA 4IJJA 3G50A 4DOZA 4MQ9F 3HJCA 2XLVA 5COMA 3LS1A 3H2VA 4MVMA 2IXMA 3IQ5A 2HMZA 3K1HA 2Q3TA 2VASA 4PJMA 2J9UA 3EH1A 4G7OF 4XLNF 5KYUB 2Y3HA 4CDVA 1YJGA 1R4TA 2J46A 4OIPF 4IWBA 3G4ZA 1QSPA 1K05A 2R03A 3EG9A 2DI3A 4LLCA 4CJOA 3TULA 4CIHA 1TQGA 4JRZA 5FZTA 1CPQA 1R5ID 3L34A 3LS0A 2WL8A 2XXAA 3FHDA 4DRIB 3Q6MA 3RW0A 1LVKA 3PDMP 1D1AA 3NMIA 4IGGA 4ZLCA 1CGME 5L0CA 1DOWA 1ZYRF 4U5EE 3DM5A 2Q9BA 2XS8A 5E33A 3B0VC 1VLSA 2YZSA 1UFBA 1AVOB 4NC3A 3HLZA 2VCBA 2VCAA 4XWJA 3IPMO 4YN0B 2R7SA 1M56C 5AGFA 4Q5SF 4D4XA 4FAPB 4F4BA 3EFOA 3ABKC 3U9MA 5KYYB 1LE2A 4LDRA 2HV6A 1TFOB 5JLIA 4JZAA 4J7TA 3T9OA 1IW7F 1N1CA 3B0PA 2VH3A 3M4CA 2YHSA 2ZPAA 4CDYA 4DXWA 1YLMA 3RQGA 1MNEA 1TWGA 4IB4A 2P61A
chains in the Genus database with same CATH topology
1UG7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UG7 A; 
#chains in the Genus database with same CATH topology
 3DMD A;  5JRA A;  1OKK A;  2AWC A;  1FNT c;  5K0I A;  3LEV A;  2G3K A;  1Z3I X;  1VMA A;  4J32 B;  2AVK A;  3FAJ A;  4JJF A;  4U9E A;  3U9J A;  4YL1 A;  1ZHT A;  5CI8 A;  5BQH A;  3DM9 B;  3EGD A;  1ORJ A;  3QW1 A;  3AGU A;  3NG1 A;  1J8M F;  1O87 A;  3DZA A;  3RFY A;  3DD7 A;  5T1D B;  4GYT A;  3C7J A;  4N6H A;  1T9K A;  2R05 A;  2XLD A;  1PD0 A;  3C8G A;  4JEA A;  2IXO A;  3T4R A;  4ZLD A;  3HNK A;  2XLE A;  4PFP A;  2L6F A;  4EUK B;  4HFK B;  4XTK A;  2HUJ A;  3I5P A;  4JC7 A;  4AE4 A;  2NG1 A;  1M6T A;  1WTY A;  3DJN B;  4J7Y A;  4MVU A;  4BJ1 A;  4XEK A;  3E70 C;  2IYL D;  2Q9C A;  5F5H A;  2KJG A;  1PD1 A;  4WGY A;  4NTA A;  1BDJ B;  3SXM A;  4B6I A;  4Z9H A;  2KNH A;  4EBB A;  1Q0M A;  2YKZ A;  5D92 A;  1FAP B;  4W8K A;  5AC4 A;  2Y39 A;  3N2Z B;  1XZP A;  3QW0 A;  1APC A;  4J30 B;  4D4N A;  1QLE C;  1VK5 A;  3R7C A;  1ZZP A;  3MYI A;  1M2V B;  2B0J A;  3QTH A;  2R7U A;  1C03 A;  2CYD A;  2PP4 A;  3HKK A;  3S27 A;  3WHN A;  1HW2 A;  2C04 A;  1YZA A;  2WB7 A;  3IQC A;  4XPX A;  3TOL A;  1QZX A;  4YL0 A;  2KQ9 A;  4EWC A;  1GQA A;  3Q6N A;  4WAB A;  4DJ9 A;  2KYH A;  2ASR A;  2PX0 A;  3E9V A;  4PJL A;  1I4Y A;  3EHM A;  1TWA A;  1ZU4 A;  1JOG A;  3GEE A;  3NKE A;  5KYU A;  3NRH A;  5L0H A;  3I5Q A;  3S84 A;  3MBG A;  1LS1 A;  3FVY A;  4JW1 A;  4H54 A;  4O7G A;  3O6X A;  3JRT A;  2EIN C;  3POV A;  1KTM A;  1JPJ A;  3GOD A;  4LDK A;  1VYI A;  4U5G A;  2WVQ A;  3VF0 A;  2Y3D A;  1FMW A;  3FXH A;  2IOQ A;  1YYX A;  4QDL A;  1OR3 A;  5AC5 A;  1ORY A;  2LSE A;  2P1A A;  2OU6 A;  5CI9 A;  3ASO C;  1FFT C;  4IAR A;  4C7O A;  1NFO A;  1WAT A;  3RQF A;  2KC3 A;  3DWW A;  1G8X A;  4AL1 A;  3WOD F;  1VB5 A;  1K40 A;  2LIG A;  4MVZ A;  4E17 A;  2P6V A;  3LLI A;  2PBE A;  1EKY A;  4BPM A;  2YL7 A;  1CGN A;  1RJ9 B;  3T6J A;  1TR2 A;  256B A;  2R25 A;  1Q0K A;  4PK4 A;  3ZSU A;  5DQT A;  3T6G B;  2A0U A;  2MHR A;  4U5C E;  2G62 A;  3VRC A;  4Z9I A;  4HE8 D;  2M64 A;  4OIO F;  2ICW G;  3K1I A;  1V54 C;  1SMY F;  3F46 A;  1QQ3 A;  1KNY A;  4O6M A;  3AG2 C;  4YL3 A;  4JTA B;  5DVW A;  5E3C A;  4KI2 A;  3U8V A;  1JRA A;  2CNW D;  1H7I A;  3GWN A;  5L3Q A;  3SNH A;  2H7V C;  1U89 A;  5E2Q A;  2L6H A;  2J7P A;  3EQL F;  1Z7Q c;  3M1C B;  4ANJ A;  3PCV A;  1JR8 A;  3JYY A;  2GWW A;  3ABL C;  1RKE B;  1U0B B;  1ZVZ A;  3QMK A;  4CJG A;  1D0X A;  3ZDL A;  3L8J A;  1GS9 A;  2JD3 A;  3O55 A;  1MMD A;  2XLM A;  1YAR O;  3U2M A;  3DI5 A;  1Q0D A;  1C02 A;  2V3C C;  1YYJ A;  1F1M A;  1EA8 A;  3JSE O;  3C63 A;  4N06 A;  2XM0 A;  3AGT A;  3NYJ A;  1VYK A;  3C18 A;  3DXJ F;  4P9T A;  3J06 A;  1H6G A;  2J9W A;  4U5B E;  5B3I A;  1A7E A;  3W8I A;  1OXK A;  3ZTZ A;  4DBQ A;  4P6I C;  3VM6 A;  2HZ8 A;  2LQG A;  3CZ6 A;  4I44 A;  4YK5 A;  5EHH A;  4OIN F;  5A6J A;  1QVX A;  2XSE A;  3ASN C;  3HNJ A;  3TJ6 A;  3LNM B;  2NSF A;  2A6E F;  1T6I A;  1QKR A;  4QI0 A;  2DB4 A;  2Y3G A;  1ZHX A;  3JSZ A;  3LEO A;  1EQ1 A;  2F22 A;  2IBF A;  1JMW A;  1T6Q A;  4CS7 A;  1MMN A;  1XWJ A;  3T6B A;  3GOR A;  4G0H A;  2XM4 A;  1ZHY A;  1M2V A;  4JTD B;  4RDA A;  4A4A A;  2L7A A;  3EH2 A;  2XLO A;  2Q7R A;  1NLX A;  3B29 A;  4HEA J;  1BR2 A;  2Y3B A;  5B1A C;  3V5X A;  5L0I A;  1S05 A;  3NDB B;  2A6H F;  2NUT B;  1RMV A;  1A41 A;  2DYS C;  5A6B A;  4NCQ A;  2X0C A;  4CBE A;  3UGP A;  5L0D A;  3BRJ A;  1MND A;  4NTB A;  1OR2 A;  2GA0 A;  3EJN A;  5T3T A;  5KYN A;  1YA7 O;  4KNV A;  2EIL C;  4BJ5 A;  2WZF A;  1G5Z A;  2KSF A;  4XEF A;  3TOM A;  4I1O B;  2HKV A;  5JVE A;  4NY3 A;  4PFO A;  3RVY A;  4BG0 A;  2R7T A;  2LFF A;  2H7O A;  4G78 A;  1YA9 A;  4IRU A;  2OJQ A;  1NG1 A;  1ZW3 A;  1CGO A;  2G3V A;  4CSA A;  2Q4F A;  2VB6 A;  1NU7 D;  2WVO A;  3GEI A;  4FWV A;  5JS5 A;  3FDQ A;  3SXY A;  3PHF 2;  1HMO A;  1OW6 A;  3JCU Q;  3LLK A;  2R02 A;  4NQF A;  3JTL O;  2CCY A;  4H4K C;  4P9F A;  3ZVR A;  2EIM C;  3SEO A;  5A6A A;  5IY5 C;  1Z23 A;  2VC9 A;  2LK4 A;  3EZH A;  4BJ6 A;  3LUT B;  1OXB A;  1ST6 A;  4PJJ A;  5E3A A;  3K66 A;  3RKO F;  5KYW B;  4EKW A;  4CIP A;  5BUO A;  1QPU A;  2KGO A;  2CGE A;  2J8W A;  1M2O A;  3DKA A;  3TQO A;  4LDQ A;  3X1O A;  5BQI A;  2W45 A;  4JE9 A;  4UDV A;  1Q0F A;  3A11 A;  2H8A A;  2X51 A;  5F28 E;  3ZC4 A;  4EIY A;  3ZTM A;  3U5S A;  3EGX B;  2R9R B;  1D1C A;  3K1I C;  3RH3 A;  2R7Q A;  3M4B A;  1G4W R;  1YDI A;  5KYX B;  2EPO A;  3AQC A;  3EG9 B;  3SYN A;  3VYW A;  1C17 M;  2QUP A;  5F5F A;  4AL0 A;  2UUI A;  2IXN A;  1PCX A;  4CS8 A;  3UNG C;  4EBJ A;  2PNO A;  1SR2 A;  1NSG B;  4G7H F;  4XLP F;  1FR0 A;  2ZXR A;  2NPU A;  2YEV A;  2ZXO A;  4O79 A;  1LKX A;  1MMG A;  4BJT A;  2P7V A;  3AQB A;  4XQ1 A;  3OWT A;  1TFK B;  3OA1 A;  5JP7 A;  2E87 A;  4X0R A;  4GEH A;  4LER A;  3HNI A;  5A6K A;  3M15 A;  1ZHZ A;  1AEP A;  1V74 B;  1MMA A;  4FES A;  3U3B A;  2J9B A;  5JUA A;  3S90 A;  1LI5 A;  3EFO B;  3GEH A;  2FFH A;  2J45 A;  1TWC A;  2HSQ A;  5COG A;  1NBB A;  2MYS A;  3N24 A;  3AG3 C;  1HMD A;  2OKU A;  4PJN A;  4BEJ A;  1TWH A;  3K33 A;  2BC5 A;  3KMI A;  1WN0 A;  3RVZ A;  4MVS A;  3RQE A;  3GAN A;  1NFN A;  2Q9A A;  5DLJ A;  3SXK A;  1YZC A;  3NMK A;  3FAP B;  2AU5 A;  2OJE D;  3UR3 C;  2HFI A;  5FCL A;  1OKK D;  2A1D D;  4JEB A;  5KYY A;  5HV9 A;  4JCZ A;  2OCC C;  4KNW A;  3EGD B;  1GGQ A;  1OW7 A;  2EIJ C;  4YWQ A;  2NUT A;  4E7Z A;  4JIO A;  3ZQY A;  1FFH A;  4MS2 A;  2IM8 A;  3ZQV A;  3S29 A;  1HE1 A;  1SF8 A;  1VOM A;  2A0B A;  3V7O A;  1RXQ A;  3IEE A;  3C8G B;  1O3U A;  4JJG A;  4RD9 A;  3ZG1 A;  3CQZ A;  1RCP A;  3S9O A;  1W2W A;  4ULW A;  3C8G D;  3HNL A;  4K7B A;  4U5F E;  1ORS C;  3LNR A;  3ECS A;  1A0B A;  2R7O A;  4MTO A;  4AE4 B;  4DVZ A;  3BEH A;  3NMJ A;  1D1B A;  4MND A;  4MTF A;  4BJ5 C;  4KBL A;  3NYL A;  3UGO A;  5DS5 A;  2D4U A;  4M63 A;  3FMS A;  3B71 A;  2C03 A;  2NSG A;  1S7Z A;  2YRF A;  3U3F A;  4N6C A;  2LCH A;  1RKC A;  2YLD A;  3US6 A;  1E83 A;  4L6R A;  4AK9 A;  1E84 A;  4OIR F;  4CSA C;  4E18 A;  3GM1 A;  4IAQ A;  4Q4Z F;  4Q7C A;  4EHP A;  1G4U S;  3OEO A;  1E85 A;  3CEX A;  1JPN A;  1U6H A;  2JX0 A;  3U0C A;  4JKV A;  1Z63 A;  2LFD A;  1I4Z A;  2LP4 A;  3KL4 A;  4JCH A;  3EZI A;  3W4Y A;  2V26 A;  1OW8 A;  4JTC B;  1WOL A;  4BJ6 C;  3TJ5 A;  4N4W A;  3GM2 A;  1L3P A;  5EK0 A;  5B3S C;  4OIQ F;  2BE5 F;  3LJB A;  2ZD9 A;  4XEV A;  2I8B A;  1BR4 A;  3EGX A;  3GWL A;  1Q0G A;  4MW3 A;  4QI2 A;  2WVN A;  1JAF A;  2YVK A;  3LAY A;  4XPW A;  1LM3 B;  1WWP A;  3QVZ A;  5KYX A;  4WGZ A;  3V5Y A;  4OD4 A;  3AG1 C;  1MQV A;  3C62 A;  3G4X A;  4DBR A;  2XLH A;  4BEM J;  3EHN A;  5JT4 A;  3ZWI A;  2R7V A;  1DOV A;  2HSB A;  3CSK A;  3KH2 A;  2O9X A;  2RD9 A;  3PMR A;  2R7W A;  2CW0 F;  4C7O B;  4C3B A;  3NKD A;  2PF4 E;  3ATP A;  1VLT A;  3U8P A;  3N0T A;  4YT8 A;  2DYR C;  3RYL A;  2NUP B;  2AWY A;  3LES A;  4C3D A;  4CS8 C;  2W4M A;  4Z9J A;  5A69 A;  3JZ0 A;  1H9G A;  3L1M A;  4YT5 A;  2EPM X;  2EPN A;  2I15 A;  3U2L A;  4CX9 A;  2YLG A;  3VAY A;  3QVY A;  2B0H A;  3MYF A;  2HJM A;  4WJ0 A;  4CS9 A;  2EIK C;  2R7X A;  5GPG B;  3KKB A;  1CPR A;  4HFF B;  3ZIB A;  1Z5Z A;  4MW8 A;  1OCC C;  4C3E A;  1FMV A;  2ZXP A;  2IXP A;  1OCZ C;  1BZ4 A;  2HS5 A;  2UUH A;  3ITF A;  2R7R A;  4YT2 A;  1B68 A;  2A68 F;  4I3M A;  3Q7G A;  1Y6D A;  3DE9 A;  5TJ5 E;  2PX3 A;  1RJ9 A;  5L0F A;  4FX5 A;  4G7Z F;  5JSL A;  2Z15 A;  2OQM A;  1K04 A;  3H2U A;  2QTV A;  3EPV A;  1XZQ A;  2MWQ A;  5D91 A;  5BQG A;  1NZE A;  1HE9 A;  4NTF A;  1VTM P;  2J7P D;  4YT4 A;  3W2V A;  1IZM A;  3UMK A;  2W9Y A;  2LD6 A;  2CNW A;  5L3V A;  2A69 F;  2QLA A;  3DJU B;  3FOP A;  4E7S A;  5EGY A;  1E86 A;  1L7C A;  3S28 A;  4K1O A;  3CAX A;  2YWA A;  2HJ3 A;  2GFH A;  4A2N B;  4AX2 A;  2VCC A;  4W8P A;  1V55 C;  4U5D E;  1RKE A;  1SZI A;  2OEX A;  2XLW A;  4IAO A;  3RF3 A;  3L0I A;  4ER9 A;  1KU2 A;  1E2X A;  4KC9 A;  3H65 A;  3F47 A;  5CIV A;  2XRH A;  2FAP B;  2FGY A;  2YQY A;  2XXA B;  2YL0 A;  4ONS A;  4LLE A;  2CDQ A;  4EBK A;  2GAQ A;  4YJW A;  3UMH A;  1FTS A;  2DGJ A;  1AUE A;  4GQH A;  1OCO C;  3Q7L A;  5B1B C;  1WAS A;  1LE4 A;  2J0W A;  4E0I A;  2KK1 A;  3IQ6 A;  2KW3 C;  3K7D A;  3TD7 A;  3MX3 A;  1H9T A;  3DAF A;  2YLI A;  3SXZ A;  2J0X A;  2BL2 A;  3AJM A;  3DAG A;  4MVQ A;  3RIP A;  3S0X A;  2AP3 A;  1TKN A;  3KYJ A;  4DRJ B;  2ETS A;  3V5Z A;  4CDA A;  1Z6A A;  2JPU A;  3TK0 A;  1LPE A;  1J8Y F;  2EPK X;  1UG7 A;  2EPL X;  3MLG A;  2XL8 A;  2QE9 A;  4MVO A;  4R32 A;  1OCR C;  3O39 A;  3SZR A;  1SYQ A;  3B0U X;  1D0Y A;  4O6N A;  2XL6 A;  3AG4 C;  3NYM A;  5DS6 A;  3JT1 A;  1ZW2 A;  4I1M A;  4PR9 A;  3JRM O;  5A6B D;  2D5R B;  3W8H A;  3GM3 A;  5DS4 A;  2HMQ A;  1HY5 A;  2XS1 A;  3ABM C;  1BBH A;  4O6Y A;  4DRH B;  2WZL A;  3A9C A;  3SP1 A;  1LS4 A;  1I5N A;  4K0D A;  2OEV A;  4JVS A;  2OOC A;  2GDC A;  4ULV A;  2H7B A;  5T3W A;  2HV7 A;  4MVR A;  1ZHW A;  1YAU O;  4U9D A;  1T5O A;  1LIH A;  3WAQ A;  1WGW A;  3IHU A;  2L6G A;  2WZG A;  1HW1 A;  3L8I A;  3QZC A;  4LAC B;  2OG2 A;  1T6U A;  3B9Q A;  1O5H A;  3R2P A;  5HSW A;  2W4B A;  1LI7 A;  1Y4C A;  2RSE B;  1T01 A;  3C8Z A;  1OQC A;  2Y69 C;  3AOU A;  3I4U A;  2NUP A;  4XPY A;  1NU9 C;  2YL3 A;  3MFN A;  5L0J A;  1V4A A;  1A7V A;  2YL1 A;  2TMV P;  3O10 A;  1EI7 A;  4U5H A;  2L9J A;  1M57 C;  3FOO A;  3KPH A;  5L0G A;  1PV3 A;  1A7D A;  1YVI A;  4DVY P;  2P0N A;  2ZXW C;  3UMI A;  2J9V A;  3W2W A;  4OD5 A;  2XL4 A;  4MTG A;  1D0Z A;  4PAC A;  3JYH A;  2Q00 A;  3DE8 A;  3M79 A;  3HTK C;  3IQT A;  4JUR I;  4CS9 C;  4RBN A;  2QNL A;  3X2Q C;  5COF A;  4E0H A;  2M4E A;  5DQZ A;  3K6B A;  2PFD A;  2L81 A;  1GM5 A;  2QY9 A;  1ZU5 A;  3WG7 C;  3KYI A;  1BR1 A;  5KYW A;  4IJJ A;  3G50 A;  4DOZ A;  4MQ9 F;  3HJC A;  2XLV A;  5COM A;  3LS1 A;  3H2V A;  4MVM A;  2IXM A;  3IQ5 A;  2HMZ A;  3K1H A;  2Q3T A;  2VAS A;  4PJM A;  2J9U A;  3EH1 A;  4G7O F;  4XLN F;  5KYU B;  2Y3H A;  4CDV A;  1YJG A;  1R4T A;  2J46 A;  4OIP F;  4IWB A;  3G4Z A;  1QSP A;  1K05 A;  2R03 A;  3EG9 A;  2DI3 A;  4LLC A;  4CJO A;  3TUL A;  4CIH A;  1TQG A;  4JRZ A;  5FZT A;  1CPQ A;  1R5I D;  3L34 A;  3LS0 A;  2WL8 A;  2XXA A;  3FHD A;  4DRI B;  3Q6M A;  3RW0 A;  1LVK A;  3PDM P;  1D1A A;  3NMI A;  4IGG A;  4ZLC A;  1CGM E;  5L0C A;  1DOW A;  1ZYR F;  4U5E E;  3DM5 A;  2Q9B A;  2XS8 A;  5E33 A;  3B0V C;  1VLS A;  2YZS A;  1UFB A;  1AVO B;  4NC3 A;  3HLZ A;  2VCB A;  2VCA A;  4XWJ A;  3IPM O;  4YN0 B;  2R7S A;  1M56 C;  5AGF A;  4Q5S F;  4D4X A;  4FAP B;  4F4B A;  3EFO A;  3ABK C;  3U9M A;  5KYY B;  1LE2 A;  4LDR A;  2HV6 A;  1TFO B;  5JLI A;  4JZA A;  4J7T A;  3T9O A;  1IW7 F;  1N1C A;  3B0P A;  2VH3 A;  3M4C A;  2YHS A;  2ZPA A;  4CDY A;  4DXW A;  1YLM A;  3RQG A;  1MNE A;  1TWG A;  4IB4 A;  2P61 A; 
#chains in the Genus database with same CATH homology
 1UG7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...