1UG7A

Solution structure of four helical up-and-down bundle domain of the hypothetical protein 2610208m17rik similar to the protein flj12806
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
128
structure length
128
Chain Sequence
GSSGSSGMSEVTRSLLQRWGASLRRGADFDSWGQLVEAIDEYQILARHLQKEAQAQHNNSEFTEEQKKTIGKIATCLELRSAALQSTQSQEEFKLEDLKKLEPILKNILTYNKEFPFDVQPISGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords 2610208M17Rik protein
publication title Solution structure of four helical up-and-down bundle domain of the hypothetical protein 2610208M17Rik similar to the protein FLJ12806
rcsb
source organism Mus musculus
total genus 31
structure length 128
sequence length 128
ec nomenclature
pdb deposition date 2003-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08910 Aida_N Aida N-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.360 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Axin interactor, dorsalization-associated protein, N-terminal domain 1ug7A00
1UG7A
chains in the Genus database with same CATH superfamily
2QNLA 1KTMA 3RQFA 2HV6A 1E83A 3WG7C 3CQZA 1T01A 3K1IC 3HTKC 4GYTA 2ZXRA 3RIPA 2DB4A 1GGQA 2R25A 3S84A 3FOPA 1NU7D 2O9XA 2Q3TA 4MTOA 3IQCA 2W9YA 2CCYA 4AL1A 4E7ZA 2YL3A 4G7ZF 4JTCB 4JEAA 3NMJA 3ZQYA 2L6GA 3M4BA 4NTBA 1Y6DA 4WGYA 1ZHTA 2AU5A 1C03A 1DOWA 1XWJA 2D5RB 3I5PA 4N6CA 1Z23A 4DRHB 1NFNA 2X0CA 3DZAA 2Z15A 3J06A 4YT8A 1OCZC 3FMSA 3L1MA 1ZU4A 1T6UA 3GANA 3L8JA 2EPOA 5JSLA 4L6RA 1LS1A 1IW7F 1CGOA 3ZDLA 2B0JA 5F28E 2HV7A 1O87A 1TWHA 5GPGB 1JAFA 1HW1A 1PD1A 3O39A 5A6AA 4OIOF 5JS5A 3VAYA 5EHHA 1M6TA 4BG0A 2Y3GA 4Z9IA 4MVQA 3EG9A 1LI5A 2X51A 3NKDA 4N6HA 3A9CA 3S90A 1LS4A 2HKVA 2L7AA 2ZXOA 4H54A 3H2UA 1Z63A 4OIQF 256BA 5A6KA 2YEVA 1Z7Qc 3IQTA 3VYWA 1Z3IX 1NBBA 1T6IA 4CS8C 3GM1A 3LEOA 1JRAA 3S0XA 4JVSA 1A7EA 1T5OA 2MHRA 4ULVA 2BE5F 1YARO 2G3KA 3HLZA 1J8YF 4D4NA 4U5HA 4OD5A 3OEOA 4NC3A 5T3WA 1GS9A 5EGYA 1YA7O 4KNWA 4I1OB 1QSPA 4DOZA 1Y4CA 1BDJB 2RD9A 4FX5A 4JRZA 1YZCA 2J8WA 4NQFA 1FFHA 3EGDA 1WOLA 2J46A 3JCUQ 1E84A 4HE8D 3B71A 2AWCA 3IQ5A 1YYXA 1BR1A 4K1OA 4P6IC 1XZQA 3HNLA 4CJGA 2R7TA 2XXAB 1NU9C 4JW1A 2ETSA 2KSFA 3RF3A 1Q0KA 2A6HF 3IPMO 3NKEA 2OOCA 2WL8A 3NYMA 3R7CA 3NDBB 4W8PA 4U5BE 2XM0A 3IHUA 3FDQA 2LIGA 1RJ9A 2OJQA 3S9OA 3V5ZA 4EBKA 3DAFA 4U5EE 3CAXA 3JT1A 3Q7LA 2XXAA 1EQ1A 3ASOC 3T6GB 1HE9A 3QZCA 1Q0MA 1V74B 4YK5A 2LFDA 5DQTA 3X1OA 3GM3A 4J32B 3SXKA 1RKEB 2PX3A 4LDKA 1PCXA 3DM9B 4BJ5C 2R7RA 3CSKA 3EHMA 3FXHA 2L9JA 3NMKA 3U5SA 2VB6A 3KKBA 4PFOA 4BEMJ 3L34A 5E3AA 1RCPA 4PJMA 3JYHA 4JIOA 5F5HA 2J9WA 1N1CA 1QQ3A 1T6QA 2YRFA 3GWLA 4O79A 2HSBA 4JCZA 1MNDA 3L8IA 2A1DD 3LEVA 3TJ5A 3NG1A 2PNOA 5JUAA 1MMNA 1MMDA 3U8VA 2UUHA 1A7DA 1NG1A 3EZIA 5B1BC 3E9VA 3GWNA 1TWCA 2LK4A 3UNGC 3ABMC 4PJLA 2YLIA 3OA1A 4U5GA 3ABKC 1A7VA 4I3MA 4RD9A 4DXWA 1VTMP 2P1AA 3F47A 2IYLD 4W8KA 4XPYA 2A68F 3LS1A 1VYIA 3W2VA 3AJMA 4MTGA 4KC9A 2DYRC 4ZLDA 3QVYA 4J7YA 3AGUA 2R7QA 5HV9A 2XL6A 3JTLO 4Z9HA 3DJUB 3ZG1A 5L0DA 1MMGA 5COMA 2YQYA 5F5FA 3A11A 2H7VC 2KK1A 1D0YA 3H2VA 1OXBA 4G0HA 2XL4A 4O6MA 3DKAA 5KYYB 4G7OF 3FHDA 2IBFA 1DOVA 2H8AA 3JSZA 2WZFA 3W4YA 4C3EA 4IWBA 4D4XA 1SF8A 1OXKA 1YVIA 4CSAA 1YDIA 3AQBA 3MX3A 1OR3A 3T4RA 1OCCC 1GQAA 1V54C 4C7OA 5EK0A 1S7ZA 4XTKA 3QW1A 2IXPA 1KU2A 2IM8A 3V7OA 1NLXA 3K7DA 2XSEA 3RW0A 3RYLA 4MVOA 2Y3HA 1VYKA 3X2QC 3W2WA 1PV3A 3UMKA 1VMAA 3DXJF 1M57C 5KYWB 3LJBA 3AG2C 1SR2A 4MW8A 2UUIA 1QPUA 3ITFA 4CDYA 2YWAA 4EBBA 4JCHA 4Z9JA 1OCRC 3U2MA 2P6VA 2PP4A 5KYWA 1U89A 4U5CE 1QVXA 3LESA 3OWTA 4BJ6A 1TWAA 3FAPB 4K0DA 3ZWIA 1U6HA 5AC4A 2AVKA 5L0HA 1E85A 2Y69C 3DWWA 2MWQA 2L6FA 3ZC4A 4U5FE 5JP7A 3ATPA 2YLDA 3T6BA 3WAQA 1FTSA 2NUPB 1UFBA 3SP1A 2GA0A 3LNRA 5E2QA 4YT2A 3SEOA 4CJOA 4AX2A 3IQ6A 1H9TA 2QUPA 1U0BB 1K05A 1C02A 3KL4A 3GODA 4IGGA 3RVYA 1O5HA 3K6BA 1OR2A 3TK0A 3EHNA 3JSEO 4IRUA 2M4EA 4RDAA 1D0ZA 5A6BD 4Q5SF 1K40A 2Q9CA 4DBRA 2P0NA 1APCA 2R7OA 4A4AA 3N2ZB 2P61A 1TKNA 2XLEA 1D1AA 5KYNA 3G4ZA 4JJGA 4CSAC 1HY5A 2CGEA 4G7HF 5CI9A 3KH2A 2PF4E 3AGTA 4YJWA 2OKUA 4MQ9F 3V5YA 2YKZA 4DBQA 2EPLX 4J7TA 4DVZA 1RKCA 1EA8A 1AUEA 4QI0A 3EZHA 4ZLCA 2LSEA 3M15A 3PHF2 2XLMA 2A0UA 4YL0A 2VCAA 3RVZA 2HMZA 3NRHA 2XLOA 2DI3A 4QI2A 3B0PA 1FR0A 3V5XA 4KI2A 3ECSA 1JPJA 3B0UX 5L0JA 4XEFA 1E86A 5CI8A 1EKYA 2XLHA 2ICWG 5AGFA 5DQZA 3RQGA 2LD6A 3MLGA 1HE1A 4BJ6C 3PMRA 4CS9A 3TQOA 4XLPF 4EIYA 2WB7A 4U9EA 4IB4A 1SZIA 3KMIA 3T9OA 3NYLA 3W8HA 5A6BA 4CX9A 2WVNA 3FOOA 2IXNA 5JT4A 3TULA 4NTFA 5DVWA 1H9GA 2A69F 2R03A 2XLWA 3RH3A 1I5NA 5T1DB 2YVKA 3S29A 4E7SA 2HS5A 2GWWA 4OD4A 1ORYA 2ASRA 1IZMA 2WZLA 3TJ6A 1FMVA 2EPKX 3EFOB 1OW6A 2OQMA 4EUKB 3O6XA 4ER9A 3LLIA 3EJNA 3EGXB 2BC5A 3KYJA 5BQHA 2QY9A 2A6EF 1RKEA 2LQGA 2R7XA 4DRJB 2YL7A 5IY5C 3LAYA 3UGPA 2ZXWC 4XQ1A 1YJGA 1ZW2A 3HNJA 5KYUB 3Q7GA 4XPWA 4YL1A 3O55A 2J9UA 2NG1A 3JRTA 4HFKB 4WGZA 3C62A 5DLJA 3POVA 2XLVA 3EGXA 3JYYA 3UMHA 1OKKD 2B0HA 3TOMA 5FZTA 1A41A 2HUJA 2AP3A 3HKKA 1B68A 2W45A 1LIHA 3TD7A 1QZXA 2J9VA 3Q6MA 1CPQA 1ORJA 4HEAJ 4DVYP 1LE4A 3QW0A 3MYIA 3T6JA 2L81A 2OCCC 4MVZA 2I8BA 4WABA 2C04A 4XEVA 3LNMB 1M2VB 4JURI 3ZIBA 3U2LA 5A69A 3M79A 2GDCA 2DGJA 2D4UA 3RFYA 2EPMX 1TQGA 3SXMA 3QTHA 2NPUA 5BUOA 1E2XA 3EH2A 4MVMA 3SYNA 1VOMA 4OIRF 3K66A 3S28A 1ZYRF 4RBNA 3ZSUA 2WVOA 1Z5ZA 4F4BA 2XS8A 1WATA 2EINC 3I5QA 1TFKB 4K7BA 4PK4A 5TJ5E 4CIHA 1M2OA 2V26A 2VC9A 1Q0GA 2R9RB 4QDLA 3W8IA 4JKVA 4KNVA 4AK9A 4U9DA 3U3BA 5L0GA 4AE4B 3UGOA 4KBLA 2G62A 4E18A 1RMVA 1AEPA 1D1CA 1R4TA 3UR3C 4E17A 2KYHA 3B29A 5KYYA 2OU6A 1ZZPA 5B1AC 3SXYA 4CS9C 1YLMA 1LPEA 2TMVP 5BQGA 4PR9A 1V55C 2L6HA 4WJ0A 4XWJA 1OKKA 5L0CA 4MVRA 1LE2A 3LS0A 1H6GA 4IAQA 1CGNA 4LERA 3GEIA 1CPRA 4JEBA 4JE9A 2I15A 4EKWA 4LLCA 2VCBA 1LI7A 3VF0A 2GFHA 1SMYF 2GAQA 2IOQA 3N0TA 3QVZA 4DJ9A 4U5DE 1ORSC 3JRMO 2EILC 1Q0DA 1WTYA 3BRJA 5E33A 4ULWA 3Q6NA 4UDVA 3SXZA 2DYSC 4LDRA 4YN0B 5COGA 4C3BA 3GORA 1MQVA 3DM5A 3S27A 1G4WR 3GEEA 2J0WA 2HFIA 1ZW3A 2CW0F 1RXQA 2IXOA 4CS7A 4YWQA 4Q4ZF 1HMOA 5D91A 2J7PD 2YL1A 1ZHXA 3F46A 3FAJA 1VB5A 1Q0FA 2HSQA 3DJNB 1C17M 1LVKA 2W4MA 3AQCA 1TR2A 2EIKC 4JC7A 1EI7A 2ZPAA 5L3QA 1AVOB 2HJMA 1ZHWA 2H7BA 2KQ9A 3WHNA 2HZ8A 4DRIB 3H65A 4MS2A 3BEHA 5E3CA 2OEVA 4ANJA 4JTAB 4M63A 1BR4A 2NUPA 4ONSA 4R32A 2KNHA 2V3CC 4PJNA 5K0IA 1HMDA 2LFFA 4O7GA 4BEJA 4C3DA 3KPHA 1I4ZA 4X0RA 1VLTA 2OJED 4NY3A 2R05A 1OCOC 3DE8A 4J30B 5KYXB 3SNHA 3B0VC 3NMIA 3VM6A 1BR2A 5FCLA 5L0IA 4O6YA 1BBHA 3HNKA 4XEKA 2YZSA 5L0FA 1D0XA 4P9FA 4BJ5A 1NZEA 4EHPA 5B3SC 1JR8A 2F22A 4HFFB 3LUTB 1G4US 3PDMP 3EG9B 3ZTZA 4FWVA 3IEEA 2R7SA 2KJGA 5JRAA 4JJFA 4LLEA 2PBEA 3G50A 1OQCA 3VRCA 5CIVA 5KYXA 2LCHA 2BL2A 1WGWA 2PFDA 2FAPB 3G4XA 2P7VA 1WN0A 1L3PA 1SYQA 4E0HA 3LLKA 2W4BA 2J7PA 4OIPF 1FAPB 3CZ6A 4FESA 3EH1A 3C8GD 3WODF 1GM5A 1CGME 2FFHA 3MYFA 4H4KC 1WASA 3AG4C 4B6IA 4EBJA 1FFTC 1K04A 3AOUA 3L0IA 5COFA 5T3TA 3EPVA 3U9MA 2CYDA 2Y3BA 1NFOA 3AG1C 1L7CA 1VK5A 3EQLF 3U0CA 1MMAA 2OG2A 2MYSA 3C8ZA 3UMIA 2EPNA 3EGDB 1A0BA 2H7OA 3K33A 2XLDA 1XZPA 2J0XA 2Y3DA 3MBGA 1T9KA 4BPMA 1TFOB 3N24A 2CDQA 5JLIA 4YL3A 4MVSA 1HW2A 1F1MA 4GQHA 1ZHYA 2KC3A 3GM2A 1R5ID 3PCVA 2YLGA 3U3FA 4AL0A 4FAPB 1RJ9B 2VASA 3E70C 2PX0A 2LP4A 2QE9A 3AG3C 1D1BA 3DAGA 1OW7A 3US6A 3C8GB 4A2NB 2NUTB 1S05A 2G3VA 2YHSA 3HJCA 2NSGA 4MTFA 1YA9A 2EIMC 3DI5A 2Q00A 4BJTA 5L3VA 1LKXA 4I44A 3I4UA 3C18A 4CDVA 5JVEA 3EFOA 3C7JA 2M64A 1FNTc 3FVYA 3U8PA 4I1MA 2WVQA 4JTDB 4YT4A 3C8GA 2NUTA 1BZ4A 2Q4FA 1V4AA 2QTVA 3ZQVA 4CIPA 1FMWA 1TWGA 2ZXPA 2A0BA 3K1IA 2VH3A 1PD0A 1J8MF 2VCCA 3B9QA 1YAUO 2WZGA 2Y39A 2XS1A 3JZ0A 4PJJA 4YT5A 5KYUA 1LM3B 1JPNA 4P9TA 4JZAA 1MNEA 3ZTMA 3U9JA 4N06A 1VLSA 4Q7CA 3O10A 2CNWD 2J45A 2FGYA 4IJJA 1H7IA 2HMQA 1JOGA 1W2WA 1YYJA 2R7VA 1M2VA 4MVUA 1QLEC 1ST6A 2YL0A 2R7UA 2E87A 3C63A 2HJ3A 5DS5A 1WWPA 1OW8A 2RSEB 4IAOA 1KNYA 4EWCA 1NSGB 3HNIA 2ZD9A 3CEXA 3NYJA 5D92A 4PFPA 2AWYA 2OEXA 3ABLC 3KYIA 5BQIA 1M56C 3M4CA 4G78A 2Q7RA 3SZRA 1YZAA 3DD7A 4XPXA 5B3IA 2KGOA 2XL8A 3GEHA 4MNDA 3K1HA 4PACA 1ZHZA 2Q9BA 4BJ1A 4CBEA 4CDAA 4AE4A 4N4WA 4NTAA 5DS4A 2NSFA 3ASNC 2JPUA 1G5ZA 3RKOF 2XRHA 2XM4A 4C7OB 5A6JA 1O3UA 2QLAA 1JMWA 2KW3C 4MW3A 2JD3A 4OINF 3RQEA 4NCQA 4CS8A 2EIJC 1I4YA 1ZVZA 3DE9A 2J9BA 2JX0A 3QMKA 3R2PA 3ZVRA 2R7WA 2CNWA 2Q9AA 1UG7A 2IXMA 1QKRA 3M1CB 3TOLA 2C03A 3DMDA 4O6NA 1Z6AA 3MFNA 4IARA 4XLNF 4E0IA 5DS6A 2R02A 5HSWA 1G8XA 5AC5A 4LACB 4GEHA 1ZU5A 4LDQA
chains in the Genus database with same CATH topology
1UG7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UG7 A; 
#chains in the Genus database with same CATH topology
 2QNL A;  1KTM A;  3RQF A;  2HV6 A;  1E83 A;  3WG7 C;  3CQZ A;  1T01 A;  3K1I C;  3HTK C;  4GYT A;  2ZXR A;  3RIP A;  2DB4 A;  1GGQ A;  2R25 A;  3S84 A;  3FOP A;  1NU7 D;  2O9X A;  2Q3T A;  4MTO A;  3IQC A;  2W9Y A;  2CCY A;  4AL1 A;  4E7Z A;  2YL3 A;  4G7Z F;  4JTC B;  4JEA A;  3NMJ A;  3ZQY A;  2L6G A;  3M4B A;  4NTB A;  1Y6D A;  4WGY A;  1ZHT A;  2AU5 A;  1C03 A;  1DOW A;  1XWJ A;  2D5R B;  3I5P A;  4N6C A;  1Z23 A;  4DRH B;  1NFN A;  2X0C A;  3DZA A;  2Z15 A;  3J06 A;  4YT8 A;  1OCZ C;  3FMS A;  3L1M A;  1ZU4 A;  1T6U A;  3GAN A;  3L8J A;  2EPO A;  5JSL A;  4L6R A;  1LS1 A;  1IW7 F;  1CGO A;  3ZDL A;  2B0J A;  5F28 E;  2HV7 A;  1O87 A;  1TWH A;  5GPG B;  1JAF A;  1HW1 A;  1PD1 A;  3O39 A;  5A6A A;  4OIO F;  5JS5 A;  3VAY A;  5EHH A;  1M6T A;  4BG0 A;  2Y3G A;  4Z9I A;  4MVQ A;  3EG9 A;  1LI5 A;  2X51 A;  3NKD A;  4N6H A;  3A9C A;  3S90 A;  1LS4 A;  2HKV A;  2L7A A;  2ZXO A;  4H54 A;  3H2U A;  1Z63 A;  4OIQ F;  256B A;  5A6K A;  2YEV A;  1Z7Q c;  3IQT A;  3VYW A;  1Z3I X;  1NBB A;  1T6I A;  4CS8 C;  3GM1 A;  3LEO A;  1JRA A;  3S0X A;  4JVS A;  1A7E A;  1T5O A;  2MHR A;  4ULV A;  2BE5 F;  1YAR O;  2G3K A;  3HLZ A;  1J8Y F;  4D4N A;  4U5H A;  4OD5 A;  3OEO A;  4NC3 A;  5T3W A;  1GS9 A;  5EGY A;  1YA7 O;  4KNW A;  4I1O B;  1QSP A;  4DOZ A;  1Y4C A;  1BDJ B;  2RD9 A;  4FX5 A;  4JRZ A;  1YZC A;  2J8W A;  4NQF A;  1FFH A;  3EGD A;  1WOL A;  2J46 A;  3JCU Q;  1E84 A;  4HE8 D;  3B71 A;  2AWC A;  3IQ5 A;  1YYX A;  1BR1 A;  4K1O A;  4P6I C;  1XZQ A;  3HNL A;  4CJG A;  2R7T A;  2XXA B;  1NU9 C;  4JW1 A;  2ETS A;  2KSF A;  3RF3 A;  1Q0K A;  2A6H F;  3IPM O;  3NKE A;  2OOC A;  2WL8 A;  3NYM A;  3R7C A;  3NDB B;  4W8P A;  4U5B E;  2XM0 A;  3IHU A;  3FDQ A;  2LIG A;  1RJ9 A;  2OJQ A;  3S9O A;  3V5Z A;  4EBK A;  3DAF A;  4U5E E;  3CAX A;  3JT1 A;  3Q7L A;  2XXA A;  1EQ1 A;  3ASO C;  3T6G B;  1HE9 A;  3QZC A;  1Q0M A;  1V74 B;  4YK5 A;  2LFD A;  5DQT A;  3X1O A;  3GM3 A;  4J32 B;  3SXK A;  1RKE B;  2PX3 A;  4LDK A;  1PCX A;  3DM9 B;  4BJ5 C;  2R7R A;  3CSK A;  3EHM A;  3FXH A;  2L9J A;  3NMK A;  3U5S A;  2VB6 A;  3KKB A;  4PFO A;  4BEM J;  3L34 A;  5E3A A;  1RCP A;  4PJM A;  3JYH A;  4JIO A;  5F5H A;  2J9W A;  1N1C A;  1QQ3 A;  1T6Q A;  2YRF A;  3GWL A;  4O79 A;  2HSB A;  4JCZ A;  1MND A;  3L8I A;  2A1D D;  3LEV A;  3TJ5 A;  3NG1 A;  2PNO A;  5JUA A;  1MMN A;  1MMD A;  3U8V A;  2UUH A;  1A7D A;  1NG1 A;  3EZI A;  5B1B C;  3E9V A;  3GWN A;  1TWC A;  2LK4 A;  3UNG C;  3ABM C;  4PJL A;  2YLI A;  3OA1 A;  4U5G A;  3ABK C;  1A7V A;  4I3M A;  4RD9 A;  4DXW A;  1VTM P;  2P1A A;  3F47 A;  2IYL D;  4W8K A;  4XPY A;  2A68 F;  3LS1 A;  1VYI A;  3W2V A;  3AJM A;  4MTG A;  4KC9 A;  2DYR C;  4ZLD A;  3QVY A;  4J7Y A;  3AGU A;  2R7Q A;  5HV9 A;  2XL6 A;  3JTL O;  4Z9H A;  3DJU B;  3ZG1 A;  5L0D A;  1MMG A;  5COM A;  2YQY A;  5F5F A;  3A11 A;  2H7V C;  2KK1 A;  1D0Y A;  3H2V A;  1OXB A;  4G0H A;  2XL4 A;  4O6M A;  3DKA A;  5KYY B;  4G7O F;  3FHD A;  2IBF A;  1DOV A;  2H8A A;  3JSZ A;  2WZF A;  3W4Y A;  4C3E A;  4IWB A;  4D4X A;  1SF8 A;  1OXK A;  1YVI A;  4CSA A;  1YDI A;  3AQB A;  3MX3 A;  1OR3 A;  3T4R A;  1OCC C;  1GQA A;  1V54 C;  4C7O A;  5EK0 A;  1S7Z A;  4XTK A;  3QW1 A;  2IXP A;  1KU2 A;  2IM8 A;  3V7O A;  1NLX A;  3K7D A;  2XSE A;  3RW0 A;  3RYL A;  4MVO A;  2Y3H A;  1VYK A;  3X2Q C;  3W2W A;  1PV3 A;  3UMK A;  1VMA A;  3DXJ F;  1M57 C;  5KYW B;  3LJB A;  3AG2 C;  1SR2 A;  4MW8 A;  2UUI A;  1QPU A;  3ITF A;  4CDY A;  2YWA A;  4EBB A;  4JCH A;  4Z9J A;  1OCR C;  3U2M A;  2P6V A;  2PP4 A;  5KYW A;  1U89 A;  4U5C E;  1QVX A;  3LES A;  3OWT A;  4BJ6 A;  1TWA A;  3FAP B;  4K0D A;  3ZWI A;  1U6H A;  5AC4 A;  2AVK A;  5L0H A;  1E85 A;  2Y69 C;  3DWW A;  2MWQ A;  2L6F A;  3ZC4 A;  4U5F E;  5JP7 A;  3ATP A;  2YLD A;  3T6B A;  3WAQ A;  1FTS A;  2NUP B;  1UFB A;  3SP1 A;  2GA0 A;  3LNR A;  5E2Q A;  4YT2 A;  3SEO A;  4CJO A;  4AX2 A;  3IQ6 A;  1H9T A;  2QUP A;  1U0B B;  1K05 A;  1C02 A;  3KL4 A;  3GOD A;  4IGG A;  3RVY A;  1O5H A;  3K6B A;  1OR2 A;  3TK0 A;  3EHN A;  3JSE O;  4IRU A;  2M4E A;  4RDA A;  1D0Z A;  5A6B D;  4Q5S F;  1K40 A;  2Q9C A;  4DBR A;  2P0N A;  1APC A;  2R7O A;  4A4A A;  3N2Z B;  2P61 A;  1TKN A;  2XLE A;  1D1A A;  5KYN A;  3G4Z A;  4JJG A;  4CSA C;  1HY5 A;  2CGE A;  4G7H F;  5CI9 A;  3KH2 A;  2PF4 E;  3AGT A;  4YJW A;  2OKU A;  4MQ9 F;  3V5Y A;  2YKZ A;  4DBQ A;  2EPL X;  4J7T A;  4DVZ A;  1RKC A;  1EA8 A;  1AUE A;  4QI0 A;  3EZH A;  4ZLC A;  2LSE A;  3M15 A;  3PHF 2;  2XLM A;  2A0U A;  4YL0 A;  2VCA A;  3RVZ A;  2HMZ A;  3NRH A;  2XLO A;  2DI3 A;  4QI2 A;  3B0P A;  1FR0 A;  3V5X A;  4KI2 A;  3ECS A;  1JPJ A;  3B0U X;  5L0J A;  4XEF A;  1E86 A;  5CI8 A;  1EKY A;  2XLH A;  2ICW G;  5AGF A;  5DQZ A;  3RQG A;  2LD6 A;  3MLG A;  1HE1 A;  4BJ6 C;  3PMR A;  4CS9 A;  3TQO A;  4XLP F;  4EIY A;  2WB7 A;  4U9E A;  4IB4 A;  1SZI A;  3KMI A;  3T9O A;  3NYL A;  3W8H A;  5A6B A;  4CX9 A;  2WVN A;  3FOO A;  2IXN A;  5JT4 A;  3TUL A;  4NTF A;  5DVW A;  1H9G A;  2A69 F;  2R03 A;  2XLW A;  3RH3 A;  1I5N A;  5T1D B;  2YVK A;  3S29 A;  4E7S A;  2HS5 A;  2GWW A;  4OD4 A;  1ORY A;  2ASR A;  1IZM A;  2WZL A;  3TJ6 A;  1FMV A;  2EPK X;  3EFO B;  1OW6 A;  2OQM A;  4EUK B;  3O6X A;  4ER9 A;  3LLI A;  3EJN A;  3EGX B;  2BC5 A;  3KYJ A;  5BQH A;  2QY9 A;  2A6E F;  1RKE A;  2LQG A;  2R7X A;  4DRJ B;  2YL7 A;  5IY5 C;  3LAY A;  3UGP A;  2ZXW C;  4XQ1 A;  1YJG A;  1ZW2 A;  3HNJ A;  5KYU B;  3Q7G A;  4XPW A;  4YL1 A;  3O55 A;  2J9U A;  2NG1 A;  3JRT A;  4HFK B;  4WGZ A;  3C62 A;  5DLJ A;  3POV A;  2XLV A;  3EGX A;  3JYY A;  3UMH A;  1OKK D;  2B0H A;  3TOM A;  5FZT A;  1A41 A;  2HUJ A;  2AP3 A;  3HKK A;  1B68 A;  2W45 A;  1LIH A;  3TD7 A;  1QZX A;  2J9V A;  3Q6M A;  1CPQ A;  1ORJ A;  4HEA J;  4DVY P;  1LE4 A;  3QW0 A;  3MYI A;  3T6J A;  2L81 A;  2OCC C;  4MVZ A;  2I8B A;  4WAB A;  2C04 A;  4XEV A;  3LNM B;  1M2V B;  4JUR I;  3ZIB A;  3U2L A;  5A69 A;  3M79 A;  2GDC A;  2DGJ A;  2D4U A;  3RFY A;  2EPM X;  1TQG A;  3SXM A;  3QTH A;  2NPU A;  5BUO A;  1E2X A;  3EH2 A;  4MVM A;  3SYN A;  1VOM A;  4OIR F;  3K66 A;  3S28 A;  1ZYR F;  4RBN A;  3ZSU A;  2WVO A;  1Z5Z A;  4F4B A;  2XS8 A;  1WAT A;  2EIN C;  3I5Q A;  1TFK B;  4K7B A;  4PK4 A;  5TJ5 E;  4CIH A;  1M2O A;  2V26 A;  2VC9 A;  1Q0G A;  2R9R B;  4QDL A;  3W8I A;  4JKV A;  4KNV A;  4AK9 A;  4U9D A;  3U3B A;  5L0G A;  4AE4 B;  3UGO A;  4KBL A;  2G62 A;  4E18 A;  1RMV A;  1AEP A;  1D1C A;  1R4T A;  3UR3 C;  4E17 A;  2KYH A;  3B29 A;  5KYY A;  2OU6 A;  1ZZP A;  5B1A C;  3SXY A;  4CS9 C;  1YLM A;  1LPE A;  2TMV P;  5BQG A;  4PR9 A;  1V55 C;  2L6H A;  4WJ0 A;  4XWJ A;  1OKK A;  5L0C A;  4MVR A;  1LE2 A;  3LS0 A;  1H6G A;  4IAQ A;  1CGN A;  4LER A;  3GEI A;  1CPR A;  4JEB A;  4JE9 A;  2I15 A;  4EKW A;  4LLC A;  2VCB A;  1LI7 A;  3VF0 A;  2GFH A;  1SMY F;  2GAQ A;  2IOQ A;  3N0T A;  3QVZ A;  4DJ9 A;  4U5D E;  1ORS C;  3JRM O;  2EIL C;  1Q0D A;  1WTY A;  3BRJ A;  5E33 A;  4ULW A;  3Q6N A;  4UDV A;  3SXZ A;  2DYS C;  4LDR A;  4YN0 B;  5COG A;  4C3B A;  3GOR A;  1MQV A;  3DM5 A;  3S27 A;  1G4W R;  3GEE A;  2J0W A;  2HFI A;  1ZW3 A;  2CW0 F;  1RXQ A;  2IXO A;  4CS7 A;  4YWQ A;  4Q4Z F;  1HMO A;  5D91 A;  2J7P D;  2YL1 A;  1ZHX A;  3F46 A;  3FAJ A;  1VB5 A;  1Q0F A;  2HSQ A;  3DJN B;  1C17 M;  1LVK A;  2W4M A;  3AQC A;  1TR2 A;  2EIK C;  4JC7 A;  1EI7 A;  2ZPA A;  5L3Q A;  1AVO B;  2HJM A;  1ZHW A;  2H7B A;  2KQ9 A;  3WHN A;  2HZ8 A;  4DRI B;  3H65 A;  4MS2 A;  3BEH A;  5E3C A;  2OEV A;  4ANJ A;  4JTA B;  4M63 A;  1BR4 A;  2NUP A;  4ONS A;  4R32 A;  2KNH A;  2V3C C;  4PJN A;  5K0I A;  1HMD A;  2LFF A;  4O7G A;  4BEJ A;  4C3D A;  3KPH A;  1I4Z A;  4X0R A;  1VLT A;  2OJE D;  4NY3 A;  2R05 A;  1OCO C;  3DE8 A;  4J30 B;  5KYX B;  3SNH A;  3B0V C;  3NMI A;  3VM6 A;  1BR2 A;  5FCL A;  5L0I A;  4O6Y A;  1BBH A;  3HNK A;  4XEK A;  2YZS A;  5L0F A;  1D0X A;  4P9F A;  4BJ5 A;  1NZE A;  4EHP A;  5B3S C;  1JR8 A;  2F22 A;  4HFF B;  3LUT B;  1G4U S;  3PDM P;  3EG9 B;  3ZTZ A;  4FWV A;  3IEE A;  2R7S A;  2KJG A;  5JRA A;  4JJF A;  4LLE A;  2PBE A;  3G50 A;  1OQC A;  3VRC A;  5CIV A;  5KYX A;  2LCH A;  2BL2 A;  1WGW A;  2PFD A;  2FAP B;  3G4X A;  2P7V A;  1WN0 A;  1L3P A;  1SYQ A;  4E0H A;  3LLK A;  2W4B A;  2J7P A;  4OIP F;  1FAP B;  3CZ6 A;  4FES A;  3EH1 A;  3C8G D;  3WOD F;  1GM5 A;  1CGM E;  2FFH A;  3MYF A;  4H4K C;  1WAS A;  3AG4 C;  4B6I A;  4EBJ A;  1FFT C;  1K04 A;  3AOU A;  3L0I A;  5COF A;  5T3T A;  3EPV A;  3U9M A;  2CYD A;  2Y3B A;  1NFO A;  3AG1 C;  1L7C A;  1VK5 A;  3EQL F;  3U0C A;  1MMA A;  2OG2 A;  2MYS A;  3C8Z A;  3UMI A;  2EPN A;  3EGD B;  1A0B A;  2H7O A;  3K33 A;  2XLD A;  1XZP A;  2J0X A;  2Y3D A;  3MBG A;  1T9K A;  4BPM A;  1TFO B;  3N24 A;  2CDQ A;  5JLI A;  4YL3 A;  4MVS A;  1HW2 A;  1F1M A;  4GQH A;  1ZHY A;  2KC3 A;  3GM2 A;  1R5I D;  3PCV A;  2YLG A;  3U3F A;  4AL0 A;  4FAP B;  1RJ9 B;  2VAS A;  3E70 C;  2PX0 A;  2LP4 A;  2QE9 A;  3AG3 C;  1D1B A;  3DAG A;  1OW7 A;  3US6 A;  3C8G B;  4A2N B;  2NUT B;  1S05 A;  2G3V A;  2YHS A;  3HJC A;  2NSG A;  4MTF A;  1YA9 A;  2EIM C;  3DI5 A;  2Q00 A;  4BJT A;  5L3V A;  1LKX A;  4I44 A;  3I4U A;  3C18 A;  4CDV A;  5JVE A;  3EFO A;  3C7J A;  2M64 A;  1FNT c;  3FVY A;  3U8P A;  4I1M A;  2WVQ A;  4JTD B;  4YT4 A;  3C8G A;  2NUT A;  1BZ4 A;  2Q4F A;  1V4A A;  2QTV A;  3ZQV A;  4CIP A;  1FMW A;  1TWG A;  2ZXP A;  2A0B A;  3K1I A;  2VH3 A;  1PD0 A;  1J8M F;  2VCC A;  3B9Q A;  1YAU O;  2WZG A;  2Y39 A;  2XS1 A;  3JZ0 A;  4PJJ A;  4YT5 A;  5KYU A;  1LM3 B;  1JPN A;  4P9T A;  4JZA A;  1MNE A;  3ZTM A;  3U9J A;  4N06 A;  1VLS A;  4Q7C A;  3O10 A;  2CNW D;  2J45 A;  2FGY A;  4IJJ A;  1H7I A;  2HMQ A;  1JOG A;  1W2W A;  1YYJ A;  2R7V A;  1M2V A;  4MVU A;  1QLE C;  1ST6 A;  2YL0 A;  2R7U A;  2E87 A;  3C63 A;  2HJ3 A;  5DS5 A;  1WWP A;  1OW8 A;  2RSE B;  4IAO A;  1KNY A;  4EWC A;  1NSG B;  3HNI A;  2ZD9 A;  3CEX A;  3NYJ A;  5D92 A;  4PFP A;  2AWY A;  2OEX A;  3ABL C;  3KYI A;  5BQI A;  1M56 C;  3M4C A;  4G78 A;  2Q7R A;  3SZR A;  1YZA A;  3DD7 A;  4XPX A;  5B3I A;  2KGO A;  2XL8 A;  3GEH A;  4MND A;  3K1H A;  4PAC A;  1ZHZ A;  2Q9B A;  4BJ1 A;  4CBE A;  4CDA A;  4AE4 A;  4N4W A;  4NTA A;  5DS4 A;  2NSF A;  3ASN C;  2JPU A;  1G5Z A;  3RKO F;  2XRH A;  2XM4 A;  4C7O B;  5A6J A;  1O3U A;  2QLA A;  1JMW A;  2KW3 C;  4MW3 A;  2JD3 A;  4OIN F;  3RQE A;  4NCQ A;  4CS8 A;  2EIJ C;  1I4Y A;  1ZVZ A;  3DE9 A;  2J9B A;  2JX0 A;  3QMK A;  3R2P A;  3ZVR A;  2R7W A;  2CNW A;  2Q9A A;  1UG7 A;  2IXM A;  1QKR A;  3M1C B;  3TOL A;  2C03 A;  3DMD A;  4O6N A;  1Z6A A;  3MFN A;  4IAR A;  4XLN F;  4E0I A;  5DS6 A;  2R02 A;  5HSW A;  1G8X A;  5AC5 A;  4LAC B;  4GEH A;  1ZU5 A;  4LDQ A; 
#chains in the Genus database with same CATH homology
 1UG7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...