1UG7A

Solution structure of four helical up-and-down bundle domain of the hypothetical protein 2610208m17rik similar to the protein flj12806
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
128
structure length
128
Chain Sequence
GSSGSSGMSEVTRSLLQRWGASLRRGADFDSWGQLVEAIDEYQILARHLQKEAQAQHNNSEFTEEQKKTIGKIATCLELRSAALQSTQSQEEFKLEDLKKLEPILKNILTYNKEFPFDVQPISGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2610208M17Rik protein
publication title Solution structure of four helical up-and-down bundle domain of the hypothetical protein 2610208M17Rik similar to the protein FLJ12806
rcsb
source organism Mus musculus
molecule tags Structural genomics, unknown function
total genus 31
structure length 128
sequence length 128
ec nomenclature
pdb deposition date 2003-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08910 Aida_N Aida N-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.360 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Axin interactor, dorsalization-associated protein, N-terminal domain 1ug7A00
1UG7A
chains in the Genus database with same CATH superfamily
3SXKA 2WB7A 1Y6DA 2MWQA 3DXJF 2Y3HA 2L7AA 3NMIA 4BEMJ 2YLIA 1JRAA 2QY9A 1ORSC 2CNWA 2IXNA 2Q00A 4MVOA 2PX3A 1SZIA 4EBBA 4CS9C 3A9CA 3S28A 3EGDB 3B29A 4QI0A 2FGYA 2NG1A 3G4XA 4O6YA 3B9QA 1SMYF 1OCOC 1S05A 2C03A 3IQ6A 3V5ZA 5L0GA 4FWVA 1D1CA 4GYTA 1ZVZA 3IPMO 3RW0A 2PF4E 3UNGC 256BA 1XZQA 1D1BA 4BJ6C 4KNVA 5CI8A 5E3CA 3UR3C 4XPXA 2VC9A 1QPUA 2R7TA 2YVKA 3QW1A 1I5NA 1OW8A 1ST6A 2W9YA 3AG3C 2A6HF 2OJED 3DWWA 2XLMA 2ICWG 4YT2A 1MNDA 2NUPB 1O87A 4AL0A 4R32A 5JSLA 2ZD9A 3DE8A 2P61A 3W8HA 3ZQYA 3UGPA 2HJ3A 5BQIA 3HNLA 2IXOA 3DD7A 3EZHA 4OIRF 1CGNA 2Y3DA 3IQTA 3O10A 3LLIA 4O6NA 4YT8A 2R7VA 3CZ6A 4Q7CA 3WG7C 1YZCA 2YZSA 4DJ9A 1AUEA 5DS6A 3GORA 4IAOA 5A69A 3K66A 3N24A 2XXAA 1RKEB 4AE4B 2G3VA 3C8GA 5KYWA 3JCUQ 4MS2A 4J7YA 1J8MF 1YLMA 1WASA 1RJ9A 3I4UA 3ZC4A 4XLPF 4DRIB 2J9VA 3US6A 3H65A 3FDQA 4H54A 3L1MA 1YARO 4Q5SF 1G5ZA 1JR8A 1JPNA 4MW3A 5KYXB 3JTLO 3HNJA 2LCHA 3M79A 1KU2A 4JJGA 3NMKA 4C7OA 1HE1A 4C3DA 1Z5ZA 4NQFA 2A1DD 3ZTMA 2B0HA 1ZHZA 1FFHA 4LERA 2EIKC 1G4US 4BJTA 1M2VA 4NTBA 3RQGA 2L81A 2R7OA 2XL8A 3V5YA 2QE9A 1NU9C 3B71A 4N6HA 1CPQA 1EA8A 2EPMX 2PP4A 4Z9JA 2J8WA 4GQHA 2IYLD 1A7VA 2X51A 3LLKA 4HEAJ 4JURI 2IOQA 2YLGA 3EH1A 1CGOA 1QLEC 2B0JA 3KYIA 2XM0A 4EUKB 3F47A 4XQ1A 5B3IA 2R7XA 2IXPA 1LVKA 4LLCA 2PNOA 3R2PA 5E33A 1APCA 1M56C 3FMSA 2Q9BA 1YDIA 4MTGA 1F1MA 1WN0A 4CS7A 1H9TA 1GS9A 4MVZA 5DQTA 5JUAA 4E0HA 1LE2A 2KK1A 1VLTA 1WTYA 3EQLF 1EQ1A 3TK0A 2J0WA 4DVYP 1SYQA 2LIGA 4G7OF 4AX2A 2PX0A 5L0IA 1MMDA 5CIVA 1NG1A 4DRJB 2WZFA 1YAUO 3ASOC 4DVZA 2HMZA 1OQCA 5L3QA 2R7WA 3OEOA 1ORJA 2DGJA 3TQOA 3K1IA 2Y3GA 4J30B 1D0XA 1R4TA 1YYJA 3B0VC 1YZAA 1OCRC 1MMAA 3EG9B 5HSWA 4U5HA 1Q0GA 5KYYB 1JAFA 3JT1A 1BR2A 1ORYA 2XLOA 4MVRA 4YJWA 2HMQA 2XLHA 3VF0A 4XTKA 4WGZA 4N4WA 2Y69C 5JLIA 1QQ3A 2TMVP 1V55C 4A4AA 4KI2A 3H2UA 4CDVA 2H7BA 1QVXA 2M4EA 1E86A 2QNLA 3JSEO 5EGYA 3ZG1A 1FR0A 2XM4A 3MFNA 2OOCA 2XS1A 2I8BA 3T6BA 5EHHA 1LPEA 5E3AA 4OIQF 1G4WR 2R9RB 3MYFA 3AQCA 3ZIBA 1M2OA 1BBHA 1NFNA 1SR2A 2KSFA 1Y4CA 2DB4A 1I4ZA 2Q9CA 3G50A 1OCZC 3QMKA 4DXWA 5COFA 2BC5A 5EK0A 1NLXA 2DYRC 1Z7Qc 1FFTC 2JX0A 1XZPA 4NC3A 1YYXA 3ZDLA 4E17A 5B1AC 2Y39A 5BQHA 2G3KA 1LIHA 2P1AA 2BL2A 1T5OA 3CQZA 4IRUA 2UUHA 2CW0F 3AQBA 3ECSA 3EGXA 1KNYA 1XWJA 3JZ0A 3R7CA 4CIHA 2LP4A 3O39A 4KC9A 2X0CA 3WAQA 2YL3A 4A2NB 2IXMA 2M64A 4IB4A 4CJGA 3S27A 3AG1C 2GDCA 4QDLA 2NSFA 3UMHA 5F5FA 4MW8A 4Z9HA 4JEBA 2A68F 1FMWA 4G0HA 1T6QA 1TWAA 3U9MA 3IQCA 3DAFA 1W2WA 4PR9A 3T4RA 2OQMA 4CX9A 3O55A 5T1DB 1Q0KA 1N1CA 1SF8A 4X0RA 2XL4A 4PFPA 5B1BC 1TWCA 2J7PD 3RIPA 3C8ZA 4B6IA 3ZVRA 5AC5A 2KNHA 2H8AA 5DLJA 2QUPA 4JZAA 2YWAA 5F5HA 2XXAB 1Q0DA 2R7RA 4JTCB 3EHNA 1LM3B 1OR2A 3LNRA 1VLSA 3C8GB 4CIPA 5KYWB 3ABMC 4HFFB 2J9BA 1OW6A 2AWCA 1MMGA 1RJ9B 2RSEB 3SXZA 1ZU5A 1DOWA 4DOZA 3SP1A 4XEVA 4CS8C 1TKNA 1TQGA 3QVYA 1U89A 2Y3BA 1V74B 4N06A 1JPJA 4YL3A 3EPVA 3QZCA 2KGOA 4C3BA 4C7OB 2J9UA 3ZWIA 2Q7RA 4XEFA 4EWCA 4PJJA 3DI5A 3HNIA 1O5HA 4O7GA 1BR4A 3MX3A 5AGFA 1FNTc 3I5PA 2WVOA 1HMOA 5HV9A 5CI9A 4BJ5A 1M2VB 1Z23A 1JOGA 3AG2C 3GWLA 4XPYA 1TR2A 1C02A 1YA9A 3KYJA 4W8PA 3VRCA 4QI2A 1HMDA 2OJQA 4JC7A 4U5EE 3RKOF 3GEHA 4NTFA 2MYSA 3HKKA 4LDKA 4N6CA 4XEKA 3QTHA 1IW7F 3S90A 2R25A 4CJOA 4YL0A 3ZSUA 2J9WA 4JRZA 5COMA 3C62A 3LEOA 1MQVA 3CSKA 3Q6MA 4JJFA 3HJCA 1OKKA 4RBNA 3L8JA 4M63A 2VCAA 4U5FE 2F22A 4WJ0A 4CS8A 2YHSA 1UFBA 4WABA 3AOUA 4IGGA 5D91A 1OKKD 2OEXA 3ZTZA 3SEOA 4ULWA 3W2VA 4AK9A 3NKEA 4G7HF 4PJLA 3K1IC 1PD0A 5DQZA 1EI7A 1K40A 4PFOA 5A6KA 2YRFA 1RKCA 3TD7A 4YT4A 4U5GA 4UDVA 4PJMA 3E9VA 2A6EF 1BDJB 1Q0MA 2OG2A 3GEIA 3N2ZB 3GANA 2L6GA 3IHUA 3DM9B 3FAPB 3F46A 5FCLA 2A0BA 3NYMA 5DS4A 3RF3A 1ZW3A 2W45A 1OR3A 2XLEA 3FOOA 1E83A 1L7CA 2HS5A 4MVQA 2OEVA 3ABLC 3E70C 3EJNA 4JW1A 1YA7O 1ZHXA 3W8IA 2IBFA 4ANJA 3AJMA 4PACA 1Z63A 3S84A 3G4ZA 4E0IA 4J32B 1ZU4A 4I1MA 1LI7A 2AWYA 3POVA 3EFOA 1BR1A 1IZMA 2VASA 4YT5A 5L0HA 3TJ5A 2QLAA 3CEXA 1TFKB 4KBLA 3FAJA 1FTSA 5GPGB 3L8IA 3JRTA 2PBEA 2R02A 1RMVA 1VB5A 3WHNA 3EZIA 3BRJA 2G62A 4YK5A 4BEJA 3UMIA 2LFFA 4L6RA 1BZ4A 3SYNA 1OW7A 2NUTB 3X2QC 1Z3IX 3C18A 5TJ5E 4CSAA 2VCCA 1GM5A 2J45A 1DOVA 3TOLA 2C04A 2P0NA 4MVSA 1RCPA 4OIPF 2R7SA 4IAQA 2HUJA 2VH3A 2KJGA 3FOPA 4I1OB 1JMWA 1MNEA 5A6JA 2CCYA 1M57C 4HFKB 2P6VA 2ZXOA 2Q3TA 3S0XA 1T6UA 2R03A 4G7ZF 4K1OA 2L6HA 2LK4A 2IM8A 4BG0A 2HFIA 2YLDA 1Z6AA 4P6IC 4DRHB 3FVYA 2V26A 4JCHA 3PHF2 3EGXB 3VYWA 1I4YA 3LAYA 4LLEA 1V54C 3LESA 4ONSA 1WATA 4KNWA 3JYHA 1M6TA 1WGWA 3U8PA 3UMKA 4E7ZA 4Z9IA 1T9KA 2CYDA 2GWWA 2LFDA 3IQ5A 4G78A 3TJ6A 1U0BB 2A0UA 4EBJA 2ZXPA 1B68A 3DAGA 5F28E 3RVZA 5A6AA 4MTOA 3K33A 1Q0FA 4YN0B 3RQEA 1VYKA 3U9JA 1HW1A 1HW2A 4D4XA 1UG7A 2HJMA 4F4BA 1LKXA 4EBKA 2KQ9A 1G8XA 3CAXA 4RDAA 3RH3A 5JT4A 2GFHA 3ITFA 2KYHA 3C7JA 4JE9A 2WZLA 3JRMO 4U5CE 2EPLX 3K7DA 3U3FA 1E2XA 1NBBA 2XSEA 2J7PA 2XRHA 2ZPAA 3HTKC 3N0TA 2WVQA 5A6BD 3U0CA 4E18A 4K0DA 3T9OA 4JVSA 2EINC 3AGUA 2PFDA 2OU6A 4PK4A 4IJJA 3RFYA 5KYNA 1QSPA 1ZZPA 1ZHTA 1K05A 4BJ5C 2R05A 3C63A 1PCXA 3W4YA 3TULA 1LI5A 2LD6A 4NCQA 4U9DA 5COGA 3LS0A 3KL4A 1NFOA 2EPNA 5L0DA 3LEVA 3BEHA 4OD5A 1VMAA 4JTAB 5JRAA 4FESA 4OIOF 3B0UX 3EHMA 3KH2A 4FAPB 2Z15A 3NDBB 2YEVA 3JSZA 2CDQA 2D4UA 1VOMA 2XLVA 3T6GB 4BJ1A 2H7OA 4EKWA 1OXKA 2HSQA 2HSBA 4IWBA 1YVIA 4EIYA 2WZGA 5T3WA 2Q9AA 2CNWD 2H7VC 3DM5A 3GEEA 4CDYA 2EIJC 2J46A 2KC3A 2R7QA 1TWHA 2XL6A 3U8VA 1J8YF 4LDRA 5KYUA 2VB6A 3K6BA 5IY5C 3DJUB 4IARA 4JCZA 1NSGB 3M15A 4JIOA 1NZEA 3M1CB 1A7DA 3KKBA 1ZHWA 5BQGA 3W2WA 5L0CA 3ATPA 5JP7A 5DS5A 4Q4ZF 4OD4A 3MLGA 3RYLA 3EGDA 3I5QA 2R7UA 5D92A 3KPHA 3A11A 1AVOB 1CGME 4RD9A 1LS4A 1D1AA 2L9JA 2YL1A 4D4NA 5B3SC 1A0BA 4NTAA 4XWJA 4XPWA 1MMNA 1QZXA 1LE4A 2GAQA 3EH2A 3Q7LA 4XLNF 3NKDA 4CS9A 1AEPA 4W8KA 1VYIA 4MVMA 4K7BA 2W4BA 4ZLCA 3SXMA 3DZAA 3NRHA 4H4KC 4ER9A 1CPRA 5K0IA 4GEHA 2NUPA 3LUTB 1O3UA 1OXBA 1YJGA 2J0XA 2VCBA 2YQYA 3M4CA 4PJNA 4BJ6A 4FX5A 4EHPA 3EFOB 3WODF 1H7IA 3C8GD 4CSAC 1WWPA 4DBQA 3FXHA 4JKVA 3HLZA 2YL7A 3RVYA 3V5XA 5BUOA 2OKUA 2LSEA 3K1HA 5E2QA 3NMJA 4MQ9F 1NU7D 2AU5A 3OA1A 2AVKA 4U9EA 3Q6NA 3S9OA 3U5SA 3V7OA 5AC4A 1RKEA 3GODA 4AE4A 1EKYA 5JVEA 4J7TA 3PDMP 2JD3A 1H9GA 2HKVA 3LS1A 1H6GA 1GGQA 4I3MA 5FZTA 2GA0A 3KMIA 4U5BE 2Q4FA 1U6HA 4E7SA 1HE9A 2XLWA 1KTMA 4OINF 2DYSC 2XS8A 3NYJA 3U2MA 4BPMA 2ETSA 5KYXA 2V3CC 4JTDB 1D0YA 2HZ8A 1WOLA 3UGOA 2ZXWC 1VTMP 2A69F 3L0IA 2JPUA 3H2VA 4MTFA 3FHDA 2CGEA 2NPUA 1VK5A 1L3PA 2P7VA 2W4MA 2YKZA 3ZQVA 5L0FA 4U5DE 4CDAA 1PV3A 2RD9A 3M4BA 4DBRA 1ZHYA 3ASNC 3RQFA 1K04A 3DKAA 2KW3C 1FAPB 2ASRA 1C17M 4NY3A 2NSGA 2HV6A 3AGTA 5JS5A 1TWGA 5L0JA 5L3VA 4ZLDA 1R5ID 2WL8A 3TOMA 3OWTA 2LQGA 1E84A 2BE5F 3GM1A 4ULVA 4I44A 1A7EA 2EPOA 3SNHA 1GQAA 3MYIA 3VM6A 3L34A 3DJNB 4LDQA 3SXYA 1RXQA 3SZRA 4CBEA 4C3EA 2ZXRA 3MBGA 4O6MA 5T3TA 3U2LA 2EILC 3ABKC 3U3BA 2E87A 3GM3A 3QW0A 2WVNA 1QKRA 2QTVA 3B0PA 1C03A 3QVZA 3T6JA 1ZYRF 3VAYA 2YL0A 3J06A 3NYLA 3AG4C 3HNKA 3PCVA 1V4AA 3EG9A 1OCCC 4HE8D 2EIMC 2HV7A 5A6BA 1E85A 5KYYA 2NUTA 4MNDA 3X1OA 3GM2A 3Q7GA 3LNMB 3LJBA 1T6IA 2MHRA 3NG1A 5DVWA 2D5RB 4WGYA 4AL1A 3DMDA 1HY5A 2O9XA 1TFOB 3S29A 2OCCC 4P9FA 2L6FA 1LS1A 3O6XA 2UUIA 1PD1A 3PMRA 4JEAA 1FMVA 3JYYA 1T01A 2AP3A 2DI3A 4MVUA 2XLDA 4O79A 3GWNA 2FFHA 4YL1A 1ZW2A 2I15A 2EPKX 3IEEA 3DE9A 4LACB 4P9TA 4YWQA 1S7ZA 2FAPB 1D0ZA 5KYUB 1A41A
chains in the Genus database with same CATH topology
1UG7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UG7 A; 
#chains in the Genus database with same CATH topology
 3SXK A;  2WB7 A;  1Y6D A;  2MWQ A;  3DXJ F;  2Y3H A;  2L7A A;  3NMI A;  4BEM J;  2YLI A;  1JRA A;  2QY9 A;  1ORS C;  2CNW A;  2IXN A;  2Q00 A;  4MVO A;  2PX3 A;  1SZI A;  4EBB A;  4CS9 C;  3A9C A;  3S28 A;  3EGD B;  3B29 A;  4QI0 A;  2FGY A;  2NG1 A;  3G4X A;  4O6Y A;  3B9Q A;  1SMY F;  1OCO C;  1S05 A;  2C03 A;  3IQ6 A;  3V5Z A;  5L0G A;  4FWV A;  1D1C A;  4GYT A;  1ZVZ A;  3IPM O;  3RW0 A;  2PF4 E;  3UNG C;  256B A;  1XZQ A;  1D1B A;  4BJ6 C;  4KNV A;  5CI8 A;  5E3C A;  3UR3 C;  4XPX A;  2VC9 A;  1QPU A;  2R7T A;  2YVK A;  3QW1 A;  1I5N A;  1OW8 A;  1ST6 A;  2W9Y A;  3AG3 C;  2A6H F;  2OJE D;  3DWW A;  2XLM A;  2ICW G;  4YT2 A;  1MND A;  2NUP B;  1O87 A;  4AL0 A;  4R32 A;  5JSL A;  2ZD9 A;  3DE8 A;  2P61 A;  3W8H A;  3ZQY A;  3UGP A;  2HJ3 A;  5BQI A;  3HNL A;  2IXO A;  3DD7 A;  3EZH A;  4OIR F;  1CGN A;  2Y3D A;  3IQT A;  3O10 A;  3LLI A;  4O6N A;  4YT8 A;  2R7V A;  3CZ6 A;  4Q7C A;  3WG7 C;  1YZC A;  2YZS A;  4DJ9 A;  1AUE A;  5DS6 A;  3GOR A;  4IAO A;  5A69 A;  3K66 A;  3N24 A;  2XXA A;  1RKE B;  4AE4 B;  2G3V A;  3C8G A;  5KYW A;  3JCU Q;  4MS2 A;  4J7Y A;  1J8M F;  1YLM A;  1WAS A;  1RJ9 A;  3I4U A;  3ZC4 A;  4XLP F;  4DRI B;  2J9V A;  3US6 A;  3H65 A;  3FDQ A;  4H54 A;  3L1M A;  1YAR O;  4Q5S F;  1G5Z A;  1JR8 A;  1JPN A;  4MW3 A;  5KYX B;  3JTL O;  3HNJ A;  2LCH A;  3M79 A;  1KU2 A;  4JJG A;  3NMK A;  4C7O A;  1HE1 A;  4C3D A;  1Z5Z A;  4NQF A;  2A1D D;  3ZTM A;  2B0H A;  1ZHZ A;  1FFH A;  4LER A;  2EIK C;  1G4U S;  4BJT A;  1M2V A;  4NTB A;  3RQG A;  2L81 A;  2R7O A;  2XL8 A;  3V5Y A;  2QE9 A;  1NU9 C;  3B71 A;  4N6H A;  1CPQ A;  1EA8 A;  2EPM X;  2PP4 A;  4Z9J A;  2J8W A;  4GQH A;  2IYL D;  1A7V A;  2X51 A;  3LLK A;  4HEA J;  4JUR I;  2IOQ A;  2YLG A;  3EH1 A;  1CGO A;  1QLE C;  2B0J A;  3KYI A;  2XM0 A;  4EUK B;  3F47 A;  4XQ1 A;  5B3I A;  2R7X A;  2IXP A;  1LVK A;  4LLC A;  2PNO A;  3R2P A;  5E33 A;  1APC A;  1M56 C;  3FMS A;  2Q9B A;  1YDI A;  4MTG A;  1F1M A;  1WN0 A;  4CS7 A;  1H9T A;  1GS9 A;  4MVZ A;  5DQT A;  5JUA A;  4E0H A;  1LE2 A;  2KK1 A;  1VLT A;  1WTY A;  3EQL F;  1EQ1 A;  3TK0 A;  2J0W A;  4DVY P;  1SYQ A;  2LIG A;  4G7O F;  4AX2 A;  2PX0 A;  5L0I A;  1MMD A;  5CIV A;  1NG1 A;  4DRJ B;  2WZF A;  1YAU O;  3ASO C;  4DVZ A;  2HMZ A;  1OQC A;  5L3Q A;  2R7W A;  3OEO A;  1ORJ A;  2DGJ A;  3TQO A;  3K1I A;  2Y3G A;  4J30 B;  1D0X A;  1R4T A;  1YYJ A;  3B0V C;  1YZA A;  1OCR C;  1MMA A;  3EG9 B;  5HSW A;  4U5H A;  1Q0G A;  5KYY B;  1JAF A;  3JT1 A;  1BR2 A;  1ORY A;  2XLO A;  4MVR A;  4YJW A;  2HMQ A;  2XLH A;  3VF0 A;  4XTK A;  4WGZ A;  4N4W A;  2Y69 C;  5JLI A;  1QQ3 A;  2TMV P;  1V55 C;  4A4A A;  4KI2 A;  3H2U A;  4CDV A;  2H7B A;  1QVX A;  2M4E A;  1E86 A;  2QNL A;  3JSE O;  5EGY A;  3ZG1 A;  1FR0 A;  2XM4 A;  3MFN A;  2OOC A;  2XS1 A;  2I8B A;  3T6B A;  5EHH A;  1LPE A;  5E3A A;  4OIQ F;  1G4W R;  2R9R B;  3MYF A;  3AQC A;  3ZIB A;  1M2O A;  1BBH A;  1NFN A;  1SR2 A;  2KSF A;  1Y4C A;  2DB4 A;  1I4Z A;  2Q9C A;  3G50 A;  1OCZ C;  3QMK A;  4DXW A;  5COF A;  2BC5 A;  5EK0 A;  1NLX A;  2DYR C;  1Z7Q c;  1FFT C;  2JX0 A;  1XZP A;  4NC3 A;  1YYX A;  3ZDL A;  4E17 A;  5B1A C;  2Y39 A;  5BQH A;  2G3K A;  1LIH A;  2P1A A;  2BL2 A;  1T5O A;  3CQZ A;  4IRU A;  2UUH A;  2CW0 F;  3AQB A;  3ECS A;  3EGX A;  1KNY A;  1XWJ A;  3JZ0 A;  3R7C A;  4CIH A;  2LP4 A;  3O39 A;  4KC9 A;  2X0C A;  3WAQ A;  2YL3 A;  4A2N B;  2IXM A;  2M64 A;  4IB4 A;  4CJG A;  3S27 A;  3AG1 C;  2GDC A;  4QDL A;  2NSF A;  3UMH A;  5F5F A;  4MW8 A;  4Z9H A;  4JEB A;  2A68 F;  1FMW A;  4G0H A;  1T6Q A;  1TWA A;  3U9M A;  3IQC A;  3DAF A;  1W2W A;  4PR9 A;  3T4R A;  2OQM A;  4CX9 A;  3O55 A;  5T1D B;  1Q0K A;  1N1C A;  1SF8 A;  4X0R A;  2XL4 A;  4PFP A;  5B1B C;  1TWC A;  2J7P D;  3RIP A;  3C8Z A;  4B6I A;  3ZVR A;  5AC5 A;  2KNH A;  2H8A A;  5DLJ A;  2QUP A;  4JZA A;  2YWA A;  5F5H A;  2XXA B;  1Q0D A;  2R7R A;  4JTC B;  3EHN A;  1LM3 B;  1OR2 A;  3LNR A;  1VLS A;  3C8G B;  4CIP A;  5KYW B;  3ABM C;  4HFF B;  2J9B A;  1OW6 A;  2AWC A;  1MMG A;  1RJ9 B;  2RSE B;  3SXZ A;  1ZU5 A;  1DOW A;  4DOZ A;  3SP1 A;  4XEV A;  4CS8 C;  1TKN A;  1TQG A;  3QVY A;  1U89 A;  2Y3B A;  1V74 B;  4N06 A;  1JPJ A;  4YL3 A;  3EPV A;  3QZC A;  2KGO A;  4C3B A;  4C7O B;  2J9U A;  3ZWI A;  2Q7R A;  4XEF A;  4EWC A;  4PJJ A;  3DI5 A;  3HNI A;  1O5H A;  4O7G A;  1BR4 A;  3MX3 A;  5AGF A;  1FNT c;  3I5P A;  2WVO A;  1HMO A;  5HV9 A;  5CI9 A;  4BJ5 A;  1M2V B;  1Z23 A;  1JOG A;  3AG2 C;  3GWL A;  4XPY A;  1TR2 A;  1C02 A;  1YA9 A;  3KYJ A;  4W8P A;  3VRC A;  4QI2 A;  1HMD A;  2OJQ A;  4JC7 A;  4U5E E;  3RKO F;  3GEH A;  4NTF A;  2MYS A;  3HKK A;  4LDK A;  4N6C A;  4XEK A;  3QTH A;  1IW7 F;  3S90 A;  2R25 A;  4CJO A;  4YL0 A;  3ZSU A;  2J9W A;  4JRZ A;  5COM A;  3C62 A;  3LEO A;  1MQV A;  3CSK A;  3Q6M A;  4JJF A;  3HJC A;  1OKK A;  4RBN A;  3L8J A;  4M63 A;  2VCA A;  4U5F E;  2F22 A;  4WJ0 A;  4CS8 A;  2YHS A;  1UFB A;  4WAB A;  3AOU A;  4IGG A;  5D91 A;  1OKK D;  2OEX A;  3ZTZ A;  3SEO A;  4ULW A;  3W2V A;  4AK9 A;  3NKE A;  4G7H F;  4PJL A;  3K1I C;  1PD0 A;  5DQZ A;  1EI7 A;  1K40 A;  4PFO A;  5A6K A;  2YRF A;  1RKC A;  3TD7 A;  4YT4 A;  4U5G A;  4UDV A;  4PJM A;  3E9V A;  2A6E F;  1BDJ B;  1Q0M A;  2OG2 A;  3GEI A;  3N2Z B;  3GAN A;  2L6G A;  3IHU A;  3DM9 B;  3FAP B;  3F46 A;  5FCL A;  2A0B A;  3NYM A;  5DS4 A;  3RF3 A;  1ZW3 A;  2W45 A;  1OR3 A;  2XLE A;  3FOO A;  1E83 A;  1L7C A;  2HS5 A;  4MVQ A;  2OEV A;  3ABL C;  3E70 C;  3EJN A;  4JW1 A;  1YA7 O;  1ZHX A;  3W8I A;  2IBF A;  4ANJ A;  3AJM A;  4PAC A;  1Z63 A;  3S84 A;  3G4Z A;  4E0I A;  4J32 B;  1ZU4 A;  4I1M A;  1LI7 A;  2AWY A;  3POV A;  3EFO A;  1BR1 A;  1IZM A;  2VAS A;  4YT5 A;  5L0H A;  3TJ5 A;  2QLA A;  3CEX A;  1TFK B;  4KBL A;  3FAJ A;  1FTS A;  5GPG B;  3L8I A;  3JRT A;  2PBE A;  2R02 A;  1RMV A;  1VB5 A;  3WHN A;  3EZI A;  3BRJ A;  2G62 A;  4YK5 A;  4BEJ A;  3UMI A;  2LFF A;  4L6R A;  1BZ4 A;  3SYN A;  1OW7 A;  2NUT B;  3X2Q C;  1Z3I X;  3C18 A;  5TJ5 E;  4CSA A;  2VCC A;  1GM5 A;  2J45 A;  1DOV A;  3TOL A;  2C04 A;  2P0N A;  4MVS A;  1RCP A;  4OIP F;  2R7S A;  4IAQ A;  2HUJ A;  2VH3 A;  2KJG A;  3FOP A;  4I1O B;  1JMW A;  1MNE A;  5A6J A;  2CCY A;  1M57 C;  4HFK B;  2P6V A;  2ZXO A;  2Q3T A;  3S0X A;  1T6U A;  2R03 A;  4G7Z F;  4K1O A;  2L6H A;  2LK4 A;  2IM8 A;  4BG0 A;  2HFI A;  2YLD A;  1Z6A A;  4P6I C;  4DRH B;  3FVY A;  2V26 A;  4JCH A;  3PHF 2;  3EGX B;  3VYW A;  1I4Y A;  3LAY A;  4LLE A;  1V54 C;  3LES A;  4ONS A;  1WAT A;  4KNW A;  3JYH A;  1M6T A;  1WGW A;  3U8P A;  3UMK A;  4E7Z A;  4Z9I A;  1T9K A;  2CYD A;  2GWW A;  2LFD A;  3IQ5 A;  4G78 A;  3TJ6 A;  1U0B B;  2A0U A;  4EBJ A;  2ZXP A;  1B68 A;  3DAG A;  5F28 E;  3RVZ A;  5A6A A;  4MTO A;  3K33 A;  1Q0F A;  4YN0 B;  3RQE A;  1VYK A;  3U9J A;  1HW1 A;  1HW2 A;  4D4X A;  1UG7 A;  2HJM A;  4F4B A;  1LKX A;  4EBK A;  2KQ9 A;  1G8X A;  3CAX A;  4RDA A;  3RH3 A;  5JT4 A;  2GFH A;  3ITF A;  2KYH A;  3C7J A;  4JE9 A;  2WZL A;  3JRM O;  4U5C E;  2EPL X;  3K7D A;  3U3F A;  1E2X A;  1NBB A;  2XSE A;  2J7P A;  2XRH A;  2ZPA A;  3HTK C;  3N0T A;  2WVQ A;  5A6B D;  3U0C A;  4E18 A;  4K0D A;  3T9O A;  4JVS A;  2EIN C;  3AGU A;  2PFD A;  2OU6 A;  4PK4 A;  4IJJ A;  3RFY A;  5KYN A;  1QSP A;  1ZZP A;  1ZHT A;  1K05 A;  4BJ5 C;  2R05 A;  3C63 A;  1PCX A;  3W4Y A;  3TUL A;  1LI5 A;  2LD6 A;  4NCQ A;  4U9D A;  5COG A;  3LS0 A;  3KL4 A;  1NFO A;  2EPN A;  5L0D A;  3LEV A;  3BEH A;  4OD5 A;  1VMA A;  4JTA B;  5JRA A;  4FES A;  4OIO F;  3B0U X;  3EHM A;  3KH2 A;  4FAP B;  2Z15 A;  3NDB B;  2YEV A;  3JSZ A;  2CDQ A;  2D4U A;  1VOM A;  2XLV A;  3T6G B;  4BJ1 A;  2H7O A;  4EKW A;  1OXK A;  2HSQ A;  2HSB A;  4IWB A;  1YVI A;  4EIY A;  2WZG A;  5T3W A;  2Q9A A;  2CNW D;  2H7V C;  3DM5 A;  3GEE A;  4CDY A;  2EIJ C;  2J46 A;  2KC3 A;  2R7Q A;  1TWH A;  2XL6 A;  3U8V A;  1J8Y F;  4LDR A;  5KYU A;  2VB6 A;  3K6B A;  5IY5 C;  3DJU B;  4IAR A;  4JCZ A;  1NSG B;  3M15 A;  4JIO A;  1NZE A;  3M1C B;  1A7D A;  3KKB A;  1ZHW A;  5BQG A;  3W2W A;  5L0C A;  3ATP A;  5JP7 A;  5DS5 A;  4Q4Z F;  4OD4 A;  3MLG A;  3RYL A;  3EGD A;  3I5Q A;  2R7U A;  5D92 A;  3KPH A;  3A11 A;  1AVO B;  1CGM E;  4RD9 A;  1LS4 A;  1D1A A;  2L9J A;  2YL1 A;  4D4N A;  5B3S C;  1A0B A;  4NTA A;  4XWJ A;  4XPW A;  1MMN A;  1QZX A;  1LE4 A;  2GAQ A;  3EH2 A;  3Q7L A;  4XLN F;  3NKD A;  4CS9 A;  1AEP A;  4W8K A;  1VYI A;  4MVM A;  4K7B A;  2W4B A;  4ZLC A;  3SXM A;  3DZA A;  3NRH A;  4H4K C;  4ER9 A;  1CPR A;  5K0I A;  4GEH A;  2NUP A;  3LUT B;  1O3U A;  1OXB A;  1YJG A;  2J0X A;  2VCB A;  2YQY A;  3M4C A;  4PJN A;  4BJ6 A;  4FX5 A;  4EHP A;  3EFO B;  3WOD F;  1H7I A;  3C8G D;  4CSA C;  1WWP A;  4DBQ A;  3FXH A;  4JKV A;  3HLZ A;  2YL7 A;  3RVY A;  3V5X A;  5BUO A;  2OKU A;  2LSE A;  3K1H A;  5E2Q A;  3NMJ A;  4MQ9 F;  1NU7 D;  2AU5 A;  3OA1 A;  2AVK A;  4U9E A;  3Q6N A;  3S9O A;  3U5S A;  3V7O A;  5AC4 A;  1RKE A;  3GOD A;  4AE4 A;  1EKY A;  5JVE A;  4J7T A;  3PDM P;  2JD3 A;  1H9G A;  2HKV A;  3LS1 A;  1H6G A;  1GGQ A;  4I3M A;  5FZT A;  2GA0 A;  3KMI A;  4U5B E;  2Q4F A;  1U6H A;  4E7S A;  1HE9 A;  2XLW A;  1KTM A;  4OIN F;  2DYS C;  2XS8 A;  3NYJ A;  3U2M A;  4BPM A;  2ETS A;  5KYX A;  2V3C C;  4JTD B;  1D0Y A;  2HZ8 A;  1WOL A;  3UGO A;  2ZXW C;  1VTM P;  2A69 F;  3L0I A;  2JPU A;  3H2V A;  4MTF A;  3FHD A;  2CGE A;  2NPU A;  1VK5 A;  1L3P A;  2P7V A;  2W4M A;  2YKZ A;  3ZQV A;  5L0F A;  4U5D E;  4CDA A;  1PV3 A;  2RD9 A;  3M4B A;  4DBR A;  1ZHY A;  3ASN C;  3RQF A;  1K04 A;  3DKA A;  2KW3 C;  1FAP B;  2ASR A;  1C17 M;  4NY3 A;  2NSG A;  2HV6 A;  3AGT A;  5JS5 A;  1TWG A;  5L0J A;  5L3V A;  4ZLD A;  1R5I D;  2WL8 A;  3TOM A;  3OWT A;  2LQG A;  1E84 A;  2BE5 F;  3GM1 A;  4ULV A;  4I44 A;  1A7E A;  2EPO A;  3SNH A;  1GQA A;  3MYI A;  3VM6 A;  3L34 A;  3DJN B;  4LDQ A;  3SXY A;  1RXQ A;  3SZR A;  4CBE A;  4C3E A;  2ZXR A;  3MBG A;  4O6M A;  5T3T A;  3U2L A;  2EIL C;  3ABK C;  3U3B A;  2E87 A;  3GM3 A;  3QW0 A;  2WVN A;  1QKR A;  2QTV A;  3B0P A;  1C03 A;  3QVZ A;  3T6J A;  1ZYR F;  3VAY A;  2YL0 A;  3J06 A;  3NYL A;  3AG4 C;  3HNK A;  3PCV A;  1V4A A;  3EG9 A;  1OCC C;  4HE8 D;  2EIM C;  2HV7 A;  5A6B A;  1E85 A;  5KYY A;  2NUT A;  4MND A;  3X1O A;  3GM2 A;  3Q7G A;  3LNM B;  3LJB A;  1T6I A;  2MHR A;  3NG1 A;  5DVW A;  2D5R B;  4WGY A;  4AL1 A;  3DMD A;  1HY5 A;  2O9X A;  1TFO B;  3S29 A;  2OCC C;  4P9F A;  2L6F A;  1LS1 A;  3O6X A;  2UUI A;  1PD1 A;  3PMR A;  4JEA A;  1FMV A;  3JYY A;  1T01 A;  2AP3 A;  2DI3 A;  4MVU A;  2XLD A;  4O79 A;  3GWN A;  2FFH A;  4YL1 A;  1ZW2 A;  2I15 A;  2EPK X;  3IEE A;  3DE9 A;  4LAC B;  4P9T A;  4YWQ A;  1S7Z A;  2FAP B;  1D0Z A;  5KYU B;  1A41 A; 
#chains in the Genus database with same CATH homology
 1UG7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...