3KPHA

Crystal structure of mycoplasma arthritidis-derived mitogen
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
196
structure length
196
Chain Sequence
QNLNNVVFTNKELEDIYNLSNKEETKEVLKLFKLKVNQFYRHAFGIVNDYNGLLEYKEIFNMMFLKLSVVFDTQRKEANNVEQIKRNIAILDEIMAKADNDLSYFISQNKNFQELWDKAVKLTKEMKIKLKGQKLDLRDGEVAINKVRELFGSDKNVKELWWFRSLLVKGVYLIKRYYEGDIELATTSDFAKAVFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Mycoplasma arthritidis-Derived Mitogen in Apo Form Reveals a 3D Domain-Swapped Dimer.
pubmed doi rcsb
source organism Mycoplasma arthritidis
molecule tags Immune system
molecule keywords Superantigen
total genus 73
structure length 196
sequence length 196
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-11-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.530 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A mam-mhc complex, Chain D, Domain 2 3kphA02
1.20.120.390 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Hla class ii histocompatibility antigen, dr alpha chain. Chain D, domain 1 3kphA01
2OJED 3KPHA 1R5ID 2ICWG
chains in the Genus database with same CATH superfamily
1O3TA 2CJJA 3B9QA 2M87A 4O6YA 1G3WA 2QSGX 2VQGA 4JBAA 1E3HA 2XAHA 4D7MA 5LRSA 2XROA 1TQMA 1ZREA 4CGZA 2VH3A 3GODA 1IUYA 2F4MB 9ANTA 2YU3A 1EQ1A 4DJAA 4CS8A 2W4MA 4MTOA 3RJPA 3FXLA 3LSGA 2NUTB 3FHDA 2L6FA 4IL6C 1BM9A 2DT5A 3WG9A 3L1PA 3L34A 4YT2A 1GT0C 5D5WB 3M7GA 4JX6A 3TOBA 4NB5A 1XMXA 2LDUA 4XIDA 2AU5A 4WGYA 1QPMA 3MVPA 3F46A 2W85A 5KYNA 1SVMA 3I4NJ 2MABA 2KFDA 3E97A 3D0SA 4C2MJ 4X1EA 4Y17A 3SDGA 1XMKA 3AG3C 3TW7A 2LRDA 3WTYC 1P7JA 4G7HF 4JRZA 2A07F 3G4ZA 4YIFA 2FUG2 4DRIB 3O39A 3FKJA 3Q6MA 4EEFG 2HI3A 5KK1A 1JHFA 2MC3A 4CH7A 3B0PA 3EGXA 1VYIA 1D0ZA 3ZQYA 2EFPA 2K40A 2CNWA 4BAYA 3ZPLA 5L3EA 2DXIA 1G4WR 3K1IA 1VQOI 4W97A 2KJBA 2YZSA 2ZXRA 4G78A 3PMRA 1HE1A 2ECCA 1VQMI 2BGCA 3PO3J 3Q0VA 1ORSC 2ZBKA 4MEYF 1UHSA 4CCNA 1NK3P 1D8JA 3KETA 4XLCA 4EV0A 2ZXWC 3OOPA 2K4BA 2O0YA 2Q0OA 4AVPA 1H7IA 2JX0A 3OYBA 2EA2A 5FRNA 1LFBA 2COMA 3RFYA 3U2RA 3KYLA 2JMWA 3M3YJ 1ETXA 1G4US 3U9MA 4E18A 3FHNA 2ZXHA 1IO2A 2VPRA 5IY5C 3DBLB 1A5JA 1WKMA 1BIAA 1FFTC 5DD8A 2R05A 5BQGA 4MEXF 3ZTZA 2ZFUA 5K5QA 4YT8A 2GZWA 3JTHA 3QQAA 3QW1A 3TDZC 5DCFA 2AXLA 2L7KA 3AG1C 2CO5A 4FASD 1A31A 1E86A 1X1DA 1ZU5A 1MKMA 1MBFA 1WJ5A 3KYDB 2GWWA 4AUXA 3B6CA 2GQQA 5ILUA 3WU1B 4DW6A 3JCUQ 3B0VC 2BBYA 1LEBA 3K1PA 3DI5A 1YIJI 2CMPA 1Z1DA 2DFFA 256BA 1SD4A 4BQNA 3K33A 2QSFX 2ZXWH 3GZ6A 3EYIA 2V6CA 2O5RA 3KPHA 5D5UB 3N2ZB 1FYLA 2Q9BA 2ELHA 4DYCA 3GZNB 5GPGB 1WJCA 3BLYA 1I3QJ 1LPQA 2J7PA 3Q9VA 2VQLA 2G0EA 3EETA 5FLXZ 5J47A 2Y9ZA 2VCAA 1N77A 1FBQA 1AUEA 1YA7O 4BJ6A 4HQEA 5F27A 4XPYA 2FD5A 2QE9A 4OIRF 5A6BD 2WAEA 1W4MA 4BH9A 4LDQA 4PJLA 3JRCA 2ZMEA 3S3MA 1G2HA 4L9VA 4XICA 3ECHA 1QSPA 4BEHA 2OTLI 1PD0A 3FDQA 4L5JA 5K7ZA 2BYVE 3P9IA 4JOMA 5LBQA 2E5ZA 4LFUA 1LE2A 2E7XA 2B7EA 4RBOA 3AG2C 3PCVA 3RIRA 3EUHC 3I3LA 3H9GA 4KA4A 4XPXA 3I56I 2K9LA 5DQZA 2Y48A 2AP3A 1QO0D 4HPQA 1VB5A 3NYJA 3A0BC 1Y1WJ 5E17F 4A3BJ 5M3FJ 2VCBA 3J7AO 1EA3A 1PD1A 2QY9A 2Z3YA 2H94A 5D4SA 1QVTA 2ELJA 3TP0A 2XXAB 3CMEI 4EVIA 3DZAA 3HHGA 3BR1A 4YELA 4Y7NJ 1ZHYA 3RQ4A 1ZYRF 4AU7A 2HU9A 2V1UA 2DGJA 5E1XA 4V2FA 2EZLA 2M0MA 2H8WA 4O6JA 3I55I 3L2CA 1P2FA 4BE2A 3VYUB 5TGTA 3DJUB 5H20A 5FRMA 4KIFA 1H88C 3ABTA 3EGDA 4IO9F 1H8AC 2WVNA 2CG4A 3LOCA 2R7FA 2A5WA 2R7DA 1QZXA 4JTAB 1DGRM 2Y0MA 1ZKGA 3BZKA 2VBWA 2LD6A 3E9VA 1Z77A 1AWCA 5HNHA 1ZGJA 5L3GA 3GFJA 3ELKA 2VB6A 5DEQA 3TEDA 1U5TB 1CPRA 1V5GA 1T6QA 1R6RA 3NYMA 5KYUA 4Y13A 2JA8J 2PFBA 3LESA 1Z3XA 4BEHB 2M7AA 5BUOA 5HVQC 3I54A 4MTDA 2QBYA 1ZTRA 5BQIA 4I44A 2XLDA 4CXFA 3OIQA 2O9XA 2A3SA 2FA5A 3MMYB 3FXHA 2R7RA 2QKLB 3LEOA 1ENHA 2E36A 4NC7A 3K1IC 4OD4A 5JHUA 3DBHB 3IAS2 3LSMA 5T1DB 5GTIC 2M8EA 3J7AY 1Z7UA 1UG7A 4ZH4F 5EG0A 4UUVA 2IOQA 4BS9A 2XAUA 1RXQA 4O6MA 4Q5SF 4S05A 3CD6I 3S84A 3U1KA 1QGPA 1ZHTA 3IH2A 4H54A 1TT5B 2V26A 4WX9A 2YKZA 3EFOA 3SXMA 2L0KA 2VE8A 1PCXA 3MFNA 3UMIA 3HGGA 4TV7A 4OOIA 3H5RA 1LVKA 1T0FC 1C03A 2Q3TA 3EDPA 1F1MA 2YSRA 3FHZA 4KFCA 3SZTA 1BJZA 3S1NJ 5KCMA 2O8KA 2PN6A 1QZZA 4DYRA 3D5LA 2NSFA 2BW3A 3BPVA 2J45A 1P7IA 1KGSA 1G59A 4ZDLA 3K4NA 1DPRA 3MKLA 2IS6A 1SF8A 1Z23A 5H2FC 2VOPA 4HE8D 3AAFA 1Y0UA 1XG1A 3S1MJ 3U5SA 3ZQ7A 5M5XJ 4OIQF 2NOJB 2EFNA 4I76A 3ZQFA 1T56A 3M07A 2JSCA 2ZO4A 2BE5F 1Z6AA 2IA0A 1FOKA 1JT6A 1UG0A 2WA0A 3OS1A 3I5QA 2O03A 4LK1F 2LYCA 3SZPA 2HGCA 2DK5A 3K0LA 4WGZA 4A0YA 1J2XA 2CFOA 1XCBA 2ZNYA 1LDDA 3D1NI 3JRFA 1XPXA 1A7DA 1ZHZA 2WVQA 4XRSG 2YLDA 3BEHA 1IZ1A 2HDWA 5CKTA 3IRQA 1J8YF 2DPUA 4AC0A 3CMYA 1G6NA 2IYLD 3TULA 3T4RA 3WGHA 4Q47A 3DKAA 4OMZA 4HSRA 4A3JJ 4CJOA 4B09A 2HMZA 3MYFA 4IJJA 3PUBA 3KP7A 1PUFB 4ZYHA 2EV6A 2KYHA 3LL7A 3QRFF 3S0XA 1IDYA 2F6CA 4D4NA 3HOSA 5COFA 3PNVA 4KYWA 3A02A 5BMZA 5LRRA 2L6HA 3Q7LA 4ZLCA 4LG0A 4L6RA 2OTJI 3CUOA 2PEXA 1S7EA 2HKXA 1ITYA 2HSBA 1VQ6I 2H1LA 1V55C 1YITI 3OYKA 4EJOA 1WVRA 3EUHA 4GO1A 2H8RA 4DBQA 2IT0A 2GIVA 4IRIA 1ZVZA 3LAYA 4A2NB 4HEA2 4XRMA 5JS5A 3GTGJ 2OZUA 4CIHA 1MW7A 4LMYA 1QVUA 5E1WA 3KLNA 4JEAA 1A04A 2FXAA 1T01A 3JZ0A 1KU9A 3KEOA 2X1DA 3EZIA 2DI3A 1NLXA 2WAFA 4M6YA 2Q2EB 3CP2A 3TDUC 1VQ4I 2X0CA 3DU5A 2EZHA 2WY7Q 4LITA 3CC4I 2ZCWA 3CSKA 1TQIA 3JTGA 2RDPA 5KYWA 1HA8A 3LSHA 1Z7LA 2R92J 2ECBA 2P6VA 3RKXA 2KGOA 3FMSA 2MH2A 5K1YA 2IM8A 3C2HA 2VKHA 3CCJI 2J7PD 3V8KA 4LOCA 1AHDP 4GEHA 4ZDOA 3T6BA 3KYCB 2PX0A 1TLHB 2RREA 5BQHA 5GPCA 4KICA 2CUJA 4HX7A 2JA7J 2XIGA 3MKWB 2KZGA 2LKXA 4BQQA 2JA6J 2CCYA 2XS1A 5HDNA 1K79A 1OCPA 3U3BA 2P8TA 3I4MJ 2ME0A 5FFXA 2E1NA 3BR5A 2KJCA 1MH4A 3C2BA 1WFXA 1J7KA 1TL8A 2XPWA 1MMSA 2OCEA 5B1BC 1YQAA 2ZXPA 4YJWA 4M71A 5JRAA 5DCMB 1LUJB 1SMTA 3DFGA 4UVCA 2HFIA 2NUTA 1BN5A 3FXUA 1WASA 4U0YA 2JRMA 3PO2J 4EJWA 1UMQA 1ZRFA 5JP7A 4A12A 3JSEO 4B6IA 4ER9A 1E2XA 3ZMSA 3H2UA 1Y0NA 3RQGA 2M1BA 2VJ4A 3V7SA 3DEWA 1IN5A 1WATA 2WZLA 4FAPB 3DXJF 3V42A 1OPCA 4BHPA 2EPKX 3C8GB 5CI8A 3F8BA 3OYLA 1Z05A 4D0PA 2OJED 3HOVJ 1OLTA 1JT0A 5JVEA 1IV8A 2HVSA 3H36A 2NPUA 1R5ID 4ZZLA 5ERIA 1H0MA 2WBMA 1J75A 3HRTA 2AVKA 4NTFA 3E6MA 1MH3A 3L2RA 3LNRA 2KL4A 4CS7A 3GCMA 1XGSA 3HOTA 2V1DA 2ELKA 3C8GA 5HLHA 1BOAA 2EPLX 2XUBA 4CCMA 1I1SA 5HOOA 3Q0UA 4IRUA 3K70D 3NKEA 1VK5A 5FLMJ 1VQLI 4Y52J 1I6HJ 3DD7A 1ORKA 1YHQI 2IS1A 2IGNA 4C3BA 2XF5A 4HLXA 3BR0A 4ENKA 3SDBA 2LNBA 3JYYA 2CQKA 2IBDA 4AIHA 1IC8A 3BOQA 3LNQA 1DUXC 4YFKF 2HOSA 3M1CB 3N0TA 4E0IA 5A6BA 4II3A 5F5HA 5A2QK 2W82A 3CCRI 1BIBA 1XDUA 2Q9CA 3FM3A 1M1EB 4HQMA 2ETSA 3T8TA 3HKKA 1FMVA 3HJEA 5D5XB 2H6CA 4ASNA 5FJ8J 2LY1A 2VC9A 1JKRC 1R22A 2V3CC 5T3TA 2XL8A 3CTAA 2WY8Q 2E34A 1VQ5I 2XHKA 3ROUA 2DMUA 5JLXA 3DE9A 3QYFA 2DA1A 1E17A 1BI1A 5L3FA 2YLGA 1Y39A 3QTHA 2YHSA 2XVCA 3HPHA 2BY2A 1LQ1A 1I6XA 1N78A 3KEQA 2W00A 4AIDA 2G3VA 3BTJA 2Z1DA 4HAMA 1RCPA 3AQCA 2RNGA 1MJAA 2PJPA 3OYNA 2E1CA 2VJIA 2UWMA 3NG1A 1IRGA 3HSFA 3W2WA 5K5RA 3RF3A 2KIUA 1HMDA 1ZQ3P 2VBZA 4EIYA 4N6HA 5HLIA 4C7OA 2BHYA 3ZQVA 2V1XA 3EZHA 3IV5A 2LSOA 1WSUA 3HG9A 5K0IA 1JUMA 2ZSIB 1UZCA 3HYIA 4ZTFA 3BCBA 5J40A 2I8BA 1LIHA 2M5WA 3M8JA 3EHMA 3WE2A 1NG7A 1E85A 1XGNA 4M9ZA 4XSZF 4KJZA 4IHYA 1S9HA 2LKPA 2J5OA 4RB3C 3HGYA 4U9DA 2DW4A 1V4AA 1P9QC 2IBFA 3BQZA 1HXDA 2R4GA 3SXKA 3LUTB 3ABKC 1TWCJ 3BTCA 1SFEA 3K1MA 3U8PA 4DGWB 5HLGA 1DPUA 2X1CA 2GBYA 1APLC 3NRHA 1VQ8I 1ETYA 1L7CA 2XSDC 1YA9A 1NBBA 2L9JA 4A69C 3FK6A 4PZJA 2UXXA 1WJAA 1YFHA 4J32B 3C63A 4U5BE 2DB4A 1C0WA 2BL2A 4LK0F 2M3AA 1XS9A 2WVOA 3ZSUA 4MVZA 2YL1A 4X0GA 5H6RA 2FJ1A 4A4AA 2LD5A 2Y31A 4XPWA 1EKEA 2LFDA 2HXOA 4OIOF 5L0HA 1J09A 3M4OJ 5EDNA 5CVRA 2Z9OA 2LLKA 3TQOA 1IRXA 1HKQA 1MSFC 3M4BA 3W8IA 3A1YA 3T6GB 1X2NA 3OS2A 2KIFA 1BZ4A 4YWQA 5FZTA 3N24A 1JGGA 4JQFA 4XRFA 2Q7RA 3L09A 5DS9A 4CS9A 3LS1A 3TO9A 2XLWA 2AWCA 2NRAC 3CQZA 4CO8A 1IXRC 1KYZA 3RQFA 2Y3HA 4LB5A 4M3DA 1WTYA 3WE3A 2GDCA 2UUIA 4N06A 3ZR8X 4N4WA 5FFZA 1LDJA 5FO5A 1BA5A 1FWZA 2L02A 3WTTC 3DBRB 3GFIA 2VT2A 2Y69H 3ZP5A 3H5NA 2GXGA 3S29A 4DJ9A 4EBJA 2FX0A 4L9JA 4F3QA 2WTEA 3FXRA 5IYBJ 2W45A 1EH8A 3UMKA 2NS0A 1NSGB 3MX3A 4R79A 5IP9J 4A3DJ 4FWVA 4MLOA 3ONQA 3REOA 3M79A 2X1EA 1YJNI 3DF8A 4KUMA 1QQIA 4B3XA 2QSHX 2XV4S 3RPUA 3BY6A 4FHTA 4IOCF 2WB1A 1RJ9B 4PDKA 2F5FA 3VOEA 1JMWA 4GQHA 2HSQA 2ID6A 2GA2A 1MMDA 1TWHJ 3BTLA 2JVHA 3WHNA 3CMAI 3EUAA 4D5FA 3CJQB 3S1RJ 5DUKA 5HODA 2DCEA 3ITFA 3U9GA 3B02A 4E4HA 2QBYB 2W4SA 4JCHA 2MWQA 1ONVA 2F4OB 2I5UA 3LQQA 3P7NA 4AL0A 2BY3A 2RGVA 2XXAA 2WL8A 1M57C 3HIFA 3CJRB 1X19A 3ULQB 4E7IA 5BOXA 2CGPA 1SZIA 6PAXA 3DPTA 2XLMA 4B8XA 3OYHA 1WI3A 3VYSB 5HDGA 1E3OC 2G3KA 5IY5H 5ICCA 5A2QZ 1VTNC 2IJLA 3S3OA 1PUFA 2A0UA 1P4XA 2FBIA 2X9DA 2KP6A 1J9IA 3RKYA 1K6YA 2ZFWA 2JN6A 2DU9A 1ZHWA 4E7KA 2STTA 1SYQA 1NFOA 1AKHA 4ZDPA 2R7ZJ 1ZW2A 1U78A 3HHHA 3HOUJ 2NAZA 1I5NA 4EBKA 3DPUA 2R93J 5L3QA 3HTKC 4E7ZA 3LA2A 2OV7A 2L9SA 3TBIA 3EH2A 4F4BA 1HOMA 3IEEA 5KYUB 1KZHA 1XSVA 1U5TA 5LGNA 4XL9A 2PLYA 3K1HA 1B8IA 4MS2A 2DOFA 2H09A 1O87A 4NQWB 3BR6A 3FBNB 4Z9IA 2XKOA 2ADUA 3JSOA 2Y3DA 5LEKA 4EATA 3BCAA 1ZK8A 4ABZA 3PNTA 2L5QA 3SZGA 1Y4CA 3F72A 1ZGWA 3IQ5A 3GEZA 1W7PB 3ABMH 2LQGA 3EQLF 3JAMZ 4IZZA 1B1BA 4MNDA 5ILVA 1P92A 1I4ZA 5F0FA 1K40A 3HXLA 4J01A 3NAUA 2CNWD 2ZJRF 3AQBA 1OYYA 1LS1A 1A7EA 4RDAA 1TP4A 2FE3A 4QSHA 1EJ9A 4G6TB 1XWJA 3DKYA 1JE8A 4IHSA 3PIPF 4CZCA 1FTTA 4CIPA 2J9BA 4ZYGA 4RAGA 3CDHA 2QLAA 2Z16A 2LMDA 1G3TA 5ILSA 2IGOA 2HZ8A 4UY8I 2R7OA 2MHRA 1W0TA 1JUSA 5DS5A 2FQ4A 2F2EA 3H0DA 1YRNA 2Q4FA 2OEVA 3SXZA 2R0QC 4XOTA 2HYJA 2WC2A 3HM5A 2E71A 1SD7A 1MDMA 1M2VA 1BW6A 4MQ9F 1X1CA 3AG4H 1A0BA 3GWLA 3PDMP 1NZEA 2JWTA 3ZQQA 3RKOF 2A1DD 1R4TA 2FEZA 2LP4A 1YYVA 4HX8A 2A6TA 3G3ZA 1NK2P 3SP1A 1ZELA 2F48A 3H92A 1YZCA 3AGUA 1WCMJ 2HZTA 2XASA 2VQHA 3EPZA 1DDNA 1U6HA 3GWNA 2ZPAA 1U0BB 2XF6A 1S6LA 3RQEA 1BOBA 2M7BA 1FSHA 2JPCA 2M0CA 4DBRA 4RBNA 2E35A 1TNTA 2L9RA 1UFBA 1VI0A 2KIQA 5FB2A 2M4EA 4UDVA 3IP4B 4ANJA 2VE9A 2L4AA 3GMEA 2NS7A 2P7CB 1X1AA 2C04A 1FNTc 2XGEA 4E7SA 1S72I 2DAOA 1KU2A 4RDUA 4S04A 5LEJA 3B6AA 4A3IJ 1D5YA 3HOZJ 4U7DA 5F0HA 5JVGF 2DYRC 4U5CE 4Q4ZF 1FTSA 4KMUX 1MQVA 4MTGA 2H7VC 2KRCA 1IN8A 1I1GA 3CZ6A 2ZC2A 4CSAA 2NVUB 3US6A 4CYDA 5J4YA 1VYKA 1YDIA 2CGEA 3BT9A 2L6GA 3DCFA 4E6KG 2YEVA 3CUQC 3QPLA 1MNMC 1VQ7I 2A05A 5GP9A 1JKOC 2IEKA 2CV0A 3ZN1A 5B5EC 3MEXA 4BACA 3C8ZA 2NUPB 2HYFA 3LSJA 2M4GA 3U0CA 1JTYA 3SFZA 1IRFA 3FXQA 1VLSA 1IUFA 3E3VA 2E2HJ 3K4KA 3JR9A 3U2LA 4ITVA 1O5HA 2P5KA 3GEHA 2K5CA 3FWEA 3IWZA 4BG0A 3K9TA 2F5VA 2IW5A 3J80K 2HDCA 3BPXA 1OW7A 2XLHA 1LPEA 3GANA 3HB9A 3AOUA 1UELB 3EGXB 4HOBA 3ZMVA 3VYTB 2GAUA 1BJAA 2Y75A 4J19A 5DS4A 1BI2A 5L0IA 2DT6A 2LREA 3HRUA 3A4CA 1ETOA 4BBSJ 2VCCA 4XKVA 4RAFA 5L0DA 1F4KA 1K83J 4YFXF 3SNHA 3W4YA 3CJNA 2HEOA 3E5UA 4WCGA 3Q7GA 2C6YA 4HLYA 4PJMA 3POVA 2LOOA 2Z5UA 1U89A 1FP1D 1OR7A 1QHHD 2NOGA 4XTKA 1APCA 2YPRA 1BR2A 3F3XA 3DV8A 4LLLA 3WTUC 3JRMO 2VXZA 4LGWA 3J7ZI 1JI8A 2ZNZA 1ST6A 1YYXA 1CF7A 3OR2C 4YRVA 4JC7A 5KYWB 2LFBA 1S7AA 4XONA 2HDDA 4A93J 1VLTA 2H27A 2QA4I 1Z0XA 2CQQA 2F5DA 4YL1A 4NC6A 1AVOB 1T8IA 5TJJA 1X58A 5FLVA 1G5ZA 1SVLA 1FZPB 4FE4A 1OCCC 4BYYA 3GTPJ 1FMWA 1MMNA 3OWTA 1JGSA 1CF7B 1HKTA 3B71A 4EUKB 2P1AA 4C30A 3HPGA 2DLLA 3C3WA 4MW8A 1ZRCA 3R0JA 2VODA 2DFEA 1WGXA 2VIXA 3R60A 1Y56A 2EH3A 3G73A 3H35A 2CSOA 3BJAA 4FE7A 3SEZA 3VYRB 4CYCA 1YX3A 2AXTC 1X4PA 4CJGA 3K4LA 3OYJA 1GXQA 1KQ8A 3L0IA 3OYFA 2HWVA 2DN0A 2L01A 4CCLA 4E70A 1G4DA 2YL7A 1P6RA 2QGUA 4DOZA 1HCRA 4QTRA 4DQ2A 2IAIA 1O7LA 2DT7B 2EIJH 2WADA 4K0DA 1OCCH 4ESFA 2XC7A 4LLNA 1TBXA 2EPNA 4XLNF 3S90A 3I71A 4XMYA 2V9KA 4LG0B 3GYHX 1KQ0A 1X3WB 3KL4A 1S29A 4AL1A 2YUSA 2IVMA 4L9TA 3S16J 2QTVA 2M34A 1D3YA 5F0CA 3O55A 1IZMA 4Z2YA 4EGYA 2JT1A 2TMVP 1ULYA 3PL8A 3WAQA 2V4JC 2FQ3A 3ZMZA 4U7BA 2VJJA 1G3YA 1S05A 3RIPA 3U2MA 3DLAA 1MD0A 3TOAA 3J81K 2PI0A 1VF9A 3K70C 4O5VA 4AYBA 4ZJZA 1M2VB 3V8JA 1ZLJA 2V9PA 1ERDA 1USSA 2CWEA 1MJ9A 5EYRA 4QLCU 2IXPA 2XRHA 2ESHA 3CQZJ 3OL3A 1Q1VA 1SD5A 3U21A 4BXFA 1T39A 4A3CJ 1DOWA 3NWSA 2PX9A 4XKBA 4F93B 5DUIA 4XSXF 3IQTA 2M2EA 4C2UA 2RV8A 2P6SA 3HBLA 3HEFA 2K27A 3GTQJ 2UXNA 3A9CA 4NCQA 3LSKA 5J3LA 2DODA 1YAUO 4Q7CA 5D6EA 3O8HA 2HTSA 1NFNA 1FBSA 4YL0A 2K86A 4L5IA 3KLOA 1M56C 2VUMJ 3MAJA 2XB5A 3ABUA 1XSDA 1I50J 4MVUA 3RZDJ 5JLWA 2NNYA 2K02A 3GTLJ 2EZKA 1QHGA 1YARO 3SXYA 3ZQGA 1ZZPA 2K9NA 2J46A 4K1OA 5B1BH 3JRAA 3PHF2 4BJTA 1XN7A 1GXPA 3PSFA 5J1UA 1OQCA 3R6SA 3HUGA 4AYBN 4IWBA 4G9YA 2E87A 4YK5A 2PX3A 3X2QH 2R7QA 2L81A 3QVYA 3HSEA 3ZQHA 1B72A 3RSNA 2B0HA 2W24A 3ABMC 4MTFA 2H6BA 2HOAA 2V9VA 3ISPA 4P55A 1HF0A 3T8RA 1QKRA 2M30A 3IAM2 1WI9A 1OCRC 2VOOA 2L2OA 4K2EA 2I10A 3L2WA 3L8JA 4I98B 4MVRA 2EWNA 4XLEA 5E3LA 4DRJB 1OXBA 4WXHA 2ETHA 1S7OA 1GM5A 1XGMA 1YJ9I 2X6YA 1I27A 2W84A 4JX5A 5IT3A 1KTMA 3LSPA 1TR2A 2WWYA 3B0UX 5CJ9A 2MSYA 4GYGA 1F43A 5TJ5E 3HOYJ 2HMQA 2D45A 2NNNA 4KC9A 1MDMB 2XAGA 4QWQA 2UZKA 5GAHJ 4ESJA 3PFIA 3LJBA 1GVDA 3K2ZA 3SQNA 3QU6A 4Y4RA 5E2QA 3ESWB 1U3EM 3CAXA 1O3RA 1M6TA 3HOWJ 4ZLDA 2P7VB 3EHNA 4D4XA 4KIBA 3FMQA 4BXUA 4PGHA 3G6EI 5DS6A 2VQCA 3BR3A 2KKOA 3FISA 3ZTMA 2KC3A 4CICA 3CMMA 3TW6A 4BJ5C 4ZC3A 1FOYA 3TO6A 1OW6A 2HKVA 2EV0A 4HSTA 2DFIA 4MFDA 1J0RA 4EM2A 2PJRB 3IKVA 5FROA 2EZIA 2VXDA 2GA0A 1BC7C 4BJ6C 3PJRA 3NMKA 4R32A 2V1NA 5C44J 3SEOA 4JKVA 2P6TA 3S3NA 1FPQA 1Z5ZA 2RQQA 5CQGA 1TC3C 3ZVRA 2PBIA 1H89C 1BDJB 4PSXA 4B1RA 4Z6YA 3F8CA 4XQ1A 3E70C 1WRJA 1SVOA 3BJOA 3KIOA 2XPVA 3JAMK 1LE8A 2L7AA 4RGSA 1QNTA 2A6HF 2E1OA 1O57A 2LH9A 4P5OA 1YW7A 2CQXA 3GF2A 2LG4A 4A0ZA 2ZSHB 1ETVA 4PGGA 1JTXA 5HS8A 1BC8C 1PP7U 4GXOA 2R5ZB 2EIMH 4JYKA 4UB6C 2EINC 5HDKA 3W2VA 4CBEA 1FLIA 2IS2A 1B9NA 3C1DA 4N0BA 4FX5A 4O3MA 3M15A 2NVXJ 3SHFA 1YW9A 3ASNC 2PMZN 5EK0A 4JJGA 2HYGD 2XB0X 3DKWA 4RM3A 1OJLA 1Z6TA 2RC4A 3OOUA 2Q8KA 1HMOA 2XAJA 5KAIC 2UV1A 1DU0A 1WN0A 3MYIA 1IN4A 4PFOA 1JJ6C 4ULWA 3QP5A 2WAQA 2PG4A 5LGTA 2ZJQF 1R1TA 4NBQA 2XL4A 1U9NA 3KZYA 4LLEA 1GS9A 3QW0A 3V7CA 2B9SA 2BY0A 2GIZA 3K69A 3ZMUA 2XGXA 3FDYA 3C62A 3VPRA 4AM3A 4M9SA 1FIPA 2EK5A 1MBEA 1SAUA 4Y3OA 4IHXA 1VMAA 4P9TA 3R61A 5GTHC 2NYXA 2ICWG 3VODA 3SYTA 5E33A 4U5FE 3HRMA 1Z9CA 4RB1A 4IRGA 3JRGA 2JQ7A 2AO9A 3KP6A 4U9EA 4O7GA 5J6XA 1C17M 4CS8C 2MH9A 5A6KA 5LGUA 2OG2A 5C4JJ 1Y6IA 1FIAA 2QNLA 5DM7F 2R7TA 1DP7P 3NMIA 3IHUA 4W1UA 3DLLF 5CLSA 5EJCA 2VONA 2EFWA 5IP6A 1T98A 1F36A 4XK4A 5ICFA 1YJGA 2LK4A 4BE1A 3U9JA 1U8RA 2XKPA 2HQ5A 3VEPA 2DOAA 3V7RA 2H7OA 3HTSB 4RMNA 4H0EA 4I2OA 1OKKA 3KFWX 4M3GA 5EEAA 3D5SC 3BG3A 3GLXA 4KT6A 2QUFA 4EWCA 2QM3A 3F6OA 1TT0A 2V7FA 5J4VA 2QUPA 1PV3A 1ZH5A 2E2IJ 5EGOA 5D91A 3O10A 3GVAA 4IOAF 1S3JA 2LVSA 3GW2A 2DA4A 4OU0A 2MG4A 4F52A 4BHCA 5E8IA 1RNLA 1KA8A 3ML6A 1DGWY 3T1BA 4J7YA 1B8IB 4DVZA 1YOVB 3T0YA 2WZGA 2OD5A 4BBRJ 1WWXA 5COGA 2ZB9A 2BV6A 3OEOA 1FFHA 2OQGA 3ZQCA 3S17J 3K10A 1YG2A 4ZZDA 3NRVA 3ECSA 3FXOA 3K6BA 1EV7A 3ASOH 1TFOB 4LDKA 2FU4A 3S93A 3C8GD 1YVIA 2ZJ2A 1VNDA 3J7YJ 1R36A 1W7PD 2DO7A 1R23A 3CUQB 1RI7A 2KIMA 4G7ZF 3KMIA 3P5JA 4MGRA 1R58A 2Y9YA 4U5HA 3OSGA 4DRHB 3CCUI 2HS5A 3OS0A 4HBLA 2WV0A 3K4CA 1A36A 1JAFA 2DA7A 3KE2A 4C3HJ 4IHVA 1Y1VJ 2O8XA 2OBPA 3KP3A 2KPMA 5AONA 2BOLA 2IP2A 4LD5A 5DQTA 5L0CA 4MQVA 1BR1A 1WHUA 5L3DA 3N05A 1EA8A 4N9HA 1NH3A 4FESA 2IGMA 2XLOA 1RC9A 2RQPA 3V5ZA 2MW8A 5BQTA 1HE9A 4UXNA 2PBEA 3P9CA 3HLZA 1V5FA 3KP4A 3OYIA 2G7UA 2F5CA 2ZXOA 3ASOC 4MVMA 4CHUA 2MLGA 1FY7A 5DLJA 5K5OA 4RLQA 4IARA 1DP3A 1EKYA 4M3FA 4UUSA 5TRDA 2RD9A 3MQ0A 2FRHA 4OMYA 1KQ9A 1N1CA 2ESNA 4QPOA 1LFPA 2VBXA 2XM0A 1FJLA 2J0WA 2XRLA 4EGZA 2JTVA 4A3LJ 4I1OB 5JSLA 4AX2A 4XOPA 5FD6A 3JTLO 4EBBA 2MLKA 3VSKA 2EFQA 1QBJA 3VF0A 5E3AA 2DA5A 2R5YA 1M2OA 4KN4X 4XQFA 1YO5C 1DU6A 2JSPA 4M74A 3WTVC 4ONSA 1YS7A 1ODDA 2E1MC 2EFOA 2Z99A 2HFHA 1XTAA 4IQ4A 4U88A 1UFMA 4NQFA 3WODF 4BGDA 5L0JA 1RMVA 3HC7A 1V5EA 2FF4A 2CV2A 2ID3A 4N6CA 1PJRA 4M9XA 4PUSA 3ZN0A 1IGNA 4NHJA 3HRSA 3GEEA 2XM4A 3GORA 3TP3A 1WQ2A 3H1CA 3GTJJ 2CYYA 2XRNA 1MBHA 3AG1H 1RRJA 1OKKD 4PJNA 5F08A 3QPHA 4EQQA 2P5LC 4F7ZA 3MBGA 2JD3A 2M45A 1V54H 3G50A 2Q9AA 4AK9A 1JXSA 4U0VA 4XR6A 4A6DA 2L4MA 2XGDA 2D1HA 5F6FA 2IRFG 1OCRH 2XAQA 5LFAA 3B29A 3M8FA 1XDSA 1D1CA 3E5QA 3FZVA 4G7OF 3OYGA 2ZKZA 3GZ5A 4HNTA 3OL4A 5HLTA 3JSPA 3LLKA 2OF7A 1LVAA 3ZCOA 4GYTA 3IH4A 2I15A 3GO5A 3TOLA 2HPIA 1TZLA 1WH7A 4Y15A 2QENA 5CQEA 1T2KA 5E3CA 3H9QA 3X2QC 3JCUC 1Z67A 3OYMA 3E6CC 3GBGA 1LE4A 5TISC 5LHGA 1QLEC 1G3SA 4M3EA 1SC7A 1X3UA 2FBKA 1R71A 1X4OA 1QZEA 3FXMA 2OZ6A 2J8WA 4HV6A 3IH3A 1USTA 2EA4A 2GA1A 1OQYA 1ZRDA 4RB0A 5D8LB 1IAWA 2HPMA 3KYIA 2VKEA 2Q00A 2DBBA 3HL2A 2Z15A 2DA3A 2XLEA 4RS8A 1ZARA 1DQUA 5IP7J 2H7BA 4ON0A 5BPIA 1H6GA 3ABKH 2LSEA 5CVJA 4W8KA 3UR3C 2E5NA 5L0FA 3RTRA 2KISA 1ZG3A 2XLVA 3WU2C 2JZYA 2STWA 4IPAA 3U8VA 4I7HA 2L7MP 1ETWA 1Y8QB 1P4AA 5LHHA 3OYDA 3AL0B 3CCYA 2E19A 2LF8A 1T6SA 1LI5A 4XLAA 2KDZA 1RUOA 2LCHA 3I53A 4RD9A 2LBFA 3L00A 2ZJPF 2MYSA 3F8FA 3FX3A 1IXSB 1MMGA 4QIWN 1YRNB 2PNOA 2C03A 4RM2A 3RPUD 3BR2A 3VSLA 2HQAA 3G2BA 5EZGA 1PDNC 2HOTA 3HSRA 2XSEA 1HDDC 3IL2A 2CUFA 1ZR2A 2MBFA 2PMZA 5B3SH 3AFHA 1FT9A 4EM0B 5J8FA 1SD6A 2QYOA 4HFKB 2X6XA 3NWTA 2EPMX 3BJ6A 1OCZC 3RH3A 1GV2A 3LAJA 1I39A 1KU3A 1U0JA 1SFUA 2YX4A 5C4XJ 2ZXJA 3BWGA 3ZMTA 3HNKA 1Q0GA 1O3UA 2CQNA 1FR0A 2WAQN 2EINH 3HNJA 4G6DA 3QZCA 4I09A 1FYKA 2NS8A 2R02A 2L9NA 1R4NB 1ZGAA 2Y0SN 3TOMA 2H1KA 1T38A 2HKOA 2OQMA 1KYWA 1MBJA 4WXDA 4ZYDA 3RVZA 2R7WA 2X51A 3SJMA 3EFOB 4JTDB 1V4RA 3MCZA 1YS6A 2D2WA 3PSIA 4ESBA 4KN7X 1TFKB 4R8HA 3H3VK 4B43A 5DDGA 1B6AA 4CDGA 2EIKC 2KZVA 2P0WA 1J5YA 3A0HC 4I99C 4YIIA 1VQNI 4U5EE 3C7JA 3KP2A 4JCZA 1QA6A 5IYDJ 2CW0F 3O2PE 5AIQA 5GPAA 1K4SA 1OCZH 2RKHA 3F22A 2EBIA 3TK0A 3VAYA 3FM5A 3LFUA 3F6VA 2QKMB 3Q9SA 2ZXIA 4OINF 2VL8A 4NQWA 3CF5F 4M63A 5B1AC 4X0RA 1K78A 2PQ8A 5EGOB 2QLZA 1PUEE 2B0LA 2W48A 5FKNA 4A5MA 3DE8A 2P4WA 1IJWC 1OR3A 1LB2A 1OYIA 3TKYA 2BZTA 3M8EA 4GYIA 3LA7A 5BNGA 2EIKH 2TRTA 3IQCA 1Z63A 2L7ZA 4BY7J 2D5VA 5AC4A 1VTMP 2HOEA 3CF2A 1AKHB 5A6JA 1YJWI 3VDXA 4M6XA 5L0GA 1STZA 1UB9A 1RKTA 2YS9A 1JPNA 4JJFA 3BZCA 4R1HA 3AJMA 1T0FA 3MZ8A 5L3BA 2OCCH 5CPRB 1ZHXA 2YWAA 3J06A 1EI7A 2MD0A 3KX2A 5LD2C 1RKCA 3ZMDA 2W9YA 4ZYEA 3N4MA 2LIGA 3R7CA 3K6GA 4FTHA 4OAYA 3RYLA 4A6EA 2L9VA 5COMA 5HNFA 1ETKA 1O3QA 4MIMA 2FMLA 3RVYA 4IJAA 2QQAA 2R03A 2P81A 5CVIA 5M3MJ 3I58A 4I6ZA 2J0XA 2CFXA 1UHWA 4P9FA 4CCOA 5FKMA 2HQRA 1CQTA 3HNLA 2OAZA 3TGNA 4OIPF 4V19K 1WPKA 4B3AA 1W0UA 4JE9A 3GFMA 1K7AA 2A61A 3O8GA 3QPTA 3E6DA 1B9MA 4HV5A 2LC2A 1YW8A 5E79C 2OC6A 3V8LA 1X3ZB 1D1AA 4GRIA 1RPWA 1VZ0A 4DVYP 4BJ1A 1J59A 5IOYA 3LAPA 2YR2A 1R49A 2DQRA 3SFIA 4B4CA 4E7JA 2HJ3A 4LLGF 4U5DE 1OW8A 4AIJA 4CDVA 4FX0A 5EEHA 5ED4A 4A3FJ 1YZAA 3CC2I 2OQRA 1YI2I 1LI7A 1MJBA 3PNYA 1IRZA 2HVQA 2R3SA 3CDLA 3Q3SA 1U8BA 2GM4A 2DJNA 1WGWA 3G71I 3AKZA 4XM3A 2B63J 2J9WA 3DTEA 5E3MA 4IEJA 4UNOA 4WJ0A 4HG2A 2BHZA 4IHTA 4EJVA 1CGPA 1OR7C 3C2GA 3LSIA 3S2WA 2UUHA 1HW5A 3I0TA 3S2HJ 3AG4C 4G0HA 4MVSA 2DJIA 2E7WA 3CDIA 3BG7A 1HSJA 5HV9A 1BR4A 2DYSH 1WJBA 4K7BA 2NVYJ 4GGGA 5D4RA 4IGGA 2VKDA 2R25A 1ZG5A 3T9OA 2DMTA 1HDPA 2A68F 2FOWA 4E0HA 3L2UA 3HUGB 3RI4A 1GQAA 5E3OA 1BI3A 3L8IA 2K4JA 2CW7A 4ZTJA 4XEFA 1LFUP 5EG0B 4YN0B 3QWLA 1IW7F 1FOXA 3E5XA 1QU3A 2IXMA 3E6BA 3BTIA 4B47A 1O3SA 1RESA 4J7TA 4BEMJ 3I4UA 2MC4A 1A41A 2GWRA 1PVEA 4FETA 2D5RB 4C3IJ 3DTKA 2O9LA 3LFKA 1QZYA 1FX7A 3IPMO 3CC7I 2RNJA 1SANA 2W57A 2XDVA 2K9SA 2ZMEC 3K7AJ 3QMKA 4RGRA 1TWHA 1FOWA 1A6IA 1TW2A 1JR8A 1H9GA 1K05A 2JPBA 3GXOA 2IXOA 5F1RA 3VRCA 3F47A 1P4WA 3AL0C 3KH2A 1Z91A 2EILH 4JW1A 1OKRA 4U5GA 4IVNA 3K2AA 1REPC 3UMHA 1I4YA 1W1WE 5DM6F 2JK3A 3CEXA 4IXAA 4IHWA 3LQRA 5F1JA 4LLCA 3GTOJ 2G7HA 2PF4E 3I64A 1WJEA 3JW4A 1A35A 4IB4A 3BZ6A 3T5XA 3CCEI 3K7DA 5E8GA 1UJ8A 4BE0A 4L0ZB 1GUUA 5A6AA 2EIMC 3GM2A 4XEVA 2O61A 5F5FA 2WZFA 3RDIA 2BVLA 1DOVA 3GEIA 3WGIA 4E7HA 3L9FA 1FBUA 3KCCA 3QYBA 2NVTJ 4RB2C 2Y39A 5KYYA 2L3DA 2TDXA 1C02A 1SFKA 4A3MJ 4N4NB 1ON2A 5FKKA 4A0XA 4EKWA 3RYPA 3COAC 4JP0A 4IF4A 4KNVA 4G12A 2MFZA 3OYCA 3DPLC 3MKYB 2NSGA 2LF7A 3RZOJ 1GDTA 3TQNA 3QU3A 2ZD9A 2W7NA 2I8DA 1EH7A 4HF1A 3DAGA 1LE8B 3NKDA 4OAZA 2NVQJ 2YRFA 3J80Z 4XKWA 4JTCB 1Q0KA 4XLHA 1ZAOA 4DXWA 5F64A 3KZIC 1LM3B 3KEYA 4C2TA 1TWGJ 3TJ5A 5A69A 5HSWA 2A69F 4L9NA 2GOXB 2LY9A 4YEJA 4HDUA 4P1WA 4A3KJ 2LR8A 4FQGA 4DNCA 3ZOBA 4KMFA 3DU6A 4PCQA 3IQ6A 5BS6A 5EHHA 5CI9A 5FLXK 2OOCA 2KSFA 3JYHA 5GAGJ 1Z3IX 2D1VA 3QPSA 3DP7A 3WGGA 1VQPI 1OYWA 2DA6A 2YX7A 2KK1A 4XWJA 4AE4A 1FP2A 1YTYA 1QVXA 4YT4A 4CCJA 3G4SI 3EUKL 2PMUA 5B66C 3FVYA 2KQ9A 4S0HB 2EV5A 5JVTA 2WB1N 3OIOA 4UV9A 4P6IC 3AGTA 2W4BA 4Z9JA 3EPVA 3A01B 3Q5FA 3IUOA 3KP5A 4JVSA 1K04A 2GOMA 2OA4A 4JK1X 1Q0MA 2FAPB 1LKXA 1AEPA 3G1OA 3V4GA 3ERED 1NU9C 3HTUA 5B3SC 1YIOA 1Z21A 1ZHFA 4XKCA 2R5ZA 4RAZA 1E3PA 2QWWA 3IRRA 2F5EA 4G8XA 4A3EJ 1W36D 2HVRA 1D5VA 1KNYA 2X6OA 4I1MA 3GM3A 5K7HA 1O7FA 1MZBA 2HXIA 3HJCA 4YL3A 1NTCA 2P61A 1AOYA 4GDFA 2F22A 2HV7A 1RZ4A 2VLAA 4HF2A 2QF7A 5IOZA 4L5EA 1Y6DA 3O3KA 2J5PA 4HFFB 3X1OA 2EJRA 3L2QA 3K4JA 3FAJA 2PMHA 3C18A 1EH6A 4HEAJ 1S8NA 3JSZA 3FF5A 3B73A 2WB7A 2KMUA 4EM1A 1RIOH 5E20A 3PUFA 3FK7A 2V6EA 1N25A 4XN3A 3CJTB 2YL3A 4XEKA 3RKWA 2PP4A 2OPTA 1TTYA 5DV5A 3MKZA 3DMDA 5FKOA 3OIPA 2P7VA 3DTIA 5JUAA 1NHAA 2K85A 3EYYA 3PQJA 4C3EA 2QVOA 3A11A 2VASA 3GWZA 3JRBA 3OSFA 1R00A 1JKPC 4WWCA 4LERA 1V3FA 3TD7A 4MNUA 1XB4A 1V55H 1GV5A 3QOEA 1K78B 4BXXJ 1TWFJ 3LA3A 4BY1J 3GTMJ 4UV8A 4KDPA 3IC7A 3CO7C 1JKQC 3EG9A 1A6QA 3LMMA 2Y69C 5H6QA 3OR1C 1JUPA 2E2JJ 1F9NA 3BG6A 3ABLC 2DMNA 2RAEA 3CUQA 3LSRA 2CW8A 4WF2A 2EQRA 2DOEA 3FKIJ 4FCYA 2GLOA 3ZG1A 2QQBA 5DYMA 1OISA 3WU0A 1F1ZA 2ISYA 2K3PA 2ACJA 5AC5A 2JUGA 3JRHA 3I4PA 4PFPA 4NTBA 4ENMA 2OCCC 3I59B 1X2MA 2DMQA 5HS7A 4AE4B 5FKLA 4F55A 4MFEA 2COBA 5KYXB 3E0JB 5M5YJ 1B72B 1ORYA 2J9VA 3EG9B 4UVAA 4FX4A 2JVGA 2GFHA 2OKUA 4O79A 1W5SA 1IV6A 4L0YB 3QVZA 5GAEJ 4BKXA 1FTZA 2NXNB 1MBGA 2KW3C 1WJFA 3ZQIA 1HY5A 2TCTA 2RVCA 3W2AA 2VT3A 3A01A 4HDVA 4HNVA 1L0OC 4NDLA 1RR7A 1VOMA 5DCMA 5LLQA 4BDZA 1JRAA 2OU6A 5L3VA 2ASRA 4ENNA 5M5WJ 1T5OA 1R5GA 1MMAA 5JFRA 3PFYA 1U9OA 1OCOH 2FMYA 1HSTA 2JRTA 3NYLA 1XMAA 3CCSI 3L2VA 4BU2A 2KQRA 1HC8A 3DWWA 3JRIA 4CYCB 4D7NA 2PFDA 4NC3A 2FSWA 2R5YB 2W1OA 3F8MA 1ZR4A 3AG2H 1WJDA 1XC5A 2AHQA 2BVMA 1IG7A 4KNYA 1V54C 1TWCA 2FFHA 2KJGA 1U6GA 1ZN2A 1YLMA 1W36C 3DJNB 1ZU4A 2MGQA 3NARA 5J8CA 2K3FA 1B68A 4KT5C 1J8MF 4A5NA 1FYMA 4XLFA 1OR2A 4CX9A 1IN7A 4IAOA 2JJ7A 2IXNA 5T3WA 2VC0A 1TNSA 4L18B 2BEOA 4ZYAA 2Q2EA 3FIWA 4M72A 4YFNF 4O6NA 2V79A 4MO7A 4BJ5A 3GM1A 2QQ8A 3FBIB 4WK8F 2P0NA 1R1UA 2R7UA 3NQOA 1CGNA 4NNJA 1O4XA 2HUJA 3RCOA 3HOXJ 1RR8C 4BDYA 3Q6NA 3F9KA 2BC5A 2RN7A 2DYRH 3IWFA 2M4KA 3M9AA 1WOLA 4EHPA 3S2DJ 4CSWA 4CDAA 4F92B 2A0BA 1F5TA 4JZAA 3WTZA 4X6AJ 5FCLA 1XCVA 4OWRB 3ZWIA 1AU7A 2VC1A 2KRHA 3H3UA 3DKXA 1HKSA 3UGPA 3S9OA 5AGFA 3R2PA 4NUBA 5LHIA 2W25A 2KHMA 3OY9A 3OYAA 4QI2A 4H4KC 3LLIA 3RW0A 2L7FP 1ORJA 5K7FA 2O6GE 3RPQA 2X85A 2M8GX 4XBFA 3QAHA 2ISZA 1GHCA 3S27A 3WG7C 3PQKA 3ASNH 2OU2A 3CP8A 4EJTA 2Q1ZB 1RKEB 4RA2A 2JPUA 3CESA 3HDDA 2K9MA 4Z9HA 5JT4A 3VB2A 3I5UA 3LNMB 4GFBA 4I0BA 4LIVA 3CCLI 4Y33A 1Q0DA 5D92A 3LWFA 4CDYA 5GADJ 1JPJA 4AVZA 5IT9K 2DDAA 3MD2A 4P9UA 4JIOA 3OV8A 4BUPA 5EF6A 2B0JA 2FGYA 4I3MA 3QYEA 5ICGA 1V74B 2R7SA 4RLFA 5CIVA 1T08B 1UG2A 1PP8F 5AIPA 3H3ZA 5DD4A 1LJ9A 5KNLA 3GTKJ 4RAYA 1VFCA 3W6KB 5JR3A 1OXKA 3KZZA 2UUZA 3WG7H 2YQYA 4D1QA 3EJNA 3EH1A 1OMIA 2KRFA 1W7PA 3S14J 1E0EA 3FOPA 2HQNA 3FMRA 4XRSA 3CCQI 1KU7A 1YX5A 3M1EA 4UHTA 3BQYA 4CZZA 1U2WA 1OFCX 2FOKA 3ZXSA 3W6VA 1E84A 2Y30A 2D4UA 2X4HA 2CS3A 4JX4A 4HNUA 5L3CA 2KT0A 3U3FA 5J1YA 3VFZA 5CYVA 3QOPA 3DEUA 2XL6A 4MW3A 3TL4X 4QDLA 5BPDA 3HKZA 3V7OA 5KYYB 2OEXA 2IXSA 4PK4A 3GUDA 3H65A 1Q1HA 1VQ9I 1T95A 1LDKB 4LACB 3E1SA 3DM9B 1NG6A 3DQVC 4LG3A 4ETSA 3PIOF 1XD7A 1FAPB 1B59A 3I5PA 4HX4A 4NY3A 5DTDA 1HLVA 2DDBA 4V2GA 3W3CA 4PR9A 1IN6A 5E18F 3MZHA 1Z3YA 1W2WA 1CGOA 3AG3H 2RSEB 3G4XA 4KNWA 4PACA 2P5VA 2Z33A 3ZGKA 3F21A 4FISA 1K4TA 3JRTA 1L3LA 2EIJC 2K7LA 1D1BA 4UB8C 2Y3BA 4PJJA 2R7XA 4BPMA 2JUCA 2KNHA 1QQ3A 3FXJA 1TWGA 2MA3A 3FXKA 3GFLA 1S7ZA 2HZDA 4M6VA 2DPDA 2Y2ZA 2Z2SB 3VYWA 2ME6A 1SFXA 1TQPA 2FBHA 1POGA 1XZPA 3VM6A 5D6FA 1KONA 3VWBA 3WTWC 4CUGA 3ZQLA 5CVUA 2LTPA 1K61A 4KBLA 1JJ8C 2X6WA 2CDQA 1Z6RA 3V5YA 4HF0A 3IKTA 1FEXA 4KITB 4PJ0C 1CGME 2ZMEB 2QZ8A 3NEUA 1QRYA 4JEBA 5KAFC 1ZG1A 3M4CA 3TJ6A 2DK8A 4RGUA 3S32A 5EZHA 3I9V2 2VPLA 1OCTC 2XPUA 3A2KA 4DIQA 1NU7D 3P9KA 4II2A 2YU9J 3EGDB 1TQGA 3T6JA 4D5CA 5KHDA 1UHMA 1R9TJ 2YLIA 4KI2A 2CYDA 3OMYA 3NDBB 4NC8A 3ECOA 3RQIA 4E17A 2BXYA 2QCOA 4PSWA 3ZDLA 4WABA 3MLGA 3ZIBA 4HA8A 2DQLA 1QPUA 3JT1A 1Z7Qc 1BL0A 4B48A 4IKFA 2DA2A 1B4AA 4N9IA 1XSXA 2VN2A 1ZLKA 3ABLH 5IT9Z 1NG1A 1ZW3A 4BEJA 3WHCA 4C3DA 1JOGA 5F04A 3L1MA 1WH5A 2BXZA 3MFKA 4LB6B 2FNPA 1BBHA 5B3IA 4U0WA 2BW3B 4UVBA 1FNNA 4G6QA 3SZRA 3O6BB 3R4KA 2LY2A 2M64A 2X48A 3S8PA 2J9UA 4B44A 3LSTA 3LEVA 4MVOA 2LK2A 2LKSA 2HNHA 3H0GJ 4MTEA 3R0AA 4XN0A 1K6OA 1RKEA 1BBYA 5IYCJ 2GAQA 2N8GA 3SYNA 2O7OA 3UKGA 1L3PA 4D9JA 1LNWA 4Q48A 4ENJA 3JREA 5E1ZB 2BY1A 4LDRA 2M9HA 1Y8RB 4HRIA 5IPAA 1R4MB 3LS0A 3BROA 1IXCA 5D8KB 4A3GJ 4C3JJ 2CUZA 2DTZA 4AWXB 4BNCA 3V5XA 2HTJA 1MNEA 2CUEA 2E60A 4EMSA 3CCMI 4LJZF 1VQKI 2LBFB 1OCOC 1HBXG 1YLFA 4CSAC 1ETQA 1MBKA 2LFFA 1W5CC 3W8HA 1X1PA 2IA2A 3TMOA 1S5LC 2L54A 3F8NA 2X0LA 1YYJA 1JHHA 4IQJA 3SEQA 3BRJA 1HW1A 1R1VA 4EJUA 5C3EJ 3J81Z 2IS4A 2R7VA 4OD5A 2Y0SA 3DEEA 2O3FA 2VI6A 3DWLE 1SEUA 4JURI 4KISA 2DYSC 1TKNA 3BG9A 2XAFA 2CH0A 2IGKA 5FD5A 3JRDA 2DTRA 2IA1A 3OA1A 5D5VB 2R9RB 2EPFA 3RYRA 1RKWA 3H9JA 1W5TA 4I0AA 1XZQA 1MIJA 1Q0FA 1MNDA 2XSJC 4YG2F 2KDOA 1WZ2A 1T6UA 1G8XA 2AQFA 1XGOA 3ATPA 3QP6A 4XLPF 3ZRGA 4BQAA 1T9KA 4BQOA 4IRHA 5ICEA 3OYEA 2Y3GA 3FOOA 1UAAA 1FC3A 4W8PA 3S28A 4LIUA 3G1LA 3E7LA 1H9TA 3GLLA 3BDDA 2PJRA 2H8AA 4AD9A 1LS4A 1RJ9A 4ULVA 3MWMA 3RKQA 2XGCA 5KYXA 1D0YA 3HZJA 1R7JA 2VKVA 3K1NA 3H2VA 3MN2A 1FSEA 1X1BA 4YIRX 3HNIA 1LEAA 2NUPA 2GXBA 1GLNA 1TW3A 3BG5A 2A5YB 1T6IA 3TO7A 2HJMA 2K9QA 3CO6C 3M1CA 1A7VA 3NMJA 5FGMA 4QPQA 3BC8A 2EILC 2G62A 5EGYA 4CS9C 2LP0A 2JA2A 4E7LA 4NTAA 2NG1A 4BL0B 3D5RC 4P96A 4MVQA 2EB7A 1YE9A 1HW2A 3UGOA 1I5ZA 3FAPB 1SR2A 2FNAA 1RETA 2DMPA 4XNFA 4DZJA 2E1MB 2MD5A 5DVWA 1HQCA 3CLOA 3WHBA 2CU7A 3K4BA 3KKBA 3I59A 5JLIA 2OUMA 5JHFA 4CA0A 2AWYA 3F0CA 1I3AA 4GCVA 4HW0A 3KYJA 2A6EF 1GVJA 1MGTA 5HS9A 4I02A 4M73A 2DFHA 3BP8A 5JI6A 1D8KA 1WWPA 2HR3A 2XF7A 4N4OB 3Q0WA 2AQEA 1TWAJ 1T33A 3ZC4A 1IF1A 3K4MA 4C7OB 2IPQX 2CV1A 4XORA 3WTSC 4KIGA 4IX7A 1BW5A 3H5AA 3K66A 3QODA 1U5TC 5CVVA 2CQ7A 1CPQA 1SAXA 1ACIA 1RUNA 1N75A 2XS8A 1D0XA 1SMYF 5F28E 4HZFA 5EEGA 5E3NA 2QEXI 2KLOA 4CCKA 4DZPA 2HV6A 2VJ5A 3L7WA 4BHBA 4YT5A 4U87A 3DM5A 3GX4X 3S1QJ 4QI0A 3F23A 3G1MA 3O6XA 4A2UA 3CLQA 3W6JB 2WV1A 4MHGA 4C9YA 1IDZA 3U1DA 1QPIA 1BI0A 4M3BA 3S15J 1ON1A 2VBYA 3DAFA 2YL0A 5KVRA 4DYQA 3CCVI 5B1AH 4I01A 1MSEC 4UUSB 3A03A 2QQ9A 4F91B 5J1RA 4UUTA 2AS5F 2GXAA 3HKZN 2G9WA 4FT8A 4AIKA 4J30B 4IAQA 2YVKA 2F4IA 1GGQA 1EF4A 2CRGA 3MZYA 4RGXA 4HYEA 1E83A 3N97A 2EPOA 2JA5J 1TWAA 3ERMA 3UNGC 3PM1A 3WTXC 1PYVA 4WXCA 4J00A 1R5HA 1AA7A 4G94A 1UCRA 2OJQA 1SFOJ 1XX5A
chains in the Genus database with same CATH topology
2OJED 3KPHA 1R5ID 2ICWG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OJE D;  3KPH A;  1R5I D;  2ICW G; 
#chains in the Genus database with same CATH topology
 1O3T A;  2CJJ A;  3B9Q A;  2M87 A;  4O6Y A;  1G3W A;  2QSG X;  2VQG A;  4JBA A;  1E3H A;  2XAH A;  4D7M A;  5LRS A;  2XRO A;  1TQM A;  1ZRE A;  4CGZ A;  2VH3 A;  3GOD A;  1IUY A;  2F4M B;  9ANT A;  2YU3 A;  1EQ1 A;  4DJA A;  4CS8 A;  2W4M A;  4MTO A;  3RJP A;  3FXL A;  3LSG A;  2NUT B;  3FHD A;  2L6F A;  4IL6 C;  1BM9 A;  2DT5 A;  3WG9 A;  3L1P A;  3L34 A;  4YT2 A;  1GT0 C;  5D5W B;  3M7G A;  4JX6 A;  3TOB A;  4NB5 A;  1XMX A;  2LDU A;  4XID A;  2AU5 A;  4WGY A;  1QPM A;  3MVP A;  3F46 A;  2W85 A;  5KYN A;  1SVM A;  3I4N J;  2MAB A;  2KFD A;  3E97 A;  3D0S A;  4C2M J;  4X1E A;  4Y17 A;  3SDG A;  1XMK A;  3AG3 C;  3TW7 A;  2LRD A;  3WTY C;  1P7J A;  4G7H F;  4JRZ A;  2A07 F;  3G4Z A;  4YIF A;  2FUG 2;  4DRI B;  3O39 A;  3FKJ A;  3Q6M A;  4EEF G;  2HI3 A;  5KK1 A;  1JHF A;  2MC3 A;  4CH7 A;  3B0P A;  3EGX A;  1VYI A;  1D0Z A;  3ZQY A;  2EFP A;  2K40 A;  2CNW A;  4BAY A;  3ZPL A;  5L3E A;  2DXI A;  1G4W R;  3K1I A;  1VQO I;  4W97 A;  2KJB A;  2YZS A;  2ZXR A;  4G78 A;  3PMR A;  1HE1 A;  2ECC A;  1VQM I;  2BGC A;  3PO3 J;  3Q0V A;  1ORS C;  2ZBK A;  4MEY F;  1UHS A;  4CCN A;  1NK3 P;  1D8J A;  3KET A;  4XLC A;  4EV0 A;  2ZXW C;  3OOP A;  2K4B A;  2O0Y A;  2Q0O A;  4AVP A;  1H7I A;  2JX0 A;  3OYB A;  2EA2 A;  5FRN A;  1LFB A;  2COM A;  3RFY A;  3U2R A;  3KYL A;  2JMW A;  3M3Y J;  1ETX A;  1G4U S;  3U9M A;  4E18 A;  3FHN A;  2ZXH A;  1IO2 A;  2VPR A;  5IY5 C;  3DBL B;  1A5J A;  1WKM A;  1BIA A;  1FFT C;  5DD8 A;  2R05 A;  5BQG A;  4MEX F;  3ZTZ A;  2ZFU A;  5K5Q A;  4YT8 A;  2GZW A;  3JTH A;  3QQA A;  3QW1 A;  3TDZ C;  5DCF A;  2AXL A;  2L7K A;  3AG1 C;  2CO5 A;  4FAS D;  1A31 A;  1E86 A;  1X1D A;  1ZU5 A;  1MKM A;  1MBF A;  1WJ5 A;  3KYD B;  2GWW A;  4AUX A;  3B6C A;  2GQQ A;  5ILU A;  3WU1 B;  4DW6 A;  3JCU Q;  3B0V C;  2BBY A;  1LEB A;  3K1P A;  3DI5 A;  1YIJ I;  2CMP A;  1Z1D A;  2DFF A;  256B A;  1SD4 A;  4BQN A;  3K33 A;  2QSF X;  2ZXW H;  3GZ6 A;  3EYI A;  2V6C A;  2O5R A;  3KPH A;  5D5U B;  3N2Z B;  1FYL A;  2Q9B A;  2ELH A;  4DYC A;  3GZN B;  5GPG B;  1WJC A;  3BLY A;  1I3Q J;  1LPQ A;  2J7P A;  3Q9V A;  2VQL A;  2G0E A;  3EET A;  5FLX Z;  5J47 A;  2Y9Z A;  2VCA A;  1N77 A;  1FBQ A;  1AUE A;  1YA7 O;  4BJ6 A;  4HQE A;  5F27 A;  4XPY A;  2FD5 A;  2QE9 A;  4OIR F;  5A6B D;  2WAE A;  1W4M A;  4BH9 A;  4LDQ A;  4PJL A;  3JRC A;  2ZME A;  3S3M A;  1G2H A;  4L9V A;  4XIC A;  3ECH A;  1QSP A;  4BEH A;  2OTL I;  1PD0 A;  3FDQ A;  4L5J A;  5K7Z A;  2BYV E;  3P9I A;  4JOM A;  5LBQ A;  2E5Z A;  4LFU A;  1LE2 A;  2E7X A;  2B7E A;  4RBO A;  3AG2 C;  3PCV A;  3RIR A;  3EUH C;  3I3L A;  3H9G A;  4KA4 A;  4XPX A;  3I56 I;  2K9L A;  5DQZ A;  2Y48 A;  2AP3 A;  1QO0 D;  4HPQ A;  1VB5 A;  3NYJ A;  3A0B C;  1Y1W J;  5E17 F;  4A3B J;  5M3F J;  2VCB A;  3J7A O;  1EA3 A;  1PD1 A;  2QY9 A;  2Z3Y A;  2H94 A;  5D4S A;  1QVT A;  2ELJ A;  3TP0 A;  2XXA B;  3CME I;  4EVI A;  3DZA A;  3HHG A;  3BR1 A;  4YEL A;  4Y7N J;  1ZHY A;  3RQ4 A;  1ZYR F;  4AU7 A;  2HU9 A;  2V1U A;  2DGJ A;  5E1X A;  4V2F A;  2EZL A;  2M0M A;  2H8W A;  4O6J A;  3I55 I;  3L2C A;  1P2F A;  4BE2 A;  3VYU B;  5TGT A;  3DJU B;  5H20 A;  5FRM A;  4KIF A;  1H88 C;  3ABT A;  3EGD A;  4IO9 F;  1H8A C;  2WVN A;  2CG4 A;  3LOC A;  2R7F A;  2A5W A;  2R7D A;  1QZX A;  4JTA B;  1DGR M;  2Y0M A;  1ZKG A;  3BZK A;  2VBW A;  2LD6 A;  3E9V A;  1Z77 A;  1AWC A;  5HNH A;  1ZGJ A;  5L3G A;  3GFJ A;  3ELK A;  2VB6 A;  5DEQ A;  3TED A;  1U5T B;  1CPR A;  1V5G A;  1T6Q A;  1R6R A;  3NYM A;  5KYU A;  4Y13 A;  2JA8 J;  2PFB A;  3LES A;  1Z3X A;  4BEH B;  2M7A A;  5BUO A;  5HVQ C;  3I54 A;  4MTD A;  2QBY A;  1ZTR A;  5BQI A;  4I44 A;  2XLD A;  4CXF A;  3OIQ A;  2O9X A;  2A3S A;  2FA5 A;  3MMY B;  3FXH A;  2R7R A;  2QKL B;  3LEO A;  1ENH A;  2E36 A;  4NC7 A;  3K1I C;  4OD4 A;  5JHU A;  3DBH B;  3IAS 2;  3LSM A;  5T1D B;  5GTI C;  2M8E A;  3J7A Y;  1Z7U A;  1UG7 A;  4ZH4 F;  5EG0 A;  4UUV A;  2IOQ A;  4BS9 A;  2XAU A;  1RXQ A;  4O6M A;  4Q5S F;  4S05 A;  3CD6 I;  3S84 A;  3U1K A;  1QGP A;  1ZHT A;  3IH2 A;  4H54 A;  1TT5 B;  2V26 A;  4WX9 A;  2YKZ A;  3EFO A;  3SXM A;  2L0K A;  2VE8 A;  1PCX A;  3MFN A;  3UMI A;  3HGG A;  4TV7 A;  4OOI A;  3H5R A;  1LVK A;  1T0F C;  1C03 A;  2Q3T A;  3EDP A;  1F1M A;  2YSR A;  3FHZ A;  4KFC A;  3SZT A;  1BJZ A;  3S1N J;  5KCM A;  2O8K A;  2PN6 A;  1QZZ A;  4DYR A;  3D5L A;  2NSF A;  2BW3 A;  3BPV A;  2J45 A;  1P7I A;  1KGS A;  1G59 A;  4ZDL A;  3K4N A;  1DPR A;  3MKL A;  2IS6 A;  1SF8 A;  1Z23 A;  5H2F C;  2VOP A;  4HE8 D;  3AAF A;  1Y0U A;  1XG1 A;  3S1M J;  3U5S A;  3ZQ7 A;  5M5X J;  4OIQ F;  2NOJ B;  2EFN A;  4I76 A;  3ZQF A;  1T56 A;  3M07 A;  2JSC A;  2ZO4 A;  2BE5 F;  1Z6A A;  2IA0 A;  1FOK A;  1JT6 A;  1UG0 A;  2WA0 A;  3OS1 A;  3I5Q A;  2O03 A;  4LK1 F;  2LYC A;  3SZP A;  2HGC A;  2DK5 A;  3K0L A;  4WGZ A;  4A0Y A;  1J2X A;  2CFO A;  1XCB A;  2ZNY A;  1LDD A;  3D1N I;  3JRF A;  1XPX A;  1A7D A;  1ZHZ A;  2WVQ A;  4XRS G;  2YLD A;  3BEH A;  1IZ1 A;  2HDW A;  5CKT A;  3IRQ A;  1J8Y F;  2DPU A;  4AC0 A;  3CMY A;  1G6N A;  2IYL D;  3TUL A;  3T4R A;  3WGH A;  4Q47 A;  3DKA A;  4OMZ A;  4HSR A;  4A3J J;  4CJO A;  4B09 A;  2HMZ A;  3MYF A;  4IJJ A;  3PUB A;  3KP7 A;  1PUF B;  4ZYH A;  2EV6 A;  2KYH A;  3LL7 A;  3QRF F;  3S0X A;  1IDY A;  2F6C A;  4D4N A;  3HOS A;  5COF A;  3PNV A;  4KYW A;  3A02 A;  5BMZ A;  5LRR A;  2L6H A;  3Q7L A;  4ZLC A;  4LG0 A;  4L6R A;  2OTJ I;  3CUO A;  2PEX A;  1S7E A;  2HKX A;  1ITY A;  2HSB A;  1VQ6 I;  2H1L A;  1V55 C;  1YIT I;  3OYK A;  4EJO A;  1WVR A;  3EUH A;  4GO1 A;  2H8R A;  4DBQ A;  2IT0 A;  2GIV A;  4IRI A;  1ZVZ A;  3LAY A;  4A2N B;  4HEA 2;  4XRM A;  5JS5 A;  3GTG J;  2OZU A;  4CIH A;  1MW7 A;  4LMY A;  1QVU A;  5E1W A;  3KLN A;  4JEA A;  1A04 A;  2FXA A;  1T01 A;  3JZ0 A;  1KU9 A;  3KEO A;  2X1D A;  3EZI A;  2DI3 A;  1NLX A;  2WAF A;  4M6Y A;  2Q2E B;  3CP2 A;  3TDU C;  1VQ4 I;  2X0C A;  3DU5 A;  2EZH A;  2WY7 Q;  4LIT A;  3CC4 I;  2ZCW A;  3CSK A;  1TQI A;  3JTG A;  2RDP A;  5KYW A;  1HA8 A;  3LSH A;  1Z7L A;  2R92 J;  2ECB A;  2P6V A;  3RKX A;  2KGO A;  3FMS A;  2MH2 A;  5K1Y A;  2IM8 A;  3C2H A;  2VKH A;  3CCJ I;  2J7P D;  3V8K A;  4LOC A;  1AHD P;  4GEH A;  4ZDO A;  3T6B A;  3KYC B;  2PX0 A;  1TLH B;  2RRE A;  5BQH A;  5GPC A;  4KIC A;  2CUJ A;  4HX7 A;  2JA7 J;  2XIG A;  3MKW B;  2KZG A;  2LKX A;  4BQQ A;  2JA6 J;  2CCY A;  2XS1 A;  5HDN A;  1K79 A;  1OCP A;  3U3B A;  2P8T A;  3I4M J;  2ME0 A;  5FFX A;  2E1N A;  3BR5 A;  2KJC A;  1MH4 A;  3C2B A;  1WFX A;  1J7K A;  1TL8 A;  2XPW A;  1MMS A;  2OCE A;  5B1B C;  1YQA A;  2ZXP A;  4YJW A;  4M71 A;  5JRA A;  5DCM B;  1LUJ B;  1SMT A;  3DFG A;  4UVC A;  2HFI A;  2NUT A;  1BN5 A;  3FXU A;  1WAS A;  4U0Y A;  2JRM A;  3PO2 J;  4EJW A;  1UMQ A;  1ZRF A;  5JP7 A;  4A12 A;  3JSE O;  4B6I A;  4ER9 A;  1E2X A;  3ZMS A;  3H2U A;  1Y0N A;  3RQG A;  2M1B A;  2VJ4 A;  3V7S A;  3DEW A;  1IN5 A;  1WAT A;  2WZL A;  4FAP B;  3DXJ F;  3V42 A;  1OPC A;  4BHP A;  2EPK X;  3C8G B;  5CI8 A;  3F8B A;  3OYL A;  1Z05 A;  4D0P A;  2OJE D;  3HOV J;  1OLT A;  1JT0 A;  5JVE A;  1IV8 A;  2HVS A;  3H36 A;  2NPU A;  1R5I D;  4ZZL A;  5ERI A;  1H0M A;  2WBM A;  1J75 A;  3HRT A;  2AVK A;  4NTF A;  3E6M A;  1MH3 A;  3L2R A;  3LNR A;  2KL4 A;  4CS7 A;  3GCM A;  1XGS A;  3HOT A;  2V1D A;  2ELK A;  3C8G A;  5HLH A;  1BOA A;  2EPL X;  2XUB A;  4CCM A;  1I1S A;  5HOO A;  3Q0U A;  4IRU A;  3K70 D;  3NKE A;  1VK5 A;  5FLM J;  1VQL I;  4Y52 J;  1I6H J;  3DD7 A;  1ORK A;  1YHQ I;  2IS1 A;  2IGN A;  4C3B A;  2XF5 A;  4HLX A;  3BR0 A;  4ENK A;  3SDB A;  2LNB A;  3JYY A;  2CQK A;  2IBD A;  4AIH A;  1IC8 A;  3BOQ A;  3LNQ A;  1DUX C;  4YFK F;  2HOS A;  3M1C B;  3N0T A;  4E0I A;  5A6B A;  4II3 A;  5F5H A;  5A2Q K;  2W82 A;  3CCR I;  1BIB A;  1XDU A;  2Q9C A;  3FM3 A;  1M1E B;  4HQM A;  2ETS A;  3T8T A;  3HKK A;  1FMV A;  3HJE A;  5D5X B;  2H6C A;  4ASN A;  5FJ8 J;  2LY1 A;  2VC9 A;  1JKR C;  1R22 A;  2V3C C;  5T3T A;  2XL8 A;  3CTA A;  2WY8 Q;  2E34 A;  1VQ5 I;  2XHK A;  3ROU A;  2DMU A;  5JLX A;  3DE9 A;  3QYF A;  2DA1 A;  1E17 A;  1BI1 A;  5L3F A;  2YLG A;  1Y39 A;  3QTH A;  2YHS A;  2XVC A;  3HPH A;  2BY2 A;  1LQ1 A;  1I6X A;  1N78 A;  3KEQ A;  2W00 A;  4AID A;  2G3V A;  3BTJ A;  2Z1D A;  4HAM A;  1RCP A;  3AQC A;  2RNG A;  1MJA A;  2PJP A;  3OYN A;  2E1C A;  2VJI A;  2UWM A;  3NG1 A;  1IRG A;  3HSF A;  3W2W A;  5K5R A;  3RF3 A;  2KIU A;  1HMD A;  1ZQ3 P;  2VBZ A;  4EIY A;  4N6H A;  5HLI A;  4C7O A;  2BHY A;  3ZQV A;  2V1X A;  3EZH A;  3IV5 A;  2LSO A;  1WSU A;  3HG9 A;  5K0I A;  1JUM A;  2ZSI B;  1UZC A;  3HYI A;  4ZTF A;  3BCB A;  5J40 A;  2I8B A;  1LIH A;  2M5W A;  3M8J A;  3EHM A;  3WE2 A;  1NG7 A;  1E85 A;  1XGN A;  4M9Z A;  4XSZ F;  4KJZ A;  4IHY A;  1S9H A;  2LKP A;  2J5O A;  4RB3 C;  3HGY A;  4U9D A;  2DW4 A;  1V4A A;  1P9Q C;  2IBF A;  3BQZ A;  1HXD A;  2R4G A;  3SXK A;  3LUT B;  3ABK C;  1TWC J;  3BTC A;  1SFE A;  3K1M A;  3U8P A;  4DGW B;  5HLG A;  1DPU A;  2X1C A;  2GBY A;  1APL C;  3NRH A;  1VQ8 I;  1ETY A;  1L7C A;  2XSD C;  1YA9 A;  1NBB A;  2L9J A;  4A69 C;  3FK6 A;  4PZJ A;  2UXX A;  1WJA A;  1YFH A;  4J32 B;  3C63 A;  4U5B E;  2DB4 A;  1C0W A;  2BL2 A;  4LK0 F;  2M3A A;  1XS9 A;  2WVO A;  3ZSU A;  4MVZ A;  2YL1 A;  4X0G A;  5H6R A;  2FJ1 A;  4A4A A;  2LD5 A;  2Y31 A;  4XPW A;  1EKE A;  2LFD A;  2HXO A;  4OIO F;  5L0H A;  1J09 A;  3M4O J;  5EDN A;  5CVR A;  2Z9O A;  2LLK A;  3TQO A;  1IRX A;  1HKQ A;  1MSF C;  3M4B A;  3W8I A;  3A1Y A;  3T6G B;  1X2N A;  3OS2 A;  2KIF A;  1BZ4 A;  4YWQ A;  5FZT A;  3N24 A;  1JGG A;  4JQF A;  4XRF A;  2Q7R A;  3L09 A;  5DS9 A;  4CS9 A;  3LS1 A;  3TO9 A;  2XLW A;  2AWC A;  2NRA C;  3CQZ A;  4CO8 A;  1IXR C;  1KYZ A;  3RQF A;  2Y3H A;  4LB5 A;  4M3D A;  1WTY A;  3WE3 A;  2GDC A;  2UUI A;  4N06 A;  3ZR8 X;  4N4W A;  5FFZ A;  1LDJ A;  5FO5 A;  1BA5 A;  1FWZ A;  2L02 A;  3WTT C;  3DBR B;  3GFI A;  2VT2 A;  2Y69 H;  3ZP5 A;  3H5N A;  2GXG A;  3S29 A;  4DJ9 A;  4EBJ A;  2FX0 A;  4L9J A;  4F3Q A;  2WTE A;  3FXR A;  5IYB J;  2W45 A;  1EH8 A;  3UMK A;  2NS0 A;  1NSG B;  3MX3 A;  4R79 A;  5IP9 J;  4A3D J;  4FWV A;  4MLO A;  3ONQ A;  3REO A;  3M79 A;  2X1E A;  1YJN I;  3DF8 A;  4KUM A;  1QQI A;  4B3X A;  2QSH X;  2XV4 S;  3RPU A;  3BY6 A;  4FHT A;  4IOC F;  2WB1 A;  1RJ9 B;  4PDK A;  2F5F A;  3VOE A;  1JMW A;  4GQH A;  2HSQ A;  2ID6 A;  2GA2 A;  1MMD A;  1TWH J;  3BTL A;  2JVH A;  3WHN A;  3CMA I;  3EUA A;  4D5F A;  3CJQ B;  3S1R J;  5DUK A;  5HOD A;  2DCE A;  3ITF A;  3U9G A;  3B02 A;  4E4H A;  2QBY B;  2W4S A;  4JCH A;  2MWQ A;  1ONV A;  2F4O B;  2I5U A;  3LQQ A;  3P7N A;  4AL0 A;  2BY3 A;  2RGV A;  2XXA A;  2WL8 A;  1M57 C;  3HIF A;  3CJR B;  1X19 A;  3ULQ B;  4E7I A;  5BOX A;  2CGP A;  1SZI A;  6PAX A;  3DPT A;  2XLM A;  4B8X A;  3OYH A;  1WI3 A;  3VYS B;  5HDG A;  1E3O C;  2G3K A;  5IY5 H;  5ICC A;  5A2Q Z;  1VTN C;  2IJL A;  3S3O A;  1PUF A;  2A0U A;  1P4X A;  2FBI A;  2X9D A;  2KP6 A;  1J9I A;  3RKY A;  1K6Y A;  2ZFW A;  2JN6 A;  2DU9 A;  1ZHW A;  4E7K A;  2STT A;  1SYQ A;  1NFO A;  1AKH A;  4ZDP A;  2R7Z J;  1ZW2 A;  1U78 A;  3HHH A;  3HOU J;  2NAZ A;  1I5N A;  4EBK A;  3DPU A;  2R93 J;  5L3Q A;  3HTK C;  4E7Z A;  3LA2 A;  2OV7 A;  2L9S A;  3TBI A;  3EH2 A;  4F4B A;  1HOM A;  3IEE A;  5KYU B;  1KZH A;  1XSV A;  1U5T A;  5LGN A;  4XL9 A;  2PLY A;  3K1H A;  1B8I A;  4MS2 A;  2DOF A;  2H09 A;  1O87 A;  4NQW B;  3BR6 A;  3FBN B;  4Z9I A;  2XKO A;  2ADU A;  3JSO A;  2Y3D A;  5LEK A;  4EAT A;  3BCA A;  1ZK8 A;  4ABZ A;  3PNT A;  2L5Q A;  3SZG A;  1Y4C A;  3F72 A;  1ZGW A;  3IQ5 A;  3GEZ A;  1W7P B;  3ABM H;  2LQG A;  3EQL F;  3JAM Z;  4IZZ A;  1B1B A;  4MND A;  5ILV A;  1P92 A;  1I4Z A;  5F0F A;  1K40 A;  3HXL A;  4J01 A;  3NAU A;  2CNW D;  2ZJR F;  3AQB A;  1OYY A;  1LS1 A;  1A7E A;  4RDA A;  1TP4 A;  2FE3 A;  4QSH A;  1EJ9 A;  4G6T B;  1XWJ A;  3DKY A;  1JE8 A;  4IHS A;  3PIP F;  4CZC A;  1FTT A;  4CIP A;  2J9B A;  4ZYG A;  4RAG A;  3CDH A;  2QLA A;  2Z16 A;  2LMD A;  1G3T A;  5ILS A;  2IGO A;  2HZ8 A;  4UY8 I;  2R7O A;  2MHR A;  1W0T A;  1JUS A;  5DS5 A;  2FQ4 A;  2F2E A;  3H0D A;  1YRN A;  2Q4F A;  2OEV A;  3SXZ A;  2R0Q C;  4XOT A;  2HYJ A;  2WC2 A;  3HM5 A;  2E71 A;  1SD7 A;  1MDM A;  1M2V A;  1BW6 A;  4MQ9 F;  1X1C A;  3AG4 H;  1A0B A;  3GWL A;  3PDM P;  1NZE A;  2JWT A;  3ZQQ A;  3RKO F;  2A1D D;  1R4T A;  2FEZ A;  2LP4 A;  1YYV A;  4HX8 A;  2A6T A;  3G3Z A;  1NK2 P;  3SP1 A;  1ZEL A;  2F48 A;  3H92 A;  1YZC A;  3AGU A;  1WCM J;  2HZT A;  2XAS A;  2VQH A;  3EPZ A;  1DDN A;  1U6H A;  3GWN A;  2ZPA A;  1U0B B;  2XF6 A;  1S6L A;  3RQE A;  1BOB A;  2M7B A;  1FSH A;  2JPC A;  2M0C A;  4DBR A;  4RBN A;  2E35 A;  1TNT A;  2L9R A;  1UFB A;  1VI0 A;  2KIQ A;  5FB2 A;  2M4E A;  4UDV A;  3IP4 B;  4ANJ A;  2VE9 A;  2L4A A;  3GME A;  2NS7 A;  2P7C B;  1X1A A;  2C04 A;  1FNT c;  2XGE A;  4E7S A;  1S72 I;  2DAO A;  1KU2 A;  4RDU A;  4S04 A;  5LEJ A;  3B6A A;  4A3I J;  1D5Y A;  3HOZ J;  4U7D A;  5F0H A;  5JVG F;  2DYR C;  4U5C E;  4Q4Z F;  1FTS A;  4KMU X;  1MQV A;  4MTG A;  2H7V C;  2KRC A;  1IN8 A;  1I1G A;  3CZ6 A;  2ZC2 A;  4CSA A;  2NVU B;  3US6 A;  4CYD A;  5J4Y A;  1VYK A;  1YDI A;  2CGE A;  3BT9 A;  2L6G A;  3DCF A;  4E6K G;  2YEV A;  3CUQ C;  3QPL A;  1MNM C;  1VQ7 I;  2A05 A;  5GP9 A;  1JKO C;  2IEK A;  2CV0 A;  3ZN1 A;  5B5E C;  3MEX A;  4BAC A;  3C8Z A;  2NUP B;  2HYF A;  3LSJ A;  2M4G A;  3U0C A;  1JTY A;  3SFZ A;  1IRF A;  3FXQ A;  1VLS A;  1IUF A;  3E3V A;  2E2H J;  3K4K A;  3JR9 A;  3U2L A;  4ITV A;  1O5H A;  2P5K A;  3GEH A;  2K5C A;  3FWE A;  3IWZ A;  4BG0 A;  3K9T A;  2F5V A;  2IW5 A;  3J80 K;  2HDC A;  3BPX A;  1OW7 A;  2XLH A;  1LPE A;  3GAN A;  3HB9 A;  3AOU A;  1UEL B;  3EGX B;  4HOB A;  3ZMV A;  3VYT B;  2GAU A;  1BJA A;  2Y75 A;  4J19 A;  5DS4 A;  1BI2 A;  5L0I A;  2DT6 A;  2LRE A;  3HRU A;  3A4C A;  1ETO A;  4BBS J;  2VCC A;  4XKV A;  4RAF A;  5L0D A;  1F4K A;  1K83 J;  4YFX F;  3SNH A;  3W4Y A;  3CJN A;  2HEO A;  3E5U A;  4WCG A;  3Q7G A;  2C6Y A;  4HLY A;  4PJM A;  3POV A;  2LOO A;  2Z5U A;  1U89 A;  1FP1 D;  1OR7 A;  1QHH D;  2NOG A;  4XTK A;  1APC A;  2YPR A;  1BR2 A;  3F3X A;  3DV8 A;  4LLL A;  3WTU C;  3JRM O;  2VXZ A;  4LGW A;  3J7Z I;  1JI8 A;  2ZNZ A;  1ST6 A;  1YYX A;  1CF7 A;  3OR2 C;  4YRV A;  4JC7 A;  5KYW B;  2LFB A;  1S7A A;  4XON A;  2HDD A;  4A93 J;  1VLT A;  2H27 A;  2QA4 I;  1Z0X A;  2CQQ A;  2F5D A;  4YL1 A;  4NC6 A;  1AVO B;  1T8I A;  5TJJ A;  1X58 A;  5FLV A;  1G5Z A;  1SVL A;  1FZP B;  4FE4 A;  1OCC C;  4BYY A;  3GTP J;  1FMW A;  1MMN A;  3OWT A;  1JGS A;  1CF7 B;  1HKT A;  3B71 A;  4EUK B;  2P1A A;  4C30 A;  3HPG A;  2DLL A;  3C3W A;  4MW8 A;  1ZRC A;  3R0J A;  2VOD A;  2DFE A;  1WGX A;  2VIX A;  3R60 A;  1Y56 A;  2EH3 A;  3G73 A;  3H35 A;  2CSO A;  3BJA A;  4FE7 A;  3SEZ A;  3VYR B;  4CYC A;  1YX3 A;  2AXT C;  1X4P A;  4CJG A;  3K4L A;  3OYJ A;  1GXQ A;  1KQ8 A;  3L0I A;  3OYF A;  2HWV A;  2DN0 A;  2L01 A;  4CCL A;  4E70 A;  1G4D A;  2YL7 A;  1P6R A;  2QGU A;  4DOZ A;  1HCR A;  4QTR A;  4DQ2 A;  2IAI A;  1O7L A;  2DT7 B;  2EIJ H;  2WAD A;  4K0D A;  1OCC H;  4ESF A;  2XC7 A;  4LLN A;  1TBX A;  2EPN A;  4XLN F;  3S90 A;  3I71 A;  4XMY A;  2V9K A;  4LG0 B;  3GYH X;  1KQ0 A;  1X3W B;  3KL4 A;  1S29 A;  4AL1 A;  2YUS A;  2IVM A;  4L9T A;  3S16 J;  2QTV A;  2M34 A;  1D3Y A;  5F0C A;  3O55 A;  1IZM A;  4Z2Y A;  4EGY A;  2JT1 A;  2TMV P;  1ULY A;  3PL8 A;  3WAQ A;  2V4J C;  2FQ3 A;  3ZMZ A;  4U7B A;  2VJJ A;  1G3Y A;  1S05 A;  3RIP A;  3U2M A;  3DLA A;  1MD0 A;  3TOA A;  3J81 K;  2PI0 A;  1VF9 A;  3K70 C;  4O5V A;  4AYB A;  4ZJZ A;  1M2V B;  3V8J A;  1ZLJ A;  2V9P A;  1ERD A;  1USS A;  2CWE A;  1MJ9 A;  5EYR A;  4QLC U;  2IXP A;  2XRH A;  2ESH A;  3CQZ J;  3OL3 A;  1Q1V A;  1SD5 A;  3U21 A;  4BXF A;  1T39 A;  4A3C J;  1DOW A;  3NWS A;  2PX9 A;  4XKB A;  4F93 B;  5DUI A;  4XSX F;  3IQT A;  2M2E A;  4C2U A;  2RV8 A;  2P6S A;  3HBL A;  3HEF A;  2K27 A;  3GTQ J;  2UXN A;  3A9C A;  4NCQ A;  3LSK A;  5J3L A;  2DOD A;  1YAU O;  4Q7C A;  5D6E A;  3O8H A;  2HTS A;  1NFN A;  1FBS A;  4YL0 A;  2K86 A;  4L5I A;  3KLO A;  1M56 C;  2VUM J;  3MAJ A;  2XB5 A;  3ABU A;  1XSD A;  1I50 J;  4MVU A;  3RZD J;  5JLW A;  2NNY A;  2K02 A;  3GTL J;  2EZK A;  1QHG A;  1YAR O;  3SXY A;  3ZQG A;  1ZZP A;  2K9N A;  2J46 A;  4K1O A;  5B1B H;  3JRA A;  3PHF 2;  4BJT A;  1XN7 A;  1GXP A;  3PSF A;  5J1U A;  1OQC A;  3R6S A;  3HUG A;  4AYB N;  4IWB A;  4G9Y A;  2E87 A;  4YK5 A;  2PX3 A;  3X2Q H;  2R7Q A;  2L81 A;  3QVY A;  3HSE A;  3ZQH A;  1B72 A;  3RSN A;  2B0H A;  2W24 A;  3ABM C;  4MTF A;  2H6B A;  2HOA A;  2V9V A;  3ISP A;  4P55 A;  1HF0 A;  3T8R A;  1QKR A;  2M30 A;  3IAM 2;  1WI9 A;  1OCR C;  2VOO A;  2L2O A;  4K2E A;  2I10 A;  3L2W A;  3L8J A;  4I98 B;  4MVR A;  2EWN A;  4XLE A;  5E3L A;  4DRJ B;  1OXB A;  4WXH A;  2ETH A;  1S7O A;  1GM5 A;  1XGM A;  1YJ9 I;  2X6Y A;  1I27 A;  2W84 A;  4JX5 A;  5IT3 A;  1KTM A;  3LSP A;  1TR2 A;  2WWY A;  3B0U X;  5CJ9 A;  2MSY A;  4GYG A;  1F43 A;  5TJ5 E;  3HOY J;  2HMQ A;  2D45 A;  2NNN A;  4KC9 A;  1MDM B;  2XAG A;  4QWQ A;  2UZK A;  5GAH J;  4ESJ A;  3PFI A;  3LJB A;  1GVD A;  3K2Z A;  3SQN A;  3QU6 A;  4Y4R A;  5E2Q A;  3ESW B;  1U3E M;  3CAX A;  1O3R A;  1M6T A;  3HOW J;  4ZLD A;  2P7V B;  3EHN A;  4D4X A;  4KIB A;  3FMQ A;  4BXU A;  4PGH A;  3G6E I;  5DS6 A;  2VQC A;  3BR3 A;  2KKO A;  3FIS A;  3ZTM A;  2KC3 A;  4CIC A;  3CMM A;  3TW6 A;  4BJ5 C;  4ZC3 A;  1FOY A;  3TO6 A;  1OW6 A;  2HKV A;  2EV0 A;  4HST A;  2DFI A;  4MFD A;  1J0R A;  4EM2 A;  2PJR B;  3IKV A;  5FRO A;  2EZI A;  2VXD A;  2GA0 A;  1BC7 C;  4BJ6 C;  3PJR A;  3NMK A;  4R32 A;  2V1N A;  5C44 J;  3SEO A;  4JKV A;  2P6T A;  3S3N A;  1FPQ A;  1Z5Z A;  2RQQ A;  5CQG A;  1TC3 C;  3ZVR A;  2PBI A;  1H89 C;  1BDJ B;  4PSX A;  4B1R A;  4Z6Y A;  3F8C A;  4XQ1 A;  3E70 C;  1WRJ A;  1SVO A;  3BJO A;  3KIO A;  2XPV A;  3JAM K;  1LE8 A;  2L7A A;  4RGS A;  1QNT A;  2A6H F;  2E1O A;  1O57 A;  2LH9 A;  4P5O A;  1YW7 A;  2CQX A;  3GF2 A;  2LG4 A;  4A0Z A;  2ZSH B;  1ETV A;  4PGG A;  1JTX A;  5HS8 A;  1BC8 C;  1PP7 U;  4GXO A;  2R5Z B;  2EIM H;  4JYK A;  4UB6 C;  2EIN C;  5HDK A;  3W2V A;  4CBE A;  1FLI A;  2IS2 A;  1B9N A;  3C1D A;  4N0B A;  4FX5 A;  4O3M A;  3M15 A;  2NVX J;  3SHF A;  1YW9 A;  3ASN C;  2PMZ N;  5EK0 A;  4JJG A;  2HYG D;  2XB0 X;  3DKW A;  4RM3 A;  1OJL A;  1Z6T A;  2RC4 A;  3OOU A;  2Q8K A;  1HMO A;  2XAJ A;  5KAI C;  2UV1 A;  1DU0 A;  1WN0 A;  3MYI A;  1IN4 A;  4PFO A;  1JJ6 C;  4ULW A;  3QP5 A;  2WAQ A;  2PG4 A;  5LGT A;  2ZJQ F;  1R1T A;  4NBQ A;  2XL4 A;  1U9N A;  3KZY A;  4LLE A;  1GS9 A;  3QW0 A;  3V7C A;  2B9S A;  2BY0 A;  2GIZ A;  3K69 A;  3ZMU A;  2XGX A;  3FDY A;  3C62 A;  3VPR A;  4AM3 A;  4M9S A;  1FIP A;  2EK5 A;  1MBE A;  1SAU A;  4Y3O A;  4IHX A;  1VMA A;  4P9T A;  3R61 A;  5GTH C;  2NYX A;  2ICW G;  3VOD A;  3SYT A;  5E33 A;  4U5F E;  3HRM A;  1Z9C A;  4RB1 A;  4IRG A;  3JRG A;  2JQ7 A;  2AO9 A;  3KP6 A;  4U9E A;  4O7G A;  5J6X A;  1C17 M;  4CS8 C;  2MH9 A;  5A6K A;  5LGU A;  2OG2 A;  5C4J J;  1Y6I A;  1FIA A;  2QNL A;  5DM7 F;  2R7T A;  1DP7 P;  3NMI A;  3IHU A;  4W1U A;  3DLL F;  5CLS A;  5EJC A;  2VON A;  2EFW A;  5IP6 A;  1T98 A;  1F36 A;  4XK4 A;  5ICF A;  1YJG A;  2LK4 A;  4BE1 A;  3U9J A;  1U8R A;  2XKP A;  2HQ5 A;  3VEP A;  2DOA A;  3V7R A;  2H7O A;  3HTS B;  4RMN A;  4H0E A;  4I2O A;  1OKK A;  3KFW X;  4M3G A;  5EEA A;  3D5S C;  3BG3 A;  3GLX A;  4KT6 A;  2QUF A;  4EWC A;  2QM3 A;  3F6O A;  1TT0 A;  2V7F A;  5J4V A;  2QUP A;  1PV3 A;  1ZH5 A;  2E2I J;  5EGO A;  5D91 A;  3O10 A;  3GVA A;  4IOA F;  1S3J A;  2LVS A;  3GW2 A;  2DA4 A;  4OU0 A;  2MG4 A;  4F52 A;  4BHC A;  5E8I A;  1RNL A;  1KA8 A;  3ML6 A;  1DGW Y;  3T1B A;  4J7Y A;  1B8I B;  4DVZ A;  1YOV B;  3T0Y A;  2WZG A;  2OD5 A;  4BBR J;  1WWX A;  5COG A;  2ZB9 A;  2BV6 A;  3OEO A;  1FFH A;  2OQG A;  3ZQC A;  3S17 J;  3K10 A;  1YG2 A;  4ZZD A;  3NRV A;  3ECS A;  3FXO A;  3K6B A;  1EV7 A;  3ASO H;  1TFO B;  4LDK A;  2FU4 A;  3S93 A;  3C8G D;  1YVI A;  2ZJ2 A;  1VND A;  3J7Y J;  1R36 A;  1W7P D;  2DO7 A;  1R23 A;  3CUQ B;  1RI7 A;  2KIM A;  4G7Z F;  3KMI A;  3P5J A;  4MGR A;  1R58 A;  2Y9Y A;  4U5H A;  3OSG A;  4DRH B;  3CCU I;  2HS5 A;  3OS0 A;  4HBL A;  2WV0 A;  3K4C A;  1A36 A;  1JAF A;  2DA7 A;  3KE2 A;  4C3H J;  4IHV A;  1Y1V J;  2O8X A;  2OBP A;  3KP3 A;  2KPM A;  5AON A;  2BOL A;  2IP2 A;  4LD5 A;  5DQT A;  5L0C A;  4MQV A;  1BR1 A;  1WHU A;  5L3D A;  3N05 A;  1EA8 A;  4N9H A;  1NH3 A;  4FES A;  2IGM A;  2XLO A;  1RC9 A;  2RQP A;  3V5Z A;  2MW8 A;  5BQT A;  1HE9 A;  4UXN A;  2PBE A;  3P9C A;  3HLZ A;  1V5F A;  3KP4 A;  3OYI A;  2G7U A;  2F5C A;  2ZXO A;  3ASO C;  4MVM A;  4CHU A;  2MLG A;  1FY7 A;  5DLJ A;  5K5O A;  4RLQ A;  4IAR A;  1DP3 A;  1EKY A;  4M3F A;  4UUS A;  5TRD A;  2RD9 A;  3MQ0 A;  2FRH A;  4OMY A;  1KQ9 A;  1N1C A;  2ESN A;  4QPO A;  1LFP A;  2VBX A;  2XM0 A;  1FJL A;  2J0W A;  2XRL A;  4EGZ A;  2JTV A;  4A3L J;  4I1O B;  5JSL A;  4AX2 A;  4XOP A;  5FD6 A;  3JTL O;  4EBB A;  2MLK A;  3VSK A;  2EFQ A;  1QBJ A;  3VF0 A;  5E3A A;  2DA5 A;  2R5Y A;  1M2O A;  4KN4 X;  4XQF A;  1YO5 C;  1DU6 A;  2JSP A;  4M74 A;  3WTV C;  4ONS A;  1YS7 A;  1ODD A;  2E1M C;  2EFO A;  2Z99 A;  2HFH A;  1XTA A;  4IQ4 A;  4U88 A;  1UFM A;  4NQF A;  3WOD F;  4BGD A;  5L0J A;  1RMV A;  3HC7 A;  1V5E A;  2FF4 A;  2CV2 A;  2ID3 A;  4N6C A;  1PJR A;  4M9X A;  4PUS A;  3ZN0 A;  1IGN A;  4NHJ A;  3HRS A;  3GEE A;  2XM4 A;  3GOR A;  3TP3 A;  1WQ2 A;  3H1C A;  3GTJ J;  2CYY A;  2XRN A;  1MBH A;  3AG1 H;  1RRJ A;  1OKK D;  4PJN A;  5F08 A;  3QPH A;  4EQQ A;  2P5L C;  4F7Z A;  3MBG A;  2JD3 A;  2M45 A;  1V54 H;  3G50 A;  2Q9A A;  4AK9 A;  1JXS A;  4U0V A;  4XR6 A;  4A6D A;  2L4M A;  2XGD A;  2D1H A;  5F6F A;  2IRF G;  1OCR H;  2XAQ A;  5LFA A;  3B29 A;  3M8F A;  1XDS A;  1D1C A;  3E5Q A;  3FZV A;  4G7O F;  3OYG A;  2ZKZ A;  3GZ5 A;  4HNT A;  3OL4 A;  5HLT A;  3JSP A;  3LLK A;  2OF7 A;  1LVA A;  3ZCO A;  4GYT A;  3IH4 A;  2I15 A;  3GO5 A;  3TOL A;  2HPI A;  1TZL A;  1WH7 A;  4Y15 A;  2QEN A;  5CQE A;  1T2K A;  5E3C A;  3H9Q A;  3X2Q C;  3JCU C;  1Z67 A;  3OYM A;  3E6C C;  3GBG A;  1LE4 A;  5TIS C;  5LHG A;  1QLE C;  1G3S A;  4M3E A;  1SC7 A;  1X3U A;  2FBK A;  1R71 A;  1X4O A;  1QZE A;  3FXM A;  2OZ6 A;  2J8W A;  4HV6 A;  3IH3 A;  1UST A;  2EA4 A;  2GA1 A;  1OQY A;  1ZRD A;  4RB0 A;  5D8L B;  1IAW A;  2HPM A;  3KYI A;  2VKE A;  2Q00 A;  2DBB A;  3HL2 A;  2Z15 A;  2DA3 A;  2XLE A;  4RS8 A;  1ZAR A;  1DQU A;  5IP7 J;  2H7B A;  4ON0 A;  5BPI A;  1H6G A;  3ABK H;  2LSE A;  5CVJ A;  4W8K A;  3UR3 C;  2E5N A;  5L0F A;  3RTR A;  2KIS A;  1ZG3 A;  2XLV A;  3WU2 C;  2JZY A;  2STW A;  4IPA A;  3U8V A;  4I7H A;  2L7M P;  1ETW A;  1Y8Q B;  1P4A A;  5LHH A;  3OYD A;  3AL0 B;  3CCY A;  2E19 A;  2LF8 A;  1T6S A;  1LI5 A;  4XLA A;  2KDZ A;  1RUO A;  2LCH A;  3I53 A;  4RD9 A;  2LBF A;  3L00 A;  2ZJP F;  2MYS A;  3F8F A;  3FX3 A;  1IXS B;  1MMG A;  4QIW N;  1YRN B;  2PNO A;  2C03 A;  4RM2 A;  3RPU D;  3BR2 A;  3VSL A;  2HQA A;  3G2B A;  5EZG A;  1PDN C;  2HOT A;  3HSR A;  2XSE A;  1HDD C;  3IL2 A;  2CUF A;  1ZR2 A;  2MBF A;  2PMZ A;  5B3S H;  3AFH A;  1FT9 A;  4EM0 B;  5J8F A;  1SD6 A;  2QYO A;  4HFK B;  2X6X A;  3NWT A;  2EPM X;  3BJ6 A;  1OCZ C;  3RH3 A;  1GV2 A;  3LAJ A;  1I39 A;  1KU3 A;  1U0J A;  1SFU A;  2YX4 A;  5C4X J;  2ZXJ A;  3BWG A;  3ZMT A;  3HNK A;  1Q0G A;  1O3U A;  2CQN A;  1FR0 A;  2WAQ N;  2EIN H;  3HNJ A;  4G6D A;  3QZC A;  4I09 A;  1FYK A;  2NS8 A;  2R02 A;  2L9N A;  1R4N B;  1ZGA A;  2Y0S N;  3TOM A;  2H1K A;  1T38 A;  2HKO A;  2OQM A;  1KYW A;  1MBJ A;  4WXD A;  4ZYD A;  3RVZ A;  2R7W A;  2X51 A;  3SJM A;  3EFO B;  4JTD B;  1V4R A;  3MCZ A;  1YS6 A;  2D2W A;  3PSI A;  4ESB A;  4KN7 X;  1TFK B;  4R8H A;  3H3V K;  4B43 A;  5DDG A;  1B6A A;  4CDG A;  2EIK C;  2KZV A;  2P0W A;  1J5Y A;  3A0H C;  4I99 C;  4YII A;  1VQN I;  4U5E E;  3C7J A;  3KP2 A;  4JCZ A;  1QA6 A;  5IYD J;  2CW0 F;  3O2P E;  5AIQ A;  5GPA A;  1K4S A;  1OCZ H;  2RKH A;  3F22 A;  2EBI A;  3TK0 A;  3VAY A;  3FM5 A;  3LFU A;  3F6V A;  2QKM B;  3Q9S A;  2ZXI A;  4OIN F;  2VL8 A;  4NQW A;  3CF5 F;  4M63 A;  5B1A C;  4X0R A;  1K78 A;  2PQ8 A;  5EGO B;  2QLZ A;  1PUE E;  2B0L A;  2W48 A;  5FKN A;  4A5M A;  3DE8 A;  2P4W A;  1IJW C;  1OR3 A;  1LB2 A;  1OYI A;  3TKY A;  2BZT A;  3M8E A;  4GYI A;  3LA7 A;  5BNG A;  2EIK H;  2TRT A;  3IQC A;  1Z63 A;  2L7Z A;  4BY7 J;  2D5V A;  5AC4 A;  1VTM P;  2HOE A;  3CF2 A;  1AKH B;  5A6J A;  1YJW I;  3VDX A;  4M6X A;  5L0G A;  1STZ A;  1UB9 A;  1RKT A;  2YS9 A;  1JPN A;  4JJF A;  3BZC A;  4R1H A;  3AJM A;  1T0F A;  3MZ8 A;  5L3B A;  2OCC H;  5CPR B;  1ZHX A;  2YWA A;  3J06 A;  1EI7 A;  2MD0 A;  3KX2 A;  5LD2 C;  1RKC A;  3ZMD A;  2W9Y A;  4ZYE A;  3N4M A;  2LIG A;  3R7C A;  3K6G A;  4FTH A;  4OAY A;  3RYL A;  4A6E A;  2L9V A;  5COM A;  5HNF A;  1ETK A;  1O3Q A;  4MIM A;  2FML A;  3RVY A;  4IJA A;  2QQA A;  2R03 A;  2P81 A;  5CVI A;  5M3M J;  3I58 A;  4I6Z A;  2J0X A;  2CFX A;  1UHW A;  4P9F A;  4CCO A;  5FKM A;  2HQR A;  1CQT A;  3HNL A;  2OAZ A;  3TGN A;  4OIP F;  4V19 K;  1WPK A;  4B3A A;  1W0U A;  4JE9 A;  3GFM A;  1K7A A;  2A61 A;  3O8G A;  3QPT A;  3E6D A;  1B9M A;  4HV5 A;  2LC2 A;  1YW8 A;  5E79 C;  2OC6 A;  3V8L A;  1X3Z B;  1D1A A;  4GRI A;  1RPW A;  1VZ0 A;  4DVY P;  4BJ1 A;  1J59 A;  5IOY A;  3LAP A;  2YR2 A;  1R49 A;  2DQR A;  3SFI A;  4B4C A;  4E7J A;  2HJ3 A;  4LLG F;  4U5D E;  1OW8 A;  4AIJ A;  4CDV A;  4FX0 A;  5EEH A;  5ED4 A;  4A3F J;  1YZA A;  3CC2 I;  2OQR A;  1YI2 I;  1LI7 A;  1MJB A;  3PNY A;  1IRZ A;  2HVQ A;  2R3S A;  3CDL A;  3Q3S A;  1U8B A;  2GM4 A;  2DJN A;  1WGW A;  3G71 I;  3AKZ A;  4XM3 A;  2B63 J;  2J9W A;  3DTE A;  5E3M A;  4IEJ A;  4UNO A;  4WJ0 A;  4HG2 A;  2BHZ A;  4IHT A;  4EJV A;  1CGP A;  1OR7 C;  3C2G A;  3LSI A;  3S2W A;  2UUH A;  1HW5 A;  3I0T A;  3S2H J;  3AG4 C;  4G0H A;  4MVS A;  2DJI A;  2E7W A;  3CDI A;  3BG7 A;  1HSJ A;  5HV9 A;  1BR4 A;  2DYS H;  1WJB A;  4K7B A;  2NVY J;  4GGG A;  5D4R A;  4IGG A;  2VKD A;  2R25 A;  1ZG5 A;  3T9O A;  2DMT A;  1HDP A;  2A68 F;  2FOW A;  4E0H A;  3L2U A;  3HUG B;  3RI4 A;  1GQA A;  5E3O A;  1BI3 A;  3L8I A;  2K4J A;  2CW7 A;  4ZTJ A;  4XEF A;  1LFU P;  5EG0 B;  4YN0 B;  3QWL A;  1IW7 F;  1FOX A;  3E5X A;  1QU3 A;  2IXM A;  3E6B A;  3BTI A;  4B47 A;  1O3S A;  1RES A;  4J7T A;  4BEM J;  3I4U A;  2MC4 A;  1A41 A;  2GWR A;  1PVE A;  4FET A;  2D5R B;  4C3I J;  3DTK A;  2O9L A;  3LFK A;  1QZY A;  1FX7 A;  3IPM O;  3CC7 I;  2RNJ A;  1SAN A;  2W57 A;  2XDV A;  2K9S A;  2ZME C;  3K7A J;  3QMK A;  4RGR A;  1TWH A;  1FOW A;  1A6I A;  1TW2 A;  1JR8 A;  1H9G A;  1K05 A;  2JPB A;  3GXO A;  2IXO A;  5F1R A;  3VRC A;  3F47 A;  1P4W A;  3AL0 C;  3KH2 A;  1Z91 A;  2EIL H;  4JW1 A;  1OKR A;  4U5G A;  4IVN A;  3K2A A;  1REP C;  3UMH A;  1I4Y A;  1W1W E;  5DM6 F;  2JK3 A;  3CEX A;  4IXA A;  4IHW A;  3LQR A;  5F1J A;  4LLC A;  3GTO J;  2G7H A;  2PF4 E;  3I64 A;  1WJE A;  3JW4 A;  1A35 A;  4IB4 A;  3BZ6 A;  3T5X A;  3CCE I;  3K7D A;  5E8G A;  1UJ8 A;  4BE0 A;  4L0Z B;  1GUU A;  5A6A A;  2EIM C;  3GM2 A;  4XEV A;  2O61 A;  5F5F A;  2WZF A;  3RDI A;  2BVL A;  1DOV A;  3GEI A;  3WGI A;  4E7H A;  3L9F A;  1FBU A;  3KCC A;  3QYB A;  2NVT J;  4RB2 C;  2Y39 A;  5KYY A;  2L3D A;  2TDX A;  1C02 A;  1SFK A;  4A3M J;  4N4N B;  1ON2 A;  5FKK A;  4A0X A;  4EKW A;  3RYP A;  3COA C;  4JP0 A;  4IF4 A;  4KNV A;  4G12 A;  2MFZ A;  3OYC A;  3DPL C;  3MKY B;  2NSG A;  2LF7 A;  3RZO J;  1GDT A;  3TQN A;  3QU3 A;  2ZD9 A;  2W7N A;  2I8D A;  1EH7 A;  4HF1 A;  3DAG A;  1LE8 B;  3NKD A;  4OAZ A;  2NVQ J;  2YRF A;  3J80 Z;  4XKW A;  4JTC B;  1Q0K A;  4XLH A;  1ZAO A;  4DXW A;  5F64 A;  3KZI C;  1LM3 B;  3KEY A;  4C2T A;  1TWG J;  3TJ5 A;  5A69 A;  5HSW A;  2A69 F;  4L9N A;  2GOX B;  2LY9 A;  4YEJ A;  4HDU A;  4P1W A;  4A3K J;  2LR8 A;  4FQG A;  4DNC A;  3ZOB A;  4KMF A;  3DU6 A;  4PCQ A;  3IQ6 A;  5BS6 A;  5EHH A;  5CI9 A;  5FLX K;  2OOC A;  2KSF A;  3JYH A;  5GAG J;  1Z3I X;  2D1V A;  3QPS A;  3DP7 A;  3WGG A;  1VQP I;  1OYW A;  2DA6 A;  2YX7 A;  2KK1 A;  4XWJ A;  4AE4 A;  1FP2 A;  1YTY A;  1QVX A;  4YT4 A;  4CCJ A;  3G4S I;  3EUK L;  2PMU A;  5B66 C;  3FVY A;  2KQ9 A;  4S0H B;  2EV5 A;  5JVT A;  2WB1 N;  3OIO A;  4UV9 A;  4P6I C;  3AGT A;  2W4B A;  4Z9J A;  3EPV A;  3A01 B;  3Q5F A;  3IUO A;  3KP5 A;  4JVS A;  1K04 A;  2GOM A;  2OA4 A;  4JK1 X;  1Q0M A;  2FAP B;  1LKX A;  1AEP A;  3G1O A;  3V4G A;  3ERE D;  1NU9 C;  3HTU A;  5B3S C;  1YIO A;  1Z21 A;  1ZHF A;  4XKC A;  2R5Z A;  4RAZ A;  1E3P A;  2QWW A;  3IRR A;  2F5E A;  4G8X A;  4A3E J;  1W36 D;  2HVR A;  1D5V A;  1KNY A;  2X6O A;  4I1M A;  3GM3 A;  5K7H A;  1O7F A;  1MZB A;  2HXI A;  3HJC A;  4YL3 A;  1NTC A;  2P61 A;  1AOY A;  4GDF A;  2F22 A;  2HV7 A;  1RZ4 A;  2VLA A;  4HF2 A;  2QF7 A;  5IOZ A;  4L5E A;  1Y6D A;  3O3K A;  2J5P A;  4HFF B;  3X1O A;  2EJR A;  3L2Q A;  3K4J A;  3FAJ A;  2PMH A;  3C18 A;  1EH6 A;  4HEA J;  1S8N A;  3JSZ A;  3FF5 A;  3B73 A;  2WB7 A;  2KMU A;  4EM1 A;  1RIO H;  5E20 A;  3PUF A;  3FK7 A;  2V6E A;  1N25 A;  4XN3 A;  3CJT B;  2YL3 A;  4XEK A;  3RKW A;  2PP4 A;  2OPT A;  1TTY A;  5DV5 A;  3MKZ A;  3DMD A;  5FKO A;  3OIP A;  2P7V A;  3DTI A;  5JUA A;  1NHA A;  2K85 A;  3EYY A;  3PQJ A;  4C3E A;  2QVO A;  3A11 A;  2VAS A;  3GWZ A;  3JRB A;  3OSF A;  1R00 A;  1JKP C;  4WWC A;  4LER A;  1V3F A;  3TD7 A;  4MNU A;  1XB4 A;  1V55 H;  1GV5 A;  3QOE A;  1K78 B;  4BXX J;  1TWF J;  3LA3 A;  4BY1 J;  3GTM J;  4UV8 A;  4KDP A;  3IC7 A;  3CO7 C;  1JKQ C;  3EG9 A;  1A6Q A;  3LMM A;  2Y69 C;  5H6Q A;  3OR1 C;  1JUP A;  2E2J J;  1F9N A;  3BG6 A;  3ABL C;  2DMN A;  2RAE A;  3CUQ A;  3LSR A;  2CW8 A;  4WF2 A;  2EQR A;  2DOE A;  3FKI J;  4FCY A;  2GLO A;  3ZG1 A;  2QQB A;  5DYM A;  1OIS A;  3WU0 A;  1F1Z A;  2ISY A;  2K3P A;  2ACJ A;  5AC5 A;  2JUG A;  3JRH A;  3I4P A;  4PFP A;  4NTB A;  4ENM A;  2OCC C;  3I59 B;  1X2M A;  2DMQ A;  5HS7 A;  4AE4 B;  5FKL A;  4F55 A;  4MFE A;  2COB A;  5KYX B;  3E0J B;  5M5Y J;  1B72 B;  1ORY A;  2J9V A;  3EG9 B;  4UVA A;  4FX4 A;  2JVG A;  2GFH A;  2OKU A;  4O79 A;  1W5S A;  1IV6 A;  4L0Y B;  3QVZ A;  5GAE J;  4BKX A;  1FTZ A;  2NXN B;  1MBG A;  2KW3 C;  1WJF A;  3ZQI A;  1HY5 A;  2TCT A;  2RVC A;  3W2A A;  2VT3 A;  3A01 A;  4HDV A;  4HNV A;  1L0O C;  4NDL A;  1RR7 A;  1VOM A;  5DCM A;  5LLQ A;  4BDZ A;  1JRA A;  2OU6 A;  5L3V A;  2ASR A;  4ENN A;  5M5W J;  1T5O A;  1R5G A;  1MMA A;  5JFR A;  3PFY A;  1U9O A;  1OCO H;  2FMY A;  1HST A;  2JRT A;  3NYL A;  1XMA A;  3CCS I;  3L2V A;  4BU2 A;  2KQR A;  1HC8 A;  3DWW A;  3JRI A;  4CYC B;  4D7N A;  2PFD A;  4NC3 A;  2FSW A;  2R5Y B;  2W1O A;  3F8M A;  1ZR4 A;  3AG2 H;  1WJD A;  1XC5 A;  2AHQ A;  2BVM A;  1IG7 A;  4KNY A;  1V54 C;  1TWC A;  2FFH A;  2KJG A;  1U6G A;  1ZN2 A;  1YLM A;  1W36 C;  3DJN B;  1ZU4 A;  2MGQ A;  3NAR A;  5J8C A;  2K3F A;  1B68 A;  4KT5 C;  1J8M F;  4A5N A;  1FYM A;  4XLF A;  1OR2 A;  4CX9 A;  1IN7 A;  4IAO A;  2JJ7 A;  2IXN A;  5T3W A;  2VC0 A;  1TNS A;  4L18 B;  2BEO A;  4ZYA A;  2Q2E A;  3FIW A;  4M72 A;  4YFN F;  4O6N A;  2V79 A;  4MO7 A;  4BJ5 A;  3GM1 A;  2QQ8 A;  3FBI B;  4WK8 F;  2P0N A;  1R1U A;  2R7U A;  3NQO A;  1CGN A;  4NNJ A;  1O4X A;  2HUJ A;  3RCO A;  3HOX J;  1RR8 C;  4BDY A;  3Q6N A;  3F9K A;  2BC5 A;  2RN7 A;  2DYR H;  3IWF A;  2M4K A;  3M9A A;  1WOL A;  4EHP A;  3S2D J;  4CSW A;  4CDA A;  4F92 B;  2A0B A;  1F5T A;  4JZA A;  3WTZ A;  4X6A J;  5FCL A;  1XCV A;  4OWR B;  3ZWI A;  1AU7 A;  2VC1 A;  2KRH A;  3H3U A;  3DKX A;  1HKS A;  3UGP A;  3S9O A;  5AGF A;  3R2P A;  4NUB A;  5LHI A;  2W25 A;  2KHM A;  3OY9 A;  3OYA A;  4QI2 A;  4H4K C;  3LLI A;  3RW0 A;  2L7F P;  1ORJ A;  5K7F A;  2O6G E;  3RPQ A;  2X85 A;  2M8G X;  4XBF A;  3QAH A;  2ISZ A;  1GHC A;  3S27 A;  3WG7 C;  3PQK A;  3ASN H;  2OU2 A;  3CP8 A;  4EJT A;  2Q1Z B;  1RKE B;  4RA2 A;  2JPU A;  3CES A;  3HDD A;  2K9M A;  4Z9H A;  5JT4 A;  3VB2 A;  3I5U A;  3LNM B;  4GFB A;  4I0B A;  4LIV A;  3CCL I;  4Y33 A;  1Q0D A;  5D92 A;  3LWF A;  4CDY A;  5GAD J;  1JPJ A;  4AVZ A;  5IT9 K;  2DDA A;  3MD2 A;  4P9U A;  4JIO A;  3OV8 A;  4BUP A;  5EF6 A;  2B0J A;  2FGY A;  4I3M A;  3QYE A;  5ICG A;  1V74 B;  2R7S A;  4RLF A;  5CIV A;  1T08 B;  1UG2 A;  1PP8 F;  5AIP A;  3H3Z A;  5DD4 A;  1LJ9 A;  5KNL A;  3GTK J;  4RAY A;  1VFC A;  3W6K B;  5JR3 A;  1OXK A;  3KZZ A;  2UUZ A;  3WG7 H;  2YQY A;  4D1Q A;  3EJN A;  3EH1 A;  1OMI A;  2KRF A;  1W7P A;  3S14 J;  1E0E A;  3FOP A;  2HQN A;  3FMR A;  4XRS A;  3CCQ I;  1KU7 A;  1YX5 A;  3M1E A;  4UHT A;  3BQY A;  4CZZ A;  1U2W A;  1OFC X;  2FOK A;  3ZXS A;  3W6V A;  1E84 A;  2Y30 A;  2D4U A;  2X4H A;  2CS3 A;  4JX4 A;  4HNU A;  5L3C A;  2KT0 A;  3U3F A;  5J1Y A;  3VFZ A;  5CYV A;  3QOP A;  3DEU A;  2XL6 A;  4MW3 A;  3TL4 X;  4QDL A;  5BPD A;  3HKZ A;  3V7O A;  5KYY B;  2OEX A;  2IXS A;  4PK4 A;  3GUD A;  3H65 A;  1Q1H A;  1VQ9 I;  1T95 A;  1LDK B;  4LAC B;  3E1S A;  3DM9 B;  1NG6 A;  3DQV C;  4LG3 A;  4ETS A;  3PIO F;  1XD7 A;  1FAP B;  1B59 A;  3I5P A;  4HX4 A;  4NY3 A;  5DTD A;  1HLV A;  2DDB A;  4V2G A;  3W3C A;  4PR9 A;  1IN6 A;  5E18 F;  3MZH A;  1Z3Y A;  1W2W A;  1CGO A;  3AG3 H;  2RSE B;  3G4X A;  4KNW A;  4PAC A;  2P5V A;  2Z33 A;  3ZGK A;  3F21 A;  4FIS A;  1K4T A;  3JRT A;  1L3L A;  2EIJ C;  2K7L A;  1D1B A;  4UB8 C;  2Y3B A;  4PJJ A;  2R7X A;  4BPM A;  2JUC A;  2KNH A;  1QQ3 A;  3FXJ A;  1TWG A;  2MA3 A;  3FXK A;  3GFL A;  1S7Z A;  2HZD A;  4M6V A;  2DPD A;  2Y2Z A;  2Z2S B;  3VYW A;  2ME6 A;  1SFX A;  1TQP A;  2FBH A;  1POG A;  1XZP A;  3VM6 A;  5D6F A;  1KON A;  3VWB A;  3WTW C;  4CUG A;  3ZQL A;  5CVU A;  2LTP A;  1K61 A;  4KBL A;  1JJ8 C;  2X6W A;  2CDQ A;  1Z6R A;  3V5Y A;  4HF0 A;  3IKT A;  1FEX A;  4KIT B;  4PJ0 C;  1CGM E;  2ZME B;  2QZ8 A;  3NEU A;  1QRY A;  4JEB A;  5KAF C;  1ZG1 A;  3M4C A;  3TJ6 A;  2DK8 A;  4RGU A;  3S32 A;  5EZH A;  3I9V 2;  2VPL A;  1OCT C;  2XPU A;  3A2K A;  4DIQ A;  1NU7 D;  3P9K A;  4II2 A;  2YU9 J;  3EGD B;  1TQG A;  3T6J A;  4D5C A;  5KHD A;  1UHM A;  1R9T J;  2YLI A;  4KI2 A;  2CYD A;  3OMY A;  3NDB B;  4NC8 A;  3ECO A;  3RQI A;  4E17 A;  2BXY A;  2QCO A;  4PSW A;  3ZDL A;  4WAB A;  3MLG A;  3ZIB A;  4HA8 A;  2DQL A;  1QPU A;  3JT1 A;  1Z7Q c;  1BL0 A;  4B48 A;  4IKF A;  2DA2 A;  1B4A A;  4N9I A;  1XSX A;  2VN2 A;  1ZLK A;  3ABL H;  5IT9 Z;  1NG1 A;  1ZW3 A;  4BEJ A;  3WHC A;  4C3D A;  1JOG A;  5F04 A;  3L1M A;  1WH5 A;  2BXZ A;  3MFK A;  4LB6 B;  2FNP A;  1BBH A;  5B3I A;  4U0W A;  2BW3 B;  4UVB A;  1FNN A;  4G6Q A;  3SZR A;  3O6B B;  3R4K A;  2LY2 A;  2M64 A;  2X48 A;  3S8P A;  2J9U A;  4B44 A;  3LST A;  3LEV A;  4MVO A;  2LK2 A;  2LKS A;  2HNH A;  3H0G J;  4MTE A;  3R0A A;  4XN0 A;  1K6O A;  1RKE A;  1BBY A;  5IYC J;  2GAQ A;  2N8G A;  3SYN A;  2O7O A;  3UKG A;  1L3P A;  4D9J A;  1LNW A;  4Q48 A;  4ENJ A;  3JRE A;  5E1Z B;  2BY1 A;  4LDR A;  2M9H A;  1Y8R B;  4HRI A;  5IPA A;  1R4M B;  3LS0 A;  3BRO A;  1IXC A;  5D8K B;  4A3G J;  4C3J J;  2CUZ A;  2DTZ A;  4AWX B;  4BNC A;  3V5X A;  2HTJ A;  1MNE A;  2CUE A;  2E60 A;  4EMS A;  3CCM I;  4LJZ F;  1VQK I;  2LBF B;  1OCO C;  1HBX G;  1YLF A;  4CSA C;  1ETQ A;  1MBK A;  2LFF A;  1W5C C;  3W8H A;  1X1P A;  2IA2 A;  3TMO A;  1S5L C;  2L54 A;  3F8N A;  2X0L A;  1YYJ A;  1JHH A;  4IQJ A;  3SEQ A;  3BRJ A;  1HW1 A;  1R1V A;  4EJU A;  5C3E J;  3J81 Z;  2IS4 A;  2R7V A;  4OD5 A;  2Y0S A;  3DEE A;  2O3F A;  2VI6 A;  3DWL E;  1SEU A;  4JUR I;  4KIS A;  2DYS C;  1TKN A;  3BG9 A;  2XAF A;  2CH0 A;  2IGK A;  5FD5 A;  3JRD A;  2DTR A;  2IA1 A;  3OA1 A;  5D5V B;  2R9R B;  2EPF A;  3RYR A;  1RKW A;  3H9J A;  1W5T A;  4I0A A;  1XZQ A;  1MIJ A;  1Q0F A;  1MND A;  2XSJ C;  4YG2 F;  2KDO A;  1WZ2 A;  1T6U A;  1G8X A;  2AQF A;  1XGO A;  3ATP A;  3QP6 A;  4XLP F;  3ZRG A;  4BQA A;  1T9K A;  4BQO A;  4IRH A;  5ICE A;  3OYE A;  2Y3G A;  3FOO A;  1UAA A;  1FC3 A;  4W8P A;  3S28 A;  4LIU A;  3G1L A;  3E7L A;  1H9T A;  3GLL A;  3BDD A;  2PJR A;  2H8A A;  4AD9 A;  1LS4 A;  1RJ9 A;  4ULV A;  3MWM A;  3RKQ A;  2XGC A;  5KYX A;  1D0Y A;  3HZJ A;  1R7J A;  2VKV A;  3K1N A;  3H2V A;  3MN2 A;  1FSE A;  1X1B A;  4YIR X;  3HNI A;  1LEA A;  2NUP A;  2GXB A;  1GLN A;  1TW3 A;  3BG5 A;  2A5Y B;  1T6I A;  3TO7 A;  2HJM A;  2K9Q A;  3CO6 C;  3M1C A;  1A7V A;  3NMJ A;  5FGM A;  4QPQ A;  3BC8 A;  2EIL C;  2G62 A;  5EGY A;  4CS9 C;  2LP0 A;  2JA2 A;  4E7L A;  4NTA A;  2NG1 A;  4BL0 B;  3D5R C;  4P96 A;  4MVQ A;  2EB7 A;  1YE9 A;  1HW2 A;  3UGO A;  1I5Z A;  3FAP B;  1SR2 A;  2FNA A;  1RET A;  2DMP A;  4XNF A;  4DZJ A;  2E1M B;  2MD5 A;  5DVW A;  1HQC A;  3CLO A;  3WHB A;  2CU7 A;  3K4B A;  3KKB A;  3I59 A;  5JLI A;  2OUM A;  5JHF A;  4CA0 A;  2AWY A;  3F0C A;  1I3A A;  4GCV A;  4HW0 A;  3KYJ A;  2A6E F;  1GVJ A;  1MGT A;  5HS9 A;  4I02 A;  4M73 A;  2DFH A;  3BP8 A;  5JI6 A;  1D8K A;  1WWP A;  2HR3 A;  2XF7 A;  4N4O B;  3Q0W A;  2AQE A;  1TWA J;  1T33 A;  3ZC4 A;  1IF1 A;  3K4M A;  4C7O B;  2IPQ X;  2CV1 A;  4XOR A;  3WTS C;  4KIG A;  4IX7 A;  1BW5 A;  3H5A A;  3K66 A;  3QOD A;  1U5T C;  5CVV A;  2CQ7 A;  1CPQ A;  1SAX A;  1ACI A;  1RUN A;  1N75 A;  2XS8 A;  1D0X A;  1SMY F;  5F28 E;  4HZF A;  5EEG A;  5E3N A;  2QEX I;  2KLO A;  4CCK A;  4DZP A;  2HV6 A;  2VJ5 A;  3L7W A;  4BHB A;  4YT5 A;  4U87 A;  3DM5 A;  3GX4 X;  3S1Q J;  4QI0 A;  3F23 A;  3G1M A;  3O6X A;  4A2U A;  3CLQ A;  3W6J B;  2WV1 A;  4MHG A;  4C9Y A;  1IDZ A;  3U1D A;  1QPI A;  1BI0 A;  4M3B A;  3S15 J;  1ON1 A;  2VBY A;  3DAF A;  2YL0 A;  5KVR A;  4DYQ A;  3CCV I;  5B1A H;  4I01 A;  1MSE C;  4UUS B;  3A03 A;  2QQ9 A;  4F91 B;  5J1R A;  4UUT A;  2AS5 F;  2GXA A;  3HKZ N;  2G9W A;  4FT8 A;  4AIK A;  4J30 B;  4IAQ A;  2YVK A;  2F4I A;  1GGQ A;  1EF4 A;  2CRG A;  3MZY A;  4RGX A;  4HYE A;  1E83 A;  3N97 A;  2EPO A;  2JA5 J;  1TWA A;  3ERM A;  3UNG C;  3PM1 A;  3WTX C;  1PYV A;  4WXC A;  4J00 A;  1R5H A;  1AA7 A;  4G94 A;  1UCR A;  2OJQ A;  1SFO J;  1XX5 A; 
#chains in the Genus database with same CATH homology
 2OJE D;  3KPH A;  1R5I D;  2ICW G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...