3KPHA

Crystal structure of mycoplasma arthritidis-derived mitogen
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
196
structure length
196
Chain Sequence
QNLNNVVFTNKELEDIYNLSNKEETKEVLKLFKLKVNQFYRHAFGIVNDYNGLLEYKEIFNMMFLKLSVVFDTQRKEANNVEQIKRNIAILDEIMAKADNDLSYFISQNKNFQELWDKAVKLTKEMKIKLKGQKLDLRDGEVAINKVRELFGSDKNVKELWWFRSLLVKGVYLIKRYYEGDIELATTSDFAKAVFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superantigen
publication title Crystal Structure of the Mycoplasma arthritidis-Derived Mitogen in Apo Form Reveals a 3D Domain-Swapped Dimer.
pubmed doi rcsb
source organism Mycoplasma arthritidis
molecule tags Immune system
total genus 73
structure length 196
sequence length 196
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-11-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.530 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A mam-mhc complex, Chain D, Domain 2 3kphA02
1.20.120.390 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Hla class ii histocompatibility antigen, dr alpha chain. Chain D, domain 1 3kphA01
3KPHA 2OJED 1R5ID 2ICWG
chains in the Genus database with same CATH superfamily
2N8GA 2WAFA 2LMDA 4G0HA 3J81Z 1VQNI 3I4MJ 2HSQA 1W7PD 5KAIC 3N24A 4IOAF 2WTEA 2V1NA 2OEVA 3U9GA 3RI4A 1R4MB 3CCEI 4JEBA 4L6RA 1M1EB 5KVRA 5IY5H 4D0PA 3G71I 2QYOA 1QQ3A 2XF6A 1I5NA 4ZYGA 5BUOA 1PJRA 2P4WA 2JRTA 2ZSIB 3M1EA 4G6QA 1MZBA 1QHHD 2MYSA 3K6BA 1FTTA 3ZTZA 4IHWA 4HPQA 1TZLA 1MBGA 4QPOA 1SZIA 3PCVA 3NMKA 5BPDA 4BAYA 4IKFA 1OPCA 1MMSA 1XGMA 4HNUA 3OYFA 3FVYA 4YG2F 3B9QA 5DS5A 2KKOA 1U0JA 1E84A 1A7VA 1TP4A 1D3YA 4KBLA 2GOXB 2LH9A 1R5GA 2DN0A 3U2RA 2RC4A 1SMTA 2W85A 4M9XA 5JVTA 5DV5A 2R5YB 5LGTA 2NSGA 2ME6A 2G3VA 1SVMA 2A05A 1R5ID 1YZAA 1TLHB 2OAZA 2VT3A 1T6UA 1I39A 3LMMA 1JJ6C 2K85A 1X1PA 3BG9A 5JSLA 1M57C 3OWTA 3HOUJ 3GM1A 4HF2A 2FX0A 2RNJA 4OWRB 5E3NA 2L7KA 3X1OA 2O3FA 4PSXA 3TP3A 2EFQA 1FSHA 2QNLA 4M6VA 1IN4A 3I58A 4JVSA 3PIPF 3US6A 4PFPA 2DB4A 3DPLC 3AFHA 4UUSA 3OYGA 2R25A 3CCJI 1FMVA 2BYVE 2ZMEA 4CYCA 3CC4I 1K40A 4JKVA 4OD5A 4HV6A 2Y3GA 4II3A 3V8LA 1FTSA 5FCLA 4M9SA 1ZHXA 4AU7A 4FX4A 1RKEA 4EGYA 1FJLA 4EKWA 1OCRH 3TMOA 1YJWI 2KQ9A 2LVSA 2DMUA 3EQLF 4L5EA 1X2MA 2JMWA 2YUSA 3K4LA 3F8NA 2GQQA 4RAZA 2PJRB 2MA3A 1FBUA 4JX5A 1XGOA 2EPMX 3JZ0A 2LDUA 4MTGA 1OQCA 3O6XA 5BQGA 1TFKB 2FA5A 3T1BA 2BW3A 1GXPA 3BTIA 1QLEC 1YJNI 3GTPJ 3OYIA 4XRSA 5C4JJ 3O55A 1VQ7I 4KJZA 4ZTFA 2DA3A 1XC5A 5M3FJ 2Y48A 4DGWB 1TQGA 2BZTA 2KJBA 3K4KA 1XDUA 4Y3OA 5L3DA 1JMWA 2O61A 1GLNA 1T95A 2XAGA 1YA7O 2OU2A 2K9NA 5J4VA 2IXMA 2X6YA 4LITA 2P6SA 3WODF 1EA8A 2EZKA 1E2XA 5F5FA 1FOYA 1W5TA 2MG4A 5CVRA 1E83A 2M4KA 2XGEA 2GM4A 2A5WA 2EILH 5D6FA 4BEJA 3AGUA 3EHNA 2LBFA 4FASD 1Y0NA 3SNHA 3U3BA 3FAPB 3VYTB 2XB0X 2VE8A 1BI0A 4CS8C 5HS8A 5E3MA 1Y8RB 2J9WA 2XLDA 3U9JA 1K4SA 1PYVA 4UNOA 3K9TA 5GADJ 3AJMA 2XF5A 3FXOA 3N4MA 4UV9A 1MNDA 1XTAA 2K4BA 3PMRA 1YDIA 2O7OA 1EH7A 2R7WA 5HLGA 3PO2J 5ED4A 3LEOA 3G6EI 4E7HA 4E7LA 4XN3A 5K5RA 2JA5J 4CYDA 3VWBA 1HKSA 1V54C 4U5DE 1WJBA 2O8XA 2H94A 2ZCWA 2E1NA 3FMRA 3DTIA 1Z9CA 2IVMA 3DAGA 5AGFA 3JRIA 3P7NA 2PNOA 1DQUA 4AD9A 2BE5F 2IYLD 1G8XA 1OCTC 1K79A 5M5YJ 2OCEA 2XB5A 1IN7A 2GDCA 3ZMZA 2L9VA 2H6CA 1JPJA 3OR2C 2LIGA 1A04A 3ZCOA 3L0IA 1VYIA 2OQRA 2EB7A 5DDGA 1WHUA 2DOEA 2IA2A 1I1SA 4ESJA 4U5EE 1X1CA 3HKZN 3DD7A 4QI2A 1EI7A 5JLIA 5J40A 2P7VB 5GAHJ 1JTXA 3HYIA 3K2ZA 3EGDB 1S6LA 2NVQJ 2PX3A 2YU3A 3DV8A 4GYGA 3EZHA 3X2QC 1EQ1A 4CUGA 3H9JA 4YFKF 4CS9C 4A3JJ 4OIRF 3P5JA 3K4CA 3K4BA 1R23A 3LNMB 3QPSA 3SXYA 4A3FJ 1VB5A 2AVKA 4HFFB 4A3CJ 4JRZA 2W24A 1JPNA 1Z77A 5LEJA 1BOAA 4XQFA 4CJOA 1QRYA 2CSOA 1KA8A 3J7AO 2ZBKA 1LS4A 3EJNA 4I1OB 2AS5F 2NS0A 2ZJ2A 4MNUA 4BQOA 1YYXA 5DTDA 2DQLA 3I4PA 1Y6IA 1LJ9A 5L0GA 3ZQGA 2OJQA 3QYEA 3COAC 1FAPB 3DKYA 2VQGA 2W00A 3JSPA 2Q4FA 2R7TA 2QUPA 5DM7F 3TK0A 1ETKA 1G3WA 4ZYHA 5FD5A 3WTTC 2FUG2 3G3ZA 3L2RA 2A0UA 3IWFA 2KYHA 5A2QK 1YA9A 1PD0A 3CJNA 2V9PA 4D5CA 1Q0FA 5L3EA 1IUFA 2CRGA 5CPRB 2DFEA 4E70A 2BC5A 1VQPI 2ETSA 3NWTA 3QPLA 3W6VA 1SFEA 4KMFA 5K7FA 2YHSA 1G59A 3LLKA 5CVJA 3CZ6A 3OMYA 3UKGA 4M3BA 3RZOJ 4MW3A 4QSHA 5IYDJ 1YZCA 2WVNA 1ZHYA 1VYKA 3CCSI 4HRIA 4HNVA 1O3UA 3FXKA 3ZMVA 1P4WA 2KT0A 3I53A 4FE4A 2HJMA 4YL0A 2ADUA 2DMTA 3WGGA 3JCUQ 2KW3C 3JTGA 2PMZN 4EGZA 2FBHA 3LQQA 3CF5F 2O8KA 3RF3A 1FR0A 3TL4X 5KYWB 1ZW2A 1W0UA 1WCMJ 3VRCA 5EYRA 1RUOA 2GWWA 5EGOA 2DTZA 1JUMA 1U89A 3H0DA 4HYEA 4F52A 4ONSA 3TQOA 1X1AA 2OA4A 1HE9A 2KRHA 1XPXA 4OIPF 4CX9A 1U9NA 3FDQA 3GZ5A 3MZYA 4PZJA 1LS1A 1D5VA 4XRMA 3FK6A 3K1IC 1TC3C 1WI3A 2IA1A 4EJOA 2V7FA 5J1YA 2WZLA 3KCCA 3ITFA 2DOAA 1MQVA 3SFZA 2FBIA 3I9V2 5FKMA 4BXFA 1T0FC 3AQCA 2IXSA 4NB5A 4ZC3A 4HEA2 2A07F 4E0HA 1PUFA 2VC0A 3IPMO 1K04A 1SD4A 4Z9HA 1QVUA 3UMIA 1LFBA 1Z05A 4O7GA 4BE2A 1QHGA 1RESA 2NUPB 3IEEA 4YFXF 4MVSA 1GVDA 4A0YA 3DAFA 4BJTA 3OYLA 1T33A 2EPFA 2J0XA 1ORJA 2KGOA 4V2GA 2ELHA 3EGXA 2R05A 2BXZA 2PBIA 5EDNA 2XKPA 4BYYA 3RFYA 5DQZA 2STTA 2FGYA 4QI0A 1X4PA 5J4YA 3ONQA 1CF7A 3MZHA 3K1MA 5FKOA 1O5HA 4R32A 2K27A 4EQQA 5D5VB 1G2HA 2EPKX 1JJ8C 4RDAA 3ERED 3IHUA 1V54H 4A3MJ 3RQFA 5FKKA 1I27A 4XICA 1MD0A 2ZNYA 3CJQB 2V1UA 2XGCA 5CVIA 2I10A 5ERIA 2DA2A 2V6EA 5B3IA 2WY7Q 2JK3A 2H7BA 1DP7P 1U9OA 1RR8C 2CQQA 3MZ8A 4M6XA 1O57A 3B02A 4KISA 4XLFA 1M2OA 2YX4A 3I56I 2Z3YA 2XUBA 1Q1HA 2E7XA 1ZYRF 2VKDA 1X3ZB 1OYWA 4KITB 3I54A 1K6YA 3EETA 2RN7A 3K0LA 5FJ8J 3RKXA 4CCLA 5JI6A 3QVZA 4F55A 1J2XA 4BDYA 2XS8A 1TWAJ 1ETXA 1XCVA 3TJ5A 2XGDA 3EYIA 4A5MA 3X2QH 2Q0OA 2D45A 3EH1A 3HHGA 2IW5A 1ODDA 3HNKA 2XS1A 4WX9A 4LJZF 3S28A 3KEQA 1GUUA 1SFKA 1P92A 1BOBA 1FFHA 1SFUA 4ZZDA 1WWXA 4ESBA 2J5PA 3OS1A 2ZXPA 5E20A 4C2MJ 5GPAA 4ENMA 1LPQA 3HRTA 1OCOC 5L3CA 1U6HA 5DD8A 5AC4A 4A3BJ 2E1OA 2QEXI 2ZXIA 1KU7A 1E85A 2K02A 2LREA 4O6YA 5FZTA 4BL0B 3OYEA 5JHUA 3MVPA 2NXNB 4E7SA 5LGUA 1LI5A 1T6IA 3SJMA 4EBBA 4C2UA 3LAYA 1LVKA 4KUMA 5AC5A 3EUAA 1YX5A 2LY1A 3CUQB 2NPUA 1T01A 1VQ4I 2IRFG 4JP0A 3IQCA 3TJ6A 3P9IA 1DP3A 3WG7C 4D9JA 4A4AA 4NDLA 1SFXA 2AWYA 4Z2YA 4G94A 4G78A 5M3MJ 2WVQA 3ASNC 1B8IA 4GYIA 3SYNA 3HTKC 4EM1A 2P5KA 1YIOA 4A2UA 3HPGA 2FRHA 2LF7A 3CCLI 3HM5A 1T9KA 1G4WR 3F3XA 1H0MA 2WA0A 1PV3A 2A61A 1QPMA 4UXNA 2F2EA 1MBFA 4CDYA 4C30A 3JRBA 3UGPA 3H65A 5FFXA 3RIRA 4AVZA 4UUVA 4CSWA 1UCRA 3RW0A 1Z3XA 1TWFJ 2X6XA 1NG6A 2QQAA 2VBWA 4XOTA 1U5TC 3A01A 3G4XA 5BQHA 5ILVA 4AYBN 2VT2A 4C7OA 3RIPA 4ASNA 4JBAA 2XPWA 2PMHA 2VPLA 2X85A 1YYJA 4O79A 2ZFWA 2XV4S 4L0YB 3PQKA 4IF4A 3Q5FA 3OOPA 3FXJA 2UXNA 4NQWB 3U21A 2R7RA 3NYMA 3QTHA 1IN6A 1P9QC 4AE4B 4LG0B 1JKOC 5C4XJ 3GXOA 1D0YA 1QZXA 3PQJA 2Q9CA 2OUMA 2IPQX 2Z99A 4UVAA 1FIPA 3DJNB 4KYWA 1B9MA 2K9SA 1VNDA 3PSFA 2ZJRF 2RSEB 4XBFA 2IP2A 2R4GA 4DBQA 5FD6A 2CFOA 1YFHA 2XXAB 1IRZA 3V8JA 2TMVP 4U0WA 1Z23A 3F8MA 1LEAA 1G4DA 1HCRA 2VIXA 1Q1VA 3M4BA 3HSEA 4KT5C 5JT4A 4HBLA 1Z91A 3K4NA 1OLTA 2MD5A 2C03A 2VJJA 4I1MA 2L01A 5B3SC 2VCCA 4WGZA 2A6TA 3OOUA 4YIIA 1U5TB 3A02A 1LVAA 1HW2A 1FBQA 2CWEA 2PI0A 1XB4A 4DJ9A 3EG9A 4PDKA 2VOPA 1XMAA 2M1BA 3M3YJ 3PL8A 2HQ5A 5FLXK 5HLTA 1XDSA 1KQ9A 1NG7A 1R5HA 3BPVA 1J8MF 1ACIA 3CMYA 3F6OA 2H27A 2DFIA 1UHSA 1YVIA 2HSBA 2G62A 2J7PA 4MW8A 5KNLA 3GFIA 3QU3A 1H89C 2L4AA 3F47A 1E3PA 5LFAA 3KLOA 2HOEA 1LE8B 3WG9A 4KFCA 4YN0B 1NZEA 3LOCA 4MTFA 3U2MA 1STZA 3K2AA 4FETA 4LLCA 2GIVA 3E6DA 2V6CA 4CCJA 4OMZA 1A7EA 3ZN1A 3M8JA 2W45A 1RC9A 1ETQA 2LY2A 3HB9A 1S5LC 2K7LA 1TWGA 2XL4A 1HOMA 3TGNA 3N0TA 3UGOA 2X6WA 2DTRA 2R5ZB 3C8GA 3WTZA 2JA2A 2KIMA 2RDPA 3DXJF 3IV5A 4HQEA 5IT9Z 1WH5A 2GAQA 4YIFA 4RBOA 2KRFA 3E3VA 3LSIA 2KFDA 3DU5A 1AHDP 4M72A 4MQ9F 4AM3A 4DRJB 3NEUA 3BY6A 2GAUA 4RA2A 1V5GA 2Z5UA 4JW1A 4XMYA 2OPTA 1D8KA 3WTSC 3M1CB 4U5BE 1OCOH 2EA4A 2OV7A 2CW7A 1VK5A 2KPMA 3WHBA 4ETSA 3MMYB 3B29A 4YK5A 3LFKA 3GMEA 3KH2A 4JQFA 3LSMA 2CNWD 2YEVA 4BU2A 5EHHA 3DWWA 3NDBB 1MH4A 4CZZA 2L02A 5DCMB 3SFIA 5IYCJ 3LQRA 1B1BA 1XGNA 1ZN2A 3J80K 3D5LA 3GZNB 1PP7U 2WVOA 2GWRA 2Z15A 4H54A 4XEFA 2V26A 2Q8KA 4B47A 4HX8A 3VAYA 3T6GB 3K66A 1FYMA 4L9NA 2OJED 5L3GA 5CVVA 2JTVA 2YQYA 3F6VA 3ASNH 3HG9A 2COMA 2FXAA 4AUXA 4E4HA 4L18B 1ZHTA 1HE1A 2HKVA 2R7QA 1WGXA 5E3OA 1HMDA 2BXYA 1FOXA 4O6JA 2VPRA 1UG7A 3EUHC 2OTJI 2M34A 1EH8A 3PUFA 2KK1A 2MD0A 4EV0A 3WTXC 4PJNA 4BBRJ 4D1QA 5GTHC 1W36C 4V19K 3G4ZA 2MABA 1C02A 2H7OA 2DA5A 2XAQA 1LKXA 3OA1A 1GVJA 4DYQA 1HMOA 4IJJA 3SXMA 3RSNA 1W7PA 1T2KA 3KX2A 4LGWA 1Y0UA 3GTOJ 4FCYA 2EPOA 2YL7A 3BROA 4QIWN 3MYIA 5FROA 5B1AC 1Z7Qc 1UHMA 1RETA 2KLOA 4ITVA 2R5YA 1ON2A 3I64A 3M15A 2CGPA 4GEHA 2XASA 4AX2A 2OOCA 2F4OB 1MSEC 3JRGA 3HNJA 2E1CA 2P0NA 4LB5A 2LP4A 2CU7A 5IP7J 1Y56A 3CQZA 1QNTA 5D5XB 3TOLA 2Y69C 3E5QA 4NBQA 3ZMUA 3RYLA 5H20A 1RNLA 1A0BA 5ICFA 2ZXJA 5DCFA 4BNCA 3I59B 4O3MA 3L8IA 2WAQN 2R93J 1ZGWA 3DQVC 4DRIB 1QSPA 3QQAA 4Q47A 3C18A 5L3FA 3Q0UA 3W2VA 4WXHA 4KN4X 4XRSG 3U1KA 1BR2A 3WHNA 1FC3A 2RREA 5EG0B 1ZRFA 1Y4CA 1T6QA 1T56A 1OCZC 3KYJA 2ZXWC 2UV1A 2K3FA 4RGSA 3G1LA 1DU0A 3C63A 4IB4A 2M0CA 3HIFA 3H9QA 1BW6A 4IEJA 1FEXA 3ZG1A 3FXLA 1TR2A 3IWZA 1WGWA 4LIUA 2LTPA 4WXCA 4B6IA 4PUSA 4I01A 2EILC 2LLKA 4CSAC 3GBGA 3HDDA 1X1BA 2X1DA 3RPQA 2QQ9A 2M45A 3ZQCA 2L81A 3H1CA 3HUGA 3V8KA 3GODA 1EH6A 3KZIC 1VFCA 4B44A 3BG6A 4FTHA 4I7HA 2Z9OA 3FBIB 1F5TA 2PF4E 2RAEA 1A6IA 2XAJA 3W8HA 3TOBA 2HYFA 2BEOA 5LHIA 3GF2A 4CIHA 2H7VC 1ZLJA 4A6EA 1YHQI 1UG0A 5HODA 2GA0A 2M4GA 2XROA 4C3DA 3TBIA 2NUTB 2HFHA 2AO9A 5GPGB 3FXQA 2IGMA 3I3LA 2ZKZA 2L3DA 3G2BA 1RKWA 2H8RA 4NHJA 3Q6MA 3ZMDA 4UVBA 4HE8D 1MNMC 3ECHA 2HKXA 1QZYA 3GFLA 3Q0VA 4ANJA 1C0WA 2IS1A 4FWVA 1FBSA 3C2BA 3ZPLA 3JCUC 2L9RA 1OMIA 3G73A 1YRNB 3ZGKA 2DA1A 3VEPA 4NTFA 2IGKA 4AIKA 2KMUA 1BM9A 3PM1A 2QTVA 2HJ3A 3IL2A 5TJJA 2Q7RA 2RV8A 1OR7C 3CMMA 4RGRA 2ZJQF 1NLXA 4ZYEA 1KQ8A 2J46A 1M2VB 2K40A 2DW4A 2F5DA 5IP6A 4I2OA 3S1RJ 3ATPA 2W25A 3L2CA 3HTUA 1SD7A 1MJBA 1HY5A 1ZZPA 2KISA 1QU3A 4D7MA 3HTSB 2AQEA 3S1NJ 1OCPA 1TWCJ 1F4KA 1AWCA 3M4CA 3WTVC 1ZH5A 1MMDA 3HC7A 2ELJA 1R1TA 1A31A 1X3WB 2BHZA 3JREA 1RUNA 2M5WA 1UAAA 4J30B 3HKZA 4DXWA 3LSHA 4N9IA 1VLTA 1Z0XA 5L0FA 2QWWA 3B0VC 1B72B 3S2DJ 3HL2A 3EGDA 1LDKB 1WJDA 2ZNZA 1ZELA 4BDZA 3A9CA 5M5XJ 1SAXA 2LFDA 4ZH4F 3LS1A 4GFBA 1P2FA 3LSKA 2EIKC 2JPCA 3R60A 1TQPA 1S7AA 4K0DA 2K86A 5K0IA 3ZRGA 4ZLDA 3VSKA 2VKHA 3FHZA 3N05A 2IGNA 3V7SA 1IN8A 1U78A 5B1AH 4IOCF 2VI6A 4XL9A 4PCQA 3S84A 1D0XA 4LFUA 3WE3A 4C3EA 1MMAA 2PJPA 3GX4X 3DF8A 3KP3A 1ZTRA 3AQBA 3HOYJ 1ZGAA 1LIHA 5D5WB 5BPIA 3C8ZA 1JHHA 5TGTA 2D2WA 1QO0D 3HZJA 2LD6A 2M64A 1AA7A 1B68A 2Y69H 4A3IJ 2R02A 2R0QC 3SEOA 4CIPA 2DDAA 1JR8A 4C3JJ 3K10A 1YS6A 4K7BA 2VBYA 3BR5A 3GTJJ 3E97A 2IXNA 4NCQA 2A6HF 4YELA 2HZDA 4YWQA 1HW1A 4PJLA 5EEHA 4I02A 1B9NA 3SEQA 3ZC4A 3B71A 1OKKD 3VPRA 4PK4A 4IRIA 3RZDJ 3DBRB 4LDKA 2M9HA 2WBMA 2L9JA 1OCZH 1I4YA 2DPDA 2ZXWH 2YZSA 4JTAB 4KI2A 2EFNA 4HW0A 4BXUA 3ZWIA 2ZFUA 2PMZA 1VQLI 4XKVA 5IP9J 3E7LA 4D7NA 2XRLA 4XKBA 4HSTA 1ZR4A 1ZREA 5HDNA 4IZZA 2FD5A 2IT0A 4BBSJ 1E17A 5FRMA 3R2PA 5E2QA 3K4MA 5KYWA 4CCKA 5B5EC 2WV1A 3F0CA 3M8EA 3R0JA 2DI3A 4WABA 2P8TA 3A11A 2OC6A 2J9UA 4HA8A 3ZXSA 3BOQA 1FLIA 3FMQA 1FPQA 2HQRA 5J6XA 1MDMB 3ASOC 2D1HA 1TNTA 5J1UA 1VTNC 1A6QA 2G0EA 2J45A 3AKZA 3KFWX 1HF0A 3M7GA 4IAOA 3IP4B 3HOSA 4N4NB 1Z1DA 3EZIA 1LFPA 3LAPA 1KONA 1JXSA 2M2EA 3E1SA 3H3ZA 4O6MA 3LA3A 2R7FA 2BY1A 2ACJA 3H5RA 4EJVA 5JVGF 3LFUA 4Y33A 1TW3A 4G9YA 4ZZLA 5HS7A 2LSOA 2P81A 2KSFA 2FMLA 2QVOA 2X1EA 2XRNA 4N6CA 2B63J 5L3VA 3RVZA 1C17M 1YG2A 5HLHA 5M5WJ 3ECOA 2E19A 2KJCA 1HW5A 4XKWA 2HKOA 5EEAA 2FOWA 3RYPA 1F9NA 2LR8A 5E3CA 3CUOA 2HUJA 4NC3A 5T3WA 3DBHB 3SZTA 4M9ZA 5E1XA 4BEHB 2MC3A 1PP8F 3BRJA 3RPUD 3EHMA 4OD4A 1QVTA 3O3KA 2HOAA 2PX9A 4ESFA 1Q0KA 4BG0A 3S0XA 1WRJA 1MSFC 3FM5A 1WQ2A 4NTBA 4XLAA 4BY1J 2DMQA 4KA4A 4M6YA 5KK1A 2R9RB 2PP4A 1YJ9I 4LLLA 1BJAA 1MJAA 3S3OA 4HFKB 1NHAA 4I99C 4LIVA 2XLEA 3CLQA 3HGYA 3LS0A 1SYQA 4XLHA 6PAXA 4ZDLA 4ENKA 5GP9A 2HTSA 2H8AA 2J9BA 4IXAA 2AXLA 2XSEA 4DQ2A 3T9OA 3NMIA 1S7ZA 2FNPA 2F5CA 2OBPA 3I5UA 1GXQA 1KZHA 4W8KA 2V79A 2ZMEC 4XLCA 1BL0A 2VH3A 1TWHJ 1XD7A 3CO7C 4CCOA 2PLYA 1UFMA 2CYDA 2P5LC 4A0ZA 4RB2C 4L5JA 5LD2C 1FP1D 4I0AA 3I71A 4UUTA 2JX0A 3U9MA 4IRHA 3HOXJ 1W5CC 4XKCA 3S93A 3CCQI 3FIWA 1VQKI 2CUJA 1QPIA 1VZ0A 2JVGA 2EIKH 2LF8A 2XLOA 4P9TA 1Z63A 2GXGA 3C2GA 3RKOF 2OZ6A 4C3BA 1R9TJ 3SZPA 4YEJA 5E1ZB 4XLEA 3IKTA 1YAUO 3MKWB 3POVA 5GAEJ 2FMYA 1Z6AA 4XM3A 4YT8A 1N1CA 3CUQA 2VCAA 3KP5A 2LKXA 2QENA 4GYTA 4EUKB 1WI9A 1YE9A 3IRRA 1S9HA 4UUSB 5IYBJ 2WAEA 2FEZA 5LLQA 2DK8A 5JHFA 3RTRA 1TBXA 2W7NA 2ZMEB 3KZYA 1A5JA 4B3XA 1J8YF 1A36A 1S8NA 4BJ6C 1ITYA 2CCYA 2DOFA 1V3FA 3MYFA 1XSVA 1DU6A 4A12A 3JTLO 1SD5A 5JFRA 1RKEB 3DZAA 1ZG1A 3O39A 3S29A 2P6VA 2P61A 3OYHA 1X1DA 1SFOJ 3AG3C 4M3EA 3SYTA 2VC1A 1WSUA 4XSXF 3H2UA 2NRAC 5DS9A 2Y3DA 4RDUA 4I44A 4NC7A 4HLXA 3ZR8X 3MFNA 2LD5A 2YL0A 2E5NA 3TP0A 2KRCA 3BJ6A 1L7CA 3JYHA 3BT9A 2IBDA 3BZCA 3LNQA 3HXLA 4G7OF 1BBHA 1G3TA 5GAGJ 2ZO4A 2O9LA 2VODA 4J32B 1A35A 4MTEA 2KC3A 3GTQJ 3QW0A 2MC4A 1GDTA 3DI5A 4KT6A 2DT5A 4D4NA 3WU1B 3TOAA 4HNTA 1I50J 3MCZA 4XPXA 2L9NA 3ZN0A 1UHWA 4M74A 4EBJA 1YW7A 4NQWA 2HS5A 4OINF 4JTDB 3V5ZA 2KL4A 3BCBA 3ASOH 3W6KB 2QA4I 2NVYJ 2JN6A 2LBFB 4ZDPA 2VJ4A 1MMGA 2DFFA 2Y31A 3K33A 2NYXA 4RM3A 4MHGA 1JHFA 3P9CA 2PG4A 2HPMA 4FESA 4A2NB 3KP6A 2L6FA 2HOSA 5L0CA 4QLCU 2BVMA 2E2HJ 2XXAA 3KEOA 4P5OA 3S15J 3FM3A 5K7HA 3KYIA 4A3GJ 4LLEA 1DPRA 4GQHA 1AOYA 3CESA 4GO1A 5JLWA 1K05A 2HZ8A 2BGCA 2QKLB 4F7ZA 4XONA 3FKIJ 4N4OB 3H3VK 1FMWA 2E35A 3DPUA 5A6AA 2OTLI 4O5VA 4P96A 4J19A 1WJCA 2XF7A 3G4SI 4LK0F 2QBYA 3F22A 1TT5B 4U7BA 3CJRB 1AUEA 4OU0A 1SVLA 3TEDA 1OXBA 3V7OA 1BZ4A 3KE2A 5HS9A 1JT0A 2Z33A 2Q2EB 5F0FA 1K78A 2I5UA 2DXIA 5IT3A 4U5CE 1HXDA 2JD3A 2NVUB 2VJ5A 3DKWA 3ZMTA 3RQ4A 3MKYB 4BHPA 3CC7I 4LLNA 3BLYA 1T39A 3QWLA 3V5XA 1ZW3A 5TRDA 3DEUA 3BP8A 3ABUA 2MFZA 2W48A 1YIJI 5H2FC 4GGGA 4CHUA 5KYUA 2VKEA 2XIGA 2GOMA 2ME0A 2AU5A 4E7KA 1H9TA 3JSEO 1FOKA 2FAPB 4B4CA 2TCTA 3MAJA 3O2PE 4LB6B 1ZHZA 1BI1A 2Y0SN 2EK5A 1AVOB 2PBEA 4RAGA 1CQTA 3GEEA 2E2JJ 2HXOA 2WZGA 3IC7A 5ILUA 4P55A 5JP7A 3HOWJ 4MIMA 3HJCA 3N2ZB 1YLMA 3FZVA 1RR7A 2R5ZA 1TTYA 3AAFA 5H6RA 4RAYA 1O87A 2DU9A 4HX7A 2TDXA 4E7ZA 4A3LJ 3DWLE 1BI2A 4RB0A 3ZQVA 4A93J 3W8IA 1H6GA 3D0SA 2L0KA 3A0HC 2YRFA 5EEGA 4CJGA 3TO6A 1K7AA 2JRMA 5FGMA 3LEVA 4JIOA 4PJJA 3OYAA 1IDZA 1YO5C 5A6KA 1IRXA 3FXHA 1NG1A 1N75A 3FISA 3CCUI 5CIVA 4EJUA 2VB6A 1IJWC 1ZRCA 5DCMA 3GTMJ 2VE9A 3OIOA 3Q0WA 3W3CA 3OR1C 3TDUC 2V9KA 1XX5A 1A7DA 3BEHA 2FQ3A 2FU4A 2HVQA 4IRUA 1RKCA 3I4UA 3WGHA 1SEUA 2W57A 5FKNA 3OS2A 2BVLA 3BR3A 3PNVA 2B0HA 3LUTB 4DNCA 5D4SA 3QZCA 4CDVA 4A3EJ 3TOMA 2ECCA 2ZXHA 2AQFA 4IJAA 4ZDOA 2NG1A 1JKRC 2EBIA 4RLQA 2XSJC 3T8TA 5COFA 4MEYF 1YW9A 2NOJB 2TRTA 2CNWA 3JT1A 1NU7D 3EPVA 3FXRA 4U88A 1J0RA 4L9TA 2VKVA 4UY8I 2MLGA 4J7YA 3OS0A 4NY3A 3AG3H 4HSRA 2D5RB 3JAMK 2L4MA 4RMNA 1ST6A 2GIZA 1NFNA 1UFBA 5BMZA 1CGPA 3UNGC 5J47A 2I8BA 3DMDA 4HX4A 1BC8C 1OCCC 3OL3A 1LPEA 3DJUB 2CYYA 2X48A 3NRHA 3S17J 2OG2A 4DVZA 5TISC 2HDWA 4WF2A 4MNDA 4DVYP 4PFOA 2H6BA 3J81K 2ZXRA 1WPKA 2K9MA 3OSFA 4I6ZA 3L1PA 3K70C 1D8JA 1RCPA 1N77A 1XWJA 4RGUA 4BHCA 3U8PA 5FB2A 3D5SC 4ENNA 2LK4A 2YKZA 3ZDLA 4M3FA 2EH3A 2WB1A 2JWTA 3BJAA 3ZMSA 3HOTA 1C03A 2JPBA 1QPUA 3LSPA 3EFOA 5D92A 4HV5A 1PVEA 2V9VA 2WAQA 2L7AA 2B7EA 3I59A 2J0WA 4N06A 1HSJA 2BOLA 5IOZA 1MIJA 2AWCA 3F23A 4GRIA 1O4XA 1R00A 3QU6A 4CBEA 2UUHA 3EGXB 4HQMA 5E33A 4XRFA 2W4SA 5K5QA 4XN0A 3K70D 5EG0A 2P7CB 2PX0A 3F9KA 4BS9A 2IBFA 3CO6C 1RZ4A 1CF7B 3JSZA 3JTHA 1FFTC 1YYVA 1HA8A 1KNYA 4JYKA 3CD6I 3EPZA 1ETOA 2RQQA 3VYUB 3KP2A 4XLNF 2VBZA 3A0BC 2NVTJ 3L8JA 3VYRB 4GDFA 1HKQA 1YJGA 4JX4A 2A5YB 1SR2A 4DJAA 3LNRA 2DLLA 3BTLA 4DYCA 3CCYA 4IAQA 2KQRA 5EK0A 3JRTA 1Y6DA 1BW5A 3HJEA 4PGGA 1OW8A 4LG3A 3VFZA 2XLVA 3F8BA 5A2QZ 2ISYA 3Q9SA 4U87A 4U0YA 3HEFA 5COGA 2KIUA 1IXRC 2MGQA 2K9QA 2X51A 3G50A 3KEYA 2E34A 1NK2P 3PDMP 3F72A 5L0JA 1JOGA 2FQ4A 1BIAA 1Y1VJ 4MVOA 4XR6A 3R0AA 5IOYA 2DO7A 3DE9A 2IEKA 4BQAA 1T38A 4HF1A 3CLOA 3GWNA 2MSYA 3W2WA 3GTKJ 2NUTA 2DYSH 1S3JA 1IUYA 2FOKA 2G9WA 4R1HA 3BG3A 5IPAA 1JUSA 3LSGA 2CUFA 5CQGA 1YI2I 3BPXA 3PHF2 3HOZJ 3CDIA 3ZQLA 2WZFA 1ONVA 3U2LA 1J09A 4UB8C 2P6TA 1DDNA 5HNFA 1D1BA 3BG7A 2FJ1A 2JT1A 4F3QA 3PJRA 3FK7A 4U9DA 1ORYA 1N25A 4NC8A 2VLAA 1QKRA 3ZQYA 1IW7F 1FNNA 1XSDA 2QLAA 3BZKA 1U3EM 5DS4A 4CSAA 3Q9VA 1FP2A 4U7DA 2JA7J 1WOLA 2JSPA 2V4JC 2CV1A 1O3SA 3OYCA 1YTYA 2NS8A 2AHQA 1M2VA 1FWZA 4FAPB 3BZ6A 4RD9A 1DGRM 2B9SA 2DT6A 4N9HA 5F04A 1B8IB 3KMIA 2Y75A 3RKQA 3B0PA 1QBJA 1UG2A 2DFHA 4X0GA 1Y1WJ 2XLWA 3MQ0A 2D4UA 3M79A 4E17A 1O7LA 1Z7UA 3J7ZI 1WASA 3Q7LA 1GGQA 2WY8Q 1BIBA 4EEFG 1XS9A 1IAWA 1DPUA 2X1CA 2XPVA 3ZQHA 3KYLA 4P6IC 5JUAA 1X4OA 2M30A 4EIYA 5F6FA 3ELKA 4BACA 3RYRA 2ID3A 1JUPA 4CZCA 1USTA 2L9SA 3A01B 5A6JA 4MTOA 3CMEI 1IRGA 4RAFA 4X1EA 4C7OB 1JKPC 1BC7C 2DMPA 1RJ9B 5BNGA 1B4AA 1MBJA 2R3SA 1S72I 2DGJA 4DZPA 3L2VA 2R7XA 1AU7A 2O9XA 4IGGA 1SAUA 3KL4A 4HDVA 4M3DA 3HNLA 2E36A 3MFKA 3U8VA 4DOZA 2HNHA 2ICWG 1W36D 2KHMA 2KNHA 1OCCH 3S14J 2GLOA 2XVCA 1HDPA 3WAQA 4MS2A 3MWMA 3BR0A 4NQFA 2QGUA 2HOTA 5H6QA 2CV0A 3D5RC 4QWQA 1L3LA 3GM2A 3U1DA 3HSFA 1SANA 4CA0A 2HYJA 1LB2A 2GBYA 2M8GX 4B1RA 1HLVA 3IAM2 1NBBA 3SXZA 4JCZA 2VL8A 2R7ZJ 1G4US 3LAJA 1D1CA 3ECSA 3S2WA 2GXBA 3Q6NA 3LSRA 4ULWA 3L09A 2DQRA 2DBBA 5K1YA 1K4TA 1TNSA 2LFBA 3WGIA 2DA6A 2L6GA 2ASRA 3FOOA 5CI8A 1Z6RA 3GWLA 3H3UA 4F92B 3PIOF 1ZAOA 2PJRA 4X6AJ 2EJRA 3OYBA 5ICEA 1J59A 4CGZA 5E3AA 3JRCA 4FX0A 3EG9B 1V4RA 2KP6A 1F36A 3GEZA 3GLLA 3HPHA 3MKLA 1OQYA 2GA1A 1TFOB 2YLGA 3PNYA 3F46A 3FMSA 4GXOA 2HMQA 3DE8A 3S32A 3OYKA 1V55C 1WN0A 1TWAA 2XAUA 5KCMA 2CQNA 256BA 4XK4A 3G1OA 3GWZA 5ICCA 5EZGA 1O3QA 1NTCA 3VSLA 4BXXJ 1DOVA 1R1UA 4K2EA 4C9YA 4BJ5C 3U3FA 1BR4A 3NAUA 2OF7A 4NC6A 3S8PA 4B48A 3V4GA 3GYHX 4MVQA 1GS9A 5L3BA 3IAS2 3IUOA 4EWCA 1OKKA 3FXUA 4LD5A 2CQ7A 4G7ZF 5L0DA 1ZVZA 4W1UA 4BQNA 4IARA 3DTKA 4BUPA 1XMKA 2K4JA 4C2TA 1K83J 5E8GA 2EZIA 1TW2A 2H8WA 3T5XA 1T8IA 4QTRA 2CFXA 3R4KA 3NYJA 2BV6A 2J9VA 3KYDB 1Z6TA 3H0GJ 4DZJA 3Q7GA 4JTCB 3OL4A 2P1AA 4JURI 5D91A 2HQNA 5F0CA 1E3OC 3GLXA 3CDHA 3C8GB 4XTKA 5FO5A 4IQJA 3FBNB 1CPQA 2F5EA 3M4OJ 4KNYA 1P7IA 2MW8A 3GO5A 2QUFA 3VYSB 1OYYA 1LFUP 1JI8A 2YLIA 1O3TA 1W5SA 3R6SA 2COBA 1R7JA 3KPHA 2YU9J 3MLGA 1R1VA 4BGDA 5F5HA 2LP0A 4QPQA 4BJ1A 1RI7A 2FFHA 2KIQA 2CV2A 5AIQA 4HLYA 2IS4A 2NS7A 2QQBA 2NNYA 4B43A 1BJZA 4EJTA 1YX3A 2EIJC 3QP5A 2E1MC 3EDPA 3SEZA 3L2UA 2CUEA 3S9OA 1SF8A 1XG1A 1OW6A 3MN2A 3H36A 3VB2A 3MX3A 1V74B 2QM3A 3R7CA 4CCMA 4EATA 4I98B 2M8EA 1TT0A 3T4RA 2LFFA 2GA2A 2Z1DA 4PGHA 4EHPA 3RDIA 3UMHA 3VM6A 5LRSA 4ER9A 1OXKA 5JVEA 4P9UA 4OIQF 4AWXB 4CS8A 4B3AA 2QCOA 5HVQC 3N97A 3LSTA 2IOQA 4JJGA 5JLXA 4JC7A 4WXDA 4D5FA 2P7VA 4HZFA 3PSIA 4CDGA 3DLAA 4P1WA 4FHTA 3WTYC 4L0ZB 5DUKA 1LE2A 1NSGB 1OFCX 2DMNA 3RPUA 3L7WA 1JE8A 3BQZA 1LQ1A 1RRJA 5JR3A 1O3RA 1HBXG 2A3SA 2DYRC 1LNWA 4A5NA 4LMYA 5DVWA 2RVCA 1JAFA 2W4MA 1I3AA 5E1WA 4CICA 3SZGA 3QRFF 1H88C 3EUKL 3FDYA 2KDOA 3OYDA 2E1MB 2NOGA 3J7YJ 3HKKA 1R4TA 2MLKA 5J1RA 4BPMA 2RGVA 1W7PB 3H92A 2G7UA 5FLXZ 3DM5A 3JRAA 3BR1A 3ESWB 3BC8A 1G5ZA 1JGSA 2WADA 1VLSA 3PFIA 3S16J 3VDXA 4JJFA 4CDAA 4KC9A 1IXCA 2CMPA 5GPCA 4AIJA 1RXQA 1PCXA 2UUZA 3K7AJ 4KNVA 2R7UA 1I3QJ 5L0IA 4BY7J 3OSGA 3FHNA 4UHTA 1KU2A 3QPTA 3KYCB 2VCBA 3GANA 1L0OC 3H5AA 2Z16A 2W84A 3T8RA 1CGNA 3L9FA 1L3PA 3LSJA 2E87A 2EIMC 3HLZA 2G7HA 3TW6A 2OD5A 4RS8A 3AG1C 2K9LA 4CS9A 1YITI 1D0ZA 1WJFA 3E5XA 2FNAA 5A6BD 2HI3A 1ZKGA 2STWA 1AEPA 1BDJB 2NVXJ 2VJIA 1M56C 2VXDA 4MFEA 1PUEE 2PEXA 3IH2A 2JA8J 2I15A 2ESNA 2RNGA 2VONA 1JKQC 3ABMC 4H0EA 2EZHA 4X0RA 3RQGA 4IHTA 3C2HA 2Y3HA 4BKXA 4YIRX 2KJGA 4MVMA 1MH3A 1VF9A 3KETA 1ORKA 1XGSA 4PR9A 4E18A 4G6DA 1WJAA 2DCEA 4MVUA 3KIOA 4BEMJ 2XLHA 3TO7A 3VODA 2QSHX 4IO9F 4KDPA 1GV2A 5D8LB 2Y9ZA 4KIGA 2C04A 4S0HB 2JZYA 1V55H 3BCAA 1UELB 5CLSA 5F64A 4Q48A 2Q9BA 1QA6A 5CJ9A 3T0YA 1VOMA 2B0LA 2A1DD 2Y39A 5B66C 3RQEA 2Y9YA 3H9GA 1EA3A 3HUGB 1TKNA 5KHDA 2RD9A 3LLIA 4LDRA 4C3HJ 2FSWA 3J80Z 2WV0A 2R7SA 2IXOA 1BN5A 4W97A 5KYXB 3JRFA 2DK5A 5HDGA 1JT6A 4MO7A 1NK3P 2UUIA 4JX6A 3E6CC 1Q0DA 3AG2C 1IZ1A 2NUPA 1Z21A 1VQ8I 4RB1A 1OJLA 1NFOA 4EM0B 4PSWA 2YL1A 4BJ6A 2IGOA 3D1NI 3GFJA 1HDDC 4GCVA 1AKHB 2G3KA 2GFHA 3B0UX 3RJPA 1IV8A 4Z6YA 2Y0MA 3E6BA 2R92J 2ZD9A 3S1QJ 5DUIA 1J7KA 4PJMA 4XORA 3NKEA 2P5VA 1VI0A 3LA7A 3NG1A 2XPUA 5KYYB 1D5YA 1IG7A 3L34A 2LKSA 2M4EA 4EM2A 3GW2A 3CC2I 5LHGA 2VASA 2EFOA 5LEKA 3K1IA 5FLVA 4XIDA 2EA2A 2M3AA 5CVUA 1WTYA 1UB9A 2PFBA 2EIJH 3REOA 1S05A 3QYBA 3JR9A 4ZLCA 4XLPF 4A3KJ 3E70C 2HPIA 4IVNA 2UWMA 1T0FA 1F1MA 1OISA 2M7BA 3DEWA 4D4XA 4UDVA 2VQLA 2Q2EA 2VUMJ 4MTDA 4WWCA 4IWBA 2Y3BA 5LRRA 3BR6A 2YL3A 3E9VA 2V1XA 3C7JA 4L5IA 1FIAA 4Y13A 1V5EA 1MBHA 2IS2A 1SC7A 4S04A 2XLMA 1VQ6I 1U6GA 2M0MA 4AL0A 2L7FP 2XKOA 1X58A 1QGPA 2O03A 3HSRA 1CGOA 1T6SA 2Y0SA 4MVZA 2EV0A 5F27A 2UXXA 4QDLA 1G3YA 2KZVA 4IPAA 3GCMA 3IKVA 4M3GA 1VQ5I 3Q3SA 2CUZA 5E8IA 4OIOF 3P9KA 2DYRH 3QPHA 5DQTA 3LWFA 4L9JA 1OR3A 3EH2A 4G7HF 2JA6J 1G3SA 4LLGF 5JS5A 3NMJA 2CH0A 4JOMA 2ZXOA 4CXFA 5HDKA 1D1AA 3K4JA 1TWGJ 2BY3A 4AL1A 4OMYA 2A0BA 3WHCA 3ZQQA 4AIHA 2ECBA 2MWQA 1I6HJ 2JUGA 3DKXA 3O8HA 3WU0A 4A69C 2A69F 3C62A 2LC2A 2K5CA 2FE3A 2A6EF 3OYMA 2F4IA 2QSFX 1EJ9A 2YVKA 4CYCB 3MD2A 1LM3B 1BI3A 3F8FA 1MMNA 5L0HA 4OAZA 3B6AA 2KIFA 4LOCA 2VQCA 3S3NA 4CO8A 4B09A 5CKTA 2EIMH 3W6JB 5FLMJ 1U8RA 2Y2ZA 3F8CA 2H09A 2QY9A 3R61A 3AG1H 3BTJA 1MJ9A 2OKUA 5IT9K 2W82A 3TQNA 1OYIA 4DBRA 5HOOA 2F4MB 1LI7A 3CTAA 3DEEA 5LBQA 3ZP5A 1ON1A 3FXMA 1H7IA 2Q9AA 3WE2A 4YL1A 3L2QA 2BW3B 2XAFA 4FT8A 4I76A 2X0LA 4IQ4A 3L2WA 2QZ8A 3ABMH 3A4CA 5EF6A 2BY2A 5F08A 4AYBA 1Z5ZA 3GZ6A 1IF1A 3NWSA 3K7DA 1IV6A 3JRMO 3HBLA 3MEXA 4CCNA 2LNBA 1T98A 4KICA 3L00A 3U5SA 1ETVA 1P4AA 1Z67A 1QZZA 2LYCA 5GTIC 4WJ0A 1FY7A 1R58A 1XSXA 2WC2A 2IM8A 3FF5A 2OCCC 4IHYA 4ZYAA 4H4KC 4AE4A 2L2OA 5B1BC 4LG0A 5D5UB 4TV7A 4DW6A 5J8CA 2LSEA 3EYYA 1OW7A 4J01A 1FT9A 1YLFA 1ZLKA 2GXAA 2PFDA 3SXKA 4OOIA 3S90A 1TQIA 2RKHA 3S27A 3IH4A 4F93B 1XMXA 4KIBA 2PN6A 3B73A 5COMA 3BWGA 1VQOI 1EKYA 3AG2H 4S05A 2CJJA 1Z3IX 3TO9A 4RM2A 4P9FA 3CCVI 3CEXA 4G6TB 3DM9B 2L5QA 2EV6A 2I8DA 1P7JA 3JRHA 1K61A 3GTGJ 1U5TA 3K1HA 4U5GA 3UMKA 1FX7A 2HZTA 2Z2SB 4YT2A 1YARO 2ZPAA 1W1WE 3MKZA 3CQZJ 5DD4A 5DS6A 2R7DA 1TWCA 3GM3A 1USSA 3DPTA 5J3LA 1HQCA 2CQXA 2R7VA 3VOEA 1WH7A 2VN2A 3OYNA 2EPNA 1VQ9I 3QYFA 2HVSA 4C3IJ 2ZSHB 2CQKA 1EV7A 2VOOA 4RB3C 4YJWA 3C3WA 5F0HA 3CCRI 1Y39A 1E3HA 1OR2A 1LE8A 4UV8A 1MKMA 4BE0A 3ZQFA 1WVRA 3IQ5A 3M8FA 3ZSUA 2X9DA 3IRQA 4BQQA 3V5YA 3ZOBA 4HOBA 4E7IA 1S7EA 2DYSC 2XL6A 4N0BA 3H2VA 4G8XA 3C1DA 3CUQC 1X19A 3L1MA 2EWNA 4HAMA 1RIOH 2LY9A 3BG5A 3IQTA 1P6RA 3BJOA 4HEAJ 1J9IA 3I0TA 3G1MA 1LE4A 3RCOA 4G12A 3MBGA 1GV5A 4PACA 1J75A 2QQ8A 3FOPA 2HMZA 5BOXA 4XPWA 3E5UA 3M1CA 2L54A 2FBKA 1FYKA 1S29A 2CO5A 2HFIA 1KU3A 3S3MA 2DA4A 4AC0A 2YSRA 3E0JB 3AGTA 2E71A 4XOPA 5C44J 3GFMA 1LDDA 5A69A 4UVCA 1I1GA 4R79A 1R22A 1APCA 2CG4A 3CSKA 4JE9A 2MHRA 1IGNA 3V7CA 3LA2A 4U5FE 3V42A 2NSFA 2BY0A 1X3UA 3S1MJ 3CAXA 4ABZA 1R71A 4V2FA 2HWVA 5HV9A 5DYMA 3I5QA 2XL8A 4B8XA 4U9EA 3A03A 1VMAA 2R03A 5F1RA 2KDZA 3BQYA 1FSEA 4J00A 3WU2C 4A0XA 1J5YA 2DAOA 2L7ZA 2VXZA 4ZTJA 3W2AA 3OV8A 2HV6A 2FF4A 4E7JA 4IHSA 1ORSC 3LJBA 3VF0A 3GEIA 4M63A 3NKDA 1P4XA 3I55I 2XRHA 3IQ6A 3HRMA 4I0BA 1Q0MA 2EINC 4I3MA 5D6EA 2MH2A 2JJ7A 2WWYA 1REPC 3BDDA 4Q7CA 1QVXA 3ROUA 3HRSA 1BBYA 1IXSB 2MBFA 2X0CA 3TULA 2M7AA 1FTZA 3GORA 1CPRA 5E79C 5EGOB 1F1ZA 1MNEA 4XNFA 4BE1A 2CDQA 2QLZA 3O8GA 4XEVA 1RPWA 2JPUA 3GTLJ 2F6CA 2XM0A 5E18F 2R7OA 3SHFA 3HOVJ 2Y30A 3A1YA 3ZVRA 1QQIA 2OU6A 2H1KA 3FKJA 3DU6A 1V4AA 3OEOA 2V1DA 2Q00A 1SMYF 4RLFA 3LESA 2QSGX 1RJ9A 2CGEA 4Q5SF 3QVYA 2D5VA 1RMVA 1LUJB 1T08B 2OCCH 3CMAI 3SZRA 2O0YA 1GT0C 3A2KA 4JK1X 4YL3A 5B1BH 5F1JA 1PUFB 2E60A 1KU9A 4EVIA 1JTYA 5FFZA 3DP7A 2GZWA 1KGSA 4AK9A 2E2IJ 3FX3A 2ELKA 3J7AY 5T1DB 3TDZC 1S7OA 2CS3A 3VYWA 3TW7A 5F28E 1YS7A 2M87A 3B6CA 3DBLB 3ZQIA 5C3EJ 2HGCA 3KLNA 1K6OA 1ZRDA 2HVRA 3ABKC 3QW1A 3T6JA 1KQ0A 2BHYA 2EFWA 1B6AA 2ID6A 3EUHA 2ETHA 5CYVA 2HDDA 2PMUA 1GM5A 2DT7B 4HF0A 1X2NA 2XAHA 5DLJA 2IXPA 1NH3A 1IZMA 2WL8A 3JYYA 3SDBA 1KTMA 2LK2A 2WB7A 3ABTA 2MH9A 3AG4C 1WFXA 4M71A 4II2A 2YPRA 1R4NB 3WTUC 1T5OA 1ETYA 1EKEA 1I4ZA 2QBYB 4WGYA 3ZIBA 4DRHB 2DJIA 2V3CC 4Q4ZF 1YW8A 4L9VA 4AIDA 5J8FA 3F21A 5HLIA 1K78B 2XDVA 1PD1A 1XCBA 5L3QA 5DEQA 1TWHA 1R6RA 3RVYA 4FE7A 4IX7A 4E0IA 1GQAA 2J5OA 3BTCA 2F22A 3ABLC 1FNTc 1Z3YA 2W1OA 4LACB 2Q3TA 1GHCA 1MGTA 4KN7X 3DTEA 1H8AC 4XSZF 1WJ5A 1IO2A 3TKYA 4ENJA 4O6NA 5KYUB 3OY9A 2E7WA 4MQVA 2OEXA 3GUDA 4LK1F 2EQRA 4NNJA 1V5FA 4NTAA 1W0TA 2JSCA 3FWEA 3OYJA 1Q0GA 1H9GA 4F4BA 2NNNA 3JRDA 4M73A 1POGA 2LKPA 2JQ7A 2JVHA 2NAZA 3NARA 4YFNF 4IRGA 5K5OA 3JSOA 1HKTA 4U5HA 1W2WA 4EBKA 1ULYA 2DPUA 1ZU4A 2OZUA 1U0BB 3QOPA 4U0VA 1MW7A 3HGGA 4JEAA 1CGME 3AL0C 5BQIA 4MVRA 1YQAA 2ZB9A 1YRNA 2LCHA 1R49A 5KYNA 1ZG3A 2CW0F 3IH3A 1RKTA 2LRDA 3PUBA 1U2WA 1N78A 1ZARA 2IAIA 1FYLA 2HQAA 1UMQA 4F91B 5E17F 4Z9IA 4UB6C 3ISPA 1EF4A 2D1VA 2DA7A 4OAYA 1Z7LA 1UZCA 5BS6A 1MBEA 2HDCA 1XZPA 2BL2A 4Z9JA 1ZU5A 2VBXA 3SDGA 1BA5A 3T6BA 1TQMA 5AIPA 5K7ZA 3FAJA 4N4WA 5DM6F 4BJ5A 4A3DJ 4FISA 4J7TA 4IHXA 3HHHA 3HNIA 5LHHA 3M9AA 2EPLX 1F43A 3KKBA 1YOVB 3PFYA 2QE9A 2DODA 5CQEA 2F5FA 5BQTA 9ANTA 4CS7A 2W4BA 1DOWA 5CI9A 3W4YA 5IY5C 2CW8A 4CH7A 2OQMA 1B59A 2PQ8A 4YRVA 1OKRA 3S2HJ 2ZJPF 1UJ8A 1PDNC 1Y8QB 3CJTB 3WG7H 1ENHA 1B72A 1KYWA 1ZQ3P 5D8KB 2VC9A 4RBNA 3PNTA 4KIFA 5FRNA 1ZHFA 2EINH 2X4HA 4IHVA 3H35A 1WJEA 2HR3A 3NRVA 1M6TA 4KMUX 3AL0B 4MLOA 2P0WA 2K3PA 1E86A 2XC7A 1ZGJA 2EV5A 3KP4A 3DKAA 4W8PA 2ZC2A 2YWAA 4R8HA 3V7RA 4Y17A 3O10A 4N6HA 1W4MA 2EFPA 3GEHA 1OR7A 1R36A 1APLC 1IRFA 1ERDA 5EJCA 2VQHA 3CP8A 1KYZA 3KP7A 2LOOA 2O5RA 5FKLA 2AXTC 5EZHA 1ZR2A 1A41A 4ZJZA 3AOUA 3ZQ7A 3J06A 4FQGA 3FHDA 2IJLA 4JZAA 1BR1A 2JUCA 3JW4A 3SP1A 2YLDA 1SD6A 1DUXC 1LEBA 1SVOA 1FOWA 4RGXA 4WCGA 1WWPA 2HTJA 4JCHA 2OQGA 3HRUA 1U8BA 5HSWA 2LG4A 4MEXF 5T3TA 5TJ5E 2HU9A 2EZLA 1JGGA 2J8WA 2WB1N 4BHBA 2J7PD 1E0EA 4XEKA 4Y4RA 3EFOB 1OCRC 1I6XA 3OIQA 5HNHA 3ABKH 4K1OA 3LL7A 3BR2A 1QZEA 3CP2A 2DJNA 2B0JA 4Y52J 4AVPA 4YT4A 2E5ZA 2ISZA 1LDJA 4LDQA 4ULVA 2IA0A 3NQOA 4DYRA 3QMKA 4LERA 5D4RA 5EGYA 3NYLA 3AG4H 4MFDA 5B3SH 1FZPB 2O6GE 1HSTA 2F5VA 2QF7A 2YS9A 2YX7A 2YR2A 3RH3A 2A68F 3C8GD 5A6BA 3CDLA 4I09A 1ETWA 4MGRA 3ZTMA 1IDYA 1WATA 5ILSA 4Y15A 2UZKA 4WK8F 2HV7A 2AP3A 1VTMP 1IC8A 1I5ZA 2H1LA 1MDMA 2Q1ZB 5AONA 3K1PA 4FX5A 1WKMA 3ABLH 3ERMA 3I4NJ 2HEOA 2IS6A 3TD7A 3U0CA 4E6KG 2HYGD 3OIPA 1WZ2A 1ZK8A 4Y7NJ 3PO3J 4XQ1A 1G6NA 5JRAA 3RQIA 3QP6A 2L7MP 5E3LA 1O7FA 3KZZA 4EMSA 2RQPA 3SQNA 3WTWC 1JRAA 2LQGA 5KYXA 3DLLF 2XM4A 3ML6A 1MBKA 3K6GA 2XGXA 2XHKA 1NU9C 3ULQB 3CF2A 5ICGA 4ZYDA 2DDBA 4HG2A 4KNWA 3H5NA 3QOEA 1XN7A 2F48A 4PJ0C 3K69A 1IN5A 3QODA 3GVAA 2KZGA 3UR3C 4IL6C 4DIQA 1AKHA 2W9YA 4EJWA 2QKMB 3M07A 1VQMI 2XSDC 3CCMI 4BH9A 2L6HA 3JAMZ 2X6OA 2ESHA 4XPYA 3QAHA 3E6MA 5KYYA 4BEHA 4HDUA 4NUBA 1ZG5A 2HXIA 3RKWA 3DCFA 4ON0A 5LGNA 3DFGA 2BBYA 1DGWY 1TL8A 1HC8A 3K1NA 3O6BB 2C6YA 5KAFC 3I5PA 4XWJA 3RKYA 4YT5A 1ZHWA 4A6DA 1XZQA
chains in the Genus database with same CATH topology
3KPHA 2OJED 1R5ID 2ICWG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KPH A;  2OJE D;  1R5I D;  2ICW G; 
#chains in the Genus database with same CATH topology
 2N8G A;  2WAF A;  2LMD A;  4G0H A;  3J81 Z;  1VQN I;  3I4M J;  2HSQ A;  1W7P D;  5KAI C;  3N24 A;  4IOA F;  2WTE A;  2V1N A;  2OEV A;  3U9G A;  3RI4 A;  1R4M B;  3CCE I;  4JEB A;  4L6R A;  1M1E B;  5KVR A;  5IY5 H;  4D0P A;  3G71 I;  2QYO A;  1QQ3 A;  2XF6 A;  1I5N A;  4ZYG A;  5BUO A;  1PJR A;  2P4W A;  2JRT A;  2ZSI B;  3M1E A;  4G6Q A;  1MZB A;  1QHH D;  2MYS A;  3K6B A;  1FTT A;  3ZTZ A;  4IHW A;  4HPQ A;  1TZL A;  1MBG A;  4QPO A;  1SZI A;  3PCV A;  3NMK A;  5BPD A;  4BAY A;  4IKF A;  1OPC A;  1MMS A;  1XGM A;  4HNU A;  3OYF A;  3FVY A;  4YG2 F;  3B9Q A;  5DS5 A;  2KKO A;  1U0J A;  1E84 A;  1A7V A;  1TP4 A;  1D3Y A;  4KBL A;  2GOX B;  2LH9 A;  1R5G A;  2DN0 A;  3U2R A;  2RC4 A;  1SMT A;  2W85 A;  4M9X A;  5JVT A;  5DV5 A;  2R5Y B;  5LGT A;  2NSG A;  2ME6 A;  2G3V A;  1SVM A;  2A05 A;  1R5I D;  1YZA A;  1TLH B;  2OAZ A;  2VT3 A;  1T6U A;  1I39 A;  3LMM A;  1JJ6 C;  2K85 A;  1X1P A;  3BG9 A;  5JSL A;  1M57 C;  3OWT A;  3HOU J;  3GM1 A;  4HF2 A;  2FX0 A;  2RNJ A;  4OWR B;  5E3N A;  2L7K A;  3X1O A;  2O3F A;  4PSX A;  3TP3 A;  2EFQ A;  1FSH A;  2QNL A;  4M6V A;  1IN4 A;  3I58 A;  4JVS A;  3PIP F;  3US6 A;  4PFP A;  2DB4 A;  3DPL C;  3AFH A;  4UUS A;  3OYG A;  2R25 A;  3CCJ I;  1FMV A;  2BYV E;  2ZME A;  4CYC A;  3CC4 I;  1K40 A;  4JKV A;  4OD5 A;  4HV6 A;  2Y3G A;  4II3 A;  3V8L A;  1FTS A;  5FCL A;  4M9S A;  1ZHX A;  4AU7 A;  4FX4 A;  1RKE A;  4EGY A;  1FJL A;  4EKW A;  1OCR H;  3TMO A;  1YJW I;  2KQ9 A;  2LVS A;  2DMU A;  3EQL F;  4L5E A;  1X2M A;  2JMW A;  2YUS A;  3K4L A;  3F8N A;  2GQQ A;  4RAZ A;  2PJR B;  2MA3 A;  1FBU A;  4JX5 A;  1XGO A;  2EPM X;  3JZ0 A;  2LDU A;  4MTG A;  1OQC A;  3O6X A;  5BQG A;  1TFK B;  2FA5 A;  3T1B A;  2BW3 A;  1GXP A;  3BTI A;  1QLE C;  1YJN I;  3GTP J;  3OYI A;  4XRS A;  5C4J J;  3O55 A;  1VQ7 I;  4KJZ A;  4ZTF A;  2DA3 A;  1XC5 A;  5M3F J;  2Y48 A;  4DGW B;  1TQG A;  2BZT A;  2KJB A;  3K4K A;  1XDU A;  4Y3O A;  5L3D A;  1JMW A;  2O61 A;  1GLN A;  1T95 A;  2XAG A;  1YA7 O;  2OU2 A;  2K9N A;  5J4V A;  2IXM A;  2X6Y A;  4LIT A;  2P6S A;  3WOD F;  1EA8 A;  2EZK A;  1E2X A;  5F5F A;  1FOY A;  1W5T A;  2MG4 A;  5CVR A;  1E83 A;  2M4K A;  2XGE A;  2GM4 A;  2A5W A;  2EIL H;  5D6F A;  4BEJ A;  3AGU A;  3EHN A;  2LBF A;  4FAS D;  1Y0N A;  3SNH A;  3U3B A;  3FAP B;  3VYT B;  2XB0 X;  2VE8 A;  1BI0 A;  4CS8 C;  5HS8 A;  5E3M A;  1Y8R B;  2J9W A;  2XLD A;  3U9J A;  1K4S A;  1PYV A;  4UNO A;  3K9T A;  5GAD J;  3AJM A;  2XF5 A;  3FXO A;  3N4M A;  4UV9 A;  1MND A;  1XTA A;  2K4B A;  3PMR A;  1YDI A;  2O7O A;  1EH7 A;  2R7W A;  5HLG A;  3PO2 J;  5ED4 A;  3LEO A;  3G6E I;  4E7H A;  4E7L A;  4XN3 A;  5K5R A;  2JA5 J;  4CYD A;  3VWB A;  1HKS A;  1V54 C;  4U5D E;  1WJB A;  2O8X A;  2H94 A;  2ZCW A;  2E1N A;  3FMR A;  3DTI A;  1Z9C A;  2IVM A;  3DAG A;  5AGF A;  3JRI A;  3P7N A;  2PNO A;  1DQU A;  4AD9 A;  2BE5 F;  2IYL D;  1G8X A;  1OCT C;  1K79 A;  5M5Y J;  2OCE A;  2XB5 A;  1IN7 A;  2GDC A;  3ZMZ A;  2L9V A;  2H6C A;  1JPJ A;  3OR2 C;  2LIG A;  1A04 A;  3ZCO A;  3L0I A;  1VYI A;  2OQR A;  2EB7 A;  5DDG A;  1WHU A;  2DOE A;  2IA2 A;  1I1S A;  4ESJ A;  4U5E E;  1X1C A;  3HKZ N;  3DD7 A;  4QI2 A;  1EI7 A;  5JLI A;  5J40 A;  2P7V B;  5GAH J;  1JTX A;  3HYI A;  3K2Z A;  3EGD B;  1S6L A;  2NVQ J;  2PX3 A;  2YU3 A;  3DV8 A;  4GYG A;  3EZH A;  3X2Q C;  1EQ1 A;  4CUG A;  3H9J A;  4YFK F;  4CS9 C;  4A3J J;  4OIR F;  3P5J A;  3K4C A;  3K4B A;  1R23 A;  3LNM B;  3QPS A;  3SXY A;  4A3F J;  1VB5 A;  2AVK A;  4HFF B;  4A3C J;  4JRZ A;  2W24 A;  1JPN A;  1Z77 A;  5LEJ A;  1BOA A;  4XQF A;  4CJO A;  1QRY A;  2CSO A;  1KA8 A;  3J7A O;  2ZBK A;  1LS4 A;  3EJN A;  4I1O B;  2AS5 F;  2NS0 A;  2ZJ2 A;  4MNU A;  4BQO A;  1YYX A;  5DTD A;  2DQL A;  3I4P A;  1Y6I A;  1LJ9 A;  5L0G A;  3ZQG A;  2OJQ A;  3QYE A;  3COA C;  1FAP B;  3DKY A;  2VQG A;  2W00 A;  3JSP A;  2Q4F A;  2R7T A;  2QUP A;  5DM7 F;  3TK0 A;  1ETK A;  1G3W A;  4ZYH A;  5FD5 A;  3WTT C;  2FUG 2;  3G3Z A;  3L2R A;  2A0U A;  3IWF A;  2KYH A;  5A2Q K;  1YA9 A;  1PD0 A;  3CJN A;  2V9P A;  4D5C A;  1Q0F A;  5L3E A;  1IUF A;  2CRG A;  5CPR B;  2DFE A;  4E70 A;  2BC5 A;  1VQP I;  2ETS A;  3NWT A;  3QPL A;  3W6V A;  1SFE A;  4KMF A;  5K7F A;  2YHS A;  1G59 A;  3LLK A;  5CVJ A;  3CZ6 A;  3OMY A;  3UKG A;  4M3B A;  3RZO J;  4MW3 A;  4QSH A;  5IYD J;  1YZC A;  2WVN A;  1ZHY A;  1VYK A;  3CCS I;  4HRI A;  4HNV A;  1O3U A;  3FXK A;  3ZMV A;  1P4W A;  2KT0 A;  3I53 A;  4FE4 A;  2HJM A;  4YL0 A;  2ADU A;  2DMT A;  3WGG A;  3JCU Q;  2KW3 C;  3JTG A;  2PMZ N;  4EGZ A;  2FBH A;  3LQQ A;  3CF5 F;  2O8K A;  3RF3 A;  1FR0 A;  3TL4 X;  5KYW B;  1ZW2 A;  1W0U A;  1WCM J;  3VRC A;  5EYR A;  1RUO A;  2GWW A;  5EGO A;  2DTZ A;  1JUM A;  1U89 A;  3H0D A;  4HYE A;  4F52 A;  4ONS A;  3TQO A;  1X1A A;  2OA4 A;  1HE9 A;  2KRH A;  1XPX A;  4OIP F;  4CX9 A;  1U9N A;  3FDQ A;  3GZ5 A;  3MZY A;  4PZJ A;  1LS1 A;  1D5V A;  4XRM A;  3FK6 A;  3K1I C;  1TC3 C;  1WI3 A;  2IA1 A;  4EJO A;  2V7F A;  5J1Y A;  2WZL A;  3KCC A;  3ITF A;  2DOA A;  1MQV A;  3SFZ A;  2FBI A;  3I9V 2;  5FKM A;  4BXF A;  1T0F C;  3AQC A;  2IXS A;  4NB5 A;  4ZC3 A;  4HEA 2;  2A07 F;  4E0H A;  1PUF A;  2VC0 A;  3IPM O;  1K04 A;  1SD4 A;  4Z9H A;  1QVU A;  3UMI A;  1LFB A;  1Z05 A;  4O7G A;  4BE2 A;  1QHG A;  1RES A;  2NUP B;  3IEE A;  4YFX F;  4MVS A;  1GVD A;  4A0Y A;  3DAF A;  4BJT A;  3OYL A;  1T33 A;  2EPF A;  2J0X A;  1ORJ A;  2KGO A;  4V2G A;  2ELH A;  3EGX A;  2R05 A;  2BXZ A;  2PBI A;  5EDN A;  2XKP A;  4BYY A;  3RFY A;  5DQZ A;  2STT A;  2FGY A;  4QI0 A;  1X4P A;  5J4Y A;  3ONQ A;  1CF7 A;  3MZH A;  3K1M A;  5FKO A;  1O5H A;  4R32 A;  2K27 A;  4EQQ A;  5D5V B;  1G2H A;  2EPK X;  1JJ8 C;  4RDA A;  3ERE D;  3IHU A;  1V54 H;  4A3M J;  3RQF A;  5FKK A;  1I27 A;  4XIC A;  1MD0 A;  2ZNY A;  3CJQ B;  2V1U A;  2XGC A;  5CVI A;  2I10 A;  5ERI A;  2DA2 A;  2V6E A;  5B3I A;  2WY7 Q;  2JK3 A;  2H7B A;  1DP7 P;  1U9O A;  1RR8 C;  2CQQ A;  3MZ8 A;  4M6X A;  1O57 A;  3B02 A;  4KIS A;  4XLF A;  1M2O A;  2YX4 A;  3I56 I;  2Z3Y A;  2XUB A;  1Q1H A;  2E7X A;  1ZYR F;  2VKD A;  1X3Z B;  1OYW A;  4KIT B;  3I54 A;  1K6Y A;  3EET A;  2RN7 A;  3K0L A;  5FJ8 J;  3RKX A;  4CCL A;  5JI6 A;  3QVZ A;  4F55 A;  1J2X A;  4BDY A;  2XS8 A;  1TWA J;  1ETX A;  1XCV A;  3TJ5 A;  2XGD A;  3EYI A;  4A5M A;  3X2Q H;  2Q0O A;  2D45 A;  3EH1 A;  3HHG A;  2IW5 A;  1ODD A;  3HNK A;  2XS1 A;  4WX9 A;  4LJZ F;  3S28 A;  3KEQ A;  1GUU A;  1SFK A;  1P92 A;  1BOB A;  1FFH A;  1SFU A;  4ZZD A;  1WWX A;  4ESB A;  2J5P A;  3OS1 A;  2ZXP A;  5E20 A;  4C2M J;  5GPA A;  4ENM A;  1LPQ A;  3HRT A;  1OCO C;  5L3C A;  1U6H A;  5DD8 A;  5AC4 A;  4A3B J;  2E1O A;  2QEX I;  2ZXI A;  1KU7 A;  1E85 A;  2K02 A;  2LRE A;  4O6Y A;  5FZT A;  4BL0 B;  3OYE A;  5JHU A;  3MVP A;  2NXN B;  4E7S A;  5LGU A;  1LI5 A;  1T6I A;  3SJM A;  4EBB A;  4C2U A;  3LAY A;  1LVK A;  4KUM A;  5AC5 A;  3EUA A;  1YX5 A;  2LY1 A;  3CUQ B;  2NPU A;  1T01 A;  1VQ4 I;  2IRF G;  4JP0 A;  3IQC A;  3TJ6 A;  3P9I A;  1DP3 A;  3WG7 C;  4D9J A;  4A4A A;  4NDL A;  1SFX A;  2AWY A;  4Z2Y A;  4G94 A;  4G78 A;  5M3M J;  2WVQ A;  3ASN C;  1B8I A;  4GYI A;  3SYN A;  3HTK C;  4EM1 A;  2P5K A;  1YIO A;  4A2U A;  3HPG A;  2FRH A;  2LF7 A;  3CCL I;  3HM5 A;  1T9K A;  1G4W R;  3F3X A;  1H0M A;  2WA0 A;  1PV3 A;  2A61 A;  1QPM A;  4UXN A;  2F2E A;  1MBF A;  4CDY A;  4C30 A;  3JRB A;  3UGP A;  3H65 A;  5FFX A;  3RIR A;  4AVZ A;  4UUV A;  4CSW A;  1UCR A;  3RW0 A;  1Z3X A;  1TWF J;  2X6X A;  1NG6 A;  2QQA A;  2VBW A;  4XOT A;  1U5T C;  3A01 A;  3G4X A;  5BQH A;  5ILV A;  4AYB N;  2VT2 A;  4C7O A;  3RIP A;  4ASN A;  4JBA A;  2XPW A;  2PMH A;  2VPL A;  2X85 A;  1YYJ A;  4O79 A;  2ZFW A;  2XV4 S;  4L0Y B;  3PQK A;  4IF4 A;  3Q5F A;  3OOP A;  3FXJ A;  2UXN A;  4NQW B;  3U21 A;  2R7R A;  3NYM A;  3QTH A;  1IN6 A;  1P9Q C;  4AE4 B;  4LG0 B;  1JKO C;  5C4X J;  3GXO A;  1D0Y A;  1QZX A;  3PQJ A;  2Q9C A;  2OUM A;  2IPQ X;  2Z99 A;  4UVA A;  1FIP A;  3DJN B;  4KYW A;  1B9M A;  2K9S A;  1VND A;  3PSF A;  2ZJR F;  2RSE B;  4XBF A;  2IP2 A;  2R4G A;  4DBQ A;  5FD6 A;  2CFO A;  1YFH A;  2XXA B;  1IRZ A;  3V8J A;  2TMV P;  4U0W A;  1Z23 A;  3F8M A;  1LEA A;  1G4D A;  1HCR A;  2VIX A;  1Q1V A;  3M4B A;  3HSE A;  4KT5 C;  5JT4 A;  4HBL A;  1Z91 A;  3K4N A;  1OLT A;  2MD5 A;  2C03 A;  2VJJ A;  4I1M A;  2L01 A;  5B3S C;  2VCC A;  4WGZ A;  2A6T A;  3OOU A;  4YII A;  1U5T B;  3A02 A;  1LVA A;  1HW2 A;  1FBQ A;  2CWE A;  2PI0 A;  1XB4 A;  4DJ9 A;  3EG9 A;  4PDK A;  2VOP A;  1XMA A;  2M1B A;  3M3Y J;  3PL8 A;  2HQ5 A;  5FLX K;  5HLT A;  1XDS A;  1KQ9 A;  1NG7 A;  1R5H A;  3BPV A;  1J8M F;  1ACI A;  3CMY A;  3F6O A;  2H27 A;  2DFI A;  1UHS A;  1YVI A;  2HSB A;  2G62 A;  2J7P A;  4MW8 A;  5KNL A;  3GFI A;  3QU3 A;  1H89 C;  2L4A A;  3F47 A;  1E3P A;  5LFA A;  3KLO A;  2HOE A;  1LE8 B;  3WG9 A;  4KFC A;  4YN0 B;  1NZE A;  3LOC A;  4MTF A;  3U2M A;  1STZ A;  3K2A A;  4FET A;  4LLC A;  2GIV A;  3E6D A;  2V6C A;  4CCJ A;  4OMZ A;  1A7E A;  3ZN1 A;  3M8J A;  2W45 A;  1RC9 A;  1ETQ A;  2LY2 A;  3HB9 A;  1S5L C;  2K7L A;  1TWG A;  2XL4 A;  1HOM A;  3TGN A;  3N0T A;  3UGO A;  2X6W A;  2DTR A;  2R5Z B;  3C8G A;  3WTZ A;  2JA2 A;  2KIM A;  2RDP A;  3DXJ F;  3IV5 A;  4HQE A;  5IT9 Z;  1WH5 A;  2GAQ A;  4YIF A;  4RBO A;  2KRF A;  3E3V A;  3LSI A;  2KFD A;  3DU5 A;  1AHD P;  4M72 A;  4MQ9 F;  4AM3 A;  4DRJ B;  3NEU A;  3BY6 A;  2GAU A;  4RA2 A;  1V5G A;  2Z5U A;  4JW1 A;  4XMY A;  2OPT A;  1D8K A;  3WTS C;  3M1C B;  4U5B E;  1OCO H;  2EA4 A;  2OV7 A;  2CW7 A;  1VK5 A;  2KPM A;  3WHB A;  4ETS A;  3MMY B;  3B29 A;  4YK5 A;  3LFK A;  3GME A;  3KH2 A;  4JQF A;  3LSM A;  2CNW D;  2YEV A;  4BU2 A;  5EHH A;  3DWW A;  3NDB B;  1MH4 A;  4CZZ A;  2L02 A;  5DCM B;  3SFI A;  5IYC J;  3LQR A;  1B1B A;  1XGN A;  1ZN2 A;  3J80 K;  3D5L A;  3GZN B;  1PP7 U;  2WVO A;  2GWR A;  2Z15 A;  4H54 A;  4XEF A;  2V26 A;  2Q8K A;  4B47 A;  4HX8 A;  3VAY A;  3T6G B;  3K66 A;  1FYM A;  4L9N A;  2OJE D;  5L3G A;  5CVV A;  2JTV A;  2YQY A;  3F6V A;  3ASN H;  3HG9 A;  2COM A;  2FXA A;  4AUX A;  4E4H A;  4L18 B;  1ZHT A;  1HE1 A;  2HKV A;  2R7Q A;  1WGX A;  5E3O A;  1HMD A;  2BXY A;  1FOX A;  4O6J A;  2VPR A;  1UG7 A;  3EUH C;  2OTJ I;  2M34 A;  1EH8 A;  3PUF A;  2KK1 A;  2MD0 A;  4EV0 A;  3WTX C;  4PJN A;  4BBR J;  4D1Q A;  5GTH C;  1W36 C;  4V19 K;  3G4Z A;  2MAB A;  1C02 A;  2H7O A;  2DA5 A;  2XAQ A;  1LKX A;  3OA1 A;  1GVJ A;  4DYQ A;  1HMO A;  4IJJ A;  3SXM A;  3RSN A;  1W7P A;  1T2K A;  3KX2 A;  4LGW A;  1Y0U A;  3GTO J;  4FCY A;  2EPO A;  2YL7 A;  3BRO A;  4QIW N;  3MYI A;  5FRO A;  5B1A C;  1Z7Q c;  1UHM A;  1RET A;  2KLO A;  4ITV A;  2R5Y A;  1ON2 A;  3I64 A;  3M15 A;  2CGP A;  4GEH A;  2XAS A;  4AX2 A;  2OOC A;  2F4O B;  1MSE C;  3JRG A;  3HNJ A;  2E1C A;  2P0N A;  4LB5 A;  2LP4 A;  2CU7 A;  5IP7 J;  1Y56 A;  3CQZ A;  1QNT A;  5D5X B;  3TOL A;  2Y69 C;  3E5Q A;  4NBQ A;  3ZMU A;  3RYL A;  5H20 A;  1RNL A;  1A0B A;  5ICF A;  2ZXJ A;  5DCF A;  4BNC A;  3I59 B;  4O3M A;  3L8I A;  2WAQ N;  2R93 J;  1ZGW A;  3DQV C;  4DRI B;  1QSP A;  3QQA A;  4Q47 A;  3C18 A;  5L3F A;  3Q0U A;  3W2V A;  4WXH A;  4KN4 X;  4XRS G;  3U1K A;  1BR2 A;  3WHN A;  1FC3 A;  2RRE A;  5EG0 B;  1ZRF A;  1Y4C A;  1T6Q A;  1T56 A;  1OCZ C;  3KYJ A;  2ZXW C;  2UV1 A;  2K3F A;  4RGS A;  3G1L A;  1DU0 A;  3C63 A;  4IB4 A;  2M0C A;  3HIF A;  3H9Q A;  1BW6 A;  4IEJ A;  1FEX A;  3ZG1 A;  3FXL A;  1TR2 A;  3IWZ A;  1WGW A;  4LIU A;  2LTP A;  4WXC A;  4B6I A;  4PUS A;  4I01 A;  2EIL C;  2LLK A;  4CSA C;  3GBG A;  3HDD A;  1X1B A;  2X1D A;  3RPQ A;  2QQ9 A;  2M45 A;  3ZQC A;  2L81 A;  3H1C A;  3HUG A;  3V8K A;  3GOD A;  1EH6 A;  3KZI C;  1VFC A;  4B44 A;  3BG6 A;  4FTH A;  4I7H A;  2Z9O A;  3FBI B;  1F5T A;  2PF4 E;  2RAE A;  1A6I A;  2XAJ A;  3W8H A;  3TOB A;  2HYF A;  2BEO A;  5LHI A;  3GF2 A;  4CIH A;  2H7V C;  1ZLJ A;  4A6E A;  1YHQ I;  1UG0 A;  5HOD A;  2GA0 A;  2M4G A;  2XRO A;  4C3D A;  3TBI A;  2NUT B;  2HFH A;  2AO9 A;  5GPG B;  3FXQ A;  2IGM A;  3I3L A;  2ZKZ A;  2L3D A;  3G2B A;  1RKW A;  2H8R A;  4NHJ A;  3Q6M A;  3ZMD A;  4UVB A;  4HE8 D;  1MNM C;  3ECH A;  2HKX A;  1QZY A;  3GFL A;  3Q0V A;  4ANJ A;  1C0W A;  2IS1 A;  4FWV A;  1FBS A;  3C2B A;  3ZPL A;  3JCU C;  2L9R A;  1OMI A;  3G73 A;  1YRN B;  3ZGK A;  2DA1 A;  3VEP A;  4NTF A;  2IGK A;  4AIK A;  2KMU A;  1BM9 A;  3PM1 A;  2QTV A;  2HJ3 A;  3IL2 A;  5TJJ A;  2Q7R A;  2RV8 A;  1OR7 C;  3CMM A;  4RGR A;  2ZJQ F;  1NLX A;  4ZYE A;  1KQ8 A;  2J46 A;  1M2V B;  2K40 A;  2DW4 A;  2F5D A;  5IP6 A;  4I2O A;  3S1R J;  3ATP A;  2W25 A;  3L2C A;  3HTU A;  1SD7 A;  1MJB A;  1HY5 A;  1ZZP A;  2KIS A;  1QU3 A;  4D7M A;  3HTS B;  2AQE A;  3S1N J;  1OCP A;  1TWC J;  1F4K A;  1AWC A;  3M4C A;  3WTV C;  1ZH5 A;  1MMD A;  3HC7 A;  2ELJ A;  1R1T A;  1A31 A;  1X3W B;  2BHZ A;  3JRE A;  1RUN A;  2M5W A;  1UAA A;  4J30 B;  3HKZ A;  4DXW A;  3LSH A;  4N9I A;  1VLT A;  1Z0X A;  5L0F A;  2QWW A;  3B0V C;  1B72 B;  3S2D J;  3HL2 A;  3EGD A;  1LDK B;  1WJD A;  2ZNZ A;  1ZEL A;  4BDZ A;  3A9C A;  5M5X J;  1SAX A;  2LFD A;  4ZH4 F;  3LS1 A;  4GFB A;  1P2F A;  3LSK A;  2EIK C;  2JPC A;  3R60 A;  1TQP A;  1S7A A;  4K0D A;  2K86 A;  5K0I A;  3ZRG A;  4ZLD A;  3VSK A;  2VKH A;  3FHZ A;  3N05 A;  2IGN A;  3V7S A;  1IN8 A;  1U78 A;  5B1A H;  4IOC F;  2VI6 A;  4XL9 A;  4PCQ A;  3S84 A;  1D0X A;  4LFU A;  3WE3 A;  4C3E A;  1MMA A;  2PJP A;  3GX4 X;  3DF8 A;  3KP3 A;  1ZTR A;  3AQB A;  3HOY J;  1ZGA A;  1LIH A;  5D5W B;  5BPI A;  3C8Z A;  1JHH A;  5TGT A;  2D2W A;  1QO0 D;  3HZJ A;  2LD6 A;  2M64 A;  1AA7 A;  1B68 A;  2Y69 H;  4A3I J;  2R02 A;  2R0Q C;  3SEO A;  4CIP A;  2DDA A;  1JR8 A;  4C3J J;  3K10 A;  1YS6 A;  4K7B A;  2VBY A;  3BR5 A;  3GTJ J;  3E97 A;  2IXN A;  4NCQ A;  2A6H F;  4YEL A;  2HZD A;  4YWQ A;  1HW1 A;  4PJL A;  5EEH A;  4I02 A;  1B9N A;  3SEQ A;  3ZC4 A;  3B71 A;  1OKK D;  3VPR A;  4PK4 A;  4IRI A;  3RZD J;  3DBR B;  4LDK A;  2M9H A;  2WBM A;  2L9J A;  1OCZ H;  1I4Y A;  2DPD A;  2ZXW H;  2YZS A;  4JTA B;  4KI2 A;  2EFN A;  4HW0 A;  4BXU A;  3ZWI A;  2ZFU A;  2PMZ A;  1VQL I;  4XKV A;  5IP9 J;  3E7L A;  4D7N A;  2XRL A;  4XKB A;  4HST A;  1ZR4 A;  1ZRE A;  5HDN A;  4IZZ A;  2FD5 A;  2IT0 A;  4BBS J;  1E17 A;  5FRM A;  3R2P A;  5E2Q A;  3K4M A;  5KYW A;  4CCK A;  5B5E C;  2WV1 A;  3F0C A;  3M8E A;  3R0J A;  2DI3 A;  4WAB A;  2P8T A;  3A11 A;  2OC6 A;  2J9U A;  4HA8 A;  3ZXS A;  3BOQ A;  1FLI A;  3FMQ A;  1FPQ A;  2HQR A;  5J6X A;  1MDM B;  3ASO C;  2D1H A;  1TNT A;  5J1U A;  1VTN C;  1A6Q A;  2G0E A;  2J45 A;  3AKZ A;  3KFW X;  1HF0 A;  3M7G A;  4IAO A;  3IP4 B;  3HOS A;  4N4N B;  1Z1D A;  3EZI A;  1LFP A;  3LAP A;  1KON A;  1JXS A;  2M2E A;  3E1S A;  3H3Z A;  4O6M A;  3LA3 A;  2R7F A;  2BY1 A;  2ACJ A;  3H5R A;  4EJV A;  5JVG F;  3LFU A;  4Y33 A;  1TW3 A;  4G9Y A;  4ZZL A;  5HS7 A;  2LSO A;  2P81 A;  2KSF A;  2FML A;  2QVO A;  2X1E A;  2XRN A;  4N6C A;  2B63 J;  5L3V A;  3RVZ A;  1C17 M;  1YG2 A;  5HLH A;  5M5W J;  3ECO A;  2E19 A;  2KJC A;  1HW5 A;  4XKW A;  2HKO A;  5EEA A;  2FOW A;  3RYP A;  1F9N A;  2LR8 A;  5E3C A;  3CUO A;  2HUJ A;  4NC3 A;  5T3W A;  3DBH B;  3SZT A;  4M9Z A;  5E1X A;  4BEH B;  2MC3 A;  1PP8 F;  3BRJ A;  3RPU D;  3EHM A;  4OD4 A;  1QVT A;  3O3K A;  2HOA A;  2PX9 A;  4ESF A;  1Q0K A;  4BG0 A;  3S0X A;  1WRJ A;  1MSF C;  3FM5 A;  1WQ2 A;  4NTB A;  4XLA A;  4BY1 J;  2DMQ A;  4KA4 A;  4M6Y A;  5KK1 A;  2R9R B;  2PP4 A;  1YJ9 I;  4LLL A;  1BJA A;  1MJA A;  3S3O A;  4HFK B;  1NHA A;  4I99 C;  4LIV A;  2XLE A;  3CLQ A;  3HGY A;  3LS0 A;  1SYQ A;  4XLH A;  6PAX A;  4ZDL A;  4ENK A;  5GP9 A;  2HTS A;  2H8A A;  2J9B A;  4IXA A;  2AXL A;  2XSE A;  4DQ2 A;  3T9O A;  3NMI A;  1S7Z A;  2FNP A;  2F5C A;  2OBP A;  3I5U A;  1GXQ A;  1KZH A;  4W8K A;  2V79 A;  2ZME C;  4XLC A;  1BL0 A;  2VH3 A;  1TWH J;  1XD7 A;  3CO7 C;  4CCO A;  2PLY A;  1UFM A;  2CYD A;  2P5L C;  4A0Z A;  4RB2 C;  4L5J A;  5LD2 C;  1FP1 D;  4I0A A;  3I71 A;  4UUT A;  2JX0 A;  3U9M A;  4IRH A;  3HOX J;  1W5C C;  4XKC A;  3S93 A;  3CCQ I;  3FIW A;  1VQK I;  2CUJ A;  1QPI A;  1VZ0 A;  2JVG A;  2EIK H;  2LF8 A;  2XLO A;  4P9T A;  1Z63 A;  2GXG A;  3C2G A;  3RKO F;  2OZ6 A;  4C3B A;  1R9T J;  3SZP A;  4YEJ A;  5E1Z B;  4XLE A;  3IKT A;  1YAU O;  3MKW B;  3POV A;  5GAE J;  2FMY A;  1Z6A A;  4XM3 A;  4YT8 A;  1N1C A;  3CUQ A;  2VCA A;  3KP5 A;  2LKX A;  2QEN A;  4GYT A;  4EUK B;  1WI9 A;  1YE9 A;  3IRR A;  1S9H A;  4UUS B;  5IYB J;  2WAE A;  2FEZ A;  5LLQ A;  2DK8 A;  5JHF A;  3RTR A;  1TBX A;  2W7N A;  2ZME B;  3KZY A;  1A5J A;  4B3X A;  1J8Y F;  1A36 A;  1S8N A;  4BJ6 C;  1ITY A;  2CCY A;  2DOF A;  1V3F A;  3MYF A;  1XSV A;  1DU6 A;  4A12 A;  3JTL O;  1SD5 A;  5JFR A;  1RKE B;  3DZA A;  1ZG1 A;  3O39 A;  3S29 A;  2P6V A;  2P61 A;  3OYH A;  1X1D A;  1SFO J;  3AG3 C;  4M3E A;  3SYT A;  2VC1 A;  1WSU A;  4XSX F;  3H2U A;  2NRA C;  5DS9 A;  2Y3D A;  4RDU A;  4I44 A;  4NC7 A;  4HLX A;  3ZR8 X;  3MFN A;  2LD5 A;  2YL0 A;  2E5N A;  3TP0 A;  2KRC A;  3BJ6 A;  1L7C A;  3JYH A;  3BT9 A;  2IBD A;  3BZC A;  3LNQ A;  3HXL A;  4G7O F;  1BBH A;  1G3T A;  5GAG J;  2ZO4 A;  2O9L A;  2VOD A;  4J32 B;  1A35 A;  4MTE A;  2KC3 A;  3GTQ J;  3QW0 A;  2MC4 A;  1GDT A;  3DI5 A;  4KT6 A;  2DT5 A;  4D4N A;  3WU1 B;  3TOA A;  4HNT A;  1I50 J;  3MCZ A;  4XPX A;  2L9N A;  3ZN0 A;  1UHW A;  4M74 A;  4EBJ A;  1YW7 A;  4NQW A;  2HS5 A;  4OIN F;  4JTD B;  3V5Z A;  2KL4 A;  3BCB A;  3ASO H;  3W6K B;  2QA4 I;  2NVY J;  2JN6 A;  2LBF B;  4ZDP A;  2VJ4 A;  1MMG A;  2DFF A;  2Y31 A;  3K33 A;  2NYX A;  4RM3 A;  4MHG A;  1JHF A;  3P9C A;  2PG4 A;  2HPM A;  4FES A;  4A2N B;  3KP6 A;  2L6F A;  2HOS A;  5L0C A;  4QLC U;  2BVM A;  2E2H J;  2XXA A;  3KEO A;  4P5O A;  3S15 J;  3FM3 A;  5K7H A;  3KYI A;  4A3G J;  4LLE A;  1DPR A;  4GQH A;  1AOY A;  3CES A;  4GO1 A;  5JLW A;  1K05 A;  2HZ8 A;  2BGC A;  2QKL B;  4F7Z A;  4XON A;  3FKI J;  4N4O B;  3H3V K;  1FMW A;  2E35 A;  3DPU A;  5A6A A;  2OTL I;  4O5V A;  4P96 A;  4J19 A;  1WJC A;  2XF7 A;  3G4S I;  4LK0 F;  2QBY A;  3F22 A;  1TT5 B;  4U7B A;  3CJR B;  1AUE A;  4OU0 A;  1SVL A;  3TED A;  1OXB A;  3V7O A;  1BZ4 A;  3KE2 A;  5HS9 A;  1JT0 A;  2Z33 A;  2Q2E B;  5F0F A;  1K78 A;  2I5U A;  2DXI A;  5IT3 A;  4U5C E;  1HXD A;  2JD3 A;  2NVU B;  2VJ5 A;  3DKW A;  3ZMT A;  3RQ4 A;  3MKY B;  4BHP A;  3CC7 I;  4LLN A;  3BLY A;  1T39 A;  3QWL A;  3V5X A;  1ZW3 A;  5TRD A;  3DEU A;  3BP8 A;  3ABU A;  2MFZ A;  2W48 A;  1YIJ I;  5H2F C;  4GGG A;  4CHU A;  5KYU A;  2VKE A;  2XIG A;  2GOM A;  2ME0 A;  2AU5 A;  4E7K A;  1H9T A;  3JSE O;  1FOK A;  2FAP B;  4B4C A;  2TCT A;  3MAJ A;  3O2P E;  4LB6 B;  1ZHZ A;  1BI1 A;  2Y0S N;  2EK5 A;  1AVO B;  2PBE A;  4RAG A;  1CQT A;  3GEE A;  2E2J J;  2HXO A;  2WZG A;  3IC7 A;  5ILU A;  4P55 A;  5JP7 A;  3HOW J;  4MIM A;  3HJC A;  3N2Z B;  1YLM A;  3FZV A;  1RR7 A;  2R5Z A;  1TTY A;  3AAF A;  5H6R A;  4RAY A;  1O87 A;  2DU9 A;  4HX7 A;  2TDX A;  4E7Z A;  4A3L J;  3DWL E;  1BI2 A;  4RB0 A;  3ZQV A;  4A93 J;  3W8I A;  1H6G A;  3D0S A;  2L0K A;  3A0H C;  2YRF A;  5EEG A;  4CJG A;  3TO6 A;  1K7A A;  2JRM A;  5FGM A;  3LEV A;  4JIO A;  4PJJ A;  3OYA A;  1IDZ A;  1YO5 C;  5A6K A;  1IRX A;  3FXH A;  1NG1 A;  1N75 A;  3FIS A;  3CCU I;  5CIV A;  4EJU A;  2VB6 A;  1IJW C;  1ZRC A;  5DCM A;  3GTM J;  2VE9 A;  3OIO A;  3Q0W A;  3W3C A;  3OR1 C;  3TDU C;  2V9K A;  1XX5 A;  1A7D A;  3BEH A;  2FQ3 A;  2FU4 A;  2HVQ A;  4IRU A;  1RKC A;  3I4U A;  3WGH A;  1SEU A;  2W57 A;  5FKN A;  3OS2 A;  2BVL A;  3BR3 A;  3PNV A;  2B0H A;  3LUT B;  4DNC A;  5D4S A;  3QZC A;  4CDV A;  4A3E J;  3TOM A;  2ECC A;  2ZXH A;  2AQF A;  4IJA A;  4ZDO A;  2NG1 A;  1JKR C;  2EBI A;  4RLQ A;  2XSJ C;  3T8T A;  5COF A;  4MEY F;  1YW9 A;  2NOJ B;  2TRT A;  2CNW A;  3JT1 A;  1NU7 D;  3EPV A;  3FXR A;  4U88 A;  1J0R A;  4L9T A;  2VKV A;  4UY8 I;  2MLG A;  4J7Y A;  3OS0 A;  4NY3 A;  3AG3 H;  4HSR A;  2D5R B;  3JAM K;  2L4M A;  4RMN A;  1ST6 A;  2GIZ A;  1NFN A;  1UFB A;  5BMZ A;  1CGP A;  3UNG C;  5J47 A;  2I8B A;  3DMD A;  4HX4 A;  1BC8 C;  1OCC C;  3OL3 A;  1LPE A;  3DJU B;  2CYY A;  2X48 A;  3NRH A;  3S17 J;  2OG2 A;  4DVZ A;  5TIS C;  2HDW A;  4WF2 A;  4MND A;  4DVY P;  4PFO A;  2H6B A;  3J81 K;  2ZXR A;  1WPK A;  2K9M A;  3OSF A;  4I6Z A;  3L1P A;  3K70 C;  1D8J A;  1RCP A;  1N77 A;  1XWJ A;  4RGU A;  4BHC A;  3U8P A;  5FB2 A;  3D5S C;  4ENN A;  2LK4 A;  2YKZ A;  3ZDL A;  4M3F A;  2EH3 A;  2WB1 A;  2JWT A;  3BJA A;  3ZMS A;  3HOT A;  1C03 A;  2JPB A;  1QPU A;  3LSP A;  3EFO A;  5D92 A;  4HV5 A;  1PVE A;  2V9V A;  2WAQ A;  2L7A A;  2B7E A;  3I59 A;  2J0W A;  4N06 A;  1HSJ A;  2BOL A;  5IOZ A;  1MIJ A;  2AWC A;  3F23 A;  4GRI A;  1O4X A;  1R00 A;  3QU6 A;  4CBE A;  2UUH A;  3EGX B;  4HQM A;  5E33 A;  4XRF A;  2W4S A;  5K5Q A;  4XN0 A;  3K70 D;  5EG0 A;  2P7C B;  2PX0 A;  3F9K A;  4BS9 A;  2IBF A;  3CO6 C;  1RZ4 A;  1CF7 B;  3JSZ A;  3JTH A;  1FFT C;  1YYV A;  1HA8 A;  1KNY A;  4JYK A;  3CD6 I;  3EPZ A;  1ETO A;  2RQQ A;  3VYU B;  3KP2 A;  4XLN F;  2VBZ A;  3A0B C;  2NVT J;  3L8J A;  3VYR B;  4GDF A;  1HKQ A;  1YJG A;  4JX4 A;  2A5Y B;  1SR2 A;  4DJA A;  3LNR A;  2DLL A;  3BTL A;  4DYC A;  3CCY A;  4IAQ A;  2KQR A;  5EK0 A;  3JRT A;  1Y6D A;  1BW5 A;  3HJE A;  4PGG A;  1OW8 A;  4LG3 A;  3VFZ A;  2XLV A;  3F8B A;  5A2Q Z;  2ISY A;  3Q9S A;  4U87 A;  4U0Y A;  3HEF A;  5COG A;  2KIU A;  1IXR C;  2MGQ A;  2K9Q A;  2X51 A;  3G50 A;  3KEY A;  2E34 A;  1NK2 P;  3PDM P;  3F72 A;  5L0J A;  1JOG A;  2FQ4 A;  1BIA A;  1Y1V J;  4MVO A;  4XR6 A;  3R0A A;  5IOY A;  2DO7 A;  3DE9 A;  2IEK A;  4BQA A;  1T38 A;  4HF1 A;  3CLO A;  3GWN A;  2MSY A;  3W2W A;  3GTK J;  2NUT A;  2DYS H;  1S3J A;  1IUY A;  2FOK A;  2G9W A;  4R1H A;  3BG3 A;  5IPA A;  1JUS A;  3LSG A;  2CUF A;  5CQG A;  1YI2 I;  3BPX A;  3PHF 2;  3HOZ J;  3CDI A;  3ZQL A;  2WZF A;  1ONV A;  3U2L A;  1J09 A;  4UB8 C;  2P6T A;  1DDN A;  5HNF A;  1D1B A;  3BG7 A;  2FJ1 A;  2JT1 A;  4F3Q A;  3PJR A;  3FK7 A;  4U9D A;  1ORY A;  1N25 A;  4NC8 A;  2VLA A;  1QKR A;  3ZQY A;  1IW7 F;  1FNN A;  1XSD A;  2QLA A;  3BZK A;  1U3E M;  5DS4 A;  4CSA A;  3Q9V A;  1FP2 A;  4U7D A;  2JA7 J;  1WOL A;  2JSP A;  2V4J C;  2CV1 A;  1O3S A;  3OYC A;  1YTY A;  2NS8 A;  2AHQ A;  1M2V A;  1FWZ A;  4FAP B;  3BZ6 A;  4RD9 A;  1DGR M;  2B9S A;  2DT6 A;  4N9H A;  5F04 A;  1B8I B;  3KMI A;  2Y75 A;  3RKQ A;  3B0P A;  1QBJ A;  1UG2 A;  2DFH A;  4X0G A;  1Y1W J;  2XLW A;  3MQ0 A;  2D4U A;  3M79 A;  4E17 A;  1O7L A;  1Z7U A;  3J7Z I;  1WAS A;  3Q7L A;  1GGQ A;  2WY8 Q;  1BIB A;  4EEF G;  1XS9 A;  1IAW A;  1DPU A;  2X1C A;  2XPV A;  3ZQH A;  3KYL A;  4P6I C;  5JUA A;  1X4O A;  2M30 A;  4EIY A;  5F6F A;  3ELK A;  4BAC A;  3RYR A;  2ID3 A;  1JUP A;  4CZC A;  1UST A;  2L9S A;  3A01 B;  5A6J A;  4MTO A;  3CME I;  1IRG A;  4RAF A;  4X1E A;  4C7O B;  1JKP C;  1BC7 C;  2DMP A;  1RJ9 B;  5BNG A;  1B4A A;  1MBJ A;  2R3S A;  1S72 I;  2DGJ A;  4DZP A;  3L2V A;  2R7X A;  1AU7 A;  2O9X A;  4IGG A;  1SAU A;  3KL4 A;  4HDV A;  4M3D A;  3HNL A;  2E36 A;  3MFK A;  3U8V A;  4DOZ A;  2HNH A;  2ICW G;  1W36 D;  2KHM A;  2KNH A;  1OCC H;  3S14 J;  2GLO A;  2XVC A;  1HDP A;  3WAQ A;  4MS2 A;  3MWM A;  3BR0 A;  4NQF A;  2QGU A;  2HOT A;  5H6Q A;  2CV0 A;  3D5R C;  4QWQ A;  1L3L A;  3GM2 A;  3U1D A;  3HSF A;  1SAN A;  4CA0 A;  2HYJ A;  1LB2 A;  2GBY A;  2M8G X;  4B1R A;  1HLV A;  3IAM 2;  1NBB A;  3SXZ A;  4JCZ A;  2VL8 A;  2R7Z J;  1G4U S;  3LAJ A;  1D1C A;  3ECS A;  3S2W A;  2GXB A;  3Q6N A;  3LSR A;  4ULW A;  3L09 A;  2DQR A;  2DBB A;  5K1Y A;  1K4T A;  1TNS A;  2LFB A;  3WGI A;  2DA6 A;  2L6G A;  2ASR A;  3FOO A;  5CI8 A;  1Z6R A;  3GWL A;  3H3U A;  4F92 B;  3PIO F;  1ZAO A;  2PJR A;  4X6A J;  2EJR A;  3OYB A;  5ICE A;  1J59 A;  4CGZ A;  5E3A A;  3JRC A;  4FX0 A;  3EG9 B;  1V4R A;  2KP6 A;  1F36 A;  3GEZ A;  3GLL A;  3HPH A;  3MKL A;  1OQY A;  2GA1 A;  1TFO B;  2YLG A;  3PNY A;  3F46 A;  3FMS A;  4GXO A;  2HMQ A;  3DE8 A;  3S32 A;  3OYK A;  1V55 C;  1WN0 A;  1TWA A;  2XAU A;  5KCM A;  2CQN A;  256B A;  4XK4 A;  3G1O A;  3GWZ A;  5ICC A;  5EZG A;  1O3Q A;  1NTC A;  3VSL A;  4BXX J;  1DOV A;  1R1U A;  4K2E A;  4C9Y A;  4BJ5 C;  3U3F A;  1BR4 A;  3NAU A;  2OF7 A;  4NC6 A;  3S8P A;  4B48 A;  3V4G A;  3GYH X;  4MVQ A;  1GS9 A;  5L3B A;  3IAS 2;  3IUO A;  4EWC A;  1OKK A;  3FXU A;  4LD5 A;  2CQ7 A;  4G7Z F;  5L0D A;  1ZVZ A;  4W1U A;  4BQN A;  4IAR A;  3DTK A;  4BUP A;  1XMK A;  2K4J A;  4C2T A;  1K83 J;  5E8G A;  2EZI A;  1TW2 A;  2H8W A;  3T5X A;  1T8I A;  4QTR A;  2CFX A;  3R4K A;  3NYJ A;  2BV6 A;  2J9V A;  3KYD B;  1Z6T A;  3H0G J;  4DZJ A;  3Q7G A;  4JTC B;  3OL4 A;  2P1A A;  4JUR I;  5D91 A;  2HQN A;  5F0C A;  1E3O C;  3GLX A;  3CDH A;  3C8G B;  4XTK A;  5FO5 A;  4IQJ A;  3FBN B;  1CPQ A;  2F5E A;  3M4O J;  4KNY A;  1P7I A;  2MW8 A;  3GO5 A;  2QUF A;  3VYS B;  1OYY A;  1LFU P;  1JI8 A;  2YLI A;  1O3T A;  1W5S A;  3R6S A;  2COB A;  1R7J A;  3KPH A;  2YU9 J;  3MLG A;  1R1V A;  4BGD A;  5F5H A;  2LP0 A;  4QPQ A;  4BJ1 A;  1RI7 A;  2FFH A;  2KIQ A;  2CV2 A;  5AIQ A;  4HLY A;  2IS4 A;  2NS7 A;  2QQB A;  2NNY A;  4B43 A;  1BJZ A;  4EJT A;  1YX3 A;  2EIJ C;  3QP5 A;  2E1M C;  3EDP A;  3SEZ A;  3L2U A;  2CUE A;  3S9O A;  1SF8 A;  1XG1 A;  1OW6 A;  3MN2 A;  3H36 A;  3VB2 A;  3MX3 A;  1V74 B;  2QM3 A;  3R7C A;  4CCM A;  4EAT A;  4I98 B;  2M8E A;  1TT0 A;  3T4R A;  2LFF A;  2GA2 A;  2Z1D A;  4PGH A;  4EHP A;  3RDI A;  3UMH A;  3VM6 A;  5LRS A;  4ER9 A;  1OXK A;  5JVE A;  4P9U A;  4OIQ F;  4AWX B;  4CS8 A;  4B3A A;  2QCO A;  5HVQ C;  3N97 A;  3LST A;  2IOQ A;  4JJG A;  5JLX A;  4JC7 A;  4WXD A;  4D5F A;  2P7V A;  4HZF A;  3PSI A;  4CDG A;  3DLA A;  4P1W A;  4FHT A;  3WTY C;  4L0Z B;  5DUK A;  1LE2 A;  1NSG B;  1OFC X;  2DMN A;  3RPU A;  3L7W A;  1JE8 A;  3BQZ A;  1LQ1 A;  1RRJ A;  5JR3 A;  1O3R A;  1HBX G;  2A3S A;  2DYR C;  1LNW A;  4A5N A;  4LMY A;  5DVW A;  2RVC A;  1JAF A;  2W4M A;  1I3A A;  5E1W A;  4CIC A;  3SZG A;  3QRF F;  1H88 C;  3EUK L;  3FDY A;  2KDO A;  3OYD A;  2E1M B;  2NOG A;  3J7Y J;  3HKK A;  1R4T A;  2MLK A;  5J1R A;  4BPM A;  2RGV A;  1W7P B;  3H92 A;  2G7U A;  5FLX Z;  3DM5 A;  3JRA A;  3BR1 A;  3ESW B;  3BC8 A;  1G5Z A;  1JGS A;  2WAD A;  1VLS A;  3PFI A;  3S16 J;  3VDX A;  4JJF A;  4CDA A;  4KC9 A;  1IXC A;  2CMP A;  5GPC A;  4AIJ A;  1RXQ A;  1PCX A;  2UUZ A;  3K7A J;  4KNV A;  2R7U A;  1I3Q J;  5L0I A;  4BY7 J;  3OSG A;  3FHN A;  4UHT A;  1KU2 A;  3QPT A;  3KYC B;  2VCB A;  3GAN A;  1L0O C;  3H5A A;  2Z16 A;  2W84 A;  3T8R A;  1CGN A;  3L9F A;  1L3P A;  3LSJ A;  2E87 A;  2EIM C;  3HLZ A;  2G7H A;  3TW6 A;  2OD5 A;  4RS8 A;  3AG1 C;  2K9L A;  4CS9 A;  1YIT I;  1D0Z A;  1WJF A;  3E5X A;  2FNA A;  5A6B D;  2HI3 A;  1ZKG A;  2STW A;  1AEP A;  1BDJ B;  2NVX J;  2VJI A;  1M56 C;  2VXD A;  4MFE A;  1PUE E;  2PEX A;  3IH2 A;  2JA8 J;  2I15 A;  2ESN A;  2RNG A;  2VON A;  1JKQ C;  3ABM C;  4H0E A;  2EZH A;  4X0R A;  3RQG A;  4IHT A;  3C2H A;  2Y3H A;  4BKX A;  4YIR X;  2KJG A;  4MVM A;  1MH3 A;  1VF9 A;  3KET A;  1ORK A;  1XGS A;  4PR9 A;  4E18 A;  4G6D A;  1WJA A;  2DCE A;  4MVU A;  3KIO A;  4BEM J;  2XLH A;  3TO7 A;  3VOD A;  2QSH X;  4IO9 F;  4KDP A;  1GV2 A;  5D8L B;  2Y9Z A;  4KIG A;  2C04 A;  4S0H B;  2JZY A;  1V55 H;  3BCA A;  1UEL B;  5CLS A;  5F64 A;  4Q48 A;  2Q9B A;  1QA6 A;  5CJ9 A;  3T0Y A;  1VOM A;  2B0L A;  2A1D D;  2Y39 A;  5B66 C;  3RQE A;  2Y9Y A;  3H9G A;  1EA3 A;  3HUG B;  1TKN A;  5KHD A;  2RD9 A;  3LLI A;  4LDR A;  4C3H J;  2FSW A;  3J80 Z;  2WV0 A;  2R7S A;  2IXO A;  1BN5 A;  4W97 A;  5KYX B;  3JRF A;  2DK5 A;  5HDG A;  1JT6 A;  4MO7 A;  1NK3 P;  2UUI A;  4JX6 A;  3E6C C;  1Q0D A;  3AG2 C;  1IZ1 A;  2NUP A;  1Z21 A;  1VQ8 I;  4RB1 A;  1OJL A;  1NFO A;  4EM0 B;  4PSW A;  2YL1 A;  4BJ6 A;  2IGO A;  3D1N I;  3GFJ A;  1HDD C;  4GCV A;  1AKH B;  2G3K A;  2GFH A;  3B0U X;  3RJP A;  1IV8 A;  4Z6Y A;  2Y0M A;  3E6B A;  2R92 J;  2ZD9 A;  3S1Q J;  5DUI A;  1J7K A;  4PJM A;  4XOR A;  3NKE A;  2P5V A;  1VI0 A;  3LA7 A;  3NG1 A;  2XPU A;  5KYY B;  1D5Y A;  1IG7 A;  3L34 A;  2LKS A;  2M4E A;  4EM2 A;  3GW2 A;  3CC2 I;  5LHG A;  2VAS A;  2EFO A;  5LEK A;  3K1I A;  5FLV A;  4XID A;  2EA2 A;  2M3A A;  5CVU A;  1WTY A;  1UB9 A;  2PFB A;  2EIJ H;  3REO A;  1S05 A;  3QYB A;  3JR9 A;  4ZLC A;  4XLP F;  4A3K J;  3E70 C;  2HPI A;  4IVN A;  2UWM A;  1T0F A;  1F1M A;  1OIS A;  2M7B A;  3DEW A;  4D4X A;  4UDV A;  2VQL A;  2Q2E A;  2VUM J;  4MTD A;  4WWC A;  4IWB A;  2Y3B A;  5LRR A;  3BR6 A;  2YL3 A;  3E9V A;  2V1X A;  3C7J A;  4L5I A;  1FIA A;  4Y13 A;  1V5E A;  1MBH A;  2IS2 A;  1SC7 A;  4S04 A;  2XLM A;  1VQ6 I;  1U6G A;  2M0M A;  4AL0 A;  2L7F P;  2XKO A;  1X58 A;  1QGP A;  2O03 A;  3HSR A;  1CGO A;  1T6S A;  2Y0S A;  4MVZ A;  2EV0 A;  5F27 A;  2UXX A;  4QDL A;  1G3Y A;  2KZV A;  4IPA A;  3GCM A;  3IKV A;  4M3G A;  1VQ5 I;  3Q3S A;  2CUZ A;  5E8I A;  4OIO F;  3P9K A;  2DYR H;  3QPH A;  5DQT A;  3LWF A;  4L9J A;  1OR3 A;  3EH2 A;  4G7H F;  2JA6 J;  1G3S A;  4LLG F;  5JS5 A;  3NMJ A;  2CH0 A;  4JOM A;  2ZXO A;  4CXF A;  5HDK A;  1D1A A;  3K4J A;  1TWG J;  2BY3 A;  4AL1 A;  4OMY A;  2A0B A;  3WHC A;  3ZQQ A;  4AIH A;  2ECB A;  2MWQ A;  1I6H J;  2JUG A;  3DKX A;  3O8H A;  3WU0 A;  4A69 C;  2A69 F;  3C62 A;  2LC2 A;  2K5C A;  2FE3 A;  2A6E F;  3OYM A;  2F4I A;  2QSF X;  1EJ9 A;  2YVK A;  4CYC B;  3MD2 A;  1LM3 B;  1BI3 A;  3F8F A;  1MMN A;  5L0H A;  4OAZ A;  3B6A A;  2KIF A;  4LOC A;  2VQC A;  3S3N A;  4CO8 A;  4B09 A;  5CKT A;  2EIM H;  3W6J B;  5FLM J;  1U8R A;  2Y2Z A;  3F8C A;  2H09 A;  2QY9 A;  3R61 A;  3AG1 H;  3BTJ A;  1MJ9 A;  2OKU A;  5IT9 K;  2W82 A;  3TQN A;  1OYI A;  4DBR A;  5HOO A;  2F4M B;  1LI7 A;  3CTA A;  3DEE A;  5LBQ A;  3ZP5 A;  1ON1 A;  3FXM A;  1H7I A;  2Q9A A;  3WE2 A;  4YL1 A;  3L2Q A;  2BW3 B;  2XAF A;  4FT8 A;  4I76 A;  2X0L A;  4IQ4 A;  3L2W A;  2QZ8 A;  3ABM H;  3A4C A;  5EF6 A;  2BY2 A;  5F08 A;  4AYB A;  1Z5Z A;  3GZ6 A;  1IF1 A;  3NWS A;  3K7D A;  1IV6 A;  3JRM O;  3HBL A;  3MEX A;  4CCN A;  2LNB A;  1T98 A;  4KIC A;  3L00 A;  3U5S A;  1ETV A;  1P4A A;  1Z67 A;  1QZZ A;  2LYC A;  5GTI C;  4WJ0 A;  1FY7 A;  1R58 A;  1XSX A;  2WC2 A;  2IM8 A;  3FF5 A;  2OCC C;  4IHY A;  4ZYA A;  4H4K C;  4AE4 A;  2L2O A;  5B1B C;  4LG0 A;  5D5U B;  4TV7 A;  4DW6 A;  5J8C A;  2LSE A;  3EYY A;  1OW7 A;  4J01 A;  1FT9 A;  1YLF A;  1ZLK A;  2GXA A;  2PFD A;  3SXK A;  4OOI A;  3S90 A;  1TQI A;  2RKH A;  3S27 A;  3IH4 A;  4F93 B;  1XMX A;  4KIB A;  2PN6 A;  3B73 A;  5COM A;  3BWG A;  1VQO I;  1EKY A;  3AG2 H;  4S05 A;  2CJJ A;  1Z3I X;  3TO9 A;  4RM2 A;  4P9F A;  3CCV I;  3CEX A;  4G6T B;  3DM9 B;  2L5Q A;  2EV6 A;  2I8D A;  1P7J A;  3JRH A;  1K61 A;  3GTG J;  1U5T A;  3K1H A;  4U5G A;  3UMK A;  1FX7 A;  2HZT A;  2Z2S B;  4YT2 A;  1YAR O;  2ZPA A;  1W1W E;  3MKZ A;  3CQZ J;  5DD4 A;  5DS6 A;  2R7D A;  1TWC A;  3GM3 A;  1USS A;  3DPT A;  5J3L A;  1HQC A;  2CQX A;  2R7V A;  3VOE A;  1WH7 A;  2VN2 A;  3OYN A;  2EPN A;  1VQ9 I;  3QYF A;  2HVS A;  4C3I J;  2ZSH B;  2CQK A;  1EV7 A;  2VOO A;  4RB3 C;  4YJW A;  3C3W A;  5F0H A;  3CCR I;  1Y39 A;  1E3H A;  1OR2 A;  1LE8 A;  4UV8 A;  1MKM A;  4BE0 A;  3ZQF A;  1WVR A;  3IQ5 A;  3M8F A;  3ZSU A;  2X9D A;  3IRQ A;  4BQQ A;  3V5Y A;  3ZOB A;  4HOB A;  4E7I A;  1S7E A;  2DYS C;  2XL6 A;  4N0B A;  3H2V A;  4G8X A;  3C1D A;  3CUQ C;  1X19 A;  3L1M A;  2EWN A;  4HAM A;  1RIO H;  2LY9 A;  3BG5 A;  3IQT A;  1P6R A;  3BJO A;  4HEA J;  1J9I A;  3I0T A;  3G1M A;  1LE4 A;  3RCO A;  4G12 A;  3MBG A;  1GV5 A;  4PAC A;  1J75 A;  2QQ8 A;  3FOP A;  2HMZ A;  5BOX A;  4XPW A;  3E5U A;  3M1C A;  2L54 A;  2FBK A;  1FYK A;  1S29 A;  2CO5 A;  2HFI A;  1KU3 A;  3S3M A;  2DA4 A;  4AC0 A;  2YSR A;  3E0J B;  3AGT A;  2E71 A;  4XOP A;  5C44 J;  3GFM A;  1LDD A;  5A69 A;  4UVC A;  1I1G A;  4R79 A;  1R22 A;  1APC A;  2CG4 A;  3CSK A;  4JE9 A;  2MHR A;  1IGN A;  3V7C A;  3LA2 A;  4U5F E;  3V42 A;  2NSF A;  2BY0 A;  1X3U A;  3S1M J;  3CAX A;  4ABZ A;  1R71 A;  4V2F A;  2HWV A;  5HV9 A;  5DYM A;  3I5Q A;  2XL8 A;  4B8X A;  4U9E A;  3A03 A;  1VMA A;  2R03 A;  5F1R A;  2KDZ A;  3BQY A;  1FSE A;  4J00 A;  3WU2 C;  4A0X A;  1J5Y A;  2DAO A;  2L7Z A;  2VXZ A;  4ZTJ A;  3W2A A;  3OV8 A;  2HV6 A;  2FF4 A;  4E7J A;  4IHS A;  1ORS C;  3LJB A;  3VF0 A;  3GEI A;  4M63 A;  3NKD A;  1P4X A;  3I55 I;  2XRH A;  3IQ6 A;  3HRM A;  4I0B A;  1Q0M A;  2EIN C;  4I3M A;  5D6E A;  2MH2 A;  2JJ7 A;  2WWY A;  1REP C;  3BDD A;  4Q7C A;  1QVX A;  3ROU A;  3HRS A;  1BBY A;  1IXS B;  2MBF A;  2X0C A;  3TUL A;  2M7A A;  1FTZ A;  3GOR A;  1CPR A;  5E79 C;  5EGO B;  1F1Z A;  1MNE A;  4XNF A;  4BE1 A;  2CDQ A;  2QLZ A;  3O8G A;  4XEV A;  1RPW A;  2JPU A;  3GTL J;  2F6C A;  2XM0 A;  5E18 F;  2R7O A;  3SHF A;  3HOV J;  2Y30 A;  3A1Y A;  3ZVR A;  1QQI A;  2OU6 A;  2H1K A;  3FKJ A;  3DU6 A;  1V4A A;  3OEO A;  2V1D A;  2Q00 A;  1SMY F;  4RLF A;  3LES A;  2QSG X;  1RJ9 A;  2CGE A;  4Q5S F;  3QVY A;  2D5V A;  1RMV A;  1LUJ B;  1T08 B;  2OCC H;  3CMA I;  3SZR A;  2O0Y A;  1GT0 C;  3A2K A;  4JK1 X;  4YL3 A;  5B1B H;  5F1J A;  1PUF B;  2E60 A;  1KU9 A;  4EVI A;  1JTY A;  5FFZ A;  3DP7 A;  2GZW A;  1KGS A;  4AK9 A;  2E2I J;  3FX3 A;  2ELK A;  3J7A Y;  5T1D B;  3TDZ C;  1S7O A;  2CS3 A;  3VYW A;  3TW7 A;  5F28 E;  1YS7 A;  2M87 A;  3B6C A;  3DBL B;  3ZQI A;  5C3E J;  2HGC A;  3KLN A;  1K6O A;  1ZRD A;  2HVR A;  3ABK C;  3QW1 A;  3T6J A;  1KQ0 A;  2BHY A;  2EFW A;  1B6A A;  2ID6 A;  3EUH A;  2ETH A;  5CYV A;  2HDD A;  2PMU A;  1GM5 A;  2DT7 B;  4HF0 A;  1X2N A;  2XAH A;  5DLJ A;  2IXP A;  1NH3 A;  1IZM A;  2WL8 A;  3JYY A;  3SDB A;  1KTM A;  2LK2 A;  2WB7 A;  3ABT A;  2MH9 A;  3AG4 C;  1WFX A;  4M71 A;  4II2 A;  2YPR A;  1R4N B;  3WTU C;  1T5O A;  1ETY A;  1EKE A;  1I4Z A;  2QBY B;  4WGY A;  3ZIB A;  4DRH B;  2DJI A;  2V3C C;  4Q4Z F;  1YW8 A;  4L9V A;  4AID A;  5J8F A;  3F21 A;  5HLI A;  1K78 B;  2XDV A;  1PD1 A;  1XCB A;  5L3Q A;  5DEQ A;  1TWH A;  1R6R A;  3RVY A;  4FE7 A;  4IX7 A;  4E0I A;  1GQA A;  2J5O A;  3BTC A;  2F22 A;  3ABL C;  1FNT c;  1Z3Y A;  2W1O A;  4LAC B;  2Q3T A;  1GHC A;  1MGT A;  4KN7 X;  3DTE A;  1H8A C;  4XSZ F;  1WJ5 A;  1IO2 A;  3TKY A;  4ENJ A;  4O6N A;  5KYU B;  3OY9 A;  2E7W A;  4MQV A;  2OEX A;  3GUD A;  4LK1 F;  2EQR A;  4NNJ A;  1V5F A;  4NTA A;  1W0T A;  2JSC A;  3FWE A;  3OYJ A;  1Q0G A;  1H9G A;  4F4B A;  2NNN A;  3JRD A;  4M73 A;  1POG A;  2LKP A;  2JQ7 A;  2JVH A;  2NAZ A;  3NAR A;  4YFN F;  4IRG A;  5K5O A;  3JSO A;  1HKT A;  4U5H A;  1W2W A;  4EBK A;  1ULY A;  2DPU A;  1ZU4 A;  2OZU A;  1U0B B;  3QOP A;  4U0V A;  1MW7 A;  3HGG A;  4JEA A;  1CGM E;  3AL0 C;  5BQI A;  4MVR A;  1YQA A;  2ZB9 A;  1YRN A;  2LCH A;  1R49 A;  5KYN A;  1ZG3 A;  2CW0 F;  3IH3 A;  1RKT A;  2LRD A;  3PUB A;  1U2W A;  1N78 A;  1ZAR A;  2IAI A;  1FYL A;  2HQA A;  1UMQ A;  4F91 B;  5E17 F;  4Z9I A;  4UB6 C;  3ISP A;  1EF4 A;  2D1V A;  2DA7 A;  4OAY A;  1Z7L A;  1UZC A;  5BS6 A;  1MBE A;  2HDC A;  1XZP A;  2BL2 A;  4Z9J A;  1ZU5 A;  2VBX A;  3SDG A;  1BA5 A;  3T6B A;  1TQM A;  5AIP A;  5K7Z A;  3FAJ A;  4N4W A;  5DM6 F;  4BJ5 A;  4A3D J;  4FIS A;  4J7T A;  4IHX A;  3HHH A;  3HNI A;  5LHH A;  3M9A A;  2EPL X;  1F43 A;  3KKB A;  1YOV B;  3PFY A;  2QE9 A;  2DOD A;  5CQE A;  2F5F A;  5BQT A;  9ANT A;  4CS7 A;  2W4B A;  1DOW A;  5CI9 A;  3W4Y A;  5IY5 C;  2CW8 A;  4CH7 A;  2OQM A;  1B59 A;  2PQ8 A;  4YRV A;  1OKR A;  3S2H J;  2ZJP F;  1UJ8 A;  1PDN C;  1Y8Q B;  3CJT B;  3WG7 H;  1ENH A;  1B72 A;  1KYW A;  1ZQ3 P;  5D8K B;  2VC9 A;  4RBN A;  3PNT A;  4KIF A;  5FRN A;  1ZHF A;  2EIN H;  2X4H A;  4IHV A;  3H35 A;  1WJE A;  2HR3 A;  3NRV A;  1M6T A;  4KMU X;  3AL0 B;  4MLO A;  2P0W A;  2K3P A;  1E86 A;  2XC7 A;  1ZGJ A;  2EV5 A;  3KP4 A;  3DKA A;  4W8P A;  2ZC2 A;  2YWA A;  4R8H A;  3V7R A;  4Y17 A;  3O10 A;  4N6H A;  1W4M A;  2EFP A;  3GEH A;  1OR7 A;  1R36 A;  1APL C;  1IRF A;  1ERD A;  5EJC A;  2VQH A;  3CP8 A;  1KYZ A;  3KP7 A;  2LOO A;  2O5R A;  5FKL A;  2AXT C;  5EZH A;  1ZR2 A;  1A41 A;  4ZJZ A;  3AOU A;  3ZQ7 A;  3J06 A;  4FQG A;  3FHD A;  2IJL A;  4JZA A;  1BR1 A;  2JUC A;  3JW4 A;  3SP1 A;  2YLD A;  1SD6 A;  1DUX C;  1LEB A;  1SVO A;  1FOW A;  4RGX A;  4WCG A;  1WWP A;  2HTJ A;  4JCH A;  2OQG A;  3HRU A;  1U8B A;  5HSW A;  2LG4 A;  4MEX F;  5T3T A;  5TJ5 E;  2HU9 A;  2EZL A;  1JGG A;  2J8W A;  2WB1 N;  4BHB A;  2J7P D;  1E0E A;  4XEK A;  4Y4R A;  3EFO B;  1OCR C;  1I6X A;  3OIQ A;  5HNH A;  3ABK H;  4K1O A;  3LL7 A;  3BR2 A;  1QZE A;  3CP2 A;  2DJN A;  2B0J A;  4Y52 J;  4AVP A;  4YT4 A;  2E5Z A;  2ISZ A;  1LDJ A;  4LDQ A;  4ULV A;  2IA0 A;  3NQO A;  4DYR A;  3QMK A;  4LER A;  5D4R A;  5EGY A;  3NYL A;  3AG4 H;  4MFD A;  5B3S H;  1FZP B;  2O6G E;  1HST A;  2F5V A;  2QF7 A;  2YS9 A;  2YX7 A;  2YR2 A;  3RH3 A;  2A68 F;  3C8G D;  5A6B A;  3CDL A;  4I09 A;  1ETW A;  4MGR A;  3ZTM A;  1IDY A;  1WAT A;  5ILS A;  4Y15 A;  2UZK A;  4WK8 F;  2HV7 A;  2AP3 A;  1VTM P;  1IC8 A;  1I5Z A;  2H1L A;  1MDM A;  2Q1Z B;  5AON A;  3K1P A;  4FX5 A;  1WKM A;  3ABL H;  3ERM A;  3I4N J;  2HEO A;  2IS6 A;  3TD7 A;  3U0C A;  4E6K G;  2HYG D;  3OIP A;  1WZ2 A;  1ZK8 A;  4Y7N J;  3PO3 J;  4XQ1 A;  1G6N A;  5JRA A;  3RQI A;  3QP6 A;  2L7M P;  5E3L A;  1O7F A;  3KZZ A;  4EMS A;  2RQP A;  3SQN A;  3WTW C;  1JRA A;  2LQG A;  5KYX A;  3DLL F;  2XM4 A;  3ML6 A;  1MBK A;  3K6G A;  2XGX A;  2XHK A;  1NU9 C;  3ULQ B;  3CF2 A;  5ICG A;  4ZYD A;  2DDB A;  4HG2 A;  4KNW A;  3H5N A;  3QOE A;  1XN7 A;  2F48 A;  4PJ0 C;  3K69 A;  1IN5 A;  3QOD A;  3GVA A;  2KZG A;  3UR3 C;  4IL6 C;  4DIQ A;  1AKH A;  2W9Y A;  4EJW A;  2QKM B;  3M07 A;  1VQM I;  2XSD C;  3CCM I;  4BH9 A;  2L6H A;  3JAM Z;  2X6O A;  2ESH A;  4XPY A;  3QAH A;  3E6M A;  5KYY A;  4BEH A;  4HDU A;  4NUB A;  1ZG5 A;  2HXI A;  3RKW A;  3DCF A;  4ON0 A;  5LGN A;  3DFG A;  2BBY A;  1DGW Y;  1TL8 A;  1HC8 A;  3K1N A;  3O6B B;  2C6Y A;  5KAF C;  3I5P A;  4XWJ A;  3RKY A;  4YT5 A;  1ZHW A;  4A6D A;  1XZQ A; 
#chains in the Genus database with same CATH homology
 3KPH A;  2OJE D;  1R5I D;  2ICW G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...