3KPHA

Crystal structure of mycoplasma arthritidis-derived mitogen
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
196
structure length
196
Chain Sequence
b'QNLNNVVFTNKELEDIYNLSNKEETKEVLKLFKLKVNQFYRHAFGIVNDYNGLLEYKEIFNMMFLKLSVVFDTQRKEANNVEQIKRNIAILDEIMAKADNDLSYFISQNKNFQELWDKAVKLTKEMKIKLKGQKLDLRDGEVAINKVRELFGSDKNVKELWWFRSLLVKGVYLIKRYYEGDIELATTSDFAKAVFE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superantigen
publication title Crystal Structure of the Mycoplasma arthritidis-Derived Mitogen in Apo Form Reveals a 3D Domain-Swapped Dimer.
pubmed doi rcsb
source organism Mycoplasma arthritidis
molecule tags Immune system
total genus 73
structure length 196
sequence length 196
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-11-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.530 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A mam-mhc complex, Chain D, Domain 2 3kphA02
1.20.120.390 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Hla class ii histocompatibility antigen, dr alpha chain. Chain D, domain 1 3kphA01
2OJED 1R5ID 3KPHA 2ICWG
chains in the Genus database with same CATH superfamily
1Z91A 3M4CA 3DBLB 3HKZN 2OF7A 3FWEA 3HSRA 3P7NA 4KNYA 4U5CE 1MSFC 4A0ZA 5GP9A 4N4WA 2DQRA 3CF2A 5ERIA 4J7YA 2LP0A 1C0WA 4CXFA 2VOOA 2W4MA 2M4EA 1QPMA 4MLOA 3TW7A 3K1HA 4W8PA 4AIDA 5D4RA 3G2BA 3EPVA 2HDCA 3PUFA 3SFZA 1VF9A 2F5CA 4Y13A 1OCRH 2KK1A 1T2KA 4I7HA 3ZQYA 4XN0A 4XRSA 1SVLA 4WWCA 3M3YJ 2MA3A 3L2RA 4I44A 4XR6A 2X6YA 3EZHA 5A69A 2XF5A 4P55A 4QI0A 4NNJA 5F6FA 3T4RA 3RH3A 1W36C 1MMGA 3BTJA 2IPQX 3T5XA 1X2MA 2BXZA 4EM2A 2E35A 2UXXA 1IXRC 1MNMC 3HUGB 3OYMA 3WHCA 4A3GJ 1Z6AA 2L81A 1JHFA 3ZMDA 2XLHA 5LGUA 2VCAA 2FAPB 5DCMA 1IF1A 1K05A 3E5XA 2KSFA 3QOEA 3DQVC 4ZDPA 3GTPJ 2WZLA 2FF4A 2VE9A 4OMYA 5A6KA 1TWGA 2FU4A 5BPIA 3Q6MA 5DS5A 3RKYA 3PNTA 2QVOA 1IO2A 3ABKH 3IH4A 3ECOA 1DGWY 2GOMA 2KDOA 2XB0X 3MWMA 2A5WA 3G4ZA 3K2ZA 5J6XA 5DTDA 4PJLA 1GGQA 3FXMA 2MSYA 5DUIA 1R71A 1ZVZA 1WJFA 2PLYA 4AM3A 5L0IA 2YZSA 2W7NA 1P6RA 3JRAA 3CCJI 3CUQB 3GUDA 2WY8Q 2Z9OA 3ZQVA 4IKFA 2M5WA 3S14J 3SFIA 3BTIA 1HF0A 4N4OB 3V42A 5FKOA 2LFDA 4E7ZA 3TQNA 3BG9A 4ZYGA 2HPIA 1ZHFA 3F21A 1Y4CA 2G62A 1BOBA 2MG4A 2LY9A 3BTCA 4XM3A 3QOPA 4XLPF 3M1CB 4YJWA 2IS6A 4KIBA 3MBGA 1M1EB 3CUQA 4WABA 4PDKA 1K61A 1ENHA 2GQQA 1VTNC 2I15A 4XQ1A 4A2NB 4DXWA 1U2WA 3DAFA 1OPCA 3M79A 2GXGA 3IWFA 2I8DA 4QSHA 5DDGA 3PDMP 5IYCJ 1TR2A 4XONA 4CBEA 3OWTA 3E6CC 3ERMA 2MH9A 4OIPF 2D1HA 2R02A 4U5HA 1V55H 1EA8A 5L3EA 2L9RA 4C2UA 4F3QA 2BEOA 3CC2I 4IRIA 2EPMX 1JTYA 4GGGA 2DXIA 3K0LA 3IQTA 4MNUA 1DU6A 2AXLA 4EBBA 1JHHA 2VQCA 4RGRA 4ZTFA 5DS6A 1E86A 3FXQA 4Z9JA 1DUXC 1XGSA 2M30A 3S2DJ 2KQRA 2STWA 4U5GA 1ODDA 3BR3A 1MJAA 3WHNA 3K1NA 1JOGA 3A11A 4MQVA 2EFOA 5B1BH 3TJ6A 2R3SA 1IZ1A 1MNDA 3OEOA 4DVYP 4IHSA 5LGTA 3RPUA 4BXUA 3TOAA 3QTHA 1OCTC 4YFKF 4J32B 5IY5C 2V1DA 3TK0A 4AVZA 1V5GA 2IBFA 1KU7A 1ETOA 2HSQA 1O7FA 1SD6A 3Q9SA 2V1UA 3EGDB 3LLKA 4BPMA 3CCYA 1M2VA 2RNJA 1RXQA 1YI2I 1XTAA 2PJRA 3K33A 5E2QA 5KCMA 2JQ7A 1P7JA 4A6DA 3T8TA 4W1UA 1EH6A 5D5XB 1WZ2A 2YX4A 3GEEA 1IV8A 4AIHA 2KP6A 5JRAA 3SEZA 2E2JJ 3A2KA 3RSNA 3HRMA 4YFNF 2QUFA 2FEZA 1QZZA 5TJ5E 3ZWIA 1YFHA 3OL3A 4E0IA 2CQQA 2HS5A 2CWEA 2HJMA 4MTOA 3BJOA 1QO0D 1K79A 3FKIJ 4F93B 2VT2A 1G3WA 3KP6A 3ATPA 4P9TA 2Y0SA 4NY3A 3CJQB 2VODA 3U3FA 3GFMA 4FHTA 3SZGA 2IA2A 3KPHA 3CD6I 3MYFA 3DJUB 3GWNA 4U5EE 5CVUA 1JGSA 1I1GA 3CTAA 1JKQC 1YO5C 3HOUJ 1WJAA 2BGCA 3WE3A 2EPNA 3F6VA 5M5YJ 2RDPA 3HPHA 3B6CA 5HLGA 1WPKA 1GV5A 2WAQA 4ZYHA 4D5CA 2DMPA 4CYCB 1GVJA 5HS8A 1WH5A 2A68F 1M57C 3FXKA 5AIPA 4EJWA 2QSFX 4L5JA 4UNOA 3EETA 3Q3SA 2FBKA 1CGPA 4RAGA 3ZXSA 4CJOA 3K2AA 1F1ZA 3FX3A 2XL4A 1ZG5A 2MC4A 1PP7U 4Q5SF 3I5PA 1J5YA 3I5QA 2OCCC 5H2FC 3HHHA 1JKPC 3FVYA 2V9PA 1XDUA 4MNDA 1UMQA 1ZHXA 2Y39A 1UHSA 4R32A 3US6A 1SD4A 2LTPA 3RVZA 4G6DA 3ZIBA 2V1NA 1P4XA 2OQMA 4BE0A 1BDJB 1R00A 2FUG2 3M9AA 4KYWA 1AKHA 2CGPA 5HV9A 1EKYA 2CMPA 4Y4RA 3I4MJ 1FTTA 3KEOA 1UFBA 2COBA 1IN5A 4M72A 1VQMI 1NG7A 2CQKA 3V5XA 2DU9A 4XPYA 4WXDA 3QYEA 1W5CC 1FIAA 3DLLF 1WFXA 1FZPB 3CLOA 4G9YA 2XGCA 5DD8A 3GFIA 1MNEA 3S1RJ 5K1YA 1LM3B 2CNWD 3L8IA 2E34A 3PFIA 2OCEA 2ZNZA 4I6ZA 2Y3BA 1IG7A 1D5VA 1FOXA 4EJUA 4K7BA 4LB5A 4XRFA 3UMKA 3DM5A 1PDNC 4IWBA 4O3MA 5DCFA 3S16J 2DT6A 3G3ZA 1U89A 4EGZA 1XPXA 2L6GA 1OCOC 3KYIA 4AL0A 2DODA 2OQRA 3WU1B 3JR9A 3E6BA 2XS8A 4CICA 3HTUA 4U7BA 2DBBA 4AX2A 3HYIA 5E79C 1KTMA 1G4US 2BVLA 3EQLF 4IPAA 1QZXA 1E17A 4FWVA 2LVSA 4A3LJ 4JVSA 2Q8KA 2HOTA 1Y6IA 3PUBA 1T8IA 4A3CJ 2HOAA 2HOEA 4AE4B 2DYRH 1MBFA 2E7XA 2LFBA 2OD5A 2OZUA 4NC7A 2H27A 4D7NA 4Q47A 4PACA 2HMQA 5JUAA 3BG5A 3FF5A 3JRGA 2DO7A 2E5NA 1REPC 1JUMA 2CV0A 2A69F 1XB4A 2G0EA 4U87A 4DVZA 1WI9A 2LNBA 3ONQA 2KHMA 2VL8A 2FRHA 3NAUA 4WCGA 3JSOA 4A0YA 1NH3A 1D0YA 1HW2A 3U2MA 3H65A 5L0CA 1GV2A 2Q7RA 3R4KA 2IJLA 2LK2A 3H3VK 2EA2A 4U0WA 4EATA 2HZTA 1F4KA 2IXNA 4KNVA 1E0EA 4BL0B 3JCUC 4MW3A 2NS8A 5E3CA 2JUGA 1HDDC 1OCZC 1OW7A 2R7OA 2AQEA 2NOJB 3GZNB 4OOIA 1NFNA 3CEXA 2KFDA 4MO7A 2DW4A 2EZIA 5IOYA 5FRNA 2VASA 3WU0A 5GAHJ 3S15J 3FZVA 1MDMB 1ZZPA 3DE9A 3F8CA 5KYWB 5CI8A 4UB8C 4BEHB 5LRSA 1OXKA 1T6QA 2KW3C 3C8GA 3K66A 3N24A 2DJIA 2GXBA 5L3QA 4XLEA 1O3UA 3MKZA 2Y9ZA 4C9YA 3U9JA 3KX2A 3BCBA 1YDIA 1Y1VJ 1Q0KA 2Z1DA 2HDDA 4XMYA 2QNLA 2HUJA 1Z0XA 2OZ6A 3AFHA 5B5EC 5J1RA 4O7GA 4O6MA 1RKWA 3BR6A 3ZMZA 4LLCA 1VQOI 1SFOJ 1RZ4A 5FCLA 2DDBA 2CU7A 1T6IA 2QTVA 3G1LA 1GUUA 4L9TA 1A7VA 2EILC 2FMLA 3ZQGA 1BR2A 1KGSA 3IC7A 2KZGA 1KYZA 1U5TB 4G12A 1A7EA 1BI0A 3MCZA 2ZD9A 4MVUA 3ML6A 2NUTA 3LFUA 4IL6C 4NTAA 3SXYA 3EZIA 2IRFG 2VC0A 2KNHA 3LSJA 3EDPA 4U9EA 1PUFA 4OD5A 5J4YA 3GZ6A 3S9OA 1OCRC 2BC5A 3U5SA 4GYGA 3VB2A 3JRBA 3CMAI 4A5MA 3PO2J 1K04A 3CUOA 1JT6A 2F4IA 3K4CA 2J9VA 4ZYDA 3RIRA 1TL8A 1HCRA 1JTXA 3K4BA 2M7BA 3QPTA 2J5OA 5JHFA 1AWCA 1G4WR 3NDBB 2LREA 4QI2A 2B7EA 4MS2A 1CF7A 2R03A 4WF2A 3NG1A 1NG6A 3K70C 2GWWA 3LA3A 3V5ZA 2L7KA 3OYFA 1AU7A 1EH8A 3H0DA 3EGXB 2BHYA 1OYWA 5EGYA 4PFOA 3S3NA 1V4AA 2FQ3A 5KYUA 5DYMA 1RI7A 2BV6A 1X1PA 2UUHA 5LBQA 4KN7X 3OYEA 4ANJA 4GCVA 4CSAC 4FTHA 2MHRA 3PNYA 2A07F 3M8EA 3FBIB 2VQGA 1QU3A 3HXLA 3AJMA 3G4XA 2JSPA 3KCCA 5B3SH 4KITB 3UMIA 2IOQA 1D3YA 2VCCA 3FMQA 5FJ8J 2EFWA 1Y39A 5BUOA 2PX9A 2QKMB 2QUPA 1ORYA 4J30B 3R0AA 1P9QC 3ZQIA 3LNRA 4L9JA 2YHSA 5GTIC 2CUZA 5E18F 3VEPA 3F46A 1F9NA 2OQGA 2XAUA 4JX6A 1YX5A 2PMZA 4OINF 5LD2C 3MYIA 1G5ZA 2IGNA 1YIJI 4HBLA 1JMWA 5HS9A 4LIUA 1QVUA 3HGGA 2DOAA 1XD7A 2BYVE 3KLOA 2ASRA 2VIXA 4CJGA 2O0YA 3LA2A 1JKOC 3O2PE 3LUTB 2E2HJ 2JVGA 2J9WA 4RDUA 5B66C 4FAPB 4EM1A 1W7PB 5TISC 1TZLA 2H8RA 1OMIA 1K6OA 3M4OJ 2LY1A 1V55C 3U8VA 2CW7A 3H35A 4QPOA 3NQOA 3VSKA 1OR2A 3BP8A 2ETSA 1U0JA 3K10A 3ZMVA 3JRCA 1U0BB 4BU2A 4CA0A 3TOMA 1V4RA 5C4JJ 2YSRA 1IN7A 2MBFA 3E7LA 2Y30A 1ETXA 2QBYB 4DZJA 2BOLA 1ZRFA 4LFUA 3L7WA 2ZKZA 1ZLJA 5K5QA 3IKVA 2VXZA 1HMDA 1N1CA 5B1BC 3B6AA 3FXUA 3REOA 3AG3C 5DLJA 4MVMA 1ZELA 2EIJH 5IY5H 4EJVA 4RB1A 5EHHA 3RQGA 3HPGA 2OBPA 3I54A 2ESHA 1OISA 1WJ5A 3GWZA 1K78A 2DA1A 4IQ4A 1GQAA 1UG7A 2MFZA 4HFFB 1TQPA 1H0MA 1MMAA 1V3FA 1XCVA 2VE8A 3LSKA 1YX3A 2PI0A 3MKWB 3E70C 4NQFA 3BC8A 5CKTA 3DP7A 5EF6A 1LE8B 2JA5J 4KC9A 4BQOA 1R6RA 5J47A 1S7ZA 4I0BA 1FP1D 2EB7A 4I76A 4HNTA 4KNWA 1VLTA 2ZFWA 1SEUA 5K0IA 3DBHB 2NS0A 3BZCA 4N9IA 4CCNA 4XOPA 5HNHA 2Q9CA 2RKHA 3T6BA 3DMDA 2IGOA 1USTA 3EUKL 5GPCA 3K7DA 2HPMA 1JJ8C 4EJTA 2HGCA 5AC5A 1LEBA 2EJRA 3PO3J 4KMUX 4Y52J 3JYHA 3G1OA 2EZLA 1R23A 2K86A 1VNDA 3ZOBA 1Q1HA 2VT3A 1LUJB 4P9FA 1KZHA 1H89C 2F4OB 3W2VA 1E3PA 3TO6A 1B8IA 2ZXJA 3F8FA 4M3BA 1RESA 4ZZLA 5ED4A 4RBOA 2XLVA 3DPLC 2A61A 2DDAA 1PJRA 2QA4I 4BJ1A 3K1PA 3DJNB 3H9JA 4BJ5C 5K7HA 1VQKI 1NK3P 2O8XA 2DA2A 2BW3B 3AG2H 2PFDA 1UJ8A 4I98B 3K4JA 2XAGA 1A41A 3FAJA 2Z5UA 2Z3YA 3GTGJ 2P5LC 5JLIA 1V5FA 5FFXA 4MVQA 2E60A 3NYMA 2YX7A 1RR8C 2DGJA 3MD2A 5EZGA 5HLIA 2QCOA 2IXOA 1H88C 3FK6A 3EFOB 5AONA 3IV5A 1ZW2A 1K6YA 1SFEA 3CO6C 3B0PA 3JCUQ 4R1HA 3SYNA 2CW8A 3ERED 3BEHA 3BZKA 1TP4A 2F5EA 1ZHTA 1BI1A 3RQ4A 3CDIA 3DWWA 1X1DA 4Y33A 3KP5A 3LSMA 1SMTA 2X1EA 2B63J 2WADA 1SAUA 2L01A 4G7OF 2TRTA 2HU9A 1BIBA 2L7MP 3GBGA 3HOZJ 4JZAA 3I5UA 1Z21A 3MVPA 1LDDA 4YWQA 1IZMA 4K2EA 5EJCA 3QPSA 5LRRA 1PD1A 4DGWB 2XM0A 1ONVA 2CUJA 4XLNF 5L3BA 2R5YA 4Y3OA 1VFCA 1CGOA 1X1CA 3JTHA 4CDYA 2CNWA 2HQNA 3RW0A 1TWCJ 3EUHC 5A6BD 2DMNA 1OLTA 3F3XA 1ZN2A 2G9WA 3H92A 3CCLI 2VUMJ 2PMUA 1T01A 3JSZA 3JSEO 3IQCA 4G94A 2HNHA 3MQ0A 1MBHA 2KIUA 4N9HA 1A31A 4CZZA 3V7RA 3ZC4A 2GXAA 4LDRA 4M3EA 1R1UA 3CMMA 2R7UA 1VMAA 1RUNA 3S2HJ 3D5RC 1WRJA 4I0AA 2OA4A 3QP6A 3BG6A 3TMOA 4LIVA 2HYFA 4B1RA 1QQIA 2WB1A 4DYQA 2DYRC 2W84A 5D8KB 3L1PA 4IRHA 3LSTA 6PAXA 3CAXA 4II2A 1D8KA 3DFGA 4WX9A 2D4UA 4JEBA 3ZVRA 5KYNA 3TQOA 4G7ZF 2TMVP 2W82A 2KIFA 4PJMA 1R5ID 5HODA 5K5OA 1HQCA 5TRDA 1HDPA 2L7ZA 2Y75A 2Y9YA 3TEDA 1MMNA 3MZHA 4OIOF 3HOYJ 1NLXA 3LS0A 4C3BA 2OUMA 5EG0A 4U7DA 3G73A 2DTZA 4GYTA 1BOAA 2R9RB 4G0HA 1DDNA 2XRHA 2WAFA 1HLVA 2K02A 1Y0NA 1UCRA 1WWPA 1SFXA 1Z05A 4YK5A 2HYGD 2TDXA 1KNYA 1ZARA 4DZPA 2M8EA 3SNHA 3BRJA 4AK9A 2MH2A 3LEVA 2RAEA 2XLEA 1W0TA 3DV8A 4C2MJ 1OCPA 3DKAA 2NVTJ 1QVTA 2ELKA 5D5UB 1LB2A 4IJJA 2GA0A 1Z67A 3FK7A 4JIOA 2P6TA 3CDHA 3S0XA 4RS8A 2L4AA 1ZU4A 3L2WA 1VTMP 3LSRA 3S29A 3QP5A 2Y69H 5BQTA 3FXHA 3LESA 3OSFA 3TD7A 2HXOA 5KYYB 1WTYA 1C17M 3F47A 4YT2A 2JA6J 2W24A 5L3DA 4ZYAA 5COMA 3DPTA 1WJDA 3EH2A 4HZFA 2K9NA 5JFRA 2CUEA 4M6YA 4AD9A 4G7HF 4NCQA 4C3HJ 3E3VA 1JPNA 1P4AA 1YJGA 1I4YA 2E2IJ 3VODA 1HE1A 4YIFA 5FKKA 1SR2A 4JQFA 1IRFA 4DRHB 1FBUA 5F5FA 4C3DA 4KT6A 4A6EA 5HVQC 2EILH 2XSEA 3GTLJ 3I71A 3TO9A 3RKQA 1FBQA 3CP2A 5KK1A 1UELB 5BMZA 3IHUA 2E5ZA 4AYBA 5FKMA 3CF5F 1O3TA 1LE2A 3C3WA 3KZZA 4A3DJ 2Y2ZA 1JT0A 3S1QJ 1OXBA 2Z16A 2EA4A 1UHWA 2R92J 1WWXA 3QMKA 1X4OA 2V9VA 1FFTC 4XEFA 2AWYA 1K83J 3ZQCA 4ESFA 2LG4A 2HYJA 4W97A 1WGWA 5HNFA 2OPTA 2QLZA 1J09A 2E1OA 2HFHA 2JRTA 1E2XA 1MW7A 2W4BA 3K9TA 2L7AA 3B0VC 1XCBA 4X1EA 3L2QA 3HRSA 2JPUA 1P4WA 3H5NA 5DCMB 1W2WA 1SYQA 2QQ9A 1R1TA 5HSWA 2MC3A 4Y15A 2JA8J 1IV6A 1W36D 1JGGA 4HRIA 2ZJRF 4YL0A 3SXKA 3CC7I 2EQRA 4KISA 3GFJA 2OG2A 1R5GA 4IAQA 3QRFF 2OEVA 3W8HA 4KI2A 3S8PA 1N78A 4I3MA 2QKLB 5ILUA 1IN4A 2H09A 5H6RA 1LVAA 3EHMA 2QEXI 4HYEA 3JSPA 4P9UA 3LAYA 4HV5A 2CYDA 3HDDA 4U5DE 3OS1A 3GODA 5B3SC 5AC4A 5C4XJ 5F04A 4DRIB 2LY2A 3F8NA 2J9UA 4U9DA 3PSIA 2E36A 1WQ2A 1IRXA 4BXFA 1QHHD 5CVRA 1SC7A 2WAQN 4X0GA 4A3BJ 2OEXA 3J81K 2NVYJ 4J01A 1TBXA 5FGMA 4F92B 3F8MA 3LMMA 3B73A 4UUSA 2VN2A 1YZAA 2KL4A 5L0JA 3ZQFA 4GFBA 2RQQA 3BR2A 3D5LA 1CPQA 5D5WB 1O7LA 1RIOH 3CC4I 4GO1A 1ZK8A 3B71A 4CIHA 3RYLA 4MW8A 3TULA 3I59A 4JK1X 3S1MJ 2JTVA 5F0CA 4KIGA 4FCYA 1T56A 2CGEA 4UV8A 3L0IA 4IRUA 2H8WA 3OS0A 4BQAA 2PG4A 1YQAA 2MYSA 3U2RA 3N97A 1UFMA 1O87A 1YYXA 2M34A 4BS9A 3ROUA 4PJ0C 1TFOB 2J45A 3ZGKA 1AEPA 1OFCX 5T3WA 4WGYA 3WTUC 3U9MA 2ELJA 3PHF2 1DP3A 3JRDA 2GAUA 1Z3XA 3SXMA 2HQRA 2XAHA 3ABMH 3S2WA 1N25A 5FLVA 4EM0B 3PIOF 1T38A 1G8XA 5F08A 2STTA 4Q7CA 4MEYF 1TNTA 3IPMO 2BY1A 2DA7A 3LEOA 2QM3A 2X51A 4MTFA 1RMVA 1RR7A 2EK5A 2BL2A 2V3CC 4BQNA 1M2VB 3RVYA 2X6XA 5L0DA 2E1NA 2QQAA 3DKWA 3WGIA 1LQ1A 3T6GB 3PNVA 2PJRB 3VSLA 2P0NA 1KQ8A 2WVOA 3AG3H 2K3FA 2LKPA 3H9GA 3VDXA 1S72I 2EIJC 1B1BA 5E3LA 2EINC 3N0TA 2VKDA 1JXSA 3IH3A 3T6JA 2ZMEC 4E7LA 4YL3A 3MAJA 4EKWA 4PSWA 2PX0A 2ICWG 3O39A 4JCZA 4N0BA 2R5ZA 3ASNH 2IXPA 3G71I 3HGYA 1SFUA 2R7WA 2EZKA 3ABUA 1OYYA 3QODA 2EIKH 4QIWN 1H9GA 2WAEA 1HXDA 4M3FA 5FRMA 3ELKA 4LLGF 1M6TA 2QF7A 4E70A 2O3FA 1BJAA 3K6BA 4F55A 4IX7A 1U8BA 1FR0A 4YFXF 1K7AA 2L5QA 2V1XA 3JAMK 4WK8F 1BW6A 2W00A 5M3FJ 3TP3A 5HS7A 3TOLA 1S29A 4RGXA 3RQEA 4M6XA 2V26A 1EQ1A 3IQ5A 1U3EM 4JTCB 3A0HC 4KICA 3S93A 2L9JA 2G7HA 1E85A 5L3CA 3GEZA 5BNGA 5LFAA 3C2HA 2KISA 2DMTA 4D5FA 5JVGF 2K9SA 2H1KA 3OYLA 5HOOA 2PN6A 4MTDA 4D1QA 2X9DA 3HOWJ 2HZ8A 2LMDA 3Q7GA 1ETYA 2I10A 4ITVA 1MBJA 4BJTA 2EH3A 1FOKA 1YA7O 3R2PA 4I1MA 4ZH4F 1FOYA 4E7JA 3R6SA 5GPGB 1XS9A 3RDIA 2XF6A 3PCVA 5LLQA 1KU9A 1NZEA 2LCHA 2R7RA 3HHGA 2F2EA 3BQZA 3B29A 3J7ZI 3N2ZB 2JT1A 5CI9A 3AG2C 2M0MA 4FISA 3CLQA 1I5NA 2R25A 1BN5A 2V7FA 2EV0A 1VYKA 5ICFA 2MLGA 3VYUB 2IYLD 1GXPA 4IARA 3DXJF 2D1VA 2ZC2A 2Q9AA 4HSTA 2X6WA 2ZXWH 5A6AA 1J9IA 2A3SA 3FXRA 3PSFA 3CQZA 1ZGJA 3HRTA 4LB6B 3LAPA 3KLNA 1AKHB 1TWFJ 1TWGJ 4AIKA 4GQHA 3LQRA 2YEVA 4HLXA 5E8GA 3P5JA 4Z6YA 2G3KA 3KZYA 3K4MA 3OYCA 3BTLA 2RGVA 3A03A 3FXJA 2CJJA 3CCSI 3EHNA 3OIQA 2J7PD 2KYHA 3VOEA 3JRHA 3NEUA 4PJNA 1J0RA 1YE9A 3BROA 3ASOC 2N8GA 3LSIA 3K1IC 1AA7A 3I55I 2FMYA 3OV8A 4RD9A 4LG3A 5K7ZA 3NRHA 4A3KJ 2L9VA 2P8TA 1EKEA 4I1OB 1W0UA 5DM7F 3SXZA 1YAUO 2QSGX 2OOCA 3TDZC 3KYDB 2VJ4A 4HLYA 2H7BA 2PFBA 1VQPI 3K7AJ 3I58A 1VQ6I 1QPIA 4I09A 2YL1A 3FM5A 5GADJ 2PJPA 4DBRA 2O03A 2AP3A 2GAQA 3GW2A 3Q0VA 1HOMA 3EUAA 4IF4A 5A6BA 3HJEA 4PGHA 2R4GA 1I27A 4CS8C 5KYXA 2NG1A 3J7AY 3F8BA 2LOOA 4ZZDA 2O9XA 2VLAA 3AQCA 1SVOA 3EG9A 4JW1A 2NOGA 4HF0A 3RIPA 3G1MA 1YW7A 2R7SA 2IP2A 1PVEA 3D5SC 2EFPA 1T0FC 1J7KA 1QBJA 1I5ZA 2IGMA 3I3LA 3ZMUA 1ETQA 1WSUA 4ZDOA 1QHGA 3OIOA 4BJ6A 3MKYB 4C30A 4PJJA 4LMYA 1WASA 3UR3C 3KYLA 2NNYA 1VYIA 5EGOA 1FNNA 1YS6A 2EIMH 2OC6A 5BOXA 4IHWA 4AC0A 2Q00A 2E19A 3KEQA 2HR3A 2M3AA 3H1CA 4JJFA 1RNLA 1WJBA 1WJEA 4HF2A 2DT7B 4XKCA 3W2WA 3H2UA 2V4JC 2NUPA 1Y8QB 1NFOA 4TV7A 2PMZN 2XIGA 3I4PA 1ITYA 1IXSB 1BR4A 2EV6A 5CQGA 2E1MB 2CUFA 5IT3A 5J8FA 3LSHA 1IDYA 5FKLA 3PIPF 3OYNA 2D2WA 1EF4A 3W2AA 1NG1A 1IDZA 3H5AA 4MFDA 4MTGA 2NNNA 3V7OA 4EQQA 3L00A 3C8GB 4RAYA 2DK8A 4A0XA 1YARO 3F9KA 1VQ5I 2Z15A 3MFKA 2Y3GA 1Q1VA 1T95A 2Y48A 2ID3A 2IXSA 2KRFA 4CS9A 2FA5A 2RNGA 3U0CA 2GIVA 3RFYA 2XASA 2ZJQF 4L6RA 4N6CA 5DQZA 2Y69C 3L34A 5DQTA 4F91B 5E1XA 2QWWA 5L3GA 5T3TA 3HL2A 4JX4A 1YRNA 2O7OA 4W8KA 1TLHB 2QZ8A 2YL7A 2HXIA 2RN7A 4XICA 3NYLA 3DEEA 1BJZA 1BW5A 2NUTB 4MGRA 1XZQA 3OY9A 2I8BA 4NTFA 2KIQA 4LACB 2LF7A 2KZVA 2M4GA 2X4HA 5FB2A 2BE5F 3VYTB 3S32A 1PUFB 5CQEA 4L5IA 4XWJA 2FJ1A 3HOSA 4IHVA 2OJQA 2CV2A 5FLXK 4GYIA 5E20A 2LSEA 3NWSA 2JN6A 2QY9A 4O5VA 4EJOA 3M8JA 3HNKA 2NRAC 5J1UA 4BACA 5M5XJ 2VOPA 1W4MA 3FM3A 2CSOA 3FOOA 2IGKA 4JRZA 3CCUI 1IRGA 2JSCA 3PL8A 2A0BA 1MIJA 3L8JA 4UDVA 2YUSA 2VC9A 1CF7B 4BHPA 4A4AA 3RQFA 2L02A 3WTXC 2AWCA 1FMVA 1V54H 4YL1A 1RKEA 2F6CA 2O61A 5CPRB 5KNLA 1TWHA 1TW3A 5HLHA 5KYUB 2LRDA 4XOTA 3L9FA 4D4XA 2VH3A 1CGME 3HSEA 3NKEA 2R05A 1ZG3A 1DOWA 4N06A 5C44J 1RJ9A 1UB9A 2KMUA 4FX5A 1QVXA 2R7ZJ 1QLEC 2FX0A 4XBFA 2RQPA 3P9IA 4MHGA 1BBHA 2M4KA 1OKRA 1S7EA 4XIDA 3K70D 2PBEA 2P6VA 2LD5A 5JVTA 4IO9F 1R5HA 3SQNA 5IYDJ 1FT9A 1TQGA 1DQUA 3W6KB 2CV1A 1Z5ZA 4JE9A 3V5YA 3L2UA 2W9YA 2R7DA 4BHBA 1ZR4A 4E7HA 1Z77A 4RLFA 2ZPAA 3FMRA 2YL3A 4CH7A 1F43A 2R7FA 3E6DA 1OR7C 4MVSA 4XNFA 4ZLCA 3QVYA 1M56C 2KJBA 3OYIA 4PFPA 1HA8A 4II3A 4BEMJ 4MFEA 5F1JA 3L2VA 5DEQA 1UZCA 3S3MA 3F23A 3RYRA 1I3AA 4HAMA 3AG1H 5EEAA 5CYVA 3V7SA 3ZQQA 2B9SA 1TWAJ 1GT0C 4RAFA 3ZP5A 2L54A 2XUBA 3DKXA 3SDGA 1Z6TA 1ZREA 3GM2A 4XK4A 3TBIA 5D92A 2XLMA 3BR1A 3PM1A 3M7GA 3AGUA 1IXCA 1OYIA 4XN3A 1UHMA 1Z7Qc 3Q0WA 2FNAA 2VJIA 2P7VA 3OR2C 5FD5A 1ORJA 1J59A 3GEIA 1I6HJ 1EA3A 2CRGA 3GM3A 2P81A 1T5OA 4C7OA 1APLC 5IP9J 3CUQC 3ABMC 4QTRA 2C6YA 1K4TA 2XB5A 4P5OA 1IN8A 5KAIC 4LK0F 4IHXA 3K1MA 4DIQA 2ZXIA 3CP8A 4R79A 1K78B 2LLKA 3RF3A 1MH3A 4EWCA 2ISZA 2WC2A 2OV7A 5H20A 2YL0A 2R0QC 1WI3A 4AUXA 1ERDA 5EK0A 1XSXA 1LDKB 2LBFA 2X1CA 1SAXA 1YJ9I 3S1NJ 1WOLA 2UUIA 2LF8A 2J5PA 1B68A 2EINH 1D1AA 2UUZA 2LYCA 3V8JA 1WHUA 4HOBA 2OKUA 3X1OA 5B3IA 3ASNC 2LDUA 4ENKA 5E17F 5E1WA 1CGNA 1HKTA 2H6BA 4O6NA 2HWVA 3QPHA 1XGMA 2ZMEA 4KN4X 2VKVA 5D4SA 1OW6A 3I64A 2RC4A 2E87A 2EIKC 5HLTA 3GEHA 1LVKA 1FP2A 2XF7A 9ANTA 3D1NI 2F5DA 5LGNA 2HEOA 2KLOA 1WCMJ 1Y8RB 4BAYA 3J81Z 4XTKA 4E7IA 2XRLA 1OKKD 3GYHX 1I39A 3Q6NA 2M87A 4HE8D 1HW1A 3ECHA 4RA2A 2VBWA 3S17J 5E3MA 4LG0A 3J7AO 2JRMA 1K4SA 1B8IB 5J3LA 2ZNYA 5K5RA 2HDWA 1B6AA 3C62A 3MZYA 4S0HB 5FROA 4L9VA 4ASNA 2QENA 3JTGA 2CFOA 1FJLA 4KFCA 1YITI 1MBEA 2BBYA 1Z6RA 2ISYA 2DK5A 3ZQ7A 4HA8A 3MLGA 5F0HA 2M8GX 2VONA 1ORSC 4S05A 4XLFA 2CCYA 2AS5F 2YKZA 2WZFA 3H3ZA 3ZR8X 1TC3C 3JRIA 2MD5A 2WTEA 2JK3A 4MQ9F 3RZDJ 1YVIA 1R22A 2CO5A 3OYBA 2ZXWC 3A1YA 4BEJA 1ZW3A 1EV7A 1WATA 1C02A 1LS4A 1J8YF 2L9NA 3O10A 4ZDLA 4E0HA 4MIMA 1M2OA 2COMA 2OU6A 5DS4A 4HNUA 5C3EJ 2C03A 3KP2A 1HKQA 2IW5A 2XAJA 4HQMA 3IP4B 4KJZA 4LK1F 3ZMSA 1YS7A 1XGOA 3E0JB 3JRMO 5BS6A 1ETVA 3CCQI 3FISA 1QQ3A 3X2QH 3CSKA 2J7PA 3MN2A 3OYDA 4JYKA 5EZHA 1HSTA 2GA1A 3PQJA 3ASOH 2LFFA 2R5YB 3DF8A 3TO7A 1BL0A 2P5KA 2DCEA 4H4KC 3NRVA 3CMEI 3GTMJ 4CDAA 5KVRA 2F48A 2XL6A 3VF0A 3LA7A 4XEKA 1EI7A 3RKXA 5EEHA 1N77A 1VQ8I 5D6EA 4LGWA 1P7IA 4N4NB 1G2HA 3J80K 3NKDA 2V79A 3GFLA 3JAMZ 2PP4A 2DTRA 3TOBA 5HDGA 5M5WJ 3AQBA 3EJNA 2B0LA 4FESA 4YT5A 1SZIA 5JSLA 3W4YA 2BY2A 2UV1A 2H94A 1ZGWA 3KYCB 4LERA 1T6SA 2W4SA 4UVBA 4E17A 4CS8A 4A12A 1GDTA 1OCCH 1VZ0A 5E3AA 4IGGA 3HM5A 3AGTA 1ZG1A 1I3QJ 4FASD 1G3SA 3DU6A 4U88A 2VPLA 1EJ9A 2BY3A 3A02A 1O3QA 3MFNA 1ZYRF 4M63A 1SD7A 2EFNA 2KDZA 1RC9A 2IEKA 1YJWI 5EG0B 4MVRA 2Q2EA 2EIMC 4CS7A 4Z9HA 3ZMTA 1CPRA 1YLFA 3I4NJ 3QYBA 1U9NA 1JUPA 2QGUA 1S8NA 1VQ7I 3RJPA 3E5UA 4CZCA 4HQEA 3HSFA 2W48A 1SD5A 1JUSA 5IP6A 4EGYA 3ZN1A 3BDDA 1GVDA 4BNCA 1E83A 2AXTC 2XPUA 2CYYA 4M9ZA 1WKMA 4IOAF 3QPLA 4UXNA 4CIPA 4IVNA 5TJJA 1IC8A 2PEXA 5HDNA 1LJ9A 4YIIA 3TW6A 1NU9C 2YVKA 3DZAA 3G50A 3VM6A 4BE2A 1FNTc 4D0PA 2BHZA 4JURI 4XQFA 2M9HA 3WGGA 2Y3HA 3MKLA 5GAEJ 2FXAA 5L0FA 3OR1C 4XKWA 2WWYA 3T0YA 3SZRA 4OAYA 1K40A 3C2BA 2I5UA 2L4MA 4OIRF 3WTYC 4DW6A 4LLNA 2HQ5A 2TCTA 1GXQA 1XX5A 2BVMA 2VBXA 1QZYA 1I1SA 1SMYF 4HFKB 4NTBA 2VPRA 2DAOA 2P6SA 3RI4A 2ME6A 4ENNA 1T33A 3GZ5A 4HG2A 5E8IA 4S04A 1PUEE 1QSPA 2WVQA 4XKVA 3ZTMA 5K7FA 3QU6A 4O6JA 3OIPA 3CZ6A 5E33A 2W85A 5F28E 3DD7A 2LH9A 3AL0B 1PCXA 1H7IA 1P92A 4I99C 2E1MC 5FLMJ 2VBZA 1Z3IX 2A6EF 3JRTA 2DMUA 2XAQA 4CO8A 1B72A 4DJAA 1UAAA 2XXAA 1R4MB 2DOFA 4BUPA 3FKJA 2D5VA 4L0YB 5ICGA 3RKOF 4U5BE 2YWAA 1DP7P 5F0FA 2O8KA 2Y3DA 1AUEA 3Q5FA 1FFHA 3KL4A 4NQWA 4EMSA 4GRIA 4LDKA 2YU3A 2DFHA 2MGQA 2XKOA 3GTQJ 2VBYA 3VPRA 1YHQI 3HIFA 2YLDA 4XORA 3R60A 3KYJA 5FD6A 2W25A 1WGXA 3AG4C 2HKOA 2X1DA 1DOVA 2R93J 4B3AA 1U6GA 2PBIA 3FHDA 3J7YJ 2M2EA 4M71A 1AVOB 1V54C 3JW4A 2IBDA 5JLXA 4BDYA 4ABZA 4KT5C 2Z99A 2XHKA 3KMIA 5KAFC 3H36A 1H9TA 4M3GA 4BH9A 2MWQA 3A01A 1ZGAA 3W6VA 4QLCU 3E5QA 4JC7A 2JD3A 2DI3A 4D9JA 1F5TA 3WTSC 5E3NA 3MZ8A 1T98A 2NPUA 2ZXHA 4O79A 4A3EJ 1MJBA 2L2OA 1U5TC 4NC6A 5EEGA 4DRJB 1TNSA 4BY1J 3U9GA 4DQ2A 3N4MA 3SZPA 4ESJA 1JKRC 1NK2P 2Y0SN 1KA8A 1S6LA 4UB6C 3Q7LA 1ST6A 3UNGC 3HJCA 3M8FA 1FY7A 3QAHA 1TKNA 4FETA 1YIOA 4XKBA 1V74B 3F6OA 2ECCA 1FAPB 3B02A 2YPRA 3DBRB 3FBNB 1U9OA 2XLWA 4DJ9A 5IOZA 1GHCA 3UGOA 2W45A 1VLSA 4FX0A 1EH7A 2R7TA 4IB4A 4UUSB 1MZBA 3GLXA 4CSAA 2YS9A 4IEJA 4BBRJ 2GOXB 1XG1A 4RB2C 3HTSB 4UVAA 4KBLA 5D6FA 1ON1A 3V4GA 3OL4A 3KP4A 4IHYA 2K40A 1ZU5A 3DTIA 3U8PA 3I59B 1OR7A 1OJLA 3BPVA 4UUTA 5D5VB 3QW0A 2K3PA 1AOYA 2HVSA 3ZPLA 3AG1C 4A69C 3GORA 1JR8A 3DTKA 5CIVA 5J40A 4PSXA 1JJ6C 2KJGA 4E7SA 2AQFA 1A36A 2RSEB 3RKWA 3LNQA 3A9CA 3HUGA 3BY6A 3NARA 1FYLA 2ZXPA 3FXOA 4JBAA 1ZR2A 3AOUA 4JJGA 3AKZA 4C2TA 3IH2A 3M07A 2L6FA 1G3YA 2A0UA 5JVEA 1YYJA 5FLXZ 4BE1A 3S84A 3KE2A 2QQ8A 3HC7A 3O3KA 5A2QK 3IRQA 1Z7UA 5J8CA 1J75A 3MX3A 2D5RB 3C63A 2HV6A 4PUSA 1ACIA 1A7DA 3C2GA 4EIYA 3HNJA 2H1LA 2HTSA 2KC3A 1BIAA 2DFIA 4PGGA 1XDSA 2AO9A 3GO5A 2JJ7A 4ONSA 4ULWA 4YEJA 3IKTA 1NU7D 1XZPA 5T1DB 4GEHA 1JI8A 1G3TA 4LITA 1IUYA 2GLOA 5LHIA 1IGNA 4UY8I 1GS9A 4WXCA 2L9SA 2ZJPF 4BQQA 4YT8A 3POVA 2R5ZB 1BC7C 1XMKA 2M1BA 3IAM2 1A6IA 1ETWA 2EZHA 4RAZA 3G6EI 1D8JA 1Q0DA 4EBJA 3HRUA 4ZC3A 3M1CA 2OAZA 1POGA 4C3JJ 2CFXA 4DYCA 5B1AH 4I2OA 1HW5A 1FTSA 3RTRA 3CMYA 3GTKJ 3IEEA 4Z9IA 1LPQA 2XAFA 1W7PD 3CCMI 5IT9K 1F1MA 1A35A 3LSPA 3NMJA 3O6BB 2W1OA 4B47A 5IPAA 4CCLA 1W5SA 3BR5A 2KT0A 3HKKA 2FSWA 3H0GJ 1R7JA 4A5NA 2K27A 1ON2A 4KDPA 5JR3A 2JX0A 5BQHA 3O8GA 2V9KA 5F1RA 3HKZA 2J8WA 5GAGJ 3S90A 2J46A 2ADUA 4I01A 4BYYA 4PK4A 2EPKX 4HNVA 1OKKA 2VJ5A 2UXNA 2NSFA 2EPFA 3A4CA 4LDQA 4B44A 1LI5A 2FBHA 5ICEA 2DMQA 4Q48A 3JT1A 4JOMA 5BQIA 4L9NA 1WN0A 5JI6A 2P1AA 1RPWA 3QW1A 2QYOA 1S7AA 3ZN0A 4XPWA 1FSEA 2A1DD 1ETKA 2HSBA 2HTJA 2HZDA 3EGDA 2Q4FA 4YG2F 3OSGA 1HMOA 2GBYA 1H6GA 4OD4A 3GCMA 2KGOA 1BZ4A 4E18A 3JTLO 2E71A 1LKXA 2K7LA 3J06A 3TKYA 1X1BA 1LIHA 2DA4A 1USSA 2DYSC 2FD5A 3SHFA 2KRCA 4CX9A 2UWMA 1TQMA 2A6HF 3CJNA 2VB6A 2GWRA 1RCPA 1DU0A 4B48A 4LOCA 4CCJA 3DE8A 1LFUP 2P7CB 4BJ5A 4IOCF 3QWLA 4Q4ZF 4LLLA 1X19A 3BT9A 4Y7NJ 4JCHA 2ESNA 3W6JB 2LK4A 4K1OA 4CGZA 3OYKA 2GFHA 1FLIA 3GF2A 3CO7C 2QE9A 1FBSA 2K4JA 3COAC 2YLIA 2ZXOA 3E9VA 1FWZA 3IQ6A 3L2CA 2GZWA 1FYMA 4U5FE 2VKEA 4ENJA 1XMAA 3NMIA 2XRNA 2Z33A 3LJBA 4EBKA 1KU2A 1NHAA 3X2QC 2NVQJ 2YU9J 1Z3YA 2JUCA 5L3VA 2WBMA 2EPLX 4EHPA 1OQYA 4M3DA 4YELA 3HZJA 3NWTA 3F22A 1L3LA 3SP1A 2D45A 3MMYB 2XGDA 4JP0A 4FE4A 4M6VA 3VYRB 3SEQA 2DA5A 3IUOA 4RM3A 2P7VB 3OOUA 4JX5A 3IAS2 2ZBKA 5BQGA 4V2FA 1Z9CA 3QVZA 3ZG1A 1Y0UA 4CYCA 2QLAA 2VKHA 1FYKA 4EEFG 4C3IJ 2H7VC 2PNOA 3S28A 4CDGA 5KYXB 2XL8A 2K85A 2MABA 4RGSA 4LD5A 3DEUA 5FFZA 1KYWA 2CDQA 3EG9B 4QPQA 2HKVA 1TT5B 3CJRB 2WY7Q 1HE9A 4HPQA 4KIFA 2M64A 3HOVJ 1IW7F 2XPVA 5J4VA 2HQAA 3RPQA 2XC7A 2B0HA 1MMSA 2YQYA 1QA6A 3HOTA 2XLOA 2PMHA 3EUHA 2ZFUA 5DVWA 3KZIC 2Q1ZB 5JP7A 1A0BA 2X85A 3A0BC 3LWFA 1VK5A 2DN0A 2GA2A 3WG7C 1OCCC 5EGOB 4MTEA 2R7QA 2XROA 3HEFA 1XSVA 1R4TA 3KETA 2FFHA 4HV6A 3U1DA 4BGDA 1ZHYA 3O6XA 4NC3A 2AVKA 2ZCWA 1AHDP 2X0CA 2G3VA 2YLGA 2ELHA 5D8LB 2NSGA 2DJNA 3ABLH 1C03A 2HVQA 5ILSA 1OW8A 3CCVI 3TL4X 2Q0OA 1MGTA 2RVCA 2NUPB 1DPRA 4N6HA 3K6GA 4EV0A 2CQXA 2DFFA 1KQ9A 4LLEA 2DLLA 1HC8A 3T1BA 2KPMA 3FHZA 4DBQA 2OTLI 2JA7J 4X6AJ 4WXHA 2LP4A 3I56I 1DPUA 4B4CA 2X6OA 1O5HA 2IXMA 1S7OA 3DEWA 5J1YA 3BG7A 3VYSB 3WE2A 4DYRA 1E3OC 1HSJA 2H8AA 3TDUC 4P6IC 5D91A 1LFBA 1TWAA 2O9LA 2IVMA 3OYAA 4ENMA 2RV8A 4HEA2 4RLQA 3K4NA 1ZAOA 1A5JA 2VI6A 4B3XA 3KP3A 1GM5A 1UG2A 5L0GA 2K4BA 1I50J 3LSGA 3OYJA 256BA 1RKCA 3H9QA 3HB9A 1YRNB 3FMSA 4JKVA 4AE4A 4ZTJA 2PF4E 2K5CA 4OIQF 2XLDA 1YYVA 3GM1A 3QYFA 4CDVA 2VCBA 3I53A 2VXDA 3M15A 3FHNA 2KQ9A 1QKRA 2XGEA 5A6JA 2IAIA 5GPAA 3OYGA 1IRZA 2L0KA 1HBXG 1LDJA 4OU0A 2NS7A 1MJ9A 1YG2A 5KHDA 2HVRA 2MD0A 2RD9A 1W1WE 2XS1A 1TW2A 2LKXA 1R9TJ 3J80Z 4FE7A 1T9KA 1STZA 3IWZA 2Z2SB 3DCFA 3LFKA 2L3DA 2BXYA 1HY5A 3HOXJ 3O8HA 3BZ6A 1O4XA 5AGFA 1N75A 4G78A 1XGNA 1R49A 4ULVA 2XVCA 3RQIA 2PQ8A 4HF1A 2LSOA 1WVRA 2NAZA 1RKEB 3QU3A 3T8RA 4UUVA 3WODF 5COFA 3KEYA 3CQZJ 1FIPA 3VAYA 4B8XA 3PFYA 1D1CA 4D7MA 1MDMA 4B09A 5KYWA 1X58A 4BEHA 3AG4H 1RJ9B 4QDLA 2JA2A 3AL0C 1JRAA 3ECSA 1SF8A 4NDLA 4XRMA 4F52A 2KIMA 3TP0A 3PJRA 1R4NB 3SYTA 3ZRGA 5L3FA 4RGUA 2R7VA 1O57A 4Y17A 1YLMA 4L18B 2IS4A 1FEXA 2WZGA 4NB5A 3RYPA 1YW9A 4M73A 1ZKGA 3WGHA 5M3MJ 2HOSA 4AU7A 3BWGA 2ZJ2A 4L5EA 3OOPA 4XRSG 2JVHA 2HV7A 4RB3C 3KP7A 4XSXF 4WGZA 3ZCOA 4XEVA 4NC8A 1ZHWA 2V6EA 2WV0A 4XLCA 4XPXA 1U5TA 3SDBA 2ZO4A 1G4DA 4A93J 5GTHC 3K69A 1QNTA 1MQVA 2E1CA 4UVCA 3GLLA 4XL9A 2ME0A 1BBYA 2J0XA 4B43A 4ZLDA 1QGPA 3TJ5A 2X48A 2CG4A 2F22A 4CUGA 2JPCA 3G4SI 4ETSA 1J8MF 4H54A 3WTZA 1CQTA 4CCMA 1JE8A 4E6KG 1L0OC 4E7KA 1DGRM 1S5LC 3V7CA 1V5EA 2HKXA 3I4UA 2ZXRA 1U78A 3I0TA 1Z23A 1Z7LA 1FPQA 1FC3A 1S9HA 2Y0MA 3BQYA 5ILVA 2F5FA 5F5HA 3S3OA 1MBGA 3S27A 2LQGA 3OA1A 2EBIA 2W57A 3FIWA 1I4ZA 3VRCA 4JEAA 2BZTA 5DV5A 1Y56A 2A5YB 3R61A 2LD6A 1LPEA 1A04A 2JWTA 4XSZF 2IA1A 5H6QA 3EGXA 1D1BA 1MSEC 3BCAA 3ABKC 2B0JA 1R36A 4C7OB 4IRGA 4UHTA 1B9MA 2JMWA 2MLKA 4M9SA 3FXLA 2NVUB 4AIJA 3T9OA 1FOWA 2GDCA 5LEJA 2EWNA 3I9V2 1X3WB 5CVIA 4HW0A 1T39A 1ZLKA 4AL1A 4ER9A 1X2NA 4XLHA 5CJ9A 1MBKA 1J2XA 5CVJA 3GX4X 1KQ0A 1VOMA 1RRJA 3ZTZA 1ORKA 1Y1WJ 2RREA 1SANA 3C18A 3TGNA 4P1WA 2O6GE 4YT4A 4JTDB 1O3SA 4A2UA 3ISPA 1S3JA 1ZHZA 2LKSA 4NBQA 1D0ZA 5FZTA 2P0WA 2LBFB 3IRRA 1G6NA 3WU2C 2CW0F 1ZH5A 2J0WA 1NBBA 4ON0A 5DD4A 2XPWA 4HDUA 4V19K 2ZSIB 4CYDA 1TWCA 2Q3TA 4HEAJ 3U2LA 2NVXJ 3W3CA 2WB7A 1Q0MA 3VWBA 4U0VA 4V2GA 2YRFA 1PYVA 3GTOJ 1X3ZB 2JZYA 1OR3A 1BC8C 2JPBA 2ZMEB 4BY7J 3PMRA 5LEKA 3CCEI 3F0CA 3U21A 4GDFA 5B1AC 1LNWA 2BY0A 1G59A 1U8RA 3P9CA 2GIZA 3M1EA 2EV5A 4G6QA 2P61A 1BI3A 4B6IA 3UGPA 2WA0A 3JZ0A 3DM9B 3ZQHA 1W7PA 1P2FA 3BPXA 4BHCA 3C1DA 3NMKA 3WG9A 3BJ6A 4CSWA 2DA3A 1GLNA 1L7CA 3K4KA 3EH1A 4EUKB 3LOCA 3WTVC 4YIRX 4MVZA 2FQ4A 2R7XA 2WB1N 4LG0B 1B9NA 3HNIA 2DFEA 2XM4A 3B0UX 3M4BA 3WTTC 2M45A 3RPUD 3BR0A 4OWRB 3FDQA 1FMWA 2G7UA 5EDNA 1Q0GA 2AU5A 3GWLA 4K0DA 2K9QA 2F4MB 3LL7A 2OU2A 2X0LA 2QBYA 2DA6A 1BI2A 1HKSA 4A3JJ 3ITFA 3F72A 2NYXA 1TTYA 2MW8A 1SVMA 1APCA 1ULYA 2VC1A 4Z2YA 4U0YA 2A6TA 1XSDA 3DU5A 4BG0A 5JT4A 1XN7A 3FDYA 5E1ZB 2IS1A 4NHJA 2IT0A 2Y31A 2ZB9A 4HX7A 3EYIA 4RBNA 3U1KA 2O5RA 1TWHJ 1YOVB 3H5RA 4CCKA 4ZYEA 1D0XA 4CCOA 3OYHA 2Q9BA 4QWQA 3R7CA 1TFKB 2L6HA 1X1AA 5FKNA 4J19A 3GXOA 1LI7A 4DNCA 2XSJC 2OJED 5A2QZ 2DPDA 1YA9A 3ZSUA 2AHQA 3W8IA 3CDLA 4BKXA 1ZRCA 2DYSH 4G8XA 2PX3A 1LE8A 4WJ0A 4OAZA 3LAJA 3QQAA 2K9LA 3OS2A 2ECBA 3C8ZA 3H3UA 2IM8A 5JHUA 5E3OA 5AIQA 4A3FJ 2NXNB 2P4WA 3Q0UA 2LR8A 3DTEA 3PQKA 1UG0A 3ESWB 3N05A 1RKTA 4FT8A 5JLWA 3LS1A 1VQ4I 1W5TA 4EVIA 5COGA 5DS9A 3AAFA 4L0ZB 2YR2A 4KUMA 2LIGA 4C3EA 2VJJA 2M0CA 2XKPA 5JS5A 3FOPA 1B4AA 2HFIA 1Z1DA 1E3HA 3E6MA 4OMZA 4YN0B 3RZOJ 1KU3A 4F4BA 3WHBA 2ID6A 2ETHA 4E4HA 3Q9VA 1WJCA 2HJ3A 1FTZA 4HSRA 4AYBN 1JPJA 4AVPA 5IT9Z 1MMDA 5IYBJ 2CQNA 2FOKA 3KIOA 4M9XA 1S05A 4LJZF 4AWXB 4IQJA 1X4PA 4XLAA 4H0EA 3B9QA 3K1IA 2OCCH 2XV4S 3ZQLA 1ZTRA 1PD0A 1XMXA 2BW3A 2KRHA 3MEXA 2DT5A 1Q0FA 2OTJI 3DI5A 3LNMB 1X3UA 5CVVA 3GVAA 2WVNA 1E84A 4A3IJ 1I6XA 1XWJA 3KFWX 4YRVA 2XSDC 1IUFA 4PCQA 5F64A 2XGXA 4HX8A 1YJNI 2WV1A 2DPUA 2E7WA 3V8KA 4BDZA 3VYWA 4GXOA 2FNPA 3FAPB 2FOWA 2FGYA 3VFZA 3EFOA 1OQCA 2P5VA 1TT0A 5EYRA 1KONA 1VB5A 2M7AA 3R0JA 3D0SA 2VQLA 2ZSHB 3SZTA 2KJCA 3NYJA 2Q2EB 1NSGB 3O55A 3HLZA 3BOQA 4PZJA 3WG7H 4IXAA 3C7JA 2C04A 2K9MA 3IL2A 4J00A 4IAOA 3SEOA 4G6TB 4IJAA 1LFPA 1H8AC 2EPOA 1JAFA 4A3MJ 3ABLC 4NUBA 3GTJJ 2XDVA 1T0FA 5ICCA 3JYYA 2CQ7A 3U3BA 3K4LA 3L09A 1QRYA 3EYYA 4ESBA 1D5YA 2VQHA 4BXXJ 1LS1A 2WL8A 1YW8A 1YTYA 2ACJA 2IA0A 2HI3A 3DLAA 4RMNA 2CH0A 4BBSJ 5LHGA 1R58A 1BM9A 1OCOH 2FE3A 1TQIA 3JREA 1VQNI 4BJ6C 2KKOA 1Z63A 5DUKA 3LLIA 3KKBA 1BR1A 3CESA 5DM6F 1BA5A 3UMHA 4X0RA 4CHUA 3ZDLA 1R1VA 4HDVA 2DQLA 1FSHA 2DB4A 1SFKA 3P9KA 1ZQ3P 1O3RA 4IHTA 3GMEA 1ZRDA 1U6HA 4P96A 3EPZA 1F36A 2CS3A 1MKMA 4RM2A 3BLYA 1RUOA 4FQGA 2EFQA 5BPDA 1RETA 3LQQA 1T6UA 5FO5A 4ZJZA 3E1SA 1VQ9I 3DKYA 5CLSA 4M74A 4PR9A 3HTKC 5L0HA 3WAQA 2J9BA 4O6YA 3HNLA 5TGTA 2L7FP 4DOZA 3OMYA 5LHHA 4J7TA 3HBLA 1FX7A 4R8HA 1B72B 3E97A 1QPUA 3BG3A 2XXAB 3GANA 3H2VA 1VQLI 1PV3A 2V6CA 3RCOA 1NTCA 1XC5A 2UZKA 1MH4A 4CS9C 4IZZA 1QZEA 1T08B 3JRFA 1IJWC 4NQWB 4HX4A 2IS2A 1VI0A 3ABTA 2H7OA 4MVOA 1OCZH 4FX4A 1Y6DA 3QZCA 1IAWA 4F7ZA 3KH2A 1MD0A 4UV9A 2DOEA 2A05A 3C8GD 3UKGA 1A6QA 1LE4A 4RDAA 1B59A 4I02A 4MEXF 3L1MA 2HMZA 4JTAB 4RB0A 4D4NA 3CJTB 1L3PA 1YZCA 1LEAA 2QSHX 2F5VA 1WH7A 3DPUA 3BJAA 4KMFA 4KA4A 2LC2A 3V8LA 3A01B 2GM4A 2FBIA 3CCRI 1PP8F 5IP7J 5HDKA 1IN6A 3SJMA 2QQBA 3DAGA 3WTWC 3HG9A 2H6CA 3ULQB 5F27A 3DWLE 5KYYA
chains in the Genus database with same CATH topology
2OJED 1R5ID 3KPHA 2ICWG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OJE D;  1R5I D;  3KPH A;  2ICW G; 
#chains in the Genus database with same CATH topology
 1Z91 A;  3M4C A;  3DBL B;  3HKZ N;  2OF7 A;  3FWE A;  3HSR A;  3P7N A;  4KNY A;  4U5C E;  1MSF C;  4A0Z A;  5GP9 A;  4N4W A;  2DQR A;  3CF2 A;  5ERI A;  4J7Y A;  2LP0 A;  1C0W A;  4CXF A;  2VOO A;  2W4M A;  2M4E A;  1QPM A;  4MLO A;  3TW7 A;  3K1H A;  4W8P A;  4AID A;  5D4R A;  3G2B A;  3EPV A;  2HDC A;  3PUF A;  3SFZ A;  1VF9 A;  2F5C A;  4Y13 A;  1OCR H;  2KK1 A;  1T2K A;  4I7H A;  3ZQY A;  4XN0 A;  4XRS A;  1SVL A;  4WWC A;  3M3Y J;  2MA3 A;  3L2R A;  4I44 A;  4XR6 A;  2X6Y A;  3EZH A;  5A69 A;  2XF5 A;  4P55 A;  4QI0 A;  4NNJ A;  5F6F A;  3T4R A;  3RH3 A;  1W36 C;  1MMG A;  3BTJ A;  2IPQ X;  3T5X A;  1X2M A;  2BXZ A;  4EM2 A;  2E35 A;  2UXX A;  1IXR C;  1MNM C;  3HUG B;  3OYM A;  3WHC A;  4A3G J;  1Z6A A;  2L81 A;  1JHF A;  3ZMD A;  2XLH A;  5LGU A;  2VCA A;  2FAP B;  5DCM A;  1IF1 A;  1K05 A;  3E5X A;  2KSF A;  3QOE A;  3DQV C;  4ZDP A;  3GTP J;  2WZL A;  2FF4 A;  2VE9 A;  4OMY A;  5A6K A;  1TWG A;  2FU4 A;  5BPI A;  3Q6M A;  5DS5 A;  3RKY A;  3PNT A;  2QVO A;  1IO2 A;  3ABK H;  3IH4 A;  3ECO A;  1DGW Y;  2GOM A;  2KDO A;  2XB0 X;  3MWM A;  2A5W A;  3G4Z A;  3K2Z A;  5J6X A;  5DTD A;  4PJL A;  1GGQ A;  3FXM A;  2MSY A;  5DUI A;  1R71 A;  1ZVZ A;  1WJF A;  2PLY A;  4AM3 A;  5L0I A;  2YZS A;  2W7N A;  1P6R A;  3JRA A;  3CCJ I;  3CUQ B;  3GUD A;  2WY8 Q;  2Z9O A;  3ZQV A;  4IKF A;  2M5W A;  3S14 J;  3SFI A;  3BTI A;  1HF0 A;  4N4O B;  3V42 A;  5FKO A;  2LFD A;  4E7Z A;  3TQN A;  3BG9 A;  4ZYG A;  2HPI A;  1ZHF A;  3F21 A;  1Y4C A;  2G62 A;  1BOB A;  2MG4 A;  2LY9 A;  3BTC A;  4XM3 A;  3QOP A;  4XLP F;  3M1C B;  4YJW A;  2IS6 A;  4KIB A;  3MBG A;  1M1E B;  3CUQ A;  4WAB A;  4PDK A;  1K61 A;  1ENH A;  2GQQ A;  1VTN C;  2I15 A;  4XQ1 A;  4A2N B;  4DXW A;  1U2W A;  3DAF A;  1OPC A;  3M79 A;  2GXG A;  3IWF A;  2I8D A;  4QSH A;  5DDG A;  3PDM P;  5IYC J;  1TR2 A;  4XON A;  4CBE A;  3OWT A;  3E6C C;  3ERM A;  2MH9 A;  4OIP F;  2D1H A;  2R02 A;  4U5H A;  1V55 H;  1EA8 A;  5L3E A;  2L9R A;  4C2U A;  4F3Q A;  2BEO A;  3CC2 I;  4IRI A;  2EPM X;  1JTY A;  4GGG A;  2DXI A;  3K0L A;  3IQT A;  4MNU A;  1DU6 A;  2AXL A;  4EBB A;  1JHH A;  2VQC A;  4RGR A;  4ZTF A;  5DS6 A;  1E86 A;  3FXQ A;  4Z9J A;  1DUX C;  1XGS A;  2M30 A;  3S2D J;  2KQR A;  2STW A;  4U5G A;  1ODD A;  3BR3 A;  1MJA A;  3WHN A;  3K1N A;  1JOG A;  3A11 A;  4MQV A;  2EFO A;  5B1B H;  3TJ6 A;  2R3S A;  1IZ1 A;  1MND A;  3OEO A;  4DVY P;  4IHS A;  5LGT A;  3RPU A;  4BXU A;  3TOA A;  3QTH A;  1OCT C;  4YFK F;  4J32 B;  5IY5 C;  2V1D A;  3TK0 A;  4AVZ A;  1V5G A;  2IBF A;  1KU7 A;  1ETO A;  2HSQ A;  1O7F A;  1SD6 A;  3Q9S A;  2V1U A;  3EGD B;  3LLK A;  4BPM A;  3CCY A;  1M2V A;  2RNJ A;  1RXQ A;  1YI2 I;  1XTA A;  2PJR A;  3K33 A;  5E2Q A;  5KCM A;  2JQ7 A;  1P7J A;  4A6D A;  3T8T A;  4W1U A;  1EH6 A;  5D5X B;  1WZ2 A;  2YX4 A;  3GEE A;  1IV8 A;  4AIH A;  2KP6 A;  5JRA A;  3SEZ A;  2E2J J;  3A2K A;  3RSN A;  3HRM A;  4YFN F;  2QUF A;  2FEZ A;  1QZZ A;  5TJ5 E;  3ZWI A;  1YFH A;  3OL3 A;  4E0I A;  2CQQ A;  2HS5 A;  2CWE A;  2HJM A;  4MTO A;  3BJO A;  1QO0 D;  1K79 A;  3FKI J;  4F93 B;  2VT2 A;  1G3W A;  3KP6 A;  3ATP A;  4P9T A;  2Y0S A;  4NY3 A;  3CJQ B;  2VOD A;  3U3F A;  3GFM A;  4FHT A;  3SZG A;  2IA2 A;  3KPH A;  3CD6 I;  3MYF A;  3DJU B;  3GWN A;  4U5E E;  5CVU A;  1JGS A;  1I1G A;  3CTA A;  1JKQ C;  1YO5 C;  3HOU J;  1WJA A;  2BGC A;  3WE3 A;  2EPN A;  3F6V A;  5M5Y J;  2RDP A;  3HPH A;  3B6C A;  5HLG A;  1WPK A;  1GV5 A;  2WAQ A;  4ZYH A;  4D5C A;  2DMP A;  4CYC B;  1GVJ A;  5HS8 A;  1WH5 A;  2A68 F;  1M57 C;  3FXK A;  5AIP A;  4EJW A;  2QSF X;  4L5J A;  4UNO A;  3EET A;  3Q3S A;  2FBK A;  1CGP A;  4RAG A;  3ZXS A;  4CJO A;  3K2A A;  1F1Z A;  3FX3 A;  2XL4 A;  1ZG5 A;  2MC4 A;  1PP7 U;  4Q5S F;  3I5P A;  1J5Y A;  3I5Q A;  2OCC C;  5H2F C;  3HHH A;  1JKP C;  3FVY A;  2V9P A;  1XDU A;  4MND A;  1UMQ A;  1ZHX A;  2Y39 A;  1UHS A;  4R32 A;  3US6 A;  1SD4 A;  2LTP A;  3RVZ A;  4G6D A;  3ZIB A;  2V1N A;  1P4X A;  2OQM A;  4BE0 A;  1BDJ B;  1R00 A;  2FUG 2;  3M9A A;  4KYW A;  1AKH A;  2CGP A;  5HV9 A;  1EKY A;  2CMP A;  4Y4R A;  3I4M J;  1FTT A;  3KEO A;  1UFB A;  2COB A;  1IN5 A;  4M72 A;  1VQM I;  1NG7 A;  2CQK A;  3V5X A;  2DU9 A;  4XPY A;  4WXD A;  3QYE A;  1W5C C;  1FIA A;  3DLL F;  1WFX A;  1FZP B;  3CLO A;  4G9Y A;  2XGC A;  5DD8 A;  3GFI A;  1MNE A;  3S1R J;  5K1Y A;  1LM3 B;  2CNW D;  3L8I A;  2E34 A;  3PFI A;  2OCE A;  2ZNZ A;  4I6Z A;  2Y3B A;  1IG7 A;  1D5V A;  1FOX A;  4EJU A;  4K7B A;  4LB5 A;  4XRF A;  3UMK A;  3DM5 A;  1PDN C;  4IWB A;  4O3M A;  5DCF A;  3S16 J;  2DT6 A;  3G3Z A;  1U89 A;  4EGZ A;  1XPX A;  2L6G A;  1OCO C;  3KYI A;  4AL0 A;  2DOD A;  2OQR A;  3WU1 B;  3JR9 A;  3E6B A;  2XS8 A;  4CIC A;  3HTU A;  4U7B A;  2DBB A;  4AX2 A;  3HYI A;  5E79 C;  1KTM A;  1G4U S;  2BVL A;  3EQL F;  4IPA A;  1QZX A;  1E17 A;  4FWV A;  2LVS A;  4A3L J;  4JVS A;  2Q8K A;  2HOT A;  1Y6I A;  3PUB A;  1T8I A;  4A3C J;  2HOA A;  2HOE A;  4AE4 B;  2DYR H;  1MBF A;  2E7X A;  2LFB A;  2OD5 A;  2OZU A;  4NC7 A;  2H27 A;  4D7N A;  4Q47 A;  4PAC A;  2HMQ A;  5JUA A;  3BG5 A;  3FF5 A;  3JRG A;  2DO7 A;  2E5N A;  1REP C;  1JUM A;  2CV0 A;  2A69 F;  1XB4 A;  2G0E A;  4U87 A;  4DVZ A;  1WI9 A;  2LNB A;  3ONQ A;  2KHM A;  2VL8 A;  2FRH A;  3NAU A;  4WCG A;  3JSO A;  4A0Y A;  1NH3 A;  1D0Y A;  1HW2 A;  3U2M A;  3H65 A;  5L0C A;  1GV2 A;  2Q7R A;  3R4K A;  2IJL A;  2LK2 A;  3H3V K;  2EA2 A;  4U0W A;  4EAT A;  2HZT A;  1F4K A;  2IXN A;  4KNV A;  1E0E A;  4BL0 B;  3JCU C;  4MW3 A;  2NS8 A;  5E3C A;  2JUG A;  1HDD C;  1OCZ C;  1OW7 A;  2R7O A;  2AQE A;  2NOJ B;  3GZN B;  4OOI A;  1NFN A;  3CEX A;  2KFD A;  4MO7 A;  2DW4 A;  2EZI A;  5IOY A;  5FRN A;  2VAS A;  3WU0 A;  5GAH J;  3S15 J;  3FZV A;  1MDM B;  1ZZP A;  3DE9 A;  3F8C A;  5KYW B;  5CI8 A;  4UB8 C;  4BEH B;  5LRS A;  1OXK A;  1T6Q A;  2KW3 C;  3C8G A;  3K66 A;  3N24 A;  2DJI A;  2GXB A;  5L3Q A;  4XLE A;  1O3U A;  3MKZ A;  2Y9Z A;  4C9Y A;  3U9J A;  3KX2 A;  3BCB A;  1YDI A;  1Y1V J;  1Q0K A;  2Z1D A;  2HDD A;  4XMY A;  2QNL A;  2HUJ A;  1Z0X A;  2OZ6 A;  3AFH A;  5B5E C;  5J1R A;  4O7G A;  4O6M A;  1RKW A;  3BR6 A;  3ZMZ A;  4LLC A;  1VQO I;  1SFO J;  1RZ4 A;  5FCL A;  2DDB A;  2CU7 A;  1T6I A;  2QTV A;  3G1L A;  1GUU A;  4L9T A;  1A7V A;  2EIL C;  2FML A;  3ZQG A;  1BR2 A;  1KGS A;  3IC7 A;  2KZG A;  1KYZ A;  1U5T B;  4G12 A;  1A7E A;  1BI0 A;  3MCZ A;  2ZD9 A;  4MVU A;  3ML6 A;  2NUT A;  3LFU A;  4IL6 C;  4NTA A;  3SXY A;  3EZI A;  2IRF G;  2VC0 A;  2KNH A;  3LSJ A;  3EDP A;  4U9E A;  1PUF A;  4OD5 A;  5J4Y A;  3GZ6 A;  3S9O A;  1OCR C;  2BC5 A;  3U5S A;  4GYG A;  3VB2 A;  3JRB A;  3CMA I;  4A5M A;  3PO2 J;  1K04 A;  3CUO A;  1JT6 A;  2F4I A;  3K4C A;  2J9V A;  4ZYD A;  3RIR A;  1TL8 A;  1HCR A;  1JTX A;  3K4B A;  2M7B A;  3QPT A;  2J5O A;  5JHF A;  1AWC A;  1G4W R;  3NDB B;  2LRE A;  4QI2 A;  2B7E A;  4MS2 A;  1CF7 A;  2R03 A;  4WF2 A;  3NG1 A;  1NG6 A;  3K70 C;  2GWW A;  3LA3 A;  3V5Z A;  2L7K A;  3OYF A;  1AU7 A;  1EH8 A;  3H0D A;  3EGX B;  2BHY A;  1OYW A;  5EGY A;  4PFO A;  3S3N A;  1V4A A;  2FQ3 A;  5KYU A;  5DYM A;  1RI7 A;  2BV6 A;  1X1P A;  2UUH A;  5LBQ A;  4KN7 X;  3OYE A;  4ANJ A;  4GCV A;  4CSA C;  4FTH A;  2MHR A;  3PNY A;  2A07 F;  3M8E A;  3FBI B;  2VQG A;  1QU3 A;  3HXL A;  3AJM A;  3G4X A;  2JSP A;  3KCC A;  5B3S H;  4KIT B;  3UMI A;  2IOQ A;  1D3Y A;  2VCC A;  3FMQ A;  5FJ8 J;  2EFW A;  1Y39 A;  5BUO A;  2PX9 A;  2QKM B;  2QUP A;  1ORY A;  4J30 B;  3R0A A;  1P9Q C;  3ZQI A;  3LNR A;  4L9J A;  2YHS A;  5GTI C;  2CUZ A;  5E18 F;  3VEP A;  3F46 A;  1F9N A;  2OQG A;  2XAU A;  4JX6 A;  1YX5 A;  2PMZ A;  4OIN F;  5LD2 C;  3MYI A;  1G5Z A;  2IGN A;  1YIJ I;  4HBL A;  1JMW A;  5HS9 A;  4LIU A;  1QVU A;  3HGG A;  2DOA A;  1XD7 A;  2BYV E;  3KLO A;  2ASR A;  2VIX A;  4CJG A;  2O0Y A;  3LA2 A;  1JKO C;  3O2P E;  3LUT B;  2E2H J;  2JVG A;  2J9W A;  4RDU A;  5B66 C;  4FAP B;  4EM1 A;  1W7P B;  5TIS C;  1TZL A;  2H8R A;  1OMI A;  1K6O A;  3M4O J;  2LY1 A;  1V55 C;  3U8V A;  2CW7 A;  3H35 A;  4QPO A;  3NQO A;  3VSK A;  1OR2 A;  3BP8 A;  2ETS A;  1U0J A;  3K10 A;  3ZMV A;  3JRC A;  1U0B B;  4BU2 A;  4CA0 A;  3TOM A;  1V4R A;  5C4J J;  2YSR A;  1IN7 A;  2MBF A;  3E7L A;  2Y30 A;  1ETX A;  2QBY B;  4DZJ A;  2BOL A;  1ZRF A;  4LFU A;  3L7W A;  2ZKZ A;  1ZLJ A;  5K5Q A;  3IKV A;  2VXZ A;  1HMD A;  1N1C A;  5B1B C;  3B6A A;  3FXU A;  3REO A;  3AG3 C;  5DLJ A;  4MVM A;  1ZEL A;  2EIJ H;  5IY5 H;  4EJV A;  4RB1 A;  5EHH A;  3RQG A;  3HPG A;  2OBP A;  3I54 A;  2ESH A;  1OIS A;  1WJ5 A;  3GWZ A;  1K78 A;  2DA1 A;  4IQ4 A;  1GQA A;  1UG7 A;  2MFZ A;  4HFF B;  1TQP A;  1H0M A;  1MMA A;  1V3F A;  1XCV A;  2VE8 A;  3LSK A;  1YX3 A;  2PI0 A;  3MKW B;  3E70 C;  4NQF A;  3BC8 A;  5CKT A;  3DP7 A;  5EF6 A;  1LE8 B;  2JA5 J;  4KC9 A;  4BQO A;  1R6R A;  5J47 A;  1S7Z A;  4I0B A;  1FP1 D;  2EB7 A;  4I76 A;  4HNT A;  4KNW A;  1VLT A;  2ZFW A;  1SEU A;  5K0I A;  3DBH B;  2NS0 A;  3BZC A;  4N9I A;  4CCN A;  4XOP A;  5HNH A;  2Q9C A;  2RKH A;  3T6B A;  3DMD A;  2IGO A;  1UST A;  3EUK L;  5GPC A;  3K7D A;  2HPM A;  1JJ8 C;  4EJT A;  2HGC A;  5AC5 A;  1LEB A;  2EJR A;  3PO3 J;  4KMU X;  4Y52 J;  3JYH A;  3G1O A;  2EZL A;  1R23 A;  2K86 A;  1VND A;  3ZOB A;  1Q1H A;  2VT3 A;  1LUJ B;  4P9F A;  1KZH A;  1H89 C;  2F4O B;  3W2V A;  1E3P A;  3TO6 A;  1B8I A;  2ZXJ A;  3F8F A;  4M3B A;  1RES A;  4ZZL A;  5ED4 A;  4RBO A;  2XLV A;  3DPL C;  2A61 A;  2DDA A;  1PJR A;  2QA4 I;  4BJ1 A;  3K1P A;  3DJN B;  3H9J A;  4BJ5 C;  5K7H A;  1VQK I;  1NK3 P;  2O8X A;  2DA2 A;  2BW3 B;  3AG2 H;  2PFD A;  1UJ8 A;  4I98 B;  3K4J A;  2XAG A;  1A41 A;  3FAJ A;  2Z5U A;  2Z3Y A;  3GTG J;  2P5L C;  5JLI A;  1V5F A;  5FFX A;  4MVQ A;  2E60 A;  3NYM A;  2YX7 A;  1RR8 C;  2DGJ A;  3MD2 A;  5EZG A;  5HLI A;  2QCO A;  2IXO A;  1H88 C;  3FK6 A;  3EFO B;  5AON A;  3IV5 A;  1ZW2 A;  1K6Y A;  1SFE A;  3CO6 C;  3B0P A;  3JCU Q;  4R1H A;  3SYN A;  2CW8 A;  3ERE D;  3BEH A;  3BZK A;  1TP4 A;  2F5E A;  1ZHT A;  1BI1 A;  3RQ4 A;  3CDI A;  3DWW A;  1X1D A;  4Y33 A;  3KP5 A;  3LSM A;  1SMT A;  2X1E A;  2B63 J;  2WAD A;  1SAU A;  2L01 A;  4G7O F;  2TRT A;  2HU9 A;  1BIB A;  2L7M P;  3GBG A;  3HOZ J;  4JZA A;  3I5U A;  1Z21 A;  3MVP A;  1LDD A;  4YWQ A;  1IZM A;  4K2E A;  5EJC A;  3QPS A;  5LRR A;  1PD1 A;  4DGW B;  2XM0 A;  1ONV A;  2CUJ A;  4XLN F;  5L3B A;  2R5Y A;  4Y3O A;  1VFC A;  1CGO A;  1X1C A;  3JTH A;  4CDY A;  2CNW A;  2HQN A;  3RW0 A;  1TWC J;  3EUH C;  5A6B D;  2DMN A;  1OLT A;  3F3X A;  1ZN2 A;  2G9W A;  3H92 A;  3CCL I;  2VUM J;  2PMU A;  1T01 A;  3JSZ A;  3JSE O;  3IQC A;  4G94 A;  2HNH A;  3MQ0 A;  1MBH A;  2KIU A;  4N9H A;  1A31 A;  4CZZ A;  3V7R A;  3ZC4 A;  2GXA A;  4LDR A;  4M3E A;  1R1U A;  3CMM A;  2R7U A;  1VMA A;  1RUN A;  3S2H J;  3D5R C;  1WRJ A;  4I0A A;  2OA4 A;  3QP6 A;  3BG6 A;  3TMO A;  4LIV A;  2HYF A;  4B1R A;  1QQI A;  2WB1 A;  4DYQ A;  2DYR C;  2W84 A;  5D8K B;  3L1P A;  4IRH A;  3LST A;  6PAX A;  3CAX A;  4II2 A;  1D8K A;  3DFG A;  4WX9 A;  2D4U A;  4JEB A;  3ZVR A;  5KYN A;  3TQO A;  4G7Z F;  2TMV P;  2W82 A;  2KIF A;  4PJM A;  1R5I D;  5HOD A;  5K5O A;  1HQC A;  5TRD A;  1HDP A;  2L7Z A;  2Y75 A;  2Y9Y A;  3TED A;  1MMN A;  3MZH A;  4OIO F;  3HOY J;  1NLX A;  3LS0 A;  4C3B A;  2OUM A;  5EG0 A;  4U7D A;  3G73 A;  2DTZ A;  4GYT A;  1BOA A;  2R9R B;  4G0H A;  1DDN A;  2XRH A;  2WAF A;  1HLV A;  2K02 A;  1Y0N A;  1UCR A;  1WWP A;  1SFX A;  1Z05 A;  4YK5 A;  2HYG D;  2TDX A;  1KNY A;  1ZAR A;  4DZP A;  2M8E A;  3SNH A;  3BRJ A;  4AK9 A;  2MH2 A;  3LEV A;  2RAE A;  2XLE A;  1W0T A;  3DV8 A;  4C2M J;  1OCP A;  3DKA A;  2NVT J;  1QVT A;  2ELK A;  5D5U B;  1LB2 A;  4IJJ A;  2GA0 A;  1Z67 A;  3FK7 A;  4JIO A;  2P6T A;  3CDH A;  3S0X A;  4RS8 A;  2L4A A;  1ZU4 A;  3L2W A;  1VTM P;  3LSR A;  3S29 A;  3QP5 A;  2Y69 H;  5BQT A;  3FXH A;  3LES A;  3OSF A;  3TD7 A;  2HXO A;  5KYY B;  1WTY A;  1C17 M;  3F47 A;  4YT2 A;  2JA6 J;  2W24 A;  5L3D A;  4ZYA A;  5COM A;  3DPT A;  1WJD A;  3EH2 A;  4HZF A;  2K9N A;  5JFR A;  2CUE A;  4M6Y A;  4AD9 A;  4G7H F;  4NCQ A;  4C3H J;  3E3V A;  1JPN A;  1P4A A;  1YJG A;  1I4Y A;  2E2I J;  3VOD A;  1HE1 A;  4YIF A;  5FKK A;  1SR2 A;  4JQF A;  1IRF A;  4DRH B;  1FBU A;  5F5F A;  4C3D A;  4KT6 A;  4A6E A;  5HVQ C;  2EIL H;  2XSE A;  3GTL J;  3I71 A;  3TO9 A;  3RKQ A;  1FBQ A;  3CP2 A;  5KK1 A;  1UEL B;  5BMZ A;  3IHU A;  2E5Z A;  4AYB A;  5FKM A;  3CF5 F;  1O3T A;  1LE2 A;  3C3W A;  3KZZ A;  4A3D J;  2Y2Z A;  1JT0 A;  3S1Q J;  1OXB A;  2Z16 A;  2EA4 A;  1UHW A;  2R92 J;  1WWX A;  3QMK A;  1X4O A;  2V9V A;  1FFT C;  4XEF A;  2AWY A;  1K83 J;  3ZQC A;  4ESF A;  2LG4 A;  2HYJ A;  4W97 A;  1WGW A;  5HNF A;  2OPT A;  2QLZ A;  1J09 A;  2E1O A;  2HFH A;  2JRT A;  1E2X A;  1MW7 A;  2W4B A;  3K9T A;  2L7A A;  3B0V C;  1XCB A;  4X1E A;  3L2Q A;  3HRS A;  2JPU A;  1P4W A;  3H5N A;  5DCM B;  1W2W A;  1SYQ A;  2QQ9 A;  1R1T A;  5HSW A;  2MC3 A;  4Y15 A;  2JA8 J;  1IV6 A;  1W36 D;  1JGG A;  4HRI A;  2ZJR F;  4YL0 A;  3SXK A;  3CC7 I;  2EQR A;  4KIS A;  3GFJ A;  2OG2 A;  1R5G A;  4IAQ A;  3QRF F;  2OEV A;  3W8H A;  4KI2 A;  3S8P A;  1N78 A;  4I3M A;  2QKL B;  5ILU A;  1IN4 A;  2H09 A;  5H6R A;  1LVA A;  3EHM A;  2QEX I;  4HYE A;  3JSP A;  4P9U A;  3LAY A;  4HV5 A;  2CYD A;  3HDD A;  4U5D E;  3OS1 A;  3GOD A;  5B3S C;  5AC4 A;  5C4X J;  5F04 A;  4DRI B;  2LY2 A;  3F8N A;  2J9U A;  4U9D A;  3PSI A;  2E36 A;  1WQ2 A;  1IRX A;  4BXF A;  1QHH D;  5CVR A;  1SC7 A;  2WAQ N;  4X0G A;  4A3B J;  2OEX A;  3J81 K;  2NVY J;  4J01 A;  1TBX A;  5FGM A;  4F92 B;  3F8M A;  3LMM A;  3B73 A;  4UUS A;  2VN2 A;  1YZA A;  2KL4 A;  5L0J A;  3ZQF A;  4GFB A;  2RQQ A;  3BR2 A;  3D5L A;  1CPQ A;  5D5W B;  1O7L A;  1RIO H;  3CC4 I;  4GO1 A;  1ZK8 A;  3B71 A;  4CIH A;  3RYL A;  4MW8 A;  3TUL A;  3I59 A;  4JK1 X;  3S1M J;  2JTV A;  5F0C A;  4KIG A;  4FCY A;  1T56 A;  2CGE A;  4UV8 A;  3L0I A;  4IRU A;  2H8W A;  3OS0 A;  4BQA A;  2PG4 A;  1YQA A;  2MYS A;  3U2R A;  3N97 A;  1UFM A;  1O87 A;  1YYX A;  2M34 A;  4BS9 A;  3ROU A;  4PJ0 C;  1TFO B;  2J45 A;  3ZGK A;  1AEP A;  1OFC X;  5T3W A;  4WGY A;  3WTU C;  3U9M A;  2ELJ A;  3PHF 2;  1DP3 A;  3JRD A;  2GAU A;  1Z3X A;  3SXM A;  2HQR A;  2XAH A;  3ABM H;  3S2W A;  1N25 A;  5FLV A;  4EM0 B;  3PIO F;  1T38 A;  1G8X A;  5F08 A;  2STT A;  4Q7C A;  4MEY F;  1TNT A;  3IPM O;  2BY1 A;  2DA7 A;  3LEO A;  2QM3 A;  2X51 A;  4MTF A;  1RMV A;  1RR7 A;  2EK5 A;  2BL2 A;  2V3C C;  4BQN A;  1M2V B;  3RVY A;  2X6X A;  5L0D A;  2E1N A;  2QQA A;  3DKW A;  3WGI A;  1LQ1 A;  3T6G B;  3PNV A;  2PJR B;  3VSL A;  2P0N A;  1KQ8 A;  2WVO A;  3AG3 H;  2K3F A;  2LKP A;  3H9G A;  3VDX A;  1S72 I;  2EIJ C;  1B1B A;  5E3L A;  2EIN C;  3N0T A;  2VKD A;  1JXS A;  3IH3 A;  3T6J A;  2ZME C;  4E7L A;  4YL3 A;  3MAJ A;  4EKW A;  4PSW A;  2PX0 A;  2ICW G;  3O39 A;  4JCZ A;  4N0B A;  2R5Z A;  3ASN H;  2IXP A;  3G71 I;  3HGY A;  1SFU A;  2R7W A;  2EZK A;  3ABU A;  1OYY A;  3QOD A;  2EIK H;  4QIW N;  1H9G A;  2WAE A;  1HXD A;  4M3F A;  5FRM A;  3ELK A;  4LLG F;  1M6T A;  2QF7 A;  4E70 A;  2O3F A;  1BJA A;  3K6B A;  4F55 A;  4IX7 A;  1U8B A;  1FR0 A;  4YFX F;  1K7A A;  2L5Q A;  2V1X A;  3JAM K;  4WK8 F;  1BW6 A;  2W00 A;  5M3F J;  3TP3 A;  5HS7 A;  3TOL A;  1S29 A;  4RGX A;  3RQE A;  4M6X A;  2V26 A;  1EQ1 A;  3IQ5 A;  1U3E M;  4JTC B;  3A0H C;  4KIC A;  3S93 A;  2L9J A;  2G7H A;  1E85 A;  5L3C A;  3GEZ A;  5BNG A;  5LFA A;  3C2H A;  2KIS A;  2DMT A;  4D5F A;  5JVG F;  2K9S A;  2H1K A;  3OYL A;  5HOO A;  2PN6 A;  4MTD A;  4D1Q A;  2X9D A;  3HOW J;  2HZ8 A;  2LMD A;  3Q7G A;  1ETY A;  2I10 A;  4ITV A;  1MBJ A;  4BJT A;  2EH3 A;  1FOK A;  1YA7 O;  3R2P A;  4I1M A;  4ZH4 F;  1FOY A;  4E7J A;  3R6S A;  5GPG B;  1XS9 A;  3RDI A;  2XF6 A;  3PCV A;  5LLQ A;  1KU9 A;  1NZE A;  2LCH A;  2R7R A;  3HHG A;  2F2E A;  3BQZ A;  3B29 A;  3J7Z I;  3N2Z B;  2JT1 A;  5CI9 A;  3AG2 C;  2M0M A;  4FIS A;  3CLQ A;  1I5N A;  2R25 A;  1BN5 A;  2V7F A;  2EV0 A;  1VYK A;  5ICF A;  2MLG A;  3VYU B;  2IYL D;  1GXP A;  4IAR A;  3DXJ F;  2D1V A;  2ZC2 A;  2Q9A A;  4HST A;  2X6W A;  2ZXW H;  5A6A A;  1J9I A;  2A3S A;  3FXR A;  3PSF A;  3CQZ A;  1ZGJ A;  3HRT A;  4LB6 B;  3LAP A;  3KLN A;  1AKH B;  1TWF J;  1TWG J;  4AIK A;  4GQH A;  3LQR A;  2YEV A;  4HLX A;  5E8G A;  3P5J A;  4Z6Y A;  2G3K A;  3KZY A;  3K4M A;  3OYC A;  3BTL A;  2RGV A;  3A03 A;  3FXJ A;  2CJJ A;  3CCS I;  3EHN A;  3OIQ A;  2J7P D;  2KYH A;  3VOE A;  3JRH A;  3NEU A;  4PJN A;  1J0R A;  1YE9 A;  3BRO A;  3ASO C;  2N8G A;  3LSI A;  3K1I C;  1AA7 A;  3I55 I;  2FMY A;  3OV8 A;  4RD9 A;  4LG3 A;  5K7Z A;  3NRH A;  4A3K J;  2L9V A;  2P8T A;  1EKE A;  4I1O B;  1W0U A;  5DM7 F;  3SXZ A;  1YAU O;  2QSG X;  2OOC A;  3TDZ C;  3KYD B;  2VJ4 A;  4HLY A;  2H7B A;  2PFB A;  1VQP I;  3K7A J;  3I58 A;  1VQ6 I;  1QPI A;  4I09 A;  2YL1 A;  3FM5 A;  5GAD J;  2PJP A;  4DBR A;  2O03 A;  2AP3 A;  2GAQ A;  3GW2 A;  3Q0V A;  1HOM A;  3EUA A;  4IF4 A;  5A6B A;  3HJE A;  4PGH A;  2R4G A;  1I27 A;  4CS8 C;  5KYX A;  2NG1 A;  3J7A Y;  3F8B A;  2LOO A;  4ZZD A;  2O9X A;  2VLA A;  3AQC A;  1SVO A;  3EG9 A;  4JW1 A;  2NOG A;  4HF0 A;  3RIP A;  3G1M A;  1YW7 A;  2R7S A;  2IP2 A;  1PVE A;  3D5S C;  2EFP A;  1T0F C;  1J7K A;  1QBJ A;  1I5Z A;  2IGM A;  3I3L A;  3ZMU A;  1ETQ A;  1WSU A;  4ZDO A;  1QHG A;  3OIO A;  4BJ6 A;  3MKY B;  4C30 A;  4PJJ A;  4LMY A;  1WAS A;  3UR3 C;  3KYL A;  2NNY A;  1VYI A;  5EGO A;  1FNN A;  1YS6 A;  2EIM H;  2OC6 A;  5BOX A;  4IHW A;  4AC0 A;  2Q00 A;  2E19 A;  3KEQ A;  2HR3 A;  2M3A A;  3H1C A;  4JJF A;  1RNL A;  1WJB A;  1WJE A;  4HF2 A;  2DT7 B;  4XKC A;  3W2W A;  3H2U A;  2V4J C;  2NUP A;  1Y8Q B;  1NFO A;  4TV7 A;  2PMZ N;  2XIG A;  3I4P A;  1ITY A;  1IXS B;  1BR4 A;  2EV6 A;  5CQG A;  2E1M B;  2CUF A;  5IT3 A;  5J8F A;  3LSH A;  1IDY A;  5FKL A;  3PIP F;  3OYN A;  2D2W A;  1EF4 A;  3W2A A;  1NG1 A;  1IDZ A;  3H5A A;  4MFD A;  4MTG A;  2NNN A;  3V7O A;  4EQQ A;  3L00 A;  3C8G B;  4RAY A;  2DK8 A;  4A0X A;  1YAR O;  3F9K A;  1VQ5 I;  2Z15 A;  3MFK A;  2Y3G A;  1Q1V A;  1T95 A;  2Y48 A;  2ID3 A;  2IXS A;  2KRF A;  4CS9 A;  2FA5 A;  2RNG A;  3U0C A;  2GIV A;  3RFY A;  2XAS A;  2ZJQ F;  4L6R A;  4N6C A;  5DQZ A;  2Y69 C;  3L34 A;  5DQT A;  4F91 B;  5E1X A;  2QWW A;  5L3G A;  5T3T A;  3HL2 A;  4JX4 A;  1YRN A;  2O7O A;  4W8K A;  1TLH B;  2QZ8 A;  2YL7 A;  2HXI A;  2RN7 A;  4XIC A;  3NYL A;  3DEE A;  1BJZ A;  1BW5 A;  2NUT B;  4MGR A;  1XZQ A;  3OY9 A;  2I8B A;  4NTF A;  2KIQ A;  4LAC B;  2LF7 A;  2KZV A;  2M4G A;  2X4H A;  5FB2 A;  2BE5 F;  3VYT B;  3S32 A;  1PUF B;  5CQE A;  4L5I A;  4XWJ A;  2FJ1 A;  3HOS A;  4IHV A;  2OJQ A;  2CV2 A;  5FLX K;  4GYI A;  5E20 A;  2LSE A;  3NWS A;  2JN6 A;  2QY9 A;  4O5V A;  4EJO A;  3M8J A;  3HNK A;  2NRA C;  5J1U A;  4BAC A;  5M5X J;  2VOP A;  1W4M A;  3FM3 A;  2CSO A;  3FOO A;  2IGK A;  4JRZ A;  3CCU I;  1IRG A;  2JSC A;  3PL8 A;  2A0B A;  1MIJ A;  3L8J A;  4UDV A;  2YUS A;  2VC9 A;  1CF7 B;  4BHP A;  4A4A A;  3RQF A;  2L02 A;  3WTX C;  2AWC A;  1FMV A;  1V54 H;  4YL1 A;  1RKE A;  2F6C A;  2O61 A;  5CPR B;  5KNL A;  1TWH A;  1TW3 A;  5HLH A;  5KYU B;  2LRD A;  4XOT A;  3L9F A;  4D4X A;  2VH3 A;  1CGM E;  3HSE A;  3NKE A;  2R05 A;  1ZG3 A;  1DOW A;  4N06 A;  5C44 J;  1RJ9 A;  1UB9 A;  2KMU A;  4FX5 A;  1QVX A;  2R7Z J;  1QLE C;  2FX0 A;  4XBF A;  2RQP A;  3P9I A;  4MHG A;  1BBH A;  2M4K A;  1OKR A;  1S7E A;  4XID A;  3K70 D;  2PBE A;  2P6V A;  2LD5 A;  5JVT A;  4IO9 F;  1R5H A;  3SQN A;  5IYD J;  1FT9 A;  1TQG A;  1DQU A;  3W6K B;  2CV1 A;  1Z5Z A;  4JE9 A;  3V5Y A;  3L2U A;  2W9Y A;  2R7D A;  4BHB A;  1ZR4 A;  4E7H A;  1Z77 A;  4RLF A;  2ZPA A;  3FMR A;  2YL3 A;  4CH7 A;  1F43 A;  2R7F A;  3E6D A;  1OR7 C;  4MVS A;  4XNF A;  4ZLC A;  3QVY A;  1M56 C;  2KJB A;  3OYI A;  4PFP A;  1HA8 A;  4II3 A;  4BEM J;  4MFE A;  5F1J A;  3L2V A;  5DEQ A;  1UZC A;  3S3M A;  3F23 A;  3RYR A;  1I3A A;  4HAM A;  3AG1 H;  5EEA A;  5CYV A;  3V7S A;  3ZQQ A;  2B9S A;  1TWA J;  1GT0 C;  4RAF A;  3ZP5 A;  2L54 A;  2XUB A;  3DKX A;  3SDG A;  1Z6T A;  1ZRE A;  3GM2 A;  4XK4 A;  3TBI A;  5D92 A;  2XLM A;  3BR1 A;  3PM1 A;  3M7G A;  3AGU A;  1IXC A;  1OYI A;  4XN3 A;  1UHM A;  1Z7Q c;  3Q0W A;  2FNA A;  2VJI A;  2P7V A;  3OR2 C;  5FD5 A;  1ORJ A;  1J59 A;  3GEI A;  1I6H J;  1EA3 A;  2CRG A;  3GM3 A;  2P81 A;  1T5O A;  4C7O A;  1APL C;  5IP9 J;  3CUQ C;  3ABM C;  4QTR A;  2C6Y A;  1K4T A;  2XB5 A;  4P5O A;  1IN8 A;  5KAI C;  4LK0 F;  4IHX A;  3K1M A;  4DIQ A;  2ZXI A;  3CP8 A;  4R79 A;  1K78 B;  2LLK A;  3RF3 A;  1MH3 A;  4EWC A;  2ISZ A;  2WC2 A;  2OV7 A;  5H20 A;  2YL0 A;  2R0Q C;  1WI3 A;  4AUX A;  1ERD A;  5EK0 A;  1XSX A;  1LDK B;  2LBF A;  2X1C A;  1SAX A;  1YJ9 I;  3S1N J;  1WOL A;  2UUI A;  2LF8 A;  2J5P A;  1B68 A;  2EIN H;  1D1A A;  2UUZ A;  2LYC A;  3V8J A;  1WHU A;  4HOB A;  2OKU A;  3X1O A;  5B3I A;  3ASN C;  2LDU A;  4ENK A;  5E17 F;  5E1W A;  1CGN A;  1HKT A;  2H6B A;  4O6N A;  2HWV A;  3QPH A;  1XGM A;  2ZME A;  4KN4 X;  2VKV A;  5D4S A;  1OW6 A;  3I64 A;  2RC4 A;  2E87 A;  2EIK C;  5HLT A;  3GEH A;  1LVK A;  1FP2 A;  2XF7 A;  9ANT A;  3D1N I;  2F5D A;  5LGN A;  2HEO A;  2KLO A;  1WCM J;  1Y8R B;  4BAY A;  3J81 Z;  4XTK A;  4E7I A;  2XRL A;  1OKK D;  3GYH X;  1I39 A;  3Q6N A;  2M87 A;  4HE8 D;  1HW1 A;  3ECH A;  4RA2 A;  2VBW A;  3S17 J;  5E3M A;  4LG0 A;  3J7A O;  2JRM A;  1K4S A;  1B8I B;  5J3L A;  2ZNY A;  5K5R A;  2HDW A;  1B6A A;  3C62 A;  3MZY A;  4S0H B;  5FRO A;  4L9V A;  4ASN A;  2QEN A;  3JTG A;  2CFO A;  1FJL A;  4KFC A;  1YIT I;  1MBE A;  2BBY A;  1Z6R A;  2ISY A;  2DK5 A;  3ZQ7 A;  4HA8 A;  3MLG A;  5F0H A;  2M8G X;  2VON A;  1ORS C;  4S05 A;  4XLF A;  2CCY A;  2AS5 F;  2YKZ A;  2WZF A;  3H3Z A;  3ZR8 X;  1TC3 C;  3JRI A;  2MD5 A;  2WTE A;  2JK3 A;  4MQ9 F;  3RZD J;  1YVI A;  1R22 A;  2CO5 A;  3OYB A;  2ZXW C;  3A1Y A;  4BEJ A;  1ZW3 A;  1EV7 A;  1WAT A;  1C02 A;  1LS4 A;  1J8Y F;  2L9N A;  3O10 A;  4ZDL A;  4E0H A;  4MIM A;  1M2O A;  2COM A;  2OU6 A;  5DS4 A;  4HNU A;  5C3E J;  2C03 A;  3KP2 A;  1HKQ A;  2IW5 A;  2XAJ A;  4HQM A;  3IP4 B;  4KJZ A;  4LK1 F;  3ZMS A;  1YS7 A;  1XGO A;  3E0J B;  3JRM O;  5BS6 A;  1ETV A;  3CCQ I;  3FIS A;  1QQ3 A;  3X2Q H;  3CSK A;  2J7P A;  3MN2 A;  3OYD A;  4JYK A;  5EZH A;  1HST A;  2GA1 A;  3PQJ A;  3ASO H;  2LFF A;  2R5Y B;  3DF8 A;  3TO7 A;  1BL0 A;  2P5K A;  2DCE A;  4H4K C;  3NRV A;  3CME I;  3GTM J;  4CDA A;  5KVR A;  2F48 A;  2XL6 A;  3VF0 A;  3LA7 A;  4XEK A;  1EI7 A;  3RKX A;  5EEH A;  1N77 A;  1VQ8 I;  5D6E A;  4LGW A;  1P7I A;  4N4N B;  1G2H A;  3J80 K;  3NKD A;  2V79 A;  3GFL A;  3JAM Z;  2PP4 A;  2DTR A;  3TOB A;  5HDG A;  5M5W J;  3AQB A;  3EJN A;  2B0L A;  4FES A;  4YT5 A;  1SZI A;  5JSL A;  3W4Y A;  2BY2 A;  2UV1 A;  2H94 A;  1ZGW A;  3KYC B;  4LER A;  1T6S A;  2W4S A;  4UVB A;  4E17 A;  4CS8 A;  4A12 A;  1GDT A;  1OCC H;  1VZ0 A;  5E3A A;  4IGG A;  3HM5 A;  3AGT A;  1ZG1 A;  1I3Q J;  4FAS D;  1G3S A;  3DU6 A;  4U88 A;  2VPL A;  1EJ9 A;  2BY3 A;  3A02 A;  1O3Q A;  3MFN A;  1ZYR F;  4M63 A;  1SD7 A;  2EFN A;  2KDZ A;  1RC9 A;  2IEK A;  1YJW I;  5EG0 B;  4MVR A;  2Q2E A;  2EIM C;  4CS7 A;  4Z9H A;  3ZMT A;  1CPR A;  1YLF A;  3I4N J;  3QYB A;  1U9N A;  1JUP A;  2QGU A;  1S8N A;  1VQ7 I;  3RJP A;  3E5U A;  4CZC A;  4HQE A;  3HSF A;  2W48 A;  1SD5 A;  1JUS A;  5IP6 A;  4EGY A;  3ZN1 A;  3BDD A;  1GVD A;  4BNC A;  1E83 A;  2AXT C;  2XPU A;  2CYY A;  4M9Z A;  1WKM A;  4IOA F;  3QPL A;  4UXN A;  4CIP A;  4IVN A;  5TJJ A;  1IC8 A;  2PEX A;  5HDN A;  1LJ9 A;  4YII A;  3TW6 A;  1NU9 C;  2YVK A;  3DZA A;  3G50 A;  3VM6 A;  4BE2 A;  1FNT c;  4D0P A;  2BHZ A;  4JUR I;  4XQF A;  2M9H A;  3WGG A;  2Y3H A;  3MKL A;  5GAE J;  2FXA A;  5L0F A;  3OR1 C;  4XKW A;  2WWY A;  3T0Y A;  3SZR A;  4OAY A;  1K40 A;  3C2B A;  2I5U A;  2L4M A;  4OIR F;  3WTY C;  4DW6 A;  4LLN A;  2HQ5 A;  2TCT A;  1GXQ A;  1XX5 A;  2BVM A;  2VBX A;  1QZY A;  1I1S A;  1SMY F;  4HFK B;  4NTB A;  2VPR A;  2DAO A;  2P6S A;  3RI4 A;  2ME6 A;  4ENN A;  1T33 A;  3GZ5 A;  4HG2 A;  5E8I A;  4S04 A;  1PUE E;  1QSP A;  2WVQ A;  4XKV A;  3ZTM A;  5K7F A;  3QU6 A;  4O6J A;  3OIP A;  3CZ6 A;  5E33 A;  2W85 A;  5F28 E;  3DD7 A;  2LH9 A;  3AL0 B;  1PCX A;  1H7I A;  1P92 A;  4I99 C;  2E1M C;  5FLM J;  2VBZ A;  1Z3I X;  2A6E F;  3JRT A;  2DMU A;  2XAQ A;  4CO8 A;  1B72 A;  4DJA A;  1UAA A;  2XXA A;  1R4M B;  2DOF A;  4BUP A;  3FKJ A;  2D5V A;  4L0Y B;  5ICG A;  3RKO F;  4U5B E;  2YWA A;  1DP7 P;  5F0F A;  2O8K A;  2Y3D A;  1AUE A;  3Q5F A;  1FFH A;  3KL4 A;  4NQW A;  4EMS A;  4GRI A;  4LDK A;  2YU3 A;  2DFH A;  2MGQ A;  2XKO A;  3GTQ J;  2VBY A;  3VPR A;  1YHQ I;  3HIF A;  2YLD A;  4XOR A;  3R60 A;  3KYJ A;  5FD6 A;  2W25 A;  1WGX A;  3AG4 C;  2HKO A;  2X1D A;  1DOV A;  2R93 J;  4B3A A;  1U6G A;  2PBI A;  3FHD A;  3J7Y J;  2M2E A;  4M71 A;  1AVO B;  1V54 C;  3JW4 A;  2IBD A;  5JLX A;  4BDY A;  4ABZ A;  4KT5 C;  2Z99 A;  2XHK A;  3KMI A;  5KAF C;  3H36 A;  1H9T A;  4M3G A;  4BH9 A;  2MWQ A;  3A01 A;  1ZGA A;  3W6V A;  4QLC U;  3E5Q A;  4JC7 A;  2JD3 A;  2DI3 A;  4D9J A;  1F5T A;  3WTS C;  5E3N A;  3MZ8 A;  1T98 A;  2NPU A;  2ZXH A;  4O79 A;  4A3E J;  1MJB A;  2L2O A;  1U5T C;  4NC6 A;  5EEG A;  4DRJ B;  1TNS A;  4BY1 J;  3U9G A;  4DQ2 A;  3N4M A;  3SZP A;  4ESJ A;  1JKR C;  1NK2 P;  2Y0S N;  1KA8 A;  1S6L A;  4UB6 C;  3Q7L A;  1ST6 A;  3UNG C;  3HJC A;  3M8F A;  1FY7 A;  3QAH A;  1TKN A;  4FET A;  1YIO A;  4XKB A;  1V74 B;  3F6O A;  2ECC A;  1FAP B;  3B02 A;  2YPR A;  3DBR B;  3FBN B;  1U9O A;  2XLW A;  4DJ9 A;  5IOZ A;  1GHC A;  3UGO A;  2W45 A;  1VLS A;  4FX0 A;  1EH7 A;  2R7T A;  4IB4 A;  4UUS B;  1MZB A;  3GLX A;  4CSA A;  2YS9 A;  4IEJ A;  4BBR J;  2GOX B;  1XG1 A;  4RB2 C;  3HTS B;  4UVA A;  4KBL A;  5D6F A;  1ON1 A;  3V4G A;  3OL4 A;  3KP4 A;  4IHY A;  2K40 A;  1ZU5 A;  3DTI A;  3U8P A;  3I59 B;  1OR7 A;  1OJL A;  3BPV A;  4UUT A;  5D5V B;  3QW0 A;  2K3P A;  1AOY A;  2HVS A;  3ZPL A;  3AG1 C;  4A69 C;  3GOR A;  1JR8 A;  3DTK A;  5CIV A;  5J40 A;  4PSX A;  1JJ6 C;  2KJG A;  4E7S A;  2AQF A;  1A36 A;  2RSE B;  3RKW A;  3LNQ A;  3A9C A;  3HUG A;  3BY6 A;  3NAR A;  1FYL A;  2ZXP A;  3FXO A;  4JBA A;  1ZR2 A;  3AOU A;  4JJG A;  3AKZ A;  4C2T A;  3IH2 A;  3M07 A;  2L6F A;  1G3Y A;  2A0U A;  5JVE A;  1YYJ A;  5FLX Z;  4BE1 A;  3S84 A;  3KE2 A;  2QQ8 A;  3HC7 A;  3O3K A;  5A2Q K;  3IRQ A;  1Z7U A;  5J8C A;  1J75 A;  3MX3 A;  2D5R B;  3C63 A;  2HV6 A;  4PUS A;  1ACI A;  1A7D A;  3C2G A;  4EIY A;  3HNJ A;  2H1L A;  2HTS A;  2KC3 A;  1BIA A;  2DFI A;  4PGG A;  1XDS A;  2AO9 A;  3GO5 A;  2JJ7 A;  4ONS A;  4ULW A;  4YEJ A;  3IKT A;  1NU7 D;  1XZP A;  5T1D B;  4GEH A;  1JI8 A;  1G3T A;  4LIT A;  1IUY A;  2GLO A;  5LHI A;  1IGN A;  4UY8 I;  1GS9 A;  4WXC A;  2L9S A;  2ZJP F;  4BQQ A;  4YT8 A;  3POV A;  2R5Z B;  1BC7 C;  1XMK A;  2M1B A;  3IAM 2;  1A6I A;  1ETW A;  2EZH A;  4RAZ A;  3G6E I;  1D8J A;  1Q0D A;  4EBJ A;  3HRU A;  4ZC3 A;  3M1C A;  2OAZ A;  1POG A;  4C3J J;  2CFX A;  4DYC A;  5B1A H;  4I2O A;  1HW5 A;  1FTS A;  3RTR A;  3CMY A;  3GTK J;  3IEE A;  4Z9I A;  1LPQ A;  2XAF A;  1W7P D;  3CCM I;  5IT9 K;  1F1M A;  1A35 A;  3LSP A;  3NMJ A;  3O6B B;  2W1O A;  4B47 A;  5IPA A;  4CCL A;  1W5S A;  3BR5 A;  2KT0 A;  3HKK A;  2FSW A;  3H0G J;  1R7J A;  4A5N A;  2K27 A;  1ON2 A;  4KDP A;  5JR3 A;  2JX0 A;  5BQH A;  3O8G A;  2V9K A;  5F1R A;  3HKZ A;  2J8W A;  5GAG J;  3S90 A;  2J46 A;  2ADU A;  4I01 A;  4BYY A;  4PK4 A;  2EPK X;  4HNV A;  1OKK A;  2VJ5 A;  2UXN A;  2NSF A;  2EPF A;  3A4C A;  4LDQ A;  4B44 A;  1LI5 A;  2FBH A;  5ICE A;  2DMQ A;  4Q48 A;  3JT1 A;  4JOM A;  5BQI A;  4L9N A;  1WN0 A;  5JI6 A;  2P1A A;  1RPW A;  3QW1 A;  2QYO A;  1S7A A;  3ZN0 A;  4XPW A;  1FSE A;  2A1D D;  1ETK A;  2HSB A;  2HTJ A;  2HZD A;  3EGD A;  2Q4F A;  4YG2 F;  3OSG A;  1HMO A;  2GBY A;  1H6G A;  4OD4 A;  3GCM A;  2KGO A;  1BZ4 A;  4E18 A;  3JTL O;  2E71 A;  1LKX A;  2K7L A;  3J06 A;  3TKY A;  1X1B A;  1LIH A;  2DA4 A;  1USS A;  2DYS C;  2FD5 A;  3SHF A;  2KRC A;  4CX9 A;  2UWM A;  1TQM A;  2A6H F;  3CJN A;  2VB6 A;  2GWR A;  1RCP A;  1DU0 A;  4B48 A;  4LOC A;  4CCJ A;  3DE8 A;  1LFU P;  2P7C B;  4BJ5 A;  4IOC F;  3QWL A;  4Q4Z F;  4LLL A;  1X19 A;  3BT9 A;  4Y7N J;  4JCH A;  2ESN A;  3W6J B;  2LK4 A;  4K1O A;  4CGZ A;  3OYK A;  2GFH A;  1FLI A;  3GF2 A;  3CO7 C;  2QE9 A;  1FBS A;  2K4J A;  3COA C;  2YLI A;  2ZXO A;  3E9V A;  1FWZ A;  3IQ6 A;  3L2C A;  2GZW A;  1FYM A;  4U5F E;  2VKE A;  4ENJ A;  1XMA A;  3NMI A;  2XRN A;  2Z33 A;  3LJB A;  4EBK A;  1KU2 A;  1NHA A;  3X2Q C;  2NVQ J;  2YU9 J;  1Z3Y A;  2JUC A;  5L3V A;  2WBM A;  2EPL X;  4EHP A;  1OQY A;  4M3D A;  4YEL A;  3HZJ A;  3NWT A;  3F22 A;  1L3L A;  3SP1 A;  2D45 A;  3MMY B;  2XGD A;  4JP0 A;  4FE4 A;  4M6V A;  3VYR B;  3SEQ A;  2DA5 A;  3IUO A;  4RM3 A;  2P7V B;  3OOU A;  4JX5 A;  3IAS 2;  2ZBK A;  5BQG A;  4V2F A;  1Z9C A;  3QVZ A;  3ZG1 A;  1Y0U A;  4CYC A;  2QLA A;  2VKH A;  1FYK A;  4EEF G;  4C3I J;  2H7V C;  2PNO A;  3S28 A;  4CDG A;  5KYX B;  2XL8 A;  2K85 A;  2MAB A;  4RGS A;  4LD5 A;  3DEU A;  5FFZ A;  1KYW A;  2CDQ A;  3EG9 B;  4QPQ A;  2HKV A;  1TT5 B;  3CJR B;  2WY7 Q;  1HE9 A;  4HPQ A;  4KIF A;  2M64 A;  3HOV J;  1IW7 F;  2XPV A;  5J4V A;  2HQA A;  3RPQ A;  2XC7 A;  2B0H A;  1MMS A;  2YQY A;  1QA6 A;  3HOT A;  2XLO A;  2PMH A;  3EUH A;  2ZFU A;  5DVW A;  3KZI C;  2Q1Z B;  5JP7 A;  1A0B A;  2X85 A;  3A0B C;  3LWF A;  1VK5 A;  2DN0 A;  2GA2 A;  3WG7 C;  1OCC C;  5EGO B;  4MTE A;  2R7Q A;  2XRO A;  3HEF A;  1XSV A;  1R4T A;  3KET A;  2FFH A;  4HV6 A;  3U1D A;  4BGD A;  1ZHY A;  3O6X A;  4NC3 A;  2AVK A;  2ZCW A;  1AHD P;  2X0C A;  2G3V A;  2YLG A;  2ELH A;  5D8L B;  2NSG A;  2DJN A;  3ABL H;  1C03 A;  2HVQ A;  5ILS A;  1OW8 A;  3CCV I;  3TL4 X;  2Q0O A;  1MGT A;  2RVC A;  2NUP B;  1DPR A;  4N6H A;  3K6G A;  4EV0 A;  2CQX A;  2DFF A;  1KQ9 A;  4LLE A;  2DLL A;  1HC8 A;  3T1B A;  2KPM A;  3FHZ A;  4DBQ A;  2OTL I;  2JA7 J;  4X6A J;  4WXH A;  2LP4 A;  3I56 I;  1DPU A;  4B4C A;  2X6O A;  1O5H A;  2IXM A;  1S7O A;  3DEW A;  5J1Y A;  3BG7 A;  3VYS B;  3WE2 A;  4DYR A;  1E3O C;  1HSJ A;  2H8A A;  3TDU C;  4P6I C;  5D91 A;  1LFB A;  1TWA A;  2O9L A;  2IVM A;  3OYA A;  4ENM A;  2RV8 A;  4HEA 2;  4RLQ A;  3K4N A;  1ZAO A;  1A5J A;  2VI6 A;  4B3X A;  3KP3 A;  1GM5 A;  1UG2 A;  5L0G A;  2K4B A;  1I50 J;  3LSG A;  3OYJ A;  256B A;  1RKC A;  3H9Q A;  3HB9 A;  1YRN B;  3FMS A;  4JKV A;  4AE4 A;  4ZTJ A;  2PF4 E;  2K5C A;  4OIQ F;  2XLD A;  1YYV A;  3GM1 A;  3QYF A;  4CDV A;  2VCB A;  3I53 A;  2VXD A;  3M15 A;  3FHN A;  2KQ9 A;  1QKR A;  2XGE A;  5A6J A;  2IAI A;  5GPA A;  3OYG A;  1IRZ A;  2L0K A;  1HBX G;  1LDJ A;  4OU0 A;  2NS7 A;  1MJ9 A;  1YG2 A;  5KHD A;  2HVR A;  2MD0 A;  2RD9 A;  1W1W E;  2XS1 A;  1TW2 A;  2LKX A;  1R9T J;  3J80 Z;  4FE7 A;  1T9K A;  1STZ A;  3IWZ A;  2Z2S B;  3DCF A;  3LFK A;  2L3D A;  2BXY A;  1HY5 A;  3HOX J;  3O8H A;  3BZ6 A;  1O4X A;  5AGF A;  1N75 A;  4G78 A;  1XGN A;  1R49 A;  4ULV A;  2XVC A;  3RQI A;  2PQ8 A;  4HF1 A;  2LSO A;  1WVR A;  2NAZ A;  1RKE B;  3QU3 A;  3T8R A;  4UUV A;  3WOD F;  5COF A;  3KEY A;  3CQZ J;  1FIP A;  3VAY A;  4B8X A;  3PFY A;  1D1C A;  4D7M A;  1MDM A;  4B09 A;  5KYW A;  1X58 A;  4BEH A;  3AG4 H;  1RJ9 B;  4QDL A;  2JA2 A;  3AL0 C;  1JRA A;  3ECS A;  1SF8 A;  4NDL A;  4XRM A;  4F52 A;  2KIM A;  3TP0 A;  3PJR A;  1R4N B;  3SYT A;  3ZRG A;  5L3F A;  4RGU A;  2R7V A;  1O57 A;  4Y17 A;  1YLM A;  4L18 B;  2IS4 A;  1FEX A;  2WZG A;  4NB5 A;  3RYP A;  1YW9 A;  4M73 A;  1ZKG A;  3WGH A;  5M3M J;  2HOS A;  4AU7 A;  3BWG A;  2ZJ2 A;  4L5E A;  3OOP A;  4XRS G;  2JVH A;  2HV7 A;  4RB3 C;  3KP7 A;  4XSX F;  4WGZ A;  3ZCO A;  4XEV A;  4NC8 A;  1ZHW A;  2V6E A;  2WV0 A;  4XLC A;  4XPX A;  1U5T A;  3SDB A;  2ZO4 A;  1G4D A;  4A93 J;  5GTH C;  3K69 A;  1QNT A;  1MQV A;  2E1C A;  4UVC A;  3GLL A;  4XL9 A;  2ME0 A;  1BBY A;  2J0X A;  4B43 A;  4ZLD A;  1QGP A;  3TJ5 A;  2X48 A;  2CG4 A;  2F22 A;  4CUG A;  2JPC A;  3G4S I;  4ETS A;  1J8M F;  4H54 A;  3WTZ A;  1CQT A;  4CCM A;  1JE8 A;  4E6K G;  1L0O C;  4E7K A;  1DGR M;  1S5L C;  3V7C A;  1V5E A;  2HKX A;  3I4U A;  2ZXR A;  1U78 A;  3I0T A;  1Z23 A;  1Z7L A;  1FPQ A;  1FC3 A;  1S9H A;  2Y0M A;  3BQY A;  5ILV A;  2F5F A;  5F5H A;  3S3O A;  1MBG A;  3S27 A;  2LQG A;  3OA1 A;  2EBI A;  2W57 A;  3FIW A;  1I4Z A;  3VRC A;  4JEA A;  2BZT A;  5DV5 A;  1Y56 A;  2A5Y B;  3R61 A;  2LD6 A;  1LPE A;  1A04 A;  2JWT A;  4XSZ F;  2IA1 A;  5H6Q A;  3EGX A;  1D1B A;  1MSE C;  3BCA A;  3ABK C;  2B0J A;  1R36 A;  4C7O B;  4IRG A;  4UHT A;  1B9M A;  2JMW A;  2MLK A;  4M9S A;  3FXL A;  2NVU B;  4AIJ A;  3T9O A;  1FOW A;  2GDC A;  5LEJ A;  2EWN A;  3I9V 2;  1X3W B;  5CVI A;  4HW0 A;  1T39 A;  1ZLK A;  4AL1 A;  4ER9 A;  1X2N A;  4XLH A;  5CJ9 A;  1MBK A;  1J2X A;  5CVJ A;  3GX4 X;  1KQ0 A;  1VOM A;  1RRJ A;  3ZTZ A;  1ORK A;  1Y1W J;  2RRE A;  1SAN A;  3C18 A;  3TGN A;  4P1W A;  2O6G E;  4YT4 A;  4JTD B;  1O3S A;  4A2U A;  3ISP A;  1S3J A;  1ZHZ A;  2LKS A;  4NBQ A;  1D0Z A;  5FZT A;  2P0W A;  2LBF B;  3IRR A;  1G6N A;  3WU2 C;  2CW0 F;  1ZH5 A;  2J0W A;  1NBB A;  4ON0 A;  5DD4 A;  2XPW A;  4HDU A;  4V19 K;  2ZSI B;  4CYD A;  1TWC A;  2Q3T A;  4HEA J;  3U2L A;  2NVX J;  3W3C A;  2WB7 A;  1Q0M A;  3VWB A;  4U0V A;  4V2G A;  2YRF A;  1PYV A;  3GTO J;  1X3Z B;  2JZY A;  1OR3 A;  1BC8 C;  2JPB A;  2ZME B;  4BY7 J;  3PMR A;  5LEK A;  3CCE I;  3F0C A;  3U21 A;  4GDF A;  5B1A C;  1LNW A;  2BY0 A;  1G59 A;  1U8R A;  3P9C A;  2GIZ A;  3M1E A;  2EV5 A;  4G6Q A;  2P61 A;  1BI3 A;  4B6I A;  3UGP A;  2WA0 A;  3JZ0 A;  3DM9 B;  3ZQH A;  1W7P A;  1P2F A;  3BPX A;  4BHC A;  3C1D A;  3NMK A;  3WG9 A;  3BJ6 A;  4CSW A;  2DA3 A;  1GLN A;  1L7C A;  3K4K A;  3EH1 A;  4EUK B;  3LOC A;  3WTV C;  4YIR X;  4MVZ A;  2FQ4 A;  2R7X A;  2WB1 N;  4LG0 B;  1B9N A;  3HNI A;  2DFE A;  2XM4 A;  3B0U X;  3M4B A;  3WTT C;  2M45 A;  3RPU D;  3BR0 A;  4OWR B;  3FDQ A;  1FMW A;  2G7U A;  5EDN A;  1Q0G A;  2AU5 A;  3GWL A;  4K0D A;  2K9Q A;  2F4M B;  3LL7 A;  2OU2 A;  2X0L A;  2QBY A;  2DA6 A;  1BI2 A;  1HKS A;  4A3J J;  3ITF A;  3F72 A;  2NYX A;  1TTY A;  2MW8 A;  1SVM A;  1APC A;  1ULY A;  2VC1 A;  4Z2Y A;  4U0Y A;  2A6T A;  1XSD A;  3DU5 A;  4BG0 A;  5JT4 A;  1XN7 A;  3FDY A;  5E1Z B;  2IS1 A;  4NHJ A;  2IT0 A;  2Y31 A;  2ZB9 A;  4HX7 A;  3EYI A;  4RBN A;  3U1K A;  2O5R A;  1TWH J;  1YOV B;  3H5R A;  4CCK A;  4ZYE A;  1D0X A;  4CCO A;  3OYH A;  2Q9B A;  4QWQ A;  3R7C A;  1TFK B;  2L6H A;  1X1A A;  5FKN A;  4J19 A;  3GXO A;  1LI7 A;  4DNC A;  2XSJ C;  2OJE D;  5A2Q Z;  2DPD A;  1YA9 A;  3ZSU A;  2AHQ A;  3W8I A;  3CDL A;  4BKX A;  1ZRC A;  2DYS H;  4G8X A;  2PX3 A;  1LE8 A;  4WJ0 A;  4OAZ A;  3LAJ A;  3QQA A;  2K9L A;  3OS2 A;  2ECB A;  3C8Z A;  3H3U A;  2IM8 A;  5JHU A;  5E3O A;  5AIQ A;  4A3F J;  2NXN B;  2P4W A;  3Q0U A;  2LR8 A;  3DTE A;  3PQK A;  1UG0 A;  3ESW B;  3N05 A;  1RKT A;  4FT8 A;  5JLW A;  3LS1 A;  1VQ4 I;  1W5T A;  4EVI A;  5COG A;  5DS9 A;  3AAF A;  4L0Z B;  2YR2 A;  4KUM A;  2LIG A;  4C3E A;  2VJJ A;  2M0C A;  2XKP A;  5JS5 A;  3FOP A;  1B4A A;  2HFI A;  1Z1D A;  1E3H A;  3E6M A;  4OMZ A;  4YN0 B;  3RZO J;  1KU3 A;  4F4B A;  3WHB A;  2ID6 A;  2ETH A;  4E4H A;  3Q9V A;  1WJC A;  2HJ3 A;  1FTZ A;  4HSR A;  4AYB N;  1JPJ A;  4AVP A;  5IT9 Z;  1MMD A;  5IYB J;  2CQN A;  2FOK A;  3KIO A;  4M9X A;  1S05 A;  4LJZ F;  4AWX B;  4IQJ A;  1X4P A;  4XLA A;  4H0E A;  3B9Q A;  3K1I A;  2OCC H;  2XV4 S;  3ZQL A;  1ZTR A;  1PD0 A;  1XMX A;  2BW3 A;  2KRH A;  3MEX A;  2DT5 A;  1Q0F A;  2OTJ I;  3DI5 A;  3LNM B;  1X3U A;  5CVV A;  3GVA A;  2WVN A;  1E84 A;  4A3I J;  1I6X A;  1XWJ A;  3KFW X;  4YRV A;  2XSD C;  1IUF A;  4PCQ A;  5F64 A;  2XGX A;  4HX8 A;  1YJN I;  2WV1 A;  2DPU A;  2E7W A;  3V8K A;  4BDZ A;  3VYW A;  4GXO A;  2FNP A;  3FAP B;  2FOW A;  2FGY A;  3VFZ A;  3EFO A;  1OQC A;  2P5V A;  1TT0 A;  5EYR A;  1KON A;  1VB5 A;  2M7A A;  3R0J A;  3D0S A;  2VQL A;  2ZSH B;  3SZT A;  2KJC A;  3NYJ A;  2Q2E B;  1NSG B;  3O55 A;  3HLZ A;  3BOQ A;  4PZJ A;  3WG7 H;  4IXA A;  3C7J A;  2C04 A;  2K9M A;  3IL2 A;  4J00 A;  4IAO A;  3SEO A;  4G6T B;  4IJA A;  1LFP A;  1H8A C;  2EPO A;  1JAF A;  4A3M J;  3ABL C;  4NUB A;  3GTJ J;  2XDV A;  1T0F A;  5ICC A;  3JYY A;  2CQ7 A;  3U3B A;  3K4L A;  3L09 A;  1QRY A;  3EYY A;  4ESB A;  1D5Y A;  2VQH A;  4BXX J;  1LS1 A;  2WL8 A;  1YW8 A;  1YTY A;  2ACJ A;  2IA0 A;  2HI3 A;  3DLA A;  4RMN A;  2CH0 A;  4BBS J;  5LHG A;  1R58 A;  1BM9 A;  1OCO H;  2FE3 A;  1TQI A;  3JRE A;  1VQN I;  4BJ6 C;  2KKO A;  1Z63 A;  5DUK A;  3LLI A;  3KKB A;  1BR1 A;  3CES A;  5DM6 F;  1BA5 A;  3UMH A;  4X0R A;  4CHU A;  3ZDL A;  1R1V A;  4HDV A;  2DQL A;  1FSH A;  2DB4 A;  1SFK A;  3P9K A;  1ZQ3 P;  1O3R A;  4IHT A;  3GME A;  1ZRD A;  1U6H A;  4P96 A;  3EPZ A;  1F36 A;  2CS3 A;  1MKM A;  4RM2 A;  3BLY A;  1RUO A;  4FQG A;  2EFQ A;  5BPD A;  1RET A;  3LQQ A;  1T6U A;  5FO5 A;  4ZJZ A;  3E1S A;  1VQ9 I;  3DKY A;  5CLS A;  4M74 A;  4PR9 A;  3HTK C;  5L0H A;  3WAQ A;  2J9B A;  4O6Y A;  3HNL A;  5TGT A;  2L7F P;  4DOZ A;  3OMY A;  5LHH A;  4J7T A;  3HBL A;  1FX7 A;  4R8H A;  1B72 B;  3E97 A;  1QPU A;  3BG3 A;  2XXA B;  3GAN A;  3H2V A;  1VQL I;  1PV3 A;  2V6C A;  3RCO A;  1NTC A;  1XC5 A;  2UZK A;  1MH4 A;  4CS9 C;  4IZZ A;  1QZE A;  1T08 B;  3JRF A;  1IJW C;  4NQW B;  4HX4 A;  2IS2 A;  1VI0 A;  3ABT A;  2H7O A;  4MVO A;  1OCZ H;  4FX4 A;  1Y6D A;  3QZC A;  1IAW A;  4F7Z A;  3KH2 A;  1MD0 A;  4UV9 A;  2DOE A;  2A05 A;  3C8G D;  3UKG A;  1A6Q A;  1LE4 A;  4RDA A;  1B59 A;  4I02 A;  4MEX F;  3L1M A;  2HMZ A;  4JTA B;  4RB0 A;  4D4N A;  3CJT B;  1L3P A;  1YZC A;  1LEA A;  2QSH X;  2F5V A;  1WH7 A;  3DPU A;  3BJA A;  4KMF A;  4KA4 A;  2LC2 A;  3V8L A;  3A01 B;  2GM4 A;  2FBI A;  3CCR I;  1PP8 F;  5IP7 J;  5HDK A;  1IN6 A;  3SJM A;  2QQB A;  3DAG A;  3WTW C;  3HG9 A;  2H6C A;  3ULQ B;  5F27 A;  3DWL E;  5KYY A; 
#chains in the Genus database with same CATH homology
 2OJE D;  1R5I D;  3KPH A;  2ICW G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...