3KPHA

Crystal structure of mycoplasma arthritidis-derived mitogen
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
196
structure length
196
Chain Sequence
b'QNLNNVVFTNKELEDIYNLSNKEETKEVLKLFKLKVNQFYRHAFGIVNDYNGLLEYKEIFNMMFLKLSVVFDTQRKEANNVEQIKRNIAILDEIMAKADNDLSYFISQNKNFQELWDKAVKLTKEMKIKLKGQKLDLRDGEVAINKVRELFGSDKNVKELWWFRSLLVKGVYLIKRYYEGDIELATTSDFAKAVFE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superantigen
publication title Crystal Structure of the Mycoplasma arthritidis-Derived Mitogen in Apo Form Reveals a 3D Domain-Swapped Dimer.
pubmed doi rcsb
source organism Mycoplasma arthritidis
molecule tags Immune system
total genus 73
structure length 196
sequence length 196
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-11-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.530 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A mam-mhc complex, Chain D, Domain 2 3kphA02
1.20.120.390 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Hla class ii histocompatibility antigen, dr alpha chain. Chain D, domain 1 3kphA01
3KPHA 2ICWG 1R5ID 2OJED
chains in the Genus database with same CATH superfamily
4W8KA 3SXYA 5M5WJ 4LITA 4KDPA 2P7VA 1W36C 3PQKA 4QSHA 1Y6IA 2BXYA 2IEKA 2KZVA 2XVCA 5GAEJ 3L1PA 4UUVA 1K04A 2PN6A 2X1EA 3OYBA 3I55I 4A6EA 2MD0A 2TRTA 1SFKA 3KYDB 4RMNA 2MD5A 4AL1A 3G1OA 1RZ4A 4PSXA 1IN8A 2HKVA 3W2WA 3U8VA 1O3TA 1YRNA 3GTOJ 2B7EA 2R5ZA 1B72B 4PJLA 4C2MJ 3HGYA 2XLWA 1HE9A 5GPAA 3QP6A 1HC8A 4JX5A 1Y0UA 1QNTA 2HQ5A 1YS7A 3OSGA 1Y39A 3U1DA 4BQOA 1R5GA 2IGNA 2XM0A 4BEHA 4CO8A 3E7LA 4A3FJ 2HS5A 4V2FA 3WE2A 3HNLA 4N9IA 3H3ZA 3Q0UA 3ASOH 1GV2A 4P5OA 1JKRC 3VYWA 2X1CA 1OFCX 4ZTJA 4EJVA 3DLAA 3HTUA 1IV8A 1WI3A 1QPIA 3MAJA 4XOPA 3I59A 1UHSA 4IZZA 1YX5A 5BMZA 2ZJQF 1X3ZB 5D8KB 2DGJA 3SEOA 3DP7A 5EGYA 2Z16A 2DA2A 3ABMH 3FAJA 4IHSA 1TW3A 3JRHA 4OIOF 5F0HA 1AKHB 1YLMA 3TJ5A 3DV8A 1I39A 4P9FA 1E83A 1P4WA 2IXSA 4HSTA 4OINF 3GF2A 5IP6A 4WXHA 2L9RA 4DW6A 3S3NA 1ZR2A 4M63A 1T56A 4H4KC 3T6GB 4HPQA 4XONA 3CCMI 2C04A 2XAUA 2H7VC 1IW7F 4XKCA 5CYVA 1VK5A 3HG9A 4MVSA 2D2WA 2ID6A 4DZJA 2PFDA 3HDDA 2QUFA 5JI6A 1M2OA 2YZSA 1X1BA 3OYJA 3QOPA 1LE8B 4M3DA 5B5EC 1CF7A 4MVUA 4G94A 2CJJA 4OMZA 4AIJA 1IUYA 2H8AA 2RD9A 1AVOB 3F22A 2W9YA 1OR3A 3ASOC 2XSJC 2DFHA 2VIXA 3JW4A 3O2PE 5EJCA 5K7ZA 1E3OC 3MZYA 2WAQA 1TQMA 4AIKA 2M2EA 1IN5A 3F8MA 4A3LJ 1U2WA 1WJFA 4NB5A 1IRZA 5L0JA 1X1AA 3K66A 2MLKA 1ZU4A 1IXCA 5LRSA 3CCVI 2RSEB 3I58A 3ABMC 4I0BA 1TZLA 1SEUA 1S72I 3MLGA 5KYNA 1I6XA 1FOXA 3S14J 2AHQA 1R1VA 2ZKZA 3KPHA 2ID3A 3RZOJ 2XLOA 3QU6A 5EG0A 3O6BB 2Q4FA 4HEAJ 4I3MA 2K86A 3SDGA 3W6VA 2R7TA 3SFZA 1T8IA 4L0YB 1OLTA 1YARO 3S84A 2P5KA 4FTHA 3K7AJ 1YRNB 1WJAA 4FETA 2M87A 1SC7A 3DJUB 3U8PA 5JFRA 1Z6RA 2R5ZB 3S2HJ 4LLCA 3PMRA 2DMTA 1R4TA 1LE2A 4DGWB 3KETA 1RI7A 1FPQA 2FNPA 3COAC 1K05A 1U89A 4BEHB 3GEHA 3O8HA 5H2FC 4LLEA 3PL8A 1ZZPA 3Q9SA 1HBXG 5DS6A 3DWLE 2P6TA 3DBLB 3I59B 3OIPA 4LIUA 4RAGA 1VLSA 4BL0B 2P0WA 1T39A 4IHWA 2M64A 3KKBA 4LB5A 1JTYA 4BXXJ 2BV6A 3KIOA 4OAYA 4A0ZA 2DPDA 2YLGA 2HYGD 2KPMA 2JPCA 1O7FA 5HDGA 2R7WA 1FAPB 2XLDA 3RKYA 1KA8A 2YPRA 3AG2H 4DXWA 4DVYP 5HLGA 5HLIA 3GBGA 3HM5A 1LM3B 3LNQA 4I2OA 3N0TA 2KNHA 1ITYA 5JVTA 2A68F 5TJ5E 3PHF2 2QEXI 1IXSB 1EH6A 5HS9A 5J8CA 3CMYA 1Z1DA 4BS9A 4CS9A 3JRFA 5LBQA 2X6WA 3HUGA 4XLFA 2LRDA 4PFPA 2CUZA 1TC3C 2QA4I 1CF7B 4I99C 2VKVA 3S16J 2P0NA 4NCQA 2X0LA 1H9GA 1DPRA 4BXUA 4E17A 3V7RA 3B6AA 2UUHA 3ZQYA 2ZO4A 3ECHA 4RDAA 1M6TA 4GO1A 2GA2A 4YL0A 4J7TA 4MIMA 5EF6A 3ZQFA 1WTYA 2DLLA 5E18F 5D8LB 1W2WA 1SVMA 4ZC3A 1N77A 1FTTA 1S29A 3CMAI 2Q0OA 2OD5A 3K1HA 5EG0B 4OOIA 1QLEC 1BM9A 2Y0MA 5E20A 2NVUB 2VLAA 1ORKA 1V5FA 3AG2C 2MFZA 2OA4A 4XOTA 2HDCA 2HFIA 4DRJB 1BDJB 1X1DA 2EPOA 2YUSA 2F5VA 3QODA 4E6KG 5J1RA 4PJJA 1H88C 5J4YA 3OYFA 4QWQA 2O8XA 1P4AA 4E7JA 1YW7A 5K5OA 1G2HA 4W8PA 4NQWA 1LPQA 4E0HA 3BG9A 2XRNA 4M3EA 3U0CA 4M9SA 4JCZA 1EV7A 2ISYA 3V7SA 2UUZA 4J01A 1FOKA 2JWTA 4XKWA 2MSYA 1NH3A 2EIMH 2MH9A 1XMKA 5GAHJ 3C3WA 1ZLJA 2AVKA 4ITVA 1I5NA 1O4XA 3RF3A 2F6CA 3L1MA 1FY7A 2LH9A 1LNWA 2DN0A 2DTZA 4QI0A 1IG7A 4BNCA 2OPTA 3FOOA 4WXCA 3K33A 3LWFA 3K4CA 4HQMA 3CMEI 2KDOA 3OA1A 5HVQC 4XORA 1ON1A 3BJ6A 1E17A 3RQEA 4BEMJ 5L0HA 2WA0A 1WCMJ 2NG1A 4JZAA 2MLGA 3F6OA 1V4AA 2EIKC 2FU4A 5COGA 2HMQA 2E1MB 4AU7A 2WY7Q 1G4US 5A6BD 2VQCA 2BZTA 4ABZA 4YIRX 4A0XA 4G7HF 2I10A 4A5MA 4HFKB 4D4NA 1PJRA 4U9EA 4JRZA 3HBLA 3HUGB 1XSXA 1T6UA 3MFNA 4KBLA 3BZ6A 5HLHA 1OQCA 2EFNA 2FE3A 3LEVA 5CVUA 5J1YA 3TO9A 3GX4X 3ZP5A 1LVKA 2XL8A 4C3HJ 4J32B 1RR7A 1VQ9I 3PJRA 3M4OJ 5JLIA 3AQBA 3S3OA 2E1MC 3DKAA 1X19A 4HV6A 2VI6A 3QOEA 2EIMC 3I5PA 2RQPA 2R7ZJ 4CS9C 3MZHA 2J5OA 4U5HA 2YRFA 2YKZA 4QLCU 2AQFA 3G1LA 1ZHWA 2PX0A 3TQNA 3HRMA 3GANA 1JGSA 3HOUJ 4B43A 3OEOA 4WXDA 3LSTA 2OCEA 1Q1VA 3BC8A 2PFBA 1I6HJ 2OEVA 3H35A 1OYWA 1JKQC 2KISA 1V5EA 1GUUA 4PGGA 2GBYA 3GM1A 1JKPC 2X6XA 4A2UA 4P9TA 2OQRA 4OIPF 3K1IA 2ECBA 3GODA 3FXHA 2OJQA 3LNRA 3CJNA 2JA7J 2GA0A 3PFIA 3Q5FA 4NQWB 2HMZA 2AU5A 1FTSA 3FAPB 4EJTA 4CIPA 1I1GA 4KMUX 4OMYA 3LFKA 3BCAA 2BY0A 2ZXWH 3KP7A 3BJOA 1D0YA 3LSMA 2G3KA 1BA5A 2L6FA 4FHTA 5ERIA 5JHFA 2MYSA 3JRGA 1SR2A 1J7KA 5DYMA 4XRMA 1QPMA 2RREA 2TCTA 3W6KB 4AVZA 3RZDJ 1MBEA 3MCZA 4D1QA 3GXOA 5D4SA 3HB9A 3DTKA 2V9PA 3KLOA 3SZTA 2Q3TA 3C8ZA 2MW8A 5J8FA 1R36A 4AIHA 3BG6A 1Q0DA 1SFXA 3WU2C 4EM1A 1GHCA 3AG3C 5T3WA 3CO7C 1YZAA 2O9XA 4ONSA 3CJRB 3I71A 2NS7A 5AIQA 3KYLA 3A1YA 3S0XA 2QWWA 5D6FA 3DPLC 1K79A 2M34A 5E8IA 4RM2A 4BKXA 3L09A 5C4JJ 1RNLA 4RLFA 5E3MA 1UG2A 2V9KA 4KI2A 4HOBA 5JRAA 3JZ0A 1X1CA 3DE8A 2BY2A 2K9MA 2R7DA 3TO7A 2CCYA 4MTOA 1TW2A 2Y75A 1FMWA 3CCLI 2XLVA 3S93A 1X2MA 2IXNA 3E97A 3FXOA 4FASD 3REOA 4G6DA 2RAEA 2Q1ZB 5DUKA 3AOUA 4W97A 3BTCA 4NUBA 3O39A 4LOCA 2EINH 1TL8A 2ZXWC 2FBIA 2GWWA 2DAOA 2HVQA 2RN7A 2KZGA 4UUTA 2VQGA 1EA3A 4KUMA 4XR6A 3U1KA 3W3CA 4DYRA 4MQVA 1YJNI 1G8XA 3GLLA 2LK4A 4YT4A 5KYXB 2IA0A 5L0GA 1KYWA 3R0AA 4YT8A 4YT2A 4GYIA 1HDDC 4P1WA 2M4KA 2NVYJ 2RQQA 1ZKGA 2QQ8A 4C30A 2AXTC 3AQCA 2Z9OA 2CQKA 2E5ZA 3ISPA 3GTPJ 4ZDLA 5HDNA 4UVCA 5F0CA 1GT0C 4UB8C 3SEZA 2OV7A 3CUOA 3DEUA 3JTLO 5FZTA 2H09A 3ZQHA 3I5QA 2W25A 3W8HA 3IC7A 3DU6A 3ZN1A 2CQQA 4JC7A 4EHPA 4CS7A 4PR9A 2DK5A 3ULQB 3HZJA 5FKLA 3TGNA 1XC5A 2VC0A 1YHQI 2FJ1A 3GWLA 1MD0A 2EV5A 4B3XA 5EZGA 3TKYA 3CCSI 2DA4A 4U87A 1AEPA 3U2MA 3DBRB 4ON0A 1ZAOA 4QIWN 3C63A 1FYLA 1KU7A 3VDXA 5EEHA 2NVTJ 4HF0A 1Z7UA 2EINC 3QPTA 2QTVA 2A3SA 1MIJA 3H9GA 5CLSA 3TOBA 5BNGA 4CGZA 2A0BA 2WVNA 1NLXA 2VCAA 3RVZA 2R05A 4O7GA 4DYQA 2JSCA 3QW0A 3CJQB 3G50A 2J9UA 1A7VA 1S7EA 2DDAA 2HOEA 1LDKB 2LF7A 2RVCA 3D5SC 1Z5ZA 3K70D 1EQ1A 3L8JA 2GLOA 3FXJA 2ME0A 2VPRA 2VOOA 2R7FA 1FZPB 1W4MA 2ZD9A 3M79A 5GTHC 3NWSA 1Q0GA 1WGXA 2LVSA 2W45A 3VAYA 1V54H 1TQGA 2ZXPA 2IBFA 3H5NA 3FDQA 1G59A 1PV3A 1GDTA 2LCHA 1X58A 2QF7A 2AO9A 5COMA 2IYLD 1T5OA 1K6YA 4G8XA 4HBLA 2EZKA 2WTEA 1U5TA 1GVDA 1YYXA 4A3IJ 5FJ8J 1YG2A 3O6XA 4LIVA 5HLTA 3DEWA 4XSZF 3HOZJ 5JVGF 2LBFA 3UNGC 1NSGB 1X3UA 3FMQA 4KT5C 5IOYA 2AS5F 3ITFA 1IZMA 5AONA 4ZYHA 2DPUA 3B0UX 4N6HA 3CEXA 3A01A 2G7HA 1Z0XA 2OU2A 1D1BA 2XAHA 4UY8I 3F46A 2ZJPF 4A2NB 3CDHA 4AL0A 4C3EA 1V55H 3I54A 4JP0A 5D6EA 1XDUA 4IRUA 3EDPA 4JEAA 1RKCA 3UMIA 2XF5A 2CV0A 2KT0A 3KP6A 3FX3A 2UZKA 3I5UA 3WGGA 1POGA 4GFBA 4U5GA 1U6GA 3PQJA 2LTPA 3KEYA 1OKKA 3HOSA 2R25A 2KQ9A 5FCLA 2GOXB 4RGSA 1XCBA 2R02A 3WAQA 4KICA 2CUEA 1SANA 4CCMA 3UMKA 3P9CA 2QM3A 3C1DA 3LSKA 3NKEA 2RNGA 1VQMI 2OTJI 4O6NA 4YIFA 2DTRA 3JREA 1JR8A 1E85A 4MVMA 2XGEA 3SFIA 4UUSB 1DDNA 1ZK8A 3KYIA 2R93J 4RAZA 2FMYA 5DTDA 4XRFA 2IXOA 2NXNB 3O8GA 1WJCA 5FKOA 4PZJA 3KH2A 4I7HA 4D7NA 3D5RC 5IP7J 4XN3A 3CQZJ 1UZCA 4AX2A 2E1NA 4PSWA 3QAHA 5L3GA 3OL4A 2GM4A 4KFCA 2W57A 2Y69H 3G2BA 4B09A 3NDBB 4R79A 1BI2A 1JUPA 4J19A 3ZIBA 1MJBA 1FX7A 2F5CA 2YSRA 3LMMA 4HDUA 2CO5A 3WTZA 3F72A 1V3FA 4ANJA 3BQYA 3U2RA 1A0BA 5L0DA 2LYCA 3SXMA 2L02A 1C0WA 1JE8A 2WZGA 2VCBA 1KU3A 5KYYA 1WH7A 3H1CA 5COFA 1D0ZA 3WODF 2JZYA 3OS0A 3HNIA 1OQYA 2V6CA 3GZ5A 3PFYA 2HKXA 5LHIA 2O9LA 1QPUA 3DD7A 1JHHA 2CFXA 2Y3GA 3HLZA 1N78A 2V6EA 1BBHA 3JRTA 1O3SA 1YW8A 1ZG5A 1NHAA 1U5TB 2CU7A 5FD6A 3C18A 3M3YJ 3CJTB 3D5LA 1W5CC 3GFJA 1IJWC 1NZEA 2A0UA 4WABA 4HX4A 4Q48A 2ZCWA 5ILVA 3OOUA 2C6YA 3FXKA 1YA9A 3H2UA 4I44A 2HR3A 2LBFB 3WTYC 1YAUO 2HU9A 1CGME 3I64A 3TEDA 3DKYA 4WGYA 1L3PA 4A93J 3P7NA 2PBIA 3AG1H 2WV1A 3A01B 2QBYA 3HYIA 1CPRA 5K0IA 2VL8A 3G71I 4BBRJ 1P4XA 2KKOA 1P6RA 4IHYA 2D5RB 3M9AA 2Y69C 3WU0A 3HIFA 3EHMA 3M4CA 5DQZA 5GADJ 3IL2A 2EFQA 1B68A 2OEXA 1IN4A 4CIHA 4LLLA 3A0HC 5FFXA 3SZGA 1A7EA 5J47A 1A6QA 2OCCH 1X3WB 1OCZH 5EHHA 2L54A 3IKVA 2H6CA 1T01A 3OSFA 2AXLA 4H0EA 2WADA 1W36D 2I8BA 4XTKA 2BL2A 3ABKH 1A35A 3NYLA 4RGUA 2XKPA 3VYRB 3HTKC 4F93B 1SD7A 2K85A 4OIRF 4N6CA 3QWLA 3ZC4A 4DOZA 2V1UA 2HPIA 1XCVA 3AG4H 4IRGA 1Z21A 2L6GA 5LGTA 4HA8A 2NSGA 3UKGA 3RQGA 1O57A 2HKOA 5IYDJ 1SVLA 3QPLA 4WGZA 2GIVA 3CDLA 3E6DA 1VF9A 5FD5A 1RXQA 1Y4CA 4IRIA 3U5SA 1UFMA 3GM2A 1BN5A 2OBPA 3CUQA 3PUFA 4ZZLA 1YZCA 5A6JA 3AG1C 1PDNC 6PAXA 4XICA 3J80K 1U0BB 3S1MJ 4YIIA 4ZYEA 3OYDA 4GEHA 2A69F 1B59A 5BQIA 3P9IA 1TWGJ 2K3PA 5H6RA 4KIFA 3L34A 1HKSA 1J8MF 3FIWA 1Z3XA 3ZMTA 2E71A 1SZIA 2OF7A 1SFUA 5KYYB 4O3MA 2XF6A 2OCCC 3BY6A 4QTRA 2ZFWA 1MMSA 1OCZC 3SXZA 4UB6C 4NC8A 2J5PA 2O6GE 1G3YA 2DJNA 4YL3A 1ZH5A 2R3SA 2XS1A 4G7OF 4C2TA 4BE2A 3ABKC 2BYVE 4R1HA 1GVJA 2VE9A 2CW7A 5HDKA 1ONVA 1TQIA 2PMUA 4DZPA 3KCCA 1Y8RB 2M0CA 3AG4C 2AQEA 1FNTc 4Y17A 4ASNA 4W1UA 3HJEA 3ZR8X 2QBYB 4XLEA 4A12A 2NOGA 4NNJA 4XIDA 2DT7B 1WWPA 3FMRA 2KMUA 1Z23A 2A6EF 4HX8A 5ICGA 4EGYA 2KRHA 2R92J 1YYJA 2KGOA 5L3QA 2L4MA 1SFOJ 3ATPA 3PSFA 1HKTA 4MEXF 3ZVRA 1RPWA 1BW5A 2DQRA 2VN2A 4M3FA 4BHBA 2ISZA 4UVAA 2VOPA 5KAFC 2VASA 3TOLA 2H7OA 1K61A 1U8RA 3DPTA 2DA6A 4YG2F 3HOTA 5DLJA 1R4MB 1BBYA 3CCQI 3J7AO 2VBYA 4BAYA 3ZQ7A 3ZGKA 2L7MP 1YJWI 4K1OA 2Q00A 4IGGA 4BHPA 1EF4A 2DXIA 1S7AA 2KIMA 2LQGA 2X4HA 5E79C 4A69C 2J0WA 3EYIA 1A7DA 2W84A 1T33A 2JK3A 2GDCA 2JX0A 1OPCA 5D92A 3K4JA 1V74B 3HEFA 2CYDA 2NUTA 3CUQB 4A3EJ 4CDVA 3JSOA 3B0PA 1SAUA 1VQ4I 1TWGA 1BI3A 2CUJA 4EM2A 5L0FA 1KU2A 2K7LA 1OCPA 3IH3A 4FISA 4Y33A 1GM5A 4HEA2 2HZTA 5JVEA 3LS1A 1T08B 4CCKA 1IRGA 4J7YA 3DTIA 4YFKF 3ZTZA 5KYWA 1PUFA 2Q2EA 4IQ4A 5JR3A 2EPKX 2XL4A 3CUQC 3LSHA 3BR0A 3K4LA 3QQAA 2Q9CA 2EFPA 3QRFF 3B29A 4HE8D 5DDGA 1VQNI 2CQXA 1JRAA 4LACB 2XM4A 5E1ZB 3ECOA 4AVPA 1TP4A 2P5VA 3V7CA 2L0KA 3HRTA 2Q9BA 3RW0A 3TOAA 3ZMDA 4MQ9F 5K1YA 3GWNA 2HTJA 2R03A 1KZHA 3T4RA 4MVQA 1A04A 3A2KA 1F5TA 3QTHA 3CSKA 2IS6A 1XG1A 1BR4A 3KFWX 4FQGA 3VODA 2MG4A 2VBZA 1D5VA 1F1ZA 2RGVA 2ZXJA 3J7ZI 4IEJA 4XLNF 2AWYA 4F91B 1RCPA 3M8JA 4M9XA 2AWCA 2VUMJ 1AWCA 1BC8C 3HSRA 4BBSJ 3DMDA 1Z91A 1VQPI 4HYEA 4G12A 4EGZA 3SZPA 2P6VA 1N25A 2DMPA 2FMLA 1YS6A 2ZXOA 3FOPA 3FXRA 1IDYA 3S90A 3ZMVA 1UMQA 1I3QJ 2FOKA 4M72A 4C7OA 2JA6J 2M7AA 1RJ9A 3T1BA 3J80Z 4PUSA 3HGGA 2FNAA 4L5JA 4OD4A 2HQRA 1L3LA 3I3LA 5C44J 2A6HF 3BR6A 1VTMP 4BJ6A 1JJ6C 2YU3A 1VZ0A 4A3CJ 3AGUA 3H65A 5AC5A 5BPDA 3FKJA 2Y30A 1NBBA 2VQLA 1H0MA 1TT0A 3OR1C 1SMTA 4EATA 2NUTB 3FWEA 3CLQA 1KYZA 4BDYA 1N1CA 4EEFG 1IN6A 1IUFA 1C17M 2Y31A 1I5ZA 3DFGA 2VJJA 2P7VB 5LHGA 2WAQN 3R60A 4Y4RA 2VQHA 1S7OA 3RH3A 1JT6A 5F04A 1PUFB 5KYWB 2Q2EB 1IRFA 3E9VA 1XMXA 1ZRFA 4L5IA 1JGGA 3J7YJ 4HZFA 4TV7A 3RKOF 3IRQA 3F23A 4C3BA 1L0OC 1U3EM 3CD6I 5DD4A 3ABTA 1TWAJ 1T98A 3VB2A 1JOGA 3HL2A 1A31A 3FHNA 3JT1A 1XGSA 3MD2A 4U0WA 3V8LA 2W85A 3A0BC 4LMYA 3B71A 2X0CA 2V1DA 3CDIA 1XGMA 2Q7RA 1AUEA 3K1PA 4JQFA 2M30A 2E2HJ 4Z2YA 2O8KA 3ZQCA 3KZIC 1J59A 3DZAA 5D4RA 2R7SA 2BHYA 4G6TB 1LS1A 3HSFA 2MC4A 1E3HA 4IARA 4BY7J 3LOCA 3RKXA 5DM7F 1DU0A 3CO6C 4KT6A 2G62A 3EZHA 1ETVA 2P7CB 4ZH4F 3JSPA 4FX5A 4RDUA 5BQHA 1V5GA 4JX4A 3A03A 1HQCA 2M3AA 1FBSA 4M3GA 1H7IA 4FE7A 1S05A 5CJ9A 4BJ1A 2ECCA 2J7PA 3C7JA 2FXAA 3G6EI 2RNJA 2KDZA 4IRHA 4IOAF 2O61A 3B02A 1JXSA 1PP7U 1OW6A 2IXPA 4EKWA 1X1PA 4C7OB 1LI7A 3JTHA 1RJ9B 1SYQA 5F5FA 1NTCA 3F9KA 1V4RA 2VXDA 1BZ4A 2Z99A 3LSPA 1FBQA 3QYFA 2F4IA 4FWVA 2FBKA 3T6JA 1MMDA 1YJGA 3IAS2 3SYTA 4KISA 1DOVA 2KRCA 9ANTA 3BR1A 1XWJA 5AC4A 3M07A 1FYKA 3ZG1A 4C3DA 5F5HA 2DFIA 3OIQA 2KW3C 3UMHA 2PP4A 2ZXHA 2BHZA 4X6AJ 2VB6A 5LHHA 2IBDA 3GFIA 1U78A 3RJPA 4U5FE 1WJEA 2XIGA 2CGPA 1EKYA 3DLLF 4D5FA 4XLAA 4CYCA 1S9HA 4IAOA 3JAMK 1LIHA 5EYRA 4M6XA 1ETWA 3TO6A 5IPAA 2MC3A 4MEYF 1Z9CA 2VC1A 5B1AH 4I1MA 4BJ6C 2PQ8A 1AOYA 3S28A 3BDDA 3BOQA 4XLPF 1WJ5A 2YS9A 5IT9K 5FRNA 4XPWA 2ZC2A 1UJ8A 5HOOA 3FDYA 1MMNA 1LB2A 3RCOA 4U0YA 1GS9A 3K4BA 1FIAA 2EIKH 3EUKL 4F55A 1G3WA 1TWAA 1BI0A 4N4OB 4K2EA 2F5FA 2KJBA 4Y52J 4AC0A 5JP7A 4M73A 3I4UA 5CIVA 4RM3A 2E1OA 3HC7A 3K2AA 4B1RA 2RDPA 5AIPA 1HW5A 4LD5A 2CW0F 1PD1A 3MKYB 5D91A 1O3UA 1WJBA 4U5BE 3WU1B 3GEEA 3QU3A 5JSLA 1OR2A 1XX5A 1FFHA 3DTEA 2B0LA 1E0EA 4ULWA 3VRCA 5CVIA 3DE9A 3KLNA 1NG7A 1VQ5I 1BOAA 4JE9A 3FXLA 1E3PA 1Z3IX 2HVSA 2IVMA 4NY3A 1MH4A 2EQRA 3I0TA 5B1AC 1A41A 4NQFA 5TGTA 4Z6YA 2J9WA 2JVHA 3K4KA 2A1DD 3CP2A 2BBYA 2CG4A 5HS7A 2D4UA 2EK5A 4LGWA 1JMWA 4E7HA 4BDZA 1C03A 2BXZA 2H8RA 4RB0A 4QPOA 1XDSA 3KP2A 1BL0A 1QHHD 1F1MA 2XL6A 4YN0B 3WGHA 4BUPA 1MMGA 4QI2A 3HXLA 2MGQA 3FZVA 1XSDA 1PUEE 1H89C 1KQ0A 1MDMA 3EH1A 2DJIA 4AIDA 4MGRA 2KJCA 3TP0A 2EPFA 1YW9A 4B4CA 1LPEA 3KEOA 1XB4A 4AYBA 4CYCB 2HQNA 1D8KA 2QQBA 3HHGA 5CPRB 3CCRI 2OQMA 4DRHB 5CQEA 3MBGA 1HCRA 4R8HA 2QY9A 3LESA 4KITB 2WVOA 2ZB9A 2VBWA 3Q9VA 5ICCA 1I50J 3ESWB 3T8RA 2KIFA 2O7OA 5HNHA 3DXJF 1CQTA 3BJAA 2AP3A 4JEBA 3HRSA 1QHGA 3AG3H 3GLXA 2Q9AA 3PO2J 4CUGA 1VQ7I 4HLYA 3TOMA 3Q6MA 4FAPB 4BHCA 2WVQA 4Z9JA 3JYYA 2W00A 1VQLI 1OKRA 5H6QA 4EBBA 4I98B 3ASNH 2GXGA 3HOXJ 2ELJA 3OR2C 4FE4A 2VKDA 2YL7A 4BACA 5DS4A 3K2ZA 4DRIB 5E33A 2J8WA 2NPUA 2VE8A 2WB1A 1VTNC 4L5EA 3IEEA 1IGNA 3JSEO 3KX2A 4J30B 4CCOA 1VYKA 4J00A 4A3MJ 4MS2A 4U0VA 1G6NA 2XDVA 5E3LA 2HVRA 2WB1N 1BJAA 2A5YB 1WJDA 1WVRA 3A4CA 1BIAA 2HOSA 4KMFA 2ZXRA 1ZYRF 3GZNB 3RYPA 1HXDA 4Q7CA 1LDDA 2HFHA 1WQ2A 2NS8A 2QZ8A 4XLCA 5H20A 1YTYA 2DMQA 4D0PA 1F4KA 3GZ6A 4L18B 2DA5A 3PCVA 3Q0WA 4BG0A 3KMIA 1XS9A 2EA4A 1BC7C 1N75A 3EZIA 1KONA 3DQVC 1DP3A 5FGMA 1VMAA 3BPXA 3CF5F 3JAMZ 4RBNA 2OAZA 3GWZA 4U88A 2XLHA 2Z33A 1JKOC 3SP1A 2QKLB 2E36A 2JRMA 1MSFC 1PVEA 3ASNC 3DM5A 3BG5A 3DKWA 5F1RA 3H2VA 1MDMB 1RUOA 2CV2A 5IT9Z 3O10A 2LF8A 1RMVA 3WTWC 1UAAA 2D1HA 3NRVA 1HE1A 2L3DA 3EH2A 2MWQA 3CC2I 2LY1A 2LC2A 4WX9A 2J0XA 4F92B 2G3VA 4YT5A 2ZNZA 1O87A 2ADUA 1FEXA 3CLOA 1HSTA 4N06A 4EJUA 2ZMEA 2R7VA 5ICEA 4CCJA 1UELB 1FP2A 3NQOA 3SDBA 2E2IJ 4IB4A 5IT3A 2PX9A 2IS4A 1HY5A 4RB3C 2A05A 1UB9A 4IL6C 1OMIA 5F6FA 2FBHA 4IHVA 2C03A 1KGSA 2CSOA 2DU9A 3CCYA 2Y9ZA 3RPUD 2LY2A 1YOVB 2QYOA 1ZN2A 4A0YA 3AAFA 3PIPF 2CNWA 2K9QA 5LEJA 2F22A 2OUMA 3K7DA 1TWFJ 5EK0A 2VJ4A 3S3MA 4ETSA 3GVAA 4BQAA 4CS8A 1B1BA 2CUFA 3C8GA 2K5CA 2CYYA 1W7PD 2PG4A 3IQ6A 4EJWA 1KNYA 3RPUA 3TDUC 1TFOB 1WHUA 1RKWA 3UR3C 5E1XA 2ELHA 4KNWA 4DJ9A 2IXMA 1ETOA 2WZFA 1MMAA 2JA2A 4F4BA 2L9NA 2W4MA 1W7PA 3WG9A 4OU0A 5LGNA 3HJCA 2QCOA 4YJWA 2LR8A 4YFNF 3K1IC 5CVVA 1DPUA 2CWEA 2DYSH 4Q5SF 3HNKA 4CBEA 3J7AY 3EUHA 1P2FA 4JOMA 3TW6A 2JTVA 5L3FA 2YR2A 1B6AA 1IV6A 4AK9A 3K9TA 4KIGA 2EA2A 4P9UA 2BEOA 2XROA 2COBA 2L7FP 4JURI 1T0FA 2EILC 4I76A 4YL1A 2KIQA 3GCMA 1XN7A 3CC7I 1WGWA 2IA1A 3I4MJ 1MSEC 1LFPA 2DMUA 2D1VA 3TQOA 2O03A 4Y15A 1IDZA 2EIJC 4KC9A 2M1BA 3LSRA 4RAFA 2KQRA 3PIOF 3CCJI 2D45A 2H1KA 3Q6NA 2LOOA 4MFDA 3DBHB 5FKKA 2IOQA 5E3OA 3JRCA 1OCCH 4N9HA 4IF4A 4NBQA 2CQNA 3BG3A 1SFEA 2YVKA 2ELKA 5HS8A 2DA1A 2LDUA 1R1UA 2QNLA 2OU6A 1YYVA 2ZMEB 2FAPB 3NYJA 2HJ3A 3ERED 4FX4A 1I4ZA 4G6QA 3TP3A 4LK0F 2R7QA 4MNUA 1K4TA 2ZJ2A 1OKKD 2DYSC 5TISC 1TWCA 3DJNB 3E70C 4N0BA 4MVOA 2K4BA 4XQ1A 3TMOA 2HZDA 3F0CA 3U9GA 3OL3A 4JTCB 1CGNA 4A3JJ 3ZQQA 4HDVA 4G78A 2QLZA 4HW0A 1BIBA 5FO5A 4GRIA 2ZMEC 3VM6A 1R22A 1SF8A 2FEZA 2RV8A 5DCMA 4I1OB 1XGNA 1LFBA 1YE9A 5F08A 1FFTC 3C8GB 1SD6A 2P5LC 1T9KA 4BQQA 1Z63A 1HDPA 3HKKA 2UV1A 1ZHYA 4L9TA 3J06A 2YL3A 5FLXK 3BP8A 4NC7A 3GEIA 5FKMA 1OCCC 4LB6B 3I4NJ 4IWBA 4A3GJ 3T0YA 1W7PB 3VOEA 3T6BA 4AUXA 4RGRA 2HXIA 3FK6A 1MKMA 4LG3A 3IP4B 2COMA 1WRJA 2VPLA 3G4XA 4CS8C 2VH3A 2O5RA 1B8IA 3DI5A 3HKZA 3EETA 3QP5A 4X0RA 4MVRA 3DAFA 2YHSA 4N4NB 4IXAA 3R4KA 3PO3J 3NWTA 4WCGA 2F2EA 3GYHX 3M8EA 3ZRGA 3NYMA 2A6TA 2KYHA 1MJAA 2LLKA 3E5XA 1PCXA 4A4AA 2EPNA 5B3IA 3HKZN 3QZCA 1UG0A 3S2DJ 4LDRA 4LJZF 3HTSB 4LLGF 4MTDA 1XPXA 3OMYA 2QKMB 3T5XA 4C3IJ 3DU5A 3B9QA 1S7ZA 3EFOA 2O3FA 4A3KJ 3OYHA 3GTGJ 3N2ZB 3E6BA 4GYTA 3EUHC 1J5YA 1ETXA 1PP8F 1NU9C 2VJIA 3N05A 1MH3A 3H0GJ 3TK0A 2GXAA 2EZHA 4UDVA 3S1QJ 3RQFA 2FQ3A 2PJPA 1XGOA 3OYEA 1WOLA 3HRUA 1FLIA 1T2KA 1ETYA 1MNDA 1OYYA 5J6XA 3WTSC 2LD5A 1JI8A 1CGOA 4E7KA 1NFNA 4ENJA 1Z7Qc 2HSQA 2XPVA 2ZBKA 3S15J 3JRDA 1E84A 4Z9HA 4D9JA 1JT0A 4JBAA 3HOVJ 3NG1A 2QENA 4E7ZA 3N97A 4DNCA 3IQ5A 2HYJA 4DVZA 4XEVA 1ERDA 2IW5A 2XRHA 1U5TC 3G4ZA 3ELKA 1ZTRA 1ORSC 2LKPA 4M6VA 2R9RB 2B0JA 1QA6A 2LD6A 1DQUA 1HMDA 3H9QA 4FT8A 2MA3A 3OYAA 1J09A 3IAM2 4MTGA 5K7HA 2GIZA 4BGDA 1CGPA 3TJ6A 3FXUA 5DCMB 3KP5A 2DFFA 1VLTA 3PDMP 2IPQX 2JSPA 1TTYA 2F4MB 4YELA 3VYUB 1ETQA 2Y0SA 1TLHB 2EH3A 2YL0A 1Z67A 4II3A 4LDQA 1ZRDA 1ORJA 2HJMA 1TNTA 5TJJA 2OKUA 2NS0A 4F52A 2P6SA 3NRHA 1R58A 4JX6A 1B8IB 2RKHA 1KQ9A 1AU7A 2KC3A 3K4NA 3TW7A 1QGPA 1K6OA 1SMYF 4RAYA 4XKVA 2VCCA 3MKZA 1F36A 2VBXA 4ESBA 1ON2A 3K4MA 2QSGX 1UHMA 3RVYA 2R0QC 1FOYA 1QQIA 1LI5A 3OYNA 4JIOA 2DFEA 1NK2P 3SQNA 5IY5C 3LSJA 4WJ0A 4DQ2A 2ETHA 1QQ3A 3EFOB 4CSAA 1UHWA 2L7ZA 1G5ZA 4B6IA 5D5XB 4LK1F 1IC8A 5FB2A 1XTAA 1T6SA 1T38A 3ZSUA 4LDKA 1Z3YA 3SNHA 3F8NA 3AFHA 3BRJA 1P7IA 1HLVA 3CESA 1YJ9I 5BPIA 5GPGB 3DAGA 2KLOA 2K3FA 1VQKI 4HF1A 3JRIA 4ENNA 1TBXA 1YVIA 4IAQA 4BU2A 1WPKA 1JTXA 3JCUC 3BQZA 5DV5A 1W0TA 2IJLA 1MBFA 2P1AA 3WTXC 3OY9A 2FOWA 4C3JJ 3JRBA 2V1XA 2V4JC 1KQ8A 1Q0FA 3IWZA 3HOYJ 1QSPA 4K7BA 5CVJA 3US6A 1DUXC 2E7XA 2B63J 1UCRA 1Q1HA 5LD2C 2ACJA 2H7BA 3V8KA 4RB1A 2VODA 2X85A 2DOAA 2OJED 5LRRA 1SAXA 5FLXZ 3TDZC 2Z2SB 2NNNA 2Z1DA 2IGKA 3L2QA 4FCYA 2H1LA 4L9JA 4FX0A 4CHUA 2QUPA 3EPZA 5EEGA 4DBQA 3MX3A 4JKVA 2K9LA 2BOLA 4CZZA 4UHTA 3BZCA 1AHDP 2XSDC 3F8FA 1BR1A 1WI9A 1MJ9A 1F9NA 3RPQA 1Y8QB 1ZHFA 1BW6A 4EV0A 2R5YA 2TMVP 4PACA 3U9MA 2FX0A 2YWAA 3LEOA 2L9VA 3H9JA 5B3SH 5JLXA 2R7UA 1VQ8I 3CMMA 5M3MJ 3OS2A 3IKTA 1TWHJ 5JS5A 2Y2ZA 5J3LA 3MFKA 2IT0A 3CC4I 2FFHA 4S05A 3L2WA 2IRFG 2A61A 3GW2A 2LIGA 4OWRB 2EZLA 2FUG2 5GP9A 2G9WA 2K4JA 1LQ1A 2VXZA 2CGEA 4HV5A 2LG4A 1D5YA 4HLXA 1M1EB 2HGCA 3L2CA 2PMZA 3R61A 1ZHZA 2FD5A 3IPMO 4U9DA 2EWNA 2RC4A 5K5RA 1RRJA 3NMJA 1O3RA 5DS5A 2M4GA 1ZELA 2Q8KA 1JPJA 2QQAA 2PNOA 2IM8A 3AGTA 2V26A 3M7GA 4GYGA 4E7SA 1E2XA 1F43A 3V42A 1QKRA 1BOBA 3SZRA 5A6AA 5D5WB 3UGOA 3KP3A 1Y1WJ 1VI0A 1AA7A 1Y1VJ 1EH8A 2L5QA 5J4VA 1R4NB 1CPQA 3EGXA 3OIOA 4U5DE 5BQTA 1R1TA 2LK2A 3ML6A 3K0LA 4LG0A 2EFWA 2ASRA 1SD4A 1JUMA 4M71A 1WKMA 3ZMUA 4QPQA 2QVOA 3ROUA 4M3BA 5B3SC 1U8BA 2H27A 2KP6A 4RA2A 3LAYA 4DJAA 4CSAC 1S5LC 1S8NA 3RKQA 2F5DA 4HRIA 1EJ9A 2IGMA 1LEAA 4UXNA 5BS6A 2PEXA 1YQAA 4EIYA 4PJNA 5A6KA 3EG9A 1ACIA 3M4BA 5GTIC 3V5XA 4QDLA 1IZ1A 4Y13A 4CXFA 4RS8A 2XPWA 3E0JB 4V2GA 1FMVA 4AD9A 3NMIA 3V5ZA 2HOAA 3VYSB 2UUIA 3GTJJ 4G7ZF 4O6MA 4DIQA 1HW1A 2E34A 2KHMA 5KAIC 1STZA 3FXQA 3MWMA 2G7UA 2DB4A 1IO2A 3E6MA 4JYKA 4KYWA 1GQAA 1OW8A 4PDKA 4WWCA 2R5YB 2LFDA 5T1DB 2E19A 2KK1A 3NKDA 5KNLA 3I53A 2XAGA 4EM0B 3GTKJ 1TWHA 1FNNA 3D0SA 1GXPA 5DCFA 5EZHA 3EJNA 1U6HA 4E7LA 1NG6A 1BR2A 2HDWA 3H5RA 3IQCA 4A6DA 3FVYA 1OCRH 4E70A 1FIPA 1RUNA 4IJAA 4XM3A 3VWBA 1VFCA 4ZYDA 2XPUA 3G1MA 5TRDA 3LLIA 3S1NJ 2JPUA 2IGOA 2HNHA 1X4OA 3BEHA 2BVMA 3LQQA 1O3QA 2L9JA 3ZDLA 1M2VA 1O7LA 4XNFA 256BA 2QSHX 2CMPA 2K27A 5DUIA 3OS1A 1FC3A 3ZN0A 4DYCA 5LEKA 4MTFA 3BTLA 4C2UA 5BQGA 2XV4S 3EGXB 3BTIA 2XXAA 1OR7A 3M1CA 1G3SA 2XHKA 1M56C 1NG1A 1YA7O 1MBKA 2X9DA 2DYRH 5ILSA 3E3VA 4CZCA 1YO5C 4ULVA 4LG0B 3E6CC 2LP0A 4D4XA 3NEUA 2WL8A 4L9VA 3H36A 5D5VB 1LS4A 1J8YF 2ESHA 4CJOA 2IP2A 1ZREA 1ZGWA 3JRMO 2BC5A 3HPHA 3F8CA 1OCRC 2K9NA 4XL9A 4I09A 3RYRA 3H0DA 1Q0KA 1OXKA 1YX3A 3NARA 2OOCA 3EG9B 2WZLA 4NTBA 2J7PD 3LAJA 4RGXA 1REPC 3GMEA 1H9TA 1MNMC 4MW3A 2ZXIA 3LFUA 3KL4A 4HAMA 1LVAA 1FYMA 2IS1A 2ETSA 2XASA 2NAZA 3OYKA 3QPHA 3RTRA 2EZIA 3ZXSA 2LKSA 2I5UA 4I01A 3ZPLA 1XZPA 2YQYA 1R23A 3ABUA 4PK4A 1MZBA 2NVQJ 3W8IA 4AWXB 5DS9A 2E60A 2OZUA 2HQAA 3MQ0A 5JLWA 1FR0A 2R7XA 3CAXA 2DYRC 3JR9A 1NU7D 1LDJA 2M8GX 2HSBA 4XEKA 4KIBA 1X2NA 4IQJA 2V79A 3LA3A 2FRHA 2YX4A 2HXOA 1R5ID 1W1WE 3C2GA 2DT6A 3MEXA 4CH7A 1P92A 2YX7A 2BY1A 2M0MA 1ZRCA 2ZSHB 3OV8A 1BJZA 2GWRA 2LMDA 2NYXA 3I9V2 5LGUA 5M5XJ 2YLIA 2CH0A 3NAUA 1W5TA 4HFFB 4L0ZB 2NUPA 4NC3A 2MABA 1WATA 3I4PA 1RR8C 1J9IA 3WTVC 2ZJRF 3FF5A 5DD8A 2DI3A 2GZWA 3L8IA 3FBIB 1M2VB 5EDNA 3F3XA 2L7AA 3SXKA 5L0CA 4M9ZA 2A07F 1HSJA 2PJRA 1XZQA 1ZG1A 2OZ6A 4JVSA 3L9FA 2LREA 3OYLA 5T3TA 4BH9A 3K1MA 5L3DA 2J45A 2XS8A 1R71A 2P4WA 4CA0A 3M1CB 2XXAB 3V4GA 2CFOA 4A3DJ 2GOMA 4ZLCA 3OYGA 1XSVA 3I56I 3MN2A 5M5YJ 3VSLA 1E86A 3IWFA 2TDXA 5E3NA 3SJMA 5K7FA 2JJ7A 5KVRA 1J0RA 1Y0NA 1APLC 3QW1A 2M9HA 4S0HB 3HOWJ 1ZVZA 5D5UB 1WSUA 1H8AC 4B48A 2FQ4A 5DVWA 3KYJA 5CI9A 1K78A 1I27A 3R6SA 2EB7A 1OR7C 4I6ZA 3K69A 4NC6A 4B47A 2UXXA 5L3BA 3GTMJ 1FOWA 3E1SA 2QQ9A 4WK8F 1IN7A 1ZARA 2VKEA 3S2WA 5HV9A 1ZHXA 3GTLJ 3Q3SA 2M5WA 3H3UA 3P9KA 4XQFA 1U9OA 4YFXF 5B66C 4KN4X 5IP9J 2P61A 2I8DA 2FGYA 1ZGJA 4XSXF 2L01A 1OXBA 4U7BA 2Z15A 4E18A 3LL7A 2VKHA 1YDIA 4H54A 1USTA 3LSIA 2X48A 3G4SI 2ZSIB 4A3BJ 1HW2A 4I02A 2K02A 4BJ5A 1LFUP 3U2LA 3VYTB 4B44A 1FWZA 4E0IA 3RDIA 1LEBA 1T95A 4ZYAA 4ZLDA 1DGRM 3MKLA 4PFOA 2PMHA 3LJBA 1MBJA 4MFEA 1QVUA 2BY3A 1FSHA 2Y39A 4L9NA 4F7ZA 2ZNYA 4XPXA 3ZMZA 5ICFA 2VT2A 3BTJA 5GPCA 3T9OA 1M57C 2LFBA 4Q4ZF 2WWYA 4BE1A 1EA8A 3QVYA 3GM3A 4E4HA 3CZ6A 3WHCA 5B1BH 4II2A 3S17J 2NUPB 2K40A 2DQLA 4JCHA 3IRRA 3ECSA 3V7OA 4RBOA 3S9OA 2GAQA 3QPSA 4Y7NJ 1R7JA 5AGFA 3WGIA 4JW1A 2X51A 4AYBN 4PCQA 3LS0A 1RKEA 3RYLA 3M1EA 4JJFA 2FF4A 2PJRB 4JTDB 1QVTA 5E8GA 1ETKA 3FM5A 2J9VA 2R4GA 2STWA 2LSEA 2GA1A 2W4BA 1Z6TA 2IA2A 3CTAA 5A6BA 4XBFA 1G4DA 5E17F 3N4MA 2VONA 1ZLKA 3ONQA 1FBUA 3GORA 3FMSA 2IS2A 5ED4A 4GXOA 4BE0A 4XN0A 1RKTA 2HI3A 4UNOA 1R6RA 3GFLA 1K40A 3LLKA 2F4OB 1K7AA 1WWXA 4XWJA 4MLOA 1DGWY 4NDLA 1K78B 4N4WA 2KJGA 2F5EA 2HV6A 4IJJA 1C02A 1JUSA 3G73A 5C4XJ 4NHJA 2DOEA 2WAEA 2VC9A 1YITI 5B1BC 2UXNA 4X1EA 2BW3A 3A9CA 4AE4A 5EEAA 4BYYA 2L9SA 4DBRA 5A2QK 1T6QA 1QZEA 4ZTFA 5BOXA 2CDQA 5HNFA 4CCNA 1K4SA 1DU6A 2JMWA 5KYXA 1USSA 4KNYA 2H8WA 1S6LA 2LNBA 3IV5A 4PJ0C 2BVLA 3JTGA 1D0XA 4CICA 3PNVA 4HNTA 1HKQA 1WN0A 1ZHTA 1JJ8C 4G9YA 3T8TA 3W2VA 4PGHA 2HDDA 3ZQIA 1UFBA 2LKXA 3LQRA 4RLQA 1Z6AA 3Q7GA 2B9SA 4IOCF 2YU9J 4BJ5C 1J2XA 3BROA 2JA8J 2YLDA 3PNTA 3DEEA 3WE3A 1QRYA 1I3AA 4ENKA 4B8XA 3Q7LA 4ER9A 5M3FJ 2DOFA 2NOJB 4HNUA 4CJGA 2X6YA 3EYYA 3S1RJ 4U7DA 1RETA 1D3YA 1OCOH 3WTTC 1GLNA 3DWWA 1RKEB 1J75A 3MKWB 1X4PA 3KZYA 1TT5B 2XGDA 2CV1A 1Y56A 2JVGA 2QLAA 2JQ7A 3L2RA 4KJZA 5LFAA 2CNWD 5C3EJ 1TWCJ 3L7WA 2XLMA 2Y3BA 2DO7A 2W7NA 2EILH 3BR2A 3PSIA 5F64A 3C8GD 5L0IA 3SEQA 1ZW2A 2DK8A 3W6JB 3FXMA 3H3VK 1LE4A 2D5VA 2E87A 1EKEA 2EIJH 2OTLI 3ZWIA 4RB2C 1OJLA 1K83J 3J81K 4ESFA 1TR2A 2KSFA 3BR3A 1G4WR 2W82A 5LLQA 4EBJA 3U9JA 1Z05A 2HUJA 2XUBA 2BE5F 4ZDPA 5IYCJ 3QYBA 3KYCB 4X0GA 1P9QC 3E5UA 3POVA 3K10A 3Q0VA 2BW3B 4AE4B 5KCMA 3TBIA 3H5AA 3R2PA 1OCTC 2Z3YA 4O5VA 3V8JA 1RIOH 1OCOC 2GFHA 5L3EA 1YLFA 3LA2A 3QVZA 3HPGA 5A69A 1RESA 2DA3A 5K5QA 5FRMA 2EPMX 2NVXJ 4Z9IA 3S27A 3BLYA 3WHNA 2EBIA 4MTEA 5E1WA 2JUGA 3X2QH 4P6IC 1YIOA 3ABLH 3FISA 1B4AA 4UV9A 2N8GA 4NTAA 4CSWA 3L0IA 3O55A 2Y48A 3N24A 1QU3A 2HEOA 4XEFA 1FP1D 1MW7A 1B9NA 1ENHA 2X1DA 4UUSA 3VPRA 1OW7A 3IQTA 2H94A 4S04A 4Y3OA 4P55A 1WZ2A 1A5JA 2QSFX 5FKNA 3IH2A 4L6RA 4I0AA 1LJ9A 4HX7A 2EPLX 3MYFA 1D1CA 2M7BA 2CS3A 5BUOA 2KL4A 2L4AA 1MBGA 2QGUA 1ODDA 1Z77A 3OOPA 3VFZA 2PI0A 1I4YA 3CP8A 4LFUA 4KA4A 1QZYA 4KN7X 3GTQJ 2CQ7A 2YEVA 3LNMB 1WASA 1IXRC 2BGCA 3JYHA 4XRSA 2XC7A 4BQNA 1HF0A 1DOWA 1TNSA 1QZZA 2J46A 4R32A 3RIPA 4BJTA 4RD9A 3K6GA 3RSNA 4CDGA 2XF7A 3B0VC 4GCVA 3WTUC 3V5YA 2XKOA 2EV0A 2GXBA 3KP4A 2DDBA 4GGGA 4HSRA 1GV5A 4CYDA 3MVPA 3F21A 2V1NA 1FTZA 3UGPA 3ZQLA 3X2QC 1Q0MA 3ABLC 5E2QA 3DKXA 3KZZA 2O0YA 1H6GA 3GO5A 2KIUA 2W1OA 4Q47A 4FESA 4XMYA 1U0JA 5HODA 2L2OA 3L2VA 1QZXA 1ST6A 3S8PA 2DW4A 5A2QZ 4M6YA 3ZCOA 1IAWA 5CI8A 4IX7A 2L81A 4CCLA 3BZKA 5JHUA 2MHRA 1O5HA 4M74A 3IH4A 5F27A 2QE9A 4EUKB 1JPNA 4IPAA 3OYMA 2WC2A 1GGQA 1HA8A 4EMSA 3DM9B 3SYNA 3RKWA 3JCUQ 3AKZA 2Y9YA 4MW8A 1YFHA 3K1NA 4YK5A 5F28E 2HYFA 4EVIA 3BWGA 2NNYA 5HSWA 1HOMA 4D7MA 3QYEA 1MNEA 2JUCA 3FK7A 2PX3A 3O3KA 5CQGA 1T6IA 1ZW3A 1V54C 3VF0A 3BR5A 1MQVA 3L00A 4ZYGA 3EHNA 3U3FA 5F0FA 1P7JA 2UWMA 2FSWA 2JA5J 2LFFA 3C2BA 3OWTA 4XLHA 3SHFA 4BXFA 4BY1J 3GUDA 3WG7H 5CVRA 2KRFA 4B3AA 2ME6A 3CCEI 1L7CA 3QMKA 4V19K 4BEJA 4EQQA 2HTSA 3FHDA 4MNDA 3BCBA 5FLVA 3KE2A 4HNVA 2G0EA 4ZZDA 2P81A 1T0FC 3TL4X 1V55C 3FHZA 1R9TJ 3U3BA 2JRTA 3FBNB 3HHHA 4D5CA 2V3CC 3B73A 4WF2A 1ZU5A 4ZDOA 1TFKB 1WH5A 3J81Z 1SD5A 3H92A 3RQIA 3F47A 2LP4A 3RI4A 2XLEA 4IHTA 2F48A 5E3CA 5DM6F 4P96A 2HV7A 2E1CA 1FT9A 2W48A 2R7OA 1PD0A 2H6BA 2GQQA 1QBJA 2WV0A 1FSEA 5IY5H 2CRGA 3AL0B 1OYIA 1VOMA 2LSOA 1YI2I 2DMNA 4K0DA 2Z5UA 2E7WA 5EGOA 4JTAB 3ZQVA 4EBKA 4CX9A 1RC9A 4EWCA 2W4SA 4XPYA 5DQTA 1R49A 3WG7C 3K70C 3B6CA 2M4EA 2ESNA 5GAGJ 3LUTB 1A36A 1XMAA 3DCFA 4AM3A 1B9MA 3GFMA 4ESJA 4CDYA 3AL0C 2XAJA 1G3TA 2XAFA 4IO9F 2L7KA 2JT1A 4A5NA 1ZR4A 4U5CE 3EPVA 2DCEA 2Y0SN 3P5JA 3EQLF 1GXQA 3OYIA 1VQOI 5L3CA 2EV6A 1TKNA 1EH7A 2DBBA 3L2UA 4ZJZA 1UG7A 3C62A 2XSEA 4OAZA 1SVOA 3PNYA 2YL1A 1FJLA 1ZQ3P 4LLNA 2OQGA 3M8FA 3EGDA 2X6OA 1MGTA 3VEPA 2OG2A 1VNDA 3U21A 2MH2A 5IOZA 3CF2A 5KHDA 2NRAC 2LY9A 2E5NA 2EJRA 2KFDA 5JT4A 3MZ8A 3ZQGA 2I15A 2R7RA 5KYUA 4PJMA 1ZG3A 2IAIA 3BG7A 2WB7A 2XRLA 3WHBA 2L6HA 3A02A 4YRVA 3CQZA 4MHGA 1KTMA 4OIQF 1D1AA 2WBMA 5KK1A 3W2AA 4F3QA 5ILUA 5FFZA 2ZFUA 1VYIA 3LA7A 1BI1A 1A6IA 4HQEA 2A5WA 4O6YA 1NK3P 3D1NI 2P8TA 2K9SA 1QO0D 2DODA 3KEQA 2STTA 3BT9A 4GDFA 4C9YA 4XKBA 3ZMSA 1NFOA 1ZGAA 2MBFA 5FROA 4CDAA 2HOTA 3MYIA 2PF4E 1LUJB 2ZPAA 2FA5A 3ERMA 2HPMA 5CKTA 1VQ6I 4MVZA 1I1SA 3JRAA 5E3AA 3X1OA 2XB5A 2VT3A 3IUOA 4U5EE 5L3VA 2PBEA 3TULA 4KNVA 2JPBA 2GAUA 2VJ5A 2XAQA 3OYCA 1JAFA 1B72A 2B0HA 3EUAA 3DF8A 1S3JA 4HG2A 2E35A 4IKFA 1PYVA 2V9VA 1XD7A 2WY8Q 5EGOB 2E2JJ 2CW8A 3E5QA 2HWVA 2DA7A 3TD7A 4G0HA 4XRSG 4LERA 2JN6A 3FKIJ 3R0JA 1DP7P 2Y3HA 2XB0X 1Z7LA 3G3ZA 2M45A 5IYBJ 3LSGA 3F8BA 3RIRA 1EI7A 1VB5A 2WAFA 3PUBA 4BPMA 1QVXA 1JHFA 3ZOBA 5F1JA 1HMOA 1W0UA 2ICWG 3M15A 4XK4A 2M8EA 2XGCA 3JSZA 1LKXA 3HNJA 3C2HA 2XGXA 3A11A 1R5HA 1OISA 3F6VA 1AKHA 1D8JA 4UVBA 1IRXA 3ZTMA 1KU9A 4YEJA 1R00A 5JUAA 3EGDB 1U9NA 3RFYA 2JD3A 3S29A 1W5SA 3FM3A 3LAPA 4O6JA 1APCA 4JJGA 5DEQA 4UV8A 3BPVA 3AJMA 1Y6DA 3DPUA 1WFXA 3NMKA 3HSEA 4JK1X 3W4YA 4IVNA 2V7FA 1IF1A 3PM1A 4NTFA 3K6BA 2J9BA 1TQPA 3S32A 2PMZN 2PLYA 4EJOA 5FLMJ 3MMYB 4GQHA 5KYUB 3RQ4A 2W24A 4ENMA 3IHUA 4MO7A 2EFOA 1ULYA 1LE8A 2NSFA 4OD5A 3VSKA 3R7CA 3GEZA 4HF2A 4O79A 4YWQA 5J1UA 1MBHA 5J40A 4IHXA 2Y3DA 1YIJI 2HZ8A 1ORYA 2DT5A 2OC6A 4E7IA 3CCUI
chains in the Genus database with same CATH topology
3KPHA 2ICWG 1R5ID 2OJED
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KPH A;  2ICW G;  1R5I D;  2OJE D; 
#chains in the Genus database with same CATH topology
 4W8K A;  3SXY A;  5M5W J;  4LIT A;  4KDP A;  2P7V A;  1W36 C;  3PQK A;  4QSH A;  1Y6I A;  2BXY A;  2IEK A;  2KZV A;  2XVC A;  5GAE J;  3L1P A;  4UUV A;  1K04 A;  2PN6 A;  2X1E A;  3OYB A;  3I55 I;  4A6E A;  2MD0 A;  2TRT A;  1SFK A;  3KYD B;  4RMN A;  2MD5 A;  4AL1 A;  3G1O A;  1RZ4 A;  4PSX A;  1IN8 A;  2HKV A;  3W2W A;  3U8V A;  1O3T A;  1YRN A;  3GTO J;  2B7E A;  2R5Z A;  1B72 B;  4PJL A;  4C2M J;  3HGY A;  2XLW A;  1HE9 A;  5GPA A;  3QP6 A;  1HC8 A;  4JX5 A;  1Y0U A;  1QNT A;  2HQ5 A;  1YS7 A;  3OSG A;  1Y39 A;  3U1D A;  4BQO A;  1R5G A;  2IGN A;  2XM0 A;  4BEH A;  4CO8 A;  3E7L A;  4A3F J;  2HS5 A;  4V2F A;  3WE2 A;  3HNL A;  4N9I A;  3H3Z A;  3Q0U A;  3ASO H;  1GV2 A;  4P5O A;  1JKR C;  3VYW A;  2X1C A;  1OFC X;  4ZTJ A;  4EJV A;  3DLA A;  3HTU A;  1IV8 A;  1WI3 A;  1QPI A;  3MAJ A;  4XOP A;  3I59 A;  1UHS A;  4IZZ A;  1YX5 A;  5BMZ A;  2ZJQ F;  1X3Z B;  5D8K B;  2DGJ A;  3SEO A;  3DP7 A;  5EGY A;  2Z16 A;  2DA2 A;  3ABM H;  3FAJ A;  4IHS A;  1TW3 A;  3JRH A;  4OIO F;  5F0H A;  1AKH B;  1YLM A;  3TJ5 A;  3DV8 A;  1I39 A;  4P9F A;  1E83 A;  1P4W A;  2IXS A;  4HST A;  4OIN F;  3GF2 A;  5IP6 A;  4WXH A;  2L9R A;  4DW6 A;  3S3N A;  1ZR2 A;  4M63 A;  1T56 A;  4H4K C;  3T6G B;  4HPQ A;  4XON A;  3CCM I;  2C04 A;  2XAU A;  2H7V C;  1IW7 F;  4XKC A;  5CYV A;  1VK5 A;  3HG9 A;  4MVS A;  2D2W A;  2ID6 A;  4DZJ A;  2PFD A;  3HDD A;  2QUF A;  5JI6 A;  1M2O A;  2YZS A;  1X1B A;  3OYJ A;  3QOP A;  1LE8 B;  4M3D A;  5B5E C;  1CF7 A;  4MVU A;  4G94 A;  2CJJ A;  4OMZ A;  4AIJ A;  1IUY A;  2H8A A;  2RD9 A;  1AVO B;  3F22 A;  2W9Y A;  1OR3 A;  3ASO C;  2XSJ C;  2DFH A;  2VIX A;  3JW4 A;  3O2P E;  5EJC A;  5K7Z A;  1E3O C;  3MZY A;  2WAQ A;  1TQM A;  4AIK A;  2M2E A;  1IN5 A;  3F8M A;  4A3L J;  1U2W A;  1WJF A;  4NB5 A;  1IRZ A;  5L0J A;  1X1A A;  3K66 A;  2MLK A;  1ZU4 A;  1IXC A;  5LRS A;  3CCV I;  2RSE B;  3I58 A;  3ABM C;  4I0B A;  1TZL A;  1SEU A;  1S72 I;  3MLG A;  5KYN A;  1I6X A;  1FOX A;  3S14 J;  2AHQ A;  1R1V A;  2ZKZ A;  3KPH A;  2ID3 A;  3RZO J;  2XLO A;  3QU6 A;  5EG0 A;  3O6B B;  2Q4F A;  4HEA J;  4I3M A;  2K86 A;  3SDG A;  3W6V A;  2R7T A;  3SFZ A;  1T8I A;  4L0Y B;  1OLT A;  1YAR O;  3S84 A;  2P5K A;  4FTH A;  3K7A J;  1YRN B;  1WJA A;  4FET A;  2M87 A;  1SC7 A;  3DJU B;  3U8P A;  5JFR A;  1Z6R A;  2R5Z B;  3S2H J;  4LLC A;  3PMR A;  2DMT A;  1R4T A;  1LE2 A;  4DGW B;  3KET A;  1RI7 A;  1FPQ A;  2FNP A;  3COA C;  1K05 A;  1U89 A;  4BEH B;  3GEH A;  3O8H A;  5H2F C;  4LLE A;  3PL8 A;  1ZZP A;  3Q9S A;  1HBX G;  5DS6 A;  3DWL E;  2P6T A;  3DBL B;  3I59 B;  3OIP A;  4LIU A;  4RAG A;  1VLS A;  4BL0 B;  2P0W A;  1T39 A;  4IHW A;  2M64 A;  3KKB A;  4LB5 A;  1JTY A;  4BXX J;  2BV6 A;  3KIO A;  4OAY A;  4A0Z A;  2DPD A;  2YLG A;  2HYG D;  2KPM A;  2JPC A;  1O7F A;  5HDG A;  2R7W A;  1FAP B;  2XLD A;  3RKY A;  1KA8 A;  2YPR A;  3AG2 H;  4DXW A;  4DVY P;  5HLG A;  5HLI A;  3GBG A;  3HM5 A;  1LM3 B;  3LNQ A;  4I2O A;  3N0T A;  2KNH A;  1ITY A;  5JVT A;  2A68 F;  5TJ5 E;  3PHF 2;  2QEX I;  1IXS B;  1EH6 A;  5HS9 A;  5J8C A;  3CMY A;  1Z1D A;  4BS9 A;  4CS9 A;  3JRF A;  5LBQ A;  2X6W A;  3HUG A;  4XLF A;  2LRD A;  4PFP A;  2CUZ A;  1TC3 C;  2QA4 I;  1CF7 B;  4I99 C;  2VKV A;  3S16 J;  2P0N A;  4NCQ A;  2X0L A;  1H9G A;  1DPR A;  4BXU A;  4E17 A;  3V7R A;  3B6A A;  2UUH A;  3ZQY A;  2ZO4 A;  3ECH A;  4RDA A;  1M6T A;  4GO1 A;  2GA2 A;  4YL0 A;  4J7T A;  4MIM A;  5EF6 A;  3ZQF A;  1WTY A;  2DLL A;  5E18 F;  5D8L B;  1W2W A;  1SVM A;  4ZC3 A;  1N77 A;  1FTT A;  1S29 A;  3CMA I;  2Q0O A;  2OD5 A;  3K1H A;  5EG0 B;  4OOI A;  1QLE C;  1BM9 A;  2Y0M A;  5E20 A;  2NVU B;  2VLA A;  1ORK A;  1V5F A;  3AG2 C;  2MFZ A;  2OA4 A;  4XOT A;  2HDC A;  2HFI A;  4DRJ B;  1BDJ B;  1X1D A;  2EPO A;  2YUS A;  2F5V A;  3QOD A;  4E6K G;  5J1R A;  4PJJ A;  1H88 C;  5J4Y A;  3OYF A;  4QWQ A;  2O8X A;  1P4A A;  4E7J A;  1YW7 A;  5K5O A;  1G2H A;  4W8P A;  4NQW A;  1LPQ A;  4E0H A;  3BG9 A;  2XRN A;  4M3E A;  3U0C A;  4M9S A;  4JCZ A;  1EV7 A;  2ISY A;  3V7S A;  2UUZ A;  4J01 A;  1FOK A;  2JWT A;  4XKW A;  2MSY A;  1NH3 A;  2EIM H;  2MH9 A;  1XMK A;  5GAH J;  3C3W A;  1ZLJ A;  2AVK A;  4ITV A;  1I5N A;  1O4X A;  3RF3 A;  2F6C A;  3L1M A;  1FY7 A;  2LH9 A;  1LNW A;  2DN0 A;  2DTZ A;  4QI0 A;  1IG7 A;  4BNC A;  2OPT A;  3FOO A;  4WXC A;  3K33 A;  3LWF A;  3K4C A;  4HQM A;  3CME I;  2KDO A;  3OA1 A;  5HVQ C;  4XOR A;  1ON1 A;  3BJ6 A;  1E17 A;  3RQE A;  4BEM J;  5L0H A;  2WA0 A;  1WCM J;  2NG1 A;  4JZA A;  2MLG A;  3F6O A;  1V4A A;  2EIK C;  2FU4 A;  5COG A;  2HMQ A;  2E1M B;  4AU7 A;  2WY7 Q;  1G4U S;  5A6B D;  2VQC A;  2BZT A;  4ABZ A;  4YIR X;  4A0X A;  4G7H F;  2I10 A;  4A5M A;  4HFK B;  4D4N A;  1PJR A;  4U9E A;  4JRZ A;  3HBL A;  3HUG B;  1XSX A;  1T6U A;  3MFN A;  4KBL A;  3BZ6 A;  5HLH A;  1OQC A;  2EFN A;  2FE3 A;  3LEV A;  5CVU A;  5J1Y A;  3TO9 A;  3GX4 X;  3ZP5 A;  1LVK A;  2XL8 A;  4C3H J;  4J32 B;  1RR7 A;  1VQ9 I;  3PJR A;  3M4O J;  5JLI A;  3AQB A;  3S3O A;  2E1M C;  3DKA A;  1X19 A;  4HV6 A;  2VI6 A;  3QOE A;  2EIM C;  3I5P A;  2RQP A;  2R7Z J;  4CS9 C;  3MZH A;  2J5O A;  4U5H A;  2YRF A;  2YKZ A;  4QLC U;  2AQF A;  3G1L A;  1ZHW A;  2PX0 A;  3TQN A;  3HRM A;  3GAN A;  1JGS A;  3HOU J;  4B43 A;  3OEO A;  4WXD A;  3LST A;  2OCE A;  1Q1V A;  3BC8 A;  2PFB A;  1I6H J;  2OEV A;  3H35 A;  1OYW A;  1JKQ C;  2KIS A;  1V5E A;  1GUU A;  4PGG A;  2GBY A;  3GM1 A;  1JKP C;  2X6X A;  4A2U A;  4P9T A;  2OQR A;  4OIP F;  3K1I A;  2ECB A;  3GOD A;  3FXH A;  2OJQ A;  3LNR A;  3CJN A;  2JA7 J;  2GA0 A;  3PFI A;  3Q5F A;  4NQW B;  2HMZ A;  2AU5 A;  1FTS A;  3FAP B;  4EJT A;  4CIP A;  1I1G A;  4KMU X;  4OMY A;  3LFK A;  3BCA A;  2BY0 A;  2ZXW H;  3KP7 A;  3BJO A;  1D0Y A;  3LSM A;  2G3K A;  1BA5 A;  2L6F A;  4FHT A;  5ERI A;  5JHF A;  2MYS A;  3JRG A;  1SR2 A;  1J7K A;  5DYM A;  4XRM A;  1QPM A;  2RRE A;  2TCT A;  3W6K B;  4AVZ A;  3RZD J;  1MBE A;  3MCZ A;  4D1Q A;  3GXO A;  5D4S A;  3HB9 A;  3DTK A;  2V9P A;  3KLO A;  3SZT A;  2Q3T A;  3C8Z A;  2MW8 A;  5J8F A;  1R36 A;  4AIH A;  3BG6 A;  1Q0D A;  1SFX A;  3WU2 C;  4EM1 A;  1GHC A;  3AG3 C;  5T3W A;  3CO7 C;  1YZA A;  2O9X A;  4ONS A;  3CJR B;  3I71 A;  2NS7 A;  5AIQ A;  3KYL A;  3A1Y A;  3S0X A;  2QWW A;  5D6F A;  3DPL C;  1K79 A;  2M34 A;  5E8I A;  4RM2 A;  4BKX A;  3L09 A;  5C4J J;  1RNL A;  4RLF A;  5E3M A;  1UG2 A;  2V9K A;  4KI2 A;  4HOB A;  5JRA A;  3JZ0 A;  1X1C A;  3DE8 A;  2BY2 A;  2K9M A;  2R7D A;  3TO7 A;  2CCY A;  4MTO A;  1TW2 A;  2Y75 A;  1FMW A;  3CCL I;  2XLV A;  3S93 A;  1X2M A;  2IXN A;  3E97 A;  3FXO A;  4FAS D;  3REO A;  4G6D A;  2RAE A;  2Q1Z B;  5DUK A;  3AOU A;  4W97 A;  3BTC A;  4NUB A;  3O39 A;  4LOC A;  2EIN H;  1TL8 A;  2ZXW C;  2FBI A;  2GWW A;  2DAO A;  2HVQ A;  2RN7 A;  2KZG A;  4UUT A;  2VQG A;  1EA3 A;  4KUM A;  4XR6 A;  3U1K A;  3W3C A;  4DYR A;  4MQV A;  1YJN I;  1G8X A;  3GLL A;  2LK4 A;  4YT4 A;  5KYX B;  2IA0 A;  5L0G A;  1KYW A;  3R0A A;  4YT8 A;  4YT2 A;  4GYI A;  1HDD C;  4P1W A;  2M4K A;  2NVY J;  2RQQ A;  1ZKG A;  2QQ8 A;  4C30 A;  2AXT C;  3AQC A;  2Z9O A;  2CQK A;  2E5Z A;  3ISP A;  3GTP J;  4ZDL A;  5HDN A;  4UVC A;  5F0C A;  1GT0 C;  4UB8 C;  3SEZ A;  2OV7 A;  3CUO A;  3DEU A;  3JTL O;  5FZT A;  2H09 A;  3ZQH A;  3I5Q A;  2W25 A;  3W8H A;  3IC7 A;  3DU6 A;  3ZN1 A;  2CQQ A;  4JC7 A;  4EHP A;  4CS7 A;  4PR9 A;  2DK5 A;  3ULQ B;  3HZJ A;  5FKL A;  3TGN A;  1XC5 A;  2VC0 A;  1YHQ I;  2FJ1 A;  3GWL A;  1MD0 A;  2EV5 A;  4B3X A;  5EZG A;  3TKY A;  3CCS I;  2DA4 A;  4U87 A;  1AEP A;  3U2M A;  3DBR B;  4ON0 A;  1ZAO A;  4QIW N;  3C63 A;  1FYL A;  1KU7 A;  3VDX A;  5EEH A;  2NVT J;  4HF0 A;  1Z7U A;  2EIN C;  3QPT A;  2QTV A;  2A3S A;  1MIJ A;  3H9G A;  5CLS A;  3TOB A;  5BNG A;  4CGZ A;  2A0B A;  2WVN A;  1NLX A;  2VCA A;  3RVZ A;  2R05 A;  4O7G A;  4DYQ A;  2JSC A;  3QW0 A;  3CJQ B;  3G50 A;  2J9U A;  1A7V A;  1S7E A;  2DDA A;  2HOE A;  1LDK B;  2LF7 A;  2RVC A;  3D5S C;  1Z5Z A;  3K70 D;  1EQ1 A;  3L8J A;  2GLO A;  3FXJ A;  2ME0 A;  2VPR A;  2VOO A;  2R7F A;  1FZP B;  1W4M A;  2ZD9 A;  3M79 A;  5GTH C;  3NWS A;  1Q0G A;  1WGX A;  2LVS A;  2W45 A;  3VAY A;  1V54 H;  1TQG A;  2ZXP A;  2IBF A;  3H5N A;  3FDQ A;  1G59 A;  1PV3 A;  1GDT A;  2LCH A;  1X58 A;  2QF7 A;  2AO9 A;  5COM A;  2IYL D;  1T5O A;  1K6Y A;  4G8X A;  4HBL A;  2EZK A;  2WTE A;  1U5T A;  1GVD A;  1YYX A;  4A3I J;  5FJ8 J;  1YG2 A;  3O6X A;  4LIV A;  5HLT A;  3DEW A;  4XSZ F;  3HOZ J;  5JVG F;  2LBF A;  3UNG C;  1NSG B;  1X3U A;  3FMQ A;  4KT5 C;  5IOY A;  2AS5 F;  3ITF A;  1IZM A;  5AON A;  4ZYH A;  2DPU A;  3B0U X;  4N6H A;  3CEX A;  3A01 A;  2G7H A;  1Z0X A;  2OU2 A;  1D1B A;  2XAH A;  4UY8 I;  3F46 A;  2ZJP F;  4A2N B;  3CDH A;  4AL0 A;  4C3E A;  1V55 H;  3I54 A;  4JP0 A;  5D6E A;  1XDU A;  4IRU A;  3EDP A;  4JEA A;  1RKC A;  3UMI A;  2XF5 A;  2CV0 A;  2KT0 A;  3KP6 A;  3FX3 A;  2UZK A;  3I5U A;  3WGG A;  1POG A;  4GFB A;  4U5G A;  1U6G A;  3PQJ A;  2LTP A;  3KEY A;  1OKK A;  3HOS A;  2R25 A;  2KQ9 A;  5FCL A;  2GOX B;  4RGS A;  1XCB A;  2R02 A;  3WAQ A;  4KIC A;  2CUE A;  1SAN A;  4CCM A;  3UMK A;  3P9C A;  2QM3 A;  3C1D A;  3LSK A;  3NKE A;  2RNG A;  1VQM I;  2OTJ I;  4O6N A;  4YIF A;  2DTR A;  3JRE A;  1JR8 A;  1E85 A;  4MVM A;  2XGE A;  3SFI A;  4UUS B;  1DDN A;  1ZK8 A;  3KYI A;  2R93 J;  4RAZ A;  2FMY A;  5DTD A;  4XRF A;  2IXO A;  2NXN B;  3O8G A;  1WJC A;  5FKO A;  4PZJ A;  3KH2 A;  4I7H A;  4D7N A;  3D5R C;  5IP7 J;  4XN3 A;  3CQZ J;  1UZC A;  4AX2 A;  2E1N A;  4PSW A;  3QAH A;  5L3G A;  3OL4 A;  2GM4 A;  4KFC A;  2W57 A;  2Y69 H;  3G2B A;  4B09 A;  3NDB B;  4R79 A;  1BI2 A;  1JUP A;  4J19 A;  3ZIB A;  1MJB A;  1FX7 A;  2F5C A;  2YSR A;  3LMM A;  4HDU A;  2CO5 A;  3WTZ A;  3F72 A;  1V3F A;  4ANJ A;  3BQY A;  3U2R A;  1A0B A;  5L0D A;  2LYC A;  3SXM A;  2L02 A;  1C0W A;  1JE8 A;  2WZG A;  2VCB A;  1KU3 A;  5KYY A;  1WH7 A;  3H1C A;  5COF A;  1D0Z A;  3WOD F;  2JZY A;  3OS0 A;  3HNI A;  1OQY A;  2V6C A;  3GZ5 A;  3PFY A;  2HKX A;  5LHI A;  2O9L A;  1QPU A;  3DD7 A;  1JHH A;  2CFX A;  2Y3G A;  3HLZ A;  1N78 A;  2V6E A;  1BBH A;  3JRT A;  1O3S A;  1YW8 A;  1ZG5 A;  1NHA A;  1U5T B;  2CU7 A;  5FD6 A;  3C18 A;  3M3Y J;  3CJT B;  3D5L A;  1W5C C;  3GFJ A;  1IJW C;  1NZE A;  2A0U A;  4WAB A;  4HX4 A;  4Q48 A;  2ZCW A;  5ILV A;  3OOU A;  2C6Y A;  3FXK A;  1YA9 A;  3H2U A;  4I44 A;  2HR3 A;  2LBF B;  3WTY C;  1YAU O;  2HU9 A;  1CGM E;  3I64 A;  3TED A;  3DKY A;  4WGY A;  1L3P A;  4A93 J;  3P7N A;  2PBI A;  3AG1 H;  2WV1 A;  3A01 B;  2QBY A;  3HYI A;  1CPR A;  5K0I A;  2VL8 A;  3G71 I;  4BBR J;  1P4X A;  2KKO A;  1P6R A;  4IHY A;  2D5R B;  3M9A A;  2Y69 C;  3WU0 A;  3HIF A;  3EHM A;  3M4C A;  5DQZ A;  5GAD J;  3IL2 A;  2EFQ A;  1B68 A;  2OEX A;  1IN4 A;  4CIH A;  4LLL A;  3A0H C;  5FFX A;  3SZG A;  1A7E A;  5J47 A;  1A6Q A;  2OCC H;  1X3W B;  1OCZ H;  5EHH A;  2L54 A;  3IKV A;  2H6C A;  1T01 A;  3OSF A;  2AXL A;  4H0E A;  2WAD A;  1W36 D;  2I8B A;  4XTK A;  2BL2 A;  3ABK H;  1A35 A;  3NYL A;  4RGU A;  2XKP A;  3VYR B;  3HTK C;  4F93 B;  1SD7 A;  2K85 A;  4OIR F;  4N6C A;  3QWL A;  3ZC4 A;  4DOZ A;  2V1U A;  2HPI A;  1XCV A;  3AG4 H;  4IRG A;  1Z21 A;  2L6G A;  5LGT A;  4HA8 A;  2NSG A;  3UKG A;  3RQG A;  1O57 A;  2HKO A;  5IYD J;  1SVL A;  3QPL A;  4WGZ A;  2GIV A;  3CDL A;  3E6D A;  1VF9 A;  5FD5 A;  1RXQ A;  1Y4C A;  4IRI A;  3U5S A;  1UFM A;  3GM2 A;  1BN5 A;  2OBP A;  3CUQ A;  3PUF A;  4ZZL A;  1YZC A;  5A6J A;  3AG1 C;  1PDN C;  6PAX A;  4XIC A;  3J80 K;  1U0B B;  3S1M J;  4YII A;  4ZYE A;  3OYD A;  4GEH A;  2A69 F;  1B59 A;  5BQI A;  3P9I A;  1TWG J;  2K3P A;  5H6R A;  4KIF A;  3L34 A;  1HKS A;  1J8M F;  3FIW A;  1Z3X A;  3ZMT A;  2E71 A;  1SZI A;  2OF7 A;  1SFU A;  5KYY B;  4O3M A;  2XF6 A;  2OCC C;  3BY6 A;  4QTR A;  2ZFW A;  1MMS A;  1OCZ C;  3SXZ A;  4UB6 C;  4NC8 A;  2J5P A;  2O6G E;  1G3Y A;  2DJN A;  4YL3 A;  1ZH5 A;  2R3S A;  2XS1 A;  4G7O F;  4C2T A;  4BE2 A;  3ABK C;  2BYV E;  4R1H A;  1GVJ A;  2VE9 A;  2CW7 A;  5HDK A;  1ONV A;  1TQI A;  2PMU A;  4DZP A;  3KCC A;  1Y8R B;  2M0C A;  3AG4 C;  2AQE A;  1FNT c;  4Y17 A;  4ASN A;  4W1U A;  3HJE A;  3ZR8 X;  2QBY B;  4XLE A;  4A12 A;  2NOG A;  4NNJ A;  4XID A;  2DT7 B;  1WWP A;  3FMR A;  2KMU A;  1Z23 A;  2A6E F;  4HX8 A;  5ICG A;  4EGY A;  2KRH A;  2R92 J;  1YYJ A;  2KGO A;  5L3Q A;  2L4M A;  1SFO J;  3ATP A;  3PSF A;  1HKT A;  4MEX F;  3ZVR A;  1RPW A;  1BW5 A;  2DQR A;  2VN2 A;  4M3F A;  4BHB A;  2ISZ A;  4UVA A;  2VOP A;  5KAF C;  2VAS A;  3TOL A;  2H7O A;  1K61 A;  1U8R A;  3DPT A;  2DA6 A;  4YG2 F;  3HOT A;  5DLJ A;  1R4M B;  1BBY A;  3CCQ I;  3J7A O;  2VBY A;  4BAY A;  3ZQ7 A;  3ZGK A;  2L7M P;  1YJW I;  4K1O A;  2Q00 A;  4IGG A;  4BHP A;  1EF4 A;  2DXI A;  1S7A A;  2KIM A;  2LQG A;  2X4H A;  5E79 C;  4A69 C;  2J0W A;  3EYI A;  1A7D A;  2W84 A;  1T33 A;  2JK3 A;  2GDC A;  2JX0 A;  1OPC A;  5D92 A;  3K4J A;  1V74 B;  3HEF A;  2CYD A;  2NUT A;  3CUQ B;  4A3E J;  4CDV A;  3JSO A;  3B0P A;  1SAU A;  1VQ4 I;  1TWG A;  1BI3 A;  2CUJ A;  4EM2 A;  5L0F A;  1KU2 A;  2K7L A;  1OCP A;  3IH3 A;  4FIS A;  4Y33 A;  1GM5 A;  4HEA 2;  2HZT A;  5JVE A;  3LS1 A;  1T08 B;  4CCK A;  1IRG A;  4J7Y A;  3DTI A;  4YFK F;  3ZTZ A;  5KYW A;  1PUF A;  2Q2E A;  4IQ4 A;  5JR3 A;  2EPK X;  2XL4 A;  3CUQ C;  3LSH A;  3BR0 A;  3K4L A;  3QQA A;  2Q9C A;  2EFP A;  3QRF F;  3B29 A;  4HE8 D;  5DDG A;  1VQN I;  2CQX A;  1JRA A;  4LAC B;  2XM4 A;  5E1Z B;  3ECO A;  4AVP A;  1TP4 A;  2P5V A;  3V7C A;  2L0K A;  3HRT A;  2Q9B A;  3RW0 A;  3TOA A;  3ZMD A;  4MQ9 F;  5K1Y A;  3GWN A;  2HTJ A;  2R03 A;  1KZH A;  3T4R A;  4MVQ A;  1A04 A;  3A2K A;  1F5T A;  3QTH A;  3CSK A;  2IS6 A;  1XG1 A;  1BR4 A;  3KFW X;  4FQG A;  3VOD A;  2MG4 A;  2VBZ A;  1D5V A;  1F1Z A;  2RGV A;  2ZXJ A;  3J7Z I;  4IEJ A;  4XLN F;  2AWY A;  4F91 B;  1RCP A;  3M8J A;  4M9X A;  2AWC A;  2VUM J;  1AWC A;  1BC8 C;  3HSR A;  4BBS J;  3DMD A;  1Z91 A;  1VQP I;  4HYE A;  4G12 A;  4EGZ A;  3SZP A;  2P6V A;  1N25 A;  2DMP A;  2FML A;  1YS6 A;  2ZXO A;  3FOP A;  3FXR A;  1IDY A;  3S90 A;  3ZMV A;  1UMQ A;  1I3Q J;  2FOK A;  4M72 A;  4C7O A;  2JA6 J;  2M7A A;  1RJ9 A;  3T1B A;  3J80 Z;  4PUS A;  3HGG A;  2FNA A;  4L5J A;  4OD4 A;  2HQR A;  1L3L A;  3I3L A;  5C44 J;  2A6H F;  3BR6 A;  1VTM P;  4BJ6 A;  1JJ6 C;  2YU3 A;  1VZ0 A;  4A3C J;  3AGU A;  3H65 A;  5AC5 A;  5BPD A;  3FKJ A;  2Y30 A;  1NBB A;  2VQL A;  1H0M A;  1TT0 A;  3OR1 C;  1SMT A;  4EAT A;  2NUT B;  3FWE A;  3CLQ A;  1KYZ A;  4BDY A;  1N1C A;  4EEF G;  1IN6 A;  1IUF A;  1C17 M;  2Y31 A;  1I5Z A;  3DFG A;  2VJJ A;  2P7V B;  5LHG A;  2WAQ N;  3R60 A;  4Y4R A;  2VQH A;  1S7O A;  3RH3 A;  1JT6 A;  5F04 A;  1PUF B;  5KYW B;  2Q2E B;  1IRF A;  3E9V A;  1XMX A;  1ZRF A;  4L5I A;  1JGG A;  3J7Y J;  4HZF A;  4TV7 A;  3RKO F;  3IRQ A;  3F23 A;  4C3B A;  1L0O C;  1U3E M;  3CD6 I;  5DD4 A;  3ABT A;  1TWA J;  1T98 A;  3VB2 A;  1JOG A;  3HL2 A;  1A31 A;  3FHN A;  3JT1 A;  1XGS A;  3MD2 A;  4U0W A;  3V8L A;  2W85 A;  3A0B C;  4LMY A;  3B71 A;  2X0C A;  2V1D A;  3CDI A;  1XGM A;  2Q7R A;  1AUE A;  3K1P A;  4JQF A;  2M30 A;  2E2H J;  4Z2Y A;  2O8K A;  3ZQC A;  3KZI C;  1J59 A;  3DZA A;  5D4R A;  2R7S A;  2BHY A;  4G6T B;  1LS1 A;  3HSF A;  2MC4 A;  1E3H A;  4IAR A;  4BY7 J;  3LOC A;  3RKX A;  5DM7 F;  1DU0 A;  3CO6 C;  4KT6 A;  2G62 A;  3EZH A;  1ETV A;  2P7C B;  4ZH4 F;  3JSP A;  4FX5 A;  4RDU A;  5BQH A;  1V5G A;  4JX4 A;  3A03 A;  1HQC A;  2M3A A;  1FBS A;  4M3G A;  1H7I A;  4FE7 A;  1S05 A;  5CJ9 A;  4BJ1 A;  2ECC A;  2J7P A;  3C7J A;  2FXA A;  3G6E I;  2RNJ A;  2KDZ A;  4IRH A;  4IOA F;  2O61 A;  3B02 A;  1JXS A;  1PP7 U;  1OW6 A;  2IXP A;  4EKW A;  1X1P A;  4C7O B;  1LI7 A;  3JTH A;  1RJ9 B;  1SYQ A;  5F5F A;  1NTC A;  3F9K A;  1V4R A;  2VXD A;  1BZ4 A;  2Z99 A;  3LSP A;  1FBQ A;  3QYF A;  2F4I A;  4FWV A;  2FBK A;  3T6J A;  1MMD A;  1YJG A;  3IAS 2;  3SYT A;  4KIS A;  1DOV A;  2KRC A;  9ANT A;  3BR1 A;  1XWJ A;  5AC4 A;  3M07 A;  1FYK A;  3ZG1 A;  4C3D A;  5F5H A;  2DFI A;  3OIQ A;  2KW3 C;  3UMH A;  2PP4 A;  2ZXH A;  2BHZ A;  4X6A J;  2VB6 A;  5LHH A;  2IBD A;  3GFI A;  1U78 A;  3RJP A;  4U5F E;  1WJE A;  2XIG A;  2CGP A;  1EKY A;  3DLL F;  4D5F A;  4XLA A;  4CYC A;  1S9H A;  4IAO A;  3JAM K;  1LIH A;  5EYR A;  4M6X A;  1ETW A;  3TO6 A;  5IPA A;  2MC3 A;  4MEY F;  1Z9C A;  2VC1 A;  5B1A H;  4I1M A;  4BJ6 C;  2PQ8 A;  1AOY A;  3S28 A;  3BDD A;  3BOQ A;  4XLP F;  1WJ5 A;  2YS9 A;  5IT9 K;  5FRN A;  4XPW A;  2ZC2 A;  1UJ8 A;  5HOO A;  3FDY A;  1MMN A;  1LB2 A;  3RCO A;  4U0Y A;  1GS9 A;  3K4B A;  1FIA A;  2EIK H;  3EUK L;  4F55 A;  1G3W A;  1TWA A;  1BI0 A;  4N4O B;  4K2E A;  2F5F A;  2KJB A;  4Y52 J;  4AC0 A;  5JP7 A;  4M73 A;  3I4U A;  5CIV A;  4RM3 A;  2E1O A;  3HC7 A;  3K2A A;  4B1R A;  2RDP A;  5AIP A;  1HW5 A;  4LD5 A;  2CW0 F;  1PD1 A;  3MKY B;  5D91 A;  1O3U A;  1WJB A;  4U5B E;  3WU1 B;  3GEE A;  3QU3 A;  5JSL A;  1OR2 A;  1XX5 A;  1FFH A;  3DTE A;  2B0L A;  1E0E A;  4ULW A;  3VRC A;  5CVI A;  3DE9 A;  3KLN A;  1NG7 A;  1VQ5 I;  1BOA A;  4JE9 A;  3FXL A;  1E3P A;  1Z3I X;  2HVS A;  2IVM A;  4NY3 A;  1MH4 A;  2EQR A;  3I0T A;  5B1A C;  1A41 A;  4NQF A;  5TGT A;  4Z6Y A;  2J9W A;  2JVH A;  3K4K A;  2A1D D;  3CP2 A;  2BBY A;  2CG4 A;  5HS7 A;  2D4U A;  2EK5 A;  4LGW A;  1JMW A;  4E7H A;  4BDZ A;  1C03 A;  2BXZ A;  2H8R A;  4RB0 A;  4QPO A;  1XDS A;  3KP2 A;  1BL0 A;  1QHH D;  1F1M A;  2XL6 A;  4YN0 B;  3WGH A;  4BUP A;  1MMG A;  4QI2 A;  3HXL A;  2MGQ A;  3FZV A;  1XSD A;  1PUE E;  1H89 C;  1KQ0 A;  1MDM A;  3EH1 A;  2DJI A;  4AID A;  4MGR A;  2KJC A;  3TP0 A;  2EPF A;  1YW9 A;  4B4C A;  1LPE A;  3KEO A;  1XB4 A;  4AYB A;  4CYC B;  2HQN A;  1D8K A;  2QQB A;  3HHG A;  5CPR B;  3CCR I;  2OQM A;  4DRH B;  5CQE A;  3MBG A;  1HCR A;  4R8H A;  2QY9 A;  3LES A;  4KIT B;  2WVO A;  2ZB9 A;  2VBW A;  3Q9V A;  5ICC A;  1I50 J;  3ESW B;  3T8R A;  2KIF A;  2O7O A;  5HNH A;  3DXJ F;  1CQT A;  3BJA A;  2AP3 A;  4JEB A;  3HRS A;  1QHG A;  3AG3 H;  3GLX A;  2Q9A A;  3PO2 J;  4CUG A;  1VQ7 I;  4HLY A;  3TOM A;  3Q6M A;  4FAP B;  4BHC A;  2WVQ A;  4Z9J A;  3JYY A;  2W00 A;  1VQL I;  1OKR A;  5H6Q A;  4EBB A;  4I98 B;  3ASN H;  2GXG A;  3HOX J;  2ELJ A;  3OR2 C;  4FE4 A;  2VKD A;  2YL7 A;  4BAC A;  5DS4 A;  3K2Z A;  4DRI B;  5E33 A;  2J8W A;  2NPU A;  2VE8 A;  2WB1 A;  1VTN C;  4L5E A;  3IEE A;  1IGN A;  3JSE O;  3KX2 A;  4J30 B;  4CCO A;  1VYK A;  4J00 A;  4A3M J;  4MS2 A;  4U0V A;  1G6N A;  2XDV A;  5E3L A;  2HVR A;  2WB1 N;  1BJA A;  2A5Y B;  1WJD A;  1WVR A;  3A4C A;  1BIA A;  2HOS A;  4KMF A;  2ZXR A;  1ZYR F;  3GZN B;  3RYP A;  1HXD A;  4Q7C A;  1LDD A;  2HFH A;  1WQ2 A;  2NS8 A;  2QZ8 A;  4XLC A;  5H20 A;  1YTY A;  2DMQ A;  4D0P A;  1F4K A;  3GZ6 A;  4L18 B;  2DA5 A;  3PCV A;  3Q0W A;  4BG0 A;  3KMI A;  1XS9 A;  2EA4 A;  1BC7 C;  1N75 A;  3EZI A;  1KON A;  3DQV C;  1DP3 A;  5FGM A;  1VMA A;  3BPX A;  3CF5 F;  3JAM Z;  4RBN A;  2OAZ A;  3GWZ A;  4U88 A;  2XLH A;  2Z33 A;  1JKO C;  3SP1 A;  2QKL B;  2E36 A;  2JRM A;  1MSF C;  1PVE A;  3ASN C;  3DM5 A;  3BG5 A;  3DKW A;  5F1R A;  3H2V A;  1MDM B;  1RUO A;  2CV2 A;  5IT9 Z;  3O10 A;  2LF8 A;  1RMV A;  3WTW C;  1UAA A;  2D1H A;  3NRV A;  1HE1 A;  2L3D A;  3EH2 A;  2MWQ A;  3CC2 I;  2LY1 A;  2LC2 A;  4WX9 A;  2J0X A;  4F92 B;  2G3V A;  4YT5 A;  2ZNZ A;  1O87 A;  2ADU A;  1FEX A;  3CLO A;  1HST A;  4N06 A;  4EJU A;  2ZME A;  2R7V A;  5ICE A;  4CCJ A;  1UEL B;  1FP2 A;  3NQO A;  3SDB A;  2E2I J;  4IB4 A;  5IT3 A;  2PX9 A;  2IS4 A;  1HY5 A;  4RB3 C;  2A05 A;  1UB9 A;  4IL6 C;  1OMI A;  5F6F A;  2FBH A;  4IHV A;  2C03 A;  1KGS A;  2CSO A;  2DU9 A;  3CCY A;  2Y9Z A;  3RPU D;  2LY2 A;  1YOV B;  2QYO A;  1ZN2 A;  4A0Y A;  3AAF A;  3PIP F;  2CNW A;  2K9Q A;  5LEJ A;  2F22 A;  2OUM A;  3K7D A;  1TWF J;  5EK0 A;  2VJ4 A;  3S3M A;  4ETS A;  3GVA A;  4BQA A;  4CS8 A;  1B1B A;  2CUF A;  3C8G A;  2K5C A;  2CYY A;  1W7P D;  2PG4 A;  3IQ6 A;  4EJW A;  1KNY A;  3RPU A;  3TDU C;  1TFO B;  1WHU A;  1RKW A;  3UR3 C;  5E1X A;  2ELH A;  4KNW A;  4DJ9 A;  2IXM A;  1ETO A;  2WZF A;  1MMA A;  2JA2 A;  4F4B A;  2L9N A;  2W4M A;  1W7P A;  3WG9 A;  4OU0 A;  5LGN A;  3HJC A;  2QCO A;  4YJW A;  2LR8 A;  4YFN F;  3K1I C;  5CVV A;  1DPU A;  2CWE A;  2DYS H;  4Q5S F;  3HNK A;  4CBE A;  3J7A Y;  3EUH A;  1P2F A;  4JOM A;  3TW6 A;  2JTV A;  5L3F A;  2YR2 A;  1B6A A;  1IV6 A;  4AK9 A;  3K9T A;  4KIG A;  2EA2 A;  4P9U A;  2BEO A;  2XRO A;  2COB A;  2L7F P;  4JUR I;  1T0F A;  2EIL C;  4I76 A;  4YL1 A;  2KIQ A;  3GCM A;  1XN7 A;  3CC7 I;  1WGW A;  2IA1 A;  3I4M J;  1MSE C;  1LFP A;  2DMU A;  2D1V A;  3TQO A;  2O03 A;  4Y15 A;  1IDZ A;  2EIJ C;  4KC9 A;  2M1B A;  3LSR A;  4RAF A;  2KQR A;  3PIO F;  3CCJ I;  2D45 A;  2H1K A;  3Q6N A;  2LOO A;  4MFD A;  3DBH B;  5FKK A;  2IOQ A;  5E3O A;  3JRC A;  1OCC H;  4N9H A;  4IF4 A;  4NBQ A;  2CQN A;  3BG3 A;  1SFE A;  2YVK A;  2ELK A;  5HS8 A;  2DA1 A;  2LDU A;  1R1U A;  2QNL A;  2OU6 A;  1YYV A;  2ZME B;  2FAP B;  3NYJ A;  2HJ3 A;  3ERE D;  4FX4 A;  1I4Z A;  4G6Q A;  3TP3 A;  4LK0 F;  2R7Q A;  4MNU A;  1K4T A;  2ZJ2 A;  1OKK D;  2DYS C;  5TIS C;  1TWC A;  3DJN B;  3E70 C;  4N0B A;  4MVO A;  2K4B A;  4XQ1 A;  3TMO A;  2HZD A;  3F0C A;  3U9G A;  3OL3 A;  4JTC B;  1CGN A;  4A3J J;  3ZQQ A;  4HDV A;  4G78 A;  2QLZ A;  4HW0 A;  1BIB A;  5FO5 A;  4GRI A;  2ZME C;  3VM6 A;  1R22 A;  1SF8 A;  2FEZ A;  2RV8 A;  5DCM A;  4I1O B;  1XGN A;  1LFB A;  1YE9 A;  5F08 A;  1FFT C;  3C8G B;  1SD6 A;  2P5L C;  1T9K A;  4BQQ A;  1Z63 A;  1HDP A;  3HKK A;  2UV1 A;  1ZHY A;  4L9T A;  3J06 A;  2YL3 A;  5FLX K;  3BP8 A;  4NC7 A;  3GEI A;  5FKM A;  1OCC C;  4LB6 B;  3I4N J;  4IWB A;  4A3G J;  3T0Y A;  1W7P B;  3VOE A;  3T6B A;  4AUX A;  4RGR A;  2HXI A;  3FK6 A;  1MKM A;  4LG3 A;  3IP4 B;  2COM A;  1WRJ A;  2VPL A;  3G4X A;  4CS8 C;  2VH3 A;  2O5R A;  1B8I A;  3DI5 A;  3HKZ A;  3EET A;  3QP5 A;  4X0R A;  4MVR A;  3DAF A;  2YHS A;  4N4N B;  4IXA A;  3R4K A;  3PO3 J;  3NWT A;  4WCG A;  2F2E A;  3GYH X;  3M8E A;  3ZRG A;  3NYM A;  2A6T A;  2KYH A;  1MJA A;  2LLK A;  3E5X A;  1PCX A;  4A4A A;  2EPN A;  5B3I A;  3HKZ N;  3QZC A;  1UG0 A;  3S2D J;  4LDR A;  4LJZ F;  3HTS B;  4LLG F;  4MTD A;  1XPX A;  3OMY A;  2QKM B;  3T5X A;  4C3I J;  3DU5 A;  3B9Q A;  1S7Z A;  3EFO A;  2O3F A;  4A3K J;  3OYH A;  3GTG J;  3N2Z B;  3E6B A;  4GYT A;  3EUH C;  1J5Y A;  1ETX A;  1PP8 F;  1NU9 C;  2VJI A;  3N05 A;  1MH3 A;  3H0G J;  3TK0 A;  2GXA A;  2EZH A;  4UDV A;  3S1Q J;  3RQF A;  2FQ3 A;  2PJP A;  1XGO A;  3OYE A;  1WOL A;  3HRU A;  1FLI A;  1T2K A;  1ETY A;  1MND A;  1OYY A;  5J6X A;  3WTS C;  2LD5 A;  1JI8 A;  1CGO A;  4E7K A;  1NFN A;  4ENJ A;  1Z7Q c;  2HSQ A;  2XPV A;  2ZBK A;  3S15 J;  3JRD A;  1E84 A;  4Z9H A;  4D9J A;  1JT0 A;  4JBA A;  3HOV J;  3NG1 A;  2QEN A;  4E7Z A;  3N97 A;  4DNC A;  3IQ5 A;  2HYJ A;  4DVZ A;  4XEV A;  1ERD A;  2IW5 A;  2XRH A;  1U5T C;  3G4Z A;  3ELK A;  1ZTR A;  1ORS C;  2LKP A;  4M6V A;  2R9R B;  2B0J A;  1QA6 A;  2LD6 A;  1DQU A;  1HMD A;  3H9Q A;  4FT8 A;  2MA3 A;  3OYA A;  1J09 A;  3IAM 2;  4MTG A;  5K7H A;  2GIZ A;  4BGD A;  1CGP A;  3TJ6 A;  3FXU A;  5DCM B;  3KP5 A;  2DFF A;  1VLT A;  3PDM P;  2IPQ X;  2JSP A;  1TTY A;  2F4M B;  4YEL A;  3VYU B;  1ETQ A;  2Y0S A;  1TLH B;  2EH3 A;  2YL0 A;  1Z67 A;  4II3 A;  4LDQ A;  1ZRD A;  1ORJ A;  2HJM A;  1TNT A;  5TJJ A;  2OKU A;  2NS0 A;  4F52 A;  2P6S A;  3NRH A;  1R58 A;  4JX6 A;  1B8I B;  2RKH A;  1KQ9 A;  1AU7 A;  2KC3 A;  3K4N A;  3TW7 A;  1QGP A;  1K6O A;  1SMY F;  4RAY A;  4XKV A;  2VCC A;  3MKZ A;  1F36 A;  2VBX A;  4ESB A;  1ON2 A;  3K4M A;  2QSG X;  1UHM A;  3RVY A;  2R0Q C;  1FOY A;  1QQI A;  1LI5 A;  3OYN A;  4JIO A;  2DFE A;  1NK2 P;  3SQN A;  5IY5 C;  3LSJ A;  4WJ0 A;  4DQ2 A;  2ETH A;  1QQ3 A;  3EFO B;  4CSA A;  1UHW A;  2L7Z A;  1G5Z A;  4B6I A;  5D5X B;  4LK1 F;  1IC8 A;  5FB2 A;  1XTA A;  1T6S A;  1T38 A;  3ZSU A;  4LDK A;  1Z3Y A;  3SNH A;  3F8N A;  3AFH A;  3BRJ A;  1P7I A;  1HLV A;  3CES A;  1YJ9 I;  5BPI A;  5GPG B;  3DAG A;  2KLO A;  2K3F A;  1VQK I;  4HF1 A;  3JRI A;  4ENN A;  1TBX A;  1YVI A;  4IAQ A;  4BU2 A;  1WPK A;  1JTX A;  3JCU C;  3BQZ A;  5DV5 A;  1W0T A;  2IJL A;  1MBF A;  2P1A A;  3WTX C;  3OY9 A;  2FOW A;  4C3J J;  3JRB A;  2V1X A;  2V4J C;  1KQ8 A;  1Q0F A;  3IWZ A;  3HOY J;  1QSP A;  4K7B A;  5CVJ A;  3US6 A;  1DUX C;  2E7X A;  2B63 J;  1UCR A;  1Q1H A;  5LD2 C;  2ACJ A;  2H7B A;  3V8K A;  4RB1 A;  2VOD A;  2X85 A;  2DOA A;  2OJE D;  5LRR A;  1SAX A;  5FLX Z;  3TDZ C;  2Z2S B;  2NNN A;  2Z1D A;  2IGK A;  3L2Q A;  4FCY A;  2H1L A;  4L9J A;  4FX0 A;  4CHU A;  2QUP A;  3EPZ A;  5EEG A;  4DBQ A;  3MX3 A;  4JKV A;  2K9L A;  2BOL A;  4CZZ A;  4UHT A;  3BZC A;  1AHD P;  2XSD C;  3F8F A;  1BR1 A;  1WI9 A;  1MJ9 A;  1F9N A;  3RPQ A;  1Y8Q B;  1ZHF A;  1BW6 A;  4EV0 A;  2R5Y A;  2TMV P;  4PAC A;  3U9M A;  2FX0 A;  2YWA A;  3LEO A;  2L9V A;  3H9J A;  5B3S H;  5JLX A;  2R7U A;  1VQ8 I;  3CMM A;  5M3M J;  3OS2 A;  3IKT A;  1TWH J;  5JS5 A;  2Y2Z A;  5J3L A;  3MFK A;  2IT0 A;  3CC4 I;  2FFH A;  4S05 A;  3L2W A;  2IRF G;  2A61 A;  3GW2 A;  2LIG A;  4OWR B;  2EZL A;  2FUG 2;  5GP9 A;  2G9W A;  2K4J A;  1LQ1 A;  2VXZ A;  2CGE A;  4HV5 A;  2LG4 A;  1D5Y A;  4HLX A;  1M1E B;  2HGC A;  3L2C A;  2PMZ A;  3R61 A;  1ZHZ A;  2FD5 A;  3IPM O;  4U9D A;  2EWN A;  2RC4 A;  5K5R A;  1RRJ A;  3NMJ A;  1O3R A;  5DS5 A;  2M4G A;  1ZEL A;  2Q8K A;  1JPJ A;  2QQA A;  2PNO A;  2IM8 A;  3AGT A;  2V26 A;  3M7G A;  4GYG A;  4E7S A;  1E2X A;  1F43 A;  3V42 A;  1QKR A;  1BOB A;  3SZR A;  5A6A A;  5D5W B;  3UGO A;  3KP3 A;  1Y1W J;  1VI0 A;  1AA7 A;  1Y1V J;  1EH8 A;  2L5Q A;  5J4V A;  1R4N B;  1CPQ A;  3EGX A;  3OIO A;  4U5D E;  5BQT A;  1R1T A;  2LK2 A;  3ML6 A;  3K0L A;  4LG0 A;  2EFW A;  2ASR A;  1SD4 A;  1JUM A;  4M71 A;  1WKM A;  3ZMU A;  4QPQ A;  2QVO A;  3ROU A;  4M3B A;  5B3S C;  1U8B A;  2H27 A;  2KP6 A;  4RA2 A;  3LAY A;  4DJA A;  4CSA C;  1S5L C;  1S8N A;  3RKQ A;  2F5D A;  4HRI A;  1EJ9 A;  2IGM A;  1LEA A;  4UXN A;  5BS6 A;  2PEX A;  1YQA A;  4EIY A;  4PJN A;  5A6K A;  3EG9 A;  1ACI A;  3M4B A;  5GTI C;  3V5X A;  4QDL A;  1IZ1 A;  4Y13 A;  4CXF A;  4RS8 A;  2XPW A;  3E0J B;  4V2G A;  1FMV A;  4AD9 A;  3NMI A;  3V5Z A;  2HOA A;  3VYS B;  2UUI A;  3GTJ J;  4G7Z F;  4O6M A;  4DIQ A;  1HW1 A;  2E34 A;  2KHM A;  5KAI C;  1STZ A;  3FXQ A;  3MWM A;  2G7U A;  2DB4 A;  1IO2 A;  3E6M A;  4JYK A;  4KYW A;  1GQA A;  1OW8 A;  4PDK A;  4WWC A;  2R5Y B;  2LFD A;  5T1D B;  2E19 A;  2KK1 A;  3NKD A;  5KNL A;  3I53 A;  2XAG A;  4EM0 B;  3GTK J;  1TWH A;  1FNN A;  3D0S A;  1GXP A;  5DCF A;  5EZH A;  3EJN A;  1U6H A;  4E7L A;  1NG6 A;  1BR2 A;  2HDW A;  3H5R A;  3IQC A;  4A6D A;  3FVY A;  1OCR H;  4E70 A;  1FIP A;  1RUN A;  4IJA A;  4XM3 A;  3VWB A;  1VFC A;  4ZYD A;  2XPU A;  3G1M A;  5TRD A;  3LLI A;  3S1N J;  2JPU A;  2IGO A;  2HNH A;  1X4O A;  3BEH A;  2BVM A;  3LQQ A;  1O3Q A;  2L9J A;  3ZDL A;  1M2V A;  1O7L A;  4XNF A;  256B A;  2QSH X;  2CMP A;  2K27 A;  5DUI A;  3OS1 A;  1FC3 A;  3ZN0 A;  4DYC A;  5LEK A;  4MTF A;  3BTL A;  4C2U A;  5BQG A;  2XV4 S;  3EGX B;  3BTI A;  2XXA A;  1OR7 A;  3M1C A;  1G3S A;  2XHK A;  1M56 C;  1NG1 A;  1YA7 O;  1MBK A;  2X9D A;  2DYR H;  5ILS A;  3E3V A;  4CZC A;  1YO5 C;  4ULV A;  4LG0 B;  3E6C C;  2LP0 A;  4D4X A;  3NEU A;  2WL8 A;  4L9V A;  3H36 A;  5D5V B;  1LS4 A;  1J8Y F;  2ESH A;  4CJO A;  2IP2 A;  1ZRE A;  1ZGW A;  3JRM O;  2BC5 A;  3HPH A;  3F8C A;  1OCR C;  2K9N A;  4XL9 A;  4I09 A;  3RYR A;  3H0D A;  1Q0K A;  1OXK A;  1YX3 A;  3NAR A;  2OOC A;  3EG9 B;  2WZL A;  4NTB A;  2J7P D;  3LAJ A;  4RGX A;  1REP C;  3GME A;  1H9T A;  1MNM C;  4MW3 A;  2ZXI A;  3LFU A;  3KL4 A;  4HAM A;  1LVA A;  1FYM A;  2IS1 A;  2ETS A;  2XAS A;  2NAZ A;  3OYK A;  3QPH A;  3RTR A;  2EZI A;  3ZXS A;  2LKS A;  2I5U A;  4I01 A;  3ZPL A;  1XZP A;  2YQY A;  1R23 A;  3ABU A;  4PK4 A;  1MZB A;  2NVQ J;  3W8I A;  4AWX B;  5DS9 A;  2E60 A;  2OZU A;  2HQA A;  3MQ0 A;  5JLW A;  1FR0 A;  2R7X A;  3CAX A;  2DYR C;  3JR9 A;  1NU7 D;  1LDJ A;  2M8G X;  2HSB A;  4XEK A;  4KIB A;  1X2N A;  4IQJ A;  2V79 A;  3LA3 A;  2FRH A;  2YX4 A;  2HXO A;  1R5I D;  1W1W E;  3C2G A;  2DT6 A;  3MEX A;  4CH7 A;  1P92 A;  2YX7 A;  2BY1 A;  2M0M A;  1ZRC A;  2ZSH B;  3OV8 A;  1BJZ A;  2GWR A;  2LMD A;  2NYX A;  3I9V 2;  5LGU A;  5M5X J;  2YLI A;  2CH0 A;  3NAU A;  1W5T A;  4HFF B;  4L0Z B;  2NUP A;  4NC3 A;  2MAB A;  1WAT A;  3I4P A;  1RR8 C;  1J9I A;  3WTV C;  2ZJR F;  3FF5 A;  5DD8 A;  2DI3 A;  2GZW A;  3L8I A;  3FBI B;  1M2V B;  5EDN A;  3F3X A;  2L7A A;  3SXK A;  5L0C A;  4M9Z A;  2A07 F;  1HSJ A;  2PJR A;  1XZQ A;  1ZG1 A;  2OZ6 A;  4JVS A;  3L9F A;  2LRE A;  3OYL A;  5T3T A;  4BH9 A;  3K1M A;  5L3D A;  2J45 A;  2XS8 A;  1R71 A;  2P4W A;  4CA0 A;  3M1C B;  2XXA B;  3V4G A;  2CFO A;  4A3D J;  2GOM A;  4ZLC A;  3OYG A;  1XSV A;  3I56 I;  3MN2 A;  5M5Y J;  3VSL A;  1E86 A;  3IWF A;  2TDX A;  5E3N A;  3SJM A;  5K7F A;  2JJ7 A;  5KVR A;  1J0R A;  1Y0N A;  1APL C;  3QW1 A;  2M9H A;  4S0H B;  3HOW J;  1ZVZ A;  5D5U B;  1WSU A;  1H8A C;  4B48 A;  2FQ4 A;  5DVW A;  3KYJ A;  5CI9 A;  1K78 A;  1I27 A;  3R6S A;  2EB7 A;  1OR7 C;  4I6Z A;  3K69 A;  4NC6 A;  4B47 A;  2UXX A;  5L3B A;  3GTM J;  1FOW A;  3E1S A;  2QQ9 A;  4WK8 F;  1IN7 A;  1ZAR A;  2VKE A;  3S2W A;  5HV9 A;  1ZHX A;  3GTL J;  3Q3S A;  2M5W A;  3H3U A;  3P9K A;  4XQF A;  1U9O A;  4YFX F;  5B66 C;  4KN4 X;  5IP9 J;  2P61 A;  2I8D A;  2FGY A;  1ZGJ A;  4XSX F;  2L01 A;  1OXB A;  4U7B A;  2Z15 A;  4E18 A;  3LL7 A;  2VKH A;  1YDI A;  4H54 A;  1UST A;  3LSI A;  2X48 A;  3G4S I;  2ZSI B;  4A3B J;  1HW2 A;  4I02 A;  2K02 A;  4BJ5 A;  1LFU P;  3U2L A;  3VYT B;  4B44 A;  1FWZ A;  4E0I A;  3RDI A;  1LEB A;  1T95 A;  4ZYA A;  4ZLD A;  1DGR M;  3MKL A;  4PFO A;  2PMH A;  3LJB A;  1MBJ A;  4MFE A;  1QVU A;  2BY3 A;  1FSH A;  2Y39 A;  4L9N A;  4F7Z A;  2ZNY A;  4XPX A;  3ZMZ A;  5ICF A;  2VT2 A;  3BTJ A;  5GPC A;  3T9O A;  1M57 C;  2LFB A;  4Q4Z F;  2WWY A;  4BE1 A;  1EA8 A;  3QVY A;  3GM3 A;  4E4H A;  3CZ6 A;  3WHC A;  5B1B H;  4II2 A;  3S17 J;  2NUP B;  2K40 A;  2DQL A;  4JCH A;  3IRR A;  3ECS A;  3V7O A;  4RBO A;  3S9O A;  2GAQ A;  3QPS A;  4Y7N J;  1R7J A;  5AGF A;  3WGI A;  4JW1 A;  2X51 A;  4AYB N;  4PCQ A;  3LS0 A;  1RKE A;  3RYL A;  3M1E A;  4JJF A;  2FF4 A;  2PJR B;  4JTD B;  1QVT A;  5E8G A;  1ETK A;  3FM5 A;  2J9V A;  2R4G A;  2STW A;  2LSE A;  2GA1 A;  2W4B A;  1Z6T A;  2IA2 A;  3CTA A;  5A6B A;  4XBF A;  1G4D A;  5E17 F;  3N4M A;  2VON A;  1ZLK A;  3ONQ A;  1FBU A;  3GOR A;  3FMS A;  2IS2 A;  5ED4 A;  4GXO A;  4BE0 A;  4XN0 A;  1RKT A;  2HI3 A;  4UNO A;  1R6R A;  3GFL A;  1K40 A;  3LLK A;  2F4O B;  1K7A A;  1WWX A;  4XWJ A;  4MLO A;  1DGW Y;  4NDL A;  1K78 B;  4N4W A;  2KJG A;  2F5E A;  2HV6 A;  4IJJ A;  1C02 A;  1JUS A;  3G73 A;  5C4X J;  4NHJ A;  2DOE A;  2WAE A;  2VC9 A;  1YIT I;  5B1B C;  2UXN A;  4X1E A;  2BW3 A;  3A9C A;  4AE4 A;  5EEA A;  4BYY A;  2L9S A;  4DBR A;  5A2Q K;  1T6Q A;  1QZE A;  4ZTF A;  5BOX A;  2CDQ A;  5HNF A;  4CCN A;  1K4S A;  1DU6 A;  2JMW A;  5KYX A;  1USS A;  4KNY A;  2H8W A;  1S6L A;  2LNB A;  3IV5 A;  4PJ0 C;  2BVL A;  3JTG A;  1D0X A;  4CIC A;  3PNV A;  4HNT A;  1HKQ A;  1WN0 A;  1ZHT A;  1JJ8 C;  4G9Y A;  3T8T A;  3W2V A;  4PGH A;  2HDD A;  3ZQI A;  1UFB A;  2LKX A;  3LQR A;  4RLQ A;  1Z6A A;  3Q7G A;  2B9S A;  4IOC F;  2YU9 J;  4BJ5 C;  1J2X A;  3BRO A;  2JA8 J;  2YLD A;  3PNT A;  3DEE A;  3WE3 A;  1QRY A;  1I3A A;  4ENK A;  4B8X A;  3Q7L A;  4ER9 A;  5M3F J;  2DOF A;  2NOJ B;  4HNU A;  4CJG A;  2X6Y A;  3EYY A;  3S1R J;  4U7D A;  1RET A;  1D3Y A;  1OCO H;  3WTT C;  1GLN A;  3DWW A;  1RKE B;  1J75 A;  3MKW B;  1X4P A;  3KZY A;  1TT5 B;  2XGD A;  2CV1 A;  1Y56 A;  2JVG A;  2QLA A;  2JQ7 A;  3L2R A;  4KJZ A;  5LFA A;  2CNW D;  5C3E J;  1TWC J;  3L7W A;  2XLM A;  2Y3B A;  2DO7 A;  2W7N A;  2EIL H;  3BR2 A;  3PSI A;  5F64 A;  3C8G D;  5L0I A;  3SEQ A;  1ZW2 A;  2DK8 A;  3W6J B;  3FXM A;  3H3V K;  1LE4 A;  2D5V A;  2E87 A;  1EKE A;  2EIJ H;  2OTL I;  3ZWI A;  4RB2 C;  1OJL A;  1K83 J;  3J81 K;  4ESF A;  1TR2 A;  2KSF A;  3BR3 A;  1G4W R;  2W82 A;  5LLQ A;  4EBJ A;  3U9J A;  1Z05 A;  2HUJ A;  2XUB A;  2BE5 F;  4ZDP A;  5IYC J;  3QYB A;  3KYC B;  4X0G A;  1P9Q C;  3E5U A;  3POV A;  3K10 A;  3Q0V A;  2BW3 B;  4AE4 B;  5KCM A;  3TBI A;  3H5A A;  3R2P A;  1OCT C;  2Z3Y A;  4O5V A;  3V8J A;  1RIO H;  1OCO C;  2GFH A;  5L3E A;  1YLF A;  3LA2 A;  3QVZ A;  3HPG A;  5A69 A;  1RES A;  2DA3 A;  5K5Q A;  5FRM A;  2EPM X;  2NVX J;  4Z9I A;  3S27 A;  3BLY A;  3WHN A;  2EBI A;  4MTE A;  5E1W A;  2JUG A;  3X2Q H;  4P6I C;  1YIO A;  3ABL H;  3FIS A;  1B4A A;  4UV9 A;  2N8G A;  4NTA A;  4CSW A;  3L0I A;  3O55 A;  2Y48 A;  3N24 A;  1QU3 A;  2HEO A;  4XEF A;  1FP1 D;  1MW7 A;  1B9N A;  1ENH A;  2X1D A;  4UUS A;  3VPR A;  1OW7 A;  3IQT A;  2H94 A;  4S04 A;  4Y3O A;  4P55 A;  1WZ2 A;  1A5J A;  2QSF X;  5FKN A;  3IH2 A;  4L6R A;  4I0A A;  1LJ9 A;  4HX7 A;  2EPL X;  3MYF A;  1D1C A;  2M7B A;  2CS3 A;  5BUO A;  2KL4 A;  2L4A A;  1MBG A;  2QGU A;  1ODD A;  1Z77 A;  3OOP A;  3VFZ A;  2PI0 A;  1I4Y A;  3CP8 A;  4LFU A;  4KA4 A;  1QZY A;  4KN7 X;  3GTQ J;  2CQ7 A;  2YEV A;  3LNM B;  1WAS A;  1IXR C;  2BGC A;  3JYH A;  4XRS A;  2XC7 A;  4BQN A;  1HF0 A;  1DOW A;  1TNS A;  1QZZ A;  2J46 A;  4R32 A;  3RIP A;  4BJT A;  4RD9 A;  3K6G A;  3RSN A;  4CDG A;  2XF7 A;  3B0V C;  4GCV A;  3WTU C;  3V5Y A;  2XKO A;  2EV0 A;  2GXB A;  3KP4 A;  2DDB A;  4GGG A;  4HSR A;  1GV5 A;  4CYD A;  3MVP A;  3F21 A;  2V1N A;  1FTZ A;  3UGP A;  3ZQL A;  3X2Q C;  1Q0M A;  3ABL C;  5E2Q A;  3DKX A;  3KZZ A;  2O0Y A;  1H6G A;  3GO5 A;  2KIU A;  2W1O A;  4Q47 A;  4FES A;  4XMY A;  1U0J A;  5HOD A;  2L2O A;  3L2V A;  1QZX A;  1ST6 A;  3S8P A;  2DW4 A;  5A2Q Z;  4M6Y A;  3ZCO A;  1IAW A;  5CI8 A;  4IX7 A;  2L81 A;  4CCL A;  3BZK A;  5JHU A;  2MHR A;  1O5H A;  4M74 A;  3IH4 A;  5F27 A;  2QE9 A;  4EUK B;  1JPN A;  4IPA A;  3OYM A;  2WC2 A;  1GGQ A;  1HA8 A;  4EMS A;  3DM9 B;  3SYN A;  3RKW A;  3JCU Q;  3AKZ A;  2Y9Y A;  4MW8 A;  1YFH A;  3K1N A;  4YK5 A;  5F28 E;  2HYF A;  4EVI A;  3BWG A;  2NNY A;  5HSW A;  1HOM A;  4D7M A;  3QYE A;  1MNE A;  2JUC A;  3FK7 A;  2PX3 A;  3O3K A;  5CQG A;  1T6I A;  1ZW3 A;  1V54 C;  3VF0 A;  3BR5 A;  1MQV A;  3L00 A;  4ZYG A;  3EHN A;  3U3F A;  5F0F A;  1P7J A;  2UWM A;  2FSW A;  2JA5 J;  2LFF A;  3C2B A;  3OWT A;  4XLH A;  3SHF A;  4BXF A;  4BY1 J;  3GUD A;  3WG7 H;  5CVR A;  2KRF A;  4B3A A;  2ME6 A;  3CCE I;  1L7C A;  3QMK A;  4V19 K;  4BEJ A;  4EQQ A;  2HTS A;  3FHD A;  4MND A;  3BCB A;  5FLV A;  3KE2 A;  4HNV A;  2G0E A;  4ZZD A;  2P81 A;  1T0F C;  3TL4 X;  1V55 C;  3FHZ A;  1R9T J;  3U3B A;  2JRT A;  3FBN B;  3HHH A;  4D5C A;  2V3C C;  3B73 A;  4WF2 A;  1ZU5 A;  4ZDO A;  1TFK B;  1WH5 A;  3J81 Z;  1SD5 A;  3H92 A;  3RQI A;  3F47 A;  2LP4 A;  3RI4 A;  2XLE A;  4IHT A;  2F48 A;  5E3C A;  5DM6 F;  4P96 A;  2HV7 A;  2E1C A;  1FT9 A;  2W48 A;  2R7O A;  1PD0 A;  2H6B A;  2GQQ A;  1QBJ A;  2WV0 A;  1FSE A;  5IY5 H;  2CRG A;  3AL0 B;  1OYI A;  1VOM A;  2LSO A;  1YI2 I;  2DMN A;  4K0D A;  2Z5U A;  2E7W A;  5EGO A;  4JTA B;  3ZQV A;  4EBK A;  4CX9 A;  1RC9 A;  4EWC A;  2W4S A;  4XPY A;  5DQT A;  1R49 A;  3WG7 C;  3K70 C;  3B6C A;  2M4E A;  2ESN A;  5GAG J;  3LUT B;  1A36 A;  1XMA A;  3DCF A;  4AM3 A;  1B9M A;  3GFM A;  4ESJ A;  4CDY A;  3AL0 C;  2XAJ A;  1G3T A;  2XAF A;  4IO9 F;  2L7K A;  2JT1 A;  4A5N A;  1ZR4 A;  4U5C E;  3EPV A;  2DCE A;  2Y0S N;  3P5J A;  3EQL F;  1GXQ A;  3OYI A;  1VQO I;  5L3C A;  2EV6 A;  1TKN A;  1EH7 A;  2DBB A;  3L2U A;  4ZJZ A;  1UG7 A;  3C62 A;  2XSE A;  4OAZ A;  1SVO A;  3PNY A;  2YL1 A;  1FJL A;  1ZQ3 P;  4LLN A;  2OQG A;  3M8F A;  3EGD A;  2X6O A;  1MGT A;  3VEP A;  2OG2 A;  1VND A;  3U21 A;  2MH2 A;  5IOZ A;  3CF2 A;  5KHD A;  2NRA C;  2LY9 A;  2E5N A;  2EJR A;  2KFD A;  5JT4 A;  3MZ8 A;  3ZQG A;  2I15 A;  2R7R A;  5KYU A;  4PJM A;  1ZG3 A;  2IAI A;  3BG7 A;  2WB7 A;  2XRL A;  3WHB A;  2L6H A;  3A02 A;  4YRV A;  3CQZ A;  4MHG A;  1KTM A;  4OIQ F;  1D1A A;  2WBM A;  5KK1 A;  3W2A A;  4F3Q A;  5ILU A;  5FFZ A;  2ZFU A;  1VYI A;  3LA7 A;  1BI1 A;  1A6I A;  4HQE A;  2A5W A;  4O6Y A;  1NK3 P;  3D1N I;  2P8T A;  2K9S A;  1QO0 D;  2DOD A;  3KEQ A;  2STT A;  3BT9 A;  4GDF A;  4C9Y A;  4XKB A;  3ZMS A;  1NFO A;  1ZGA A;  2MBF A;  5FRO A;  4CDA A;  2HOT A;  3MYI A;  2PF4 E;  1LUJ B;  2ZPA A;  2FA5 A;  3ERM A;  2HPM A;  5CKT A;  1VQ6 I;  4MVZ A;  1I1S A;  3JRA A;  5E3A A;  3X1O A;  2XB5 A;  2VT3 A;  3IUO A;  4U5E E;  5L3V A;  2PBE A;  3TUL A;  4KNV A;  2JPB A;  2GAU A;  2VJ5 A;  2XAQ A;  3OYC A;  1JAF A;  1B72 A;  2B0H A;  3EUA A;  3DF8 A;  1S3J A;  4HG2 A;  2E35 A;  4IKF A;  1PYV A;  2V9V A;  1XD7 A;  2WY8 Q;  5EGO B;  2E2J J;  2CW8 A;  3E5Q A;  2HWV A;  2DA7 A;  3TD7 A;  4G0H A;  4XRS G;  4LER A;  2JN6 A;  3FKI J;  3R0J A;  1DP7 P;  2Y3H A;  2XB0 X;  1Z7L A;  3G3Z A;  2M45 A;  5IYB J;  3LSG A;  3F8B A;  3RIR A;  1EI7 A;  1VB5 A;  2WAF A;  3PUB A;  4BPM A;  1QVX A;  1JHF A;  3ZOB A;  5F1J A;  1HMO A;  1W0U A;  2ICW G;  3M15 A;  4XK4 A;  2M8E A;  2XGC A;  3JSZ A;  1LKX A;  3HNJ A;  3C2H A;  2XGX A;  3A11 A;  1R5H A;  1OIS A;  3F6V A;  1AKH A;  1D8J A;  4UVB A;  1IRX A;  3ZTM A;  1KU9 A;  4YEJ A;  1R00 A;  5JUA A;  3EGD B;  1U9N A;  3RFY A;  2JD3 A;  3S29 A;  1W5S A;  3FM3 A;  3LAP A;  4O6J A;  1APC A;  4JJG A;  5DEQ A;  4UV8 A;  3BPV A;  3AJM A;  1Y6D A;  3DPU A;  1WFX A;  3NMK A;  3HSE A;  4JK1 X;  3W4Y A;  4IVN A;  2V7F A;  1IF1 A;  3PM1 A;  4NTF A;  3K6B A;  2J9B A;  1TQP A;  3S32 A;  2PMZ N;  2PLY A;  4EJO A;  5FLM J;  3MMY B;  4GQH A;  5KYU B;  3RQ4 A;  2W24 A;  4ENM A;  3IHU A;  4MO7 A;  2EFO A;  1ULY A;  1LE8 A;  2NSF A;  4OD5 A;  3VSK A;  3R7C A;  3GEZ A;  4HF2 A;  4O79 A;  4YWQ A;  5J1U A;  1MBH A;  5J40 A;  4IHX A;  2Y3D A;  1YIJ I;  2HZ8 A;  1ORY A;  2DT5 A;  2OC6 A;  4E7I A;  3CCU I; 
#chains in the Genus database with same CATH homology
 3KPH A;  2ICW G;  1R5I D;  2OJE D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...