3KPHA

Crystal structure of mycoplasma arthritidis-derived mitogen
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
196
structure length
196
Chain Sequence
QNLNNVVFTNKELEDIYNLSNKEETKEVLKLFKLKVNQFYRHAFGIVNDYNGLLEYKEIFNMMFLKLSVVFDTQRKEANNVEQIKRNIAILDEIMAKADNDLSYFISQNKNFQELWDKAVKLTKEMKIKLKGQKLDLRDGEVAINKVRELFGSDKNVKELWWFRSLLVKGVYLIKRYYEGDIELATTSDFAKAVFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Superantigen
publication title Crystal Structure of the Mycoplasma arthritidis-Derived Mitogen in Apo Form Reveals a 3D Domain-Swapped Dimer.
pubmed doi rcsb
source organism Mycoplasma arthritidis
total genus 73
structure length 196
sequence length 196
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-11-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.530 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A mam-mhc complex, Chain D, Domain 2 3kphA02
1.20.120.390 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Hla class ii histocompatibility antigen, dr alpha chain. Chain D, domain 1 3kphA01
2ICWG 3KPHA 2OJED 1R5ID
chains in the Genus database with same CATH superfamily
3RYLA 2X6XA 1D5YA 2DCEA 1VQKI 4DOZA 3G3ZA 4JX4A 1TZLA 2EA2A 4C2MJ 2IXNA 2HTJA 1A31A 3DAFA 2BVMA 1YQAA 2EIJC 5GAGJ 2D5RB 1LFUP 3E6MA 1GGQA 3AL0C 1H88C 1HA8A 2WVOA 3I5PA 2P5LC 4IAQA 4XLCA 1OYWA 2CU7A 2Y2ZA 1E84A 4GCVA 2EFOA 4HFFB 3S27A 5BOXA 4I01A 1U6HA 2CGEA 3HLZA 3ROUA 1TW3A 4XEFA 1D0YA 1SFKA 5EGOB 3VF0A 2LOOA 1HE9A 1SZIA 1F36A 4EJWA 2PP4A 3GEEA 5HV9A 4NQFA 3ZQIA 3IH4A 1S7OA 3GTGJ 1K83J 3OR2C 5L3CA 2JPCA 1M57C 2CQKA 5AIQA 2Y9ZA 4EM0B 1MDMB 3TKYA 3SP1A 5FFZA 2FQ4A 4QI0A 3PJRA 2D1HA 2DGJA 3WHNA 3JRAA 1T5OA 3GM1A 2E36A 1K04A 5CVIA 4WXHA 1LFPA 1YOVB 1Z6AA 1IW7F 3H5NA 3NARA 3VYRB 2M2EA 3I4UA 4XNFA 1Z7UA 1R1UA 4IJJA 1B8IB 1FNTc 2R25A 1IO2A 2HI3A 2QQ8A 2PQ8A 2JX0A 2ZMEA 4K2EA 2B63J 3K6BA 1U8BA 4D9JA 2M1BA 2G3KA 3H1CA 4XQ1A 4EBJA 2RNJA 1V3FA 5ICGA 1LM3B 4N06A 2DDBA 3HG9A 4HNTA 2XPVA 2LMDA 1RKCA 2G3VA 1FNNA 3IUOA 1E3PA 1VI0A 1TKNA 3POVA 1LE2A 2R7UA 4G7HF 1X1CA 4NBQA 1A6IA 2Z9OA 1POGA 3H5AA 3TD7A 2NXNB 3BZKA 3QODA 3HKZN 3KX2A 4L5JA 3U3BA 3MLGA 4KYWA 4UB6C 2X0CA 2DAOA 4JBAA 3V7SA 3A01A 3OYHA 4RDUA 2DA7A 2ZXJA 3ABKH 1TWFJ 3HRSA 4QWQA 4LACB 2LSEA 4XRSG 2LF8A 4BKXA 1I3QJ 3NAUA 1MH3A 2ZB9A 5A2QZ 3GZ5A 5JLIA 1ZZPA 1ULYA 4OD4A 3JRCA 3KYIA 4XPXA 2FOKA 1N77A 3I5UA 2J8WA 1JUMA 2V1DA 2DA1A 1G4WR 2YL0A 1S3JA 3HC7A 4M74A 4F52A 3EPZA 2JK3A 2K85A 1BR4A 3L1MA 1UAAA 1RIOH 1Q1HA 3HTKC 3WTYC 2AWYA 1T6SA 5JR3A 2QNLA 1TQMA 3V8KA 1JTYA 3SZGA 1D5VA 4HAMA 2LFDA 4Y4RA 1YFHA 3OV8A 5EEGA 2STTA 4I1MA 2H09A 4D7NA 3S1MJ 3EGDB 4B3AA 4G6QA 5J4VA 2VLAA 3SFZA 3DF8A 4LD5A 4U0VA 4RLQA 4BHPA 3WODF 3H9GA 3EUKL 1FSHA 1ZARA 4IHVA 2IJLA 1NFNA 1OISA 2M5WA 4UUVA 2XGCA 3AL0B 4YT2A 3AJMA 4BJ5A 2ADUA 5JVEA 2GDCA 2JTVA 2IBDA 3AGUA 3DFGA 4ENNA 3ASNH 1B59A 1IRZA 2Y30A 1GHCA 1NG1A 2NOJB 3MVPA 1MNMC 1Y39A 5CVUA 5LHHA 3ZQLA 3KL4A 5ERIA 2QA4I 4AL0A 2KISA 3BTLA 1Z6TA 2QENA 3AGTA 2QLZA 4YEJA 3FHDA 3BT9A 2L9JA 1SVOA 2CQNA 3KP2A 1RJ9A 2DFIA 5F1JA 3JSZA 3V7OA 1ZVZA 1U8RA 2QGUA 1QPMA 3KP6A 4AIKA 2KIFA 2LP0A 4CS9C 1JTXA 4YWQA 4L9TA 2W57A 4ZYAA 3OYNA 3ECOA 3C62A 2CFXA 3BR1A 1E3OC 1X58A 1M56C 4DXWA 2HPIA 1K78A 1G3TA 2L6FA 3EZIA 2XASA 4V2FA 2L7MP 4AYBA 4YJWA 1RXQA 4B43A 3RKOF 1IV6A 2HZTA 3AG2C 2PLYA 5HNFA 2GAUA 4PGGA 3LS1A 2V9VA 4HYEA 3GFIA 2IVMA 2BZTA 2ZNYA 2YRFA 1KGSA 1K6OA 2PI0A 1Z63A 4WCGA 1UG2A 2Z33A 2J7PD 1NHAA 2CH0A 3TOAA 4QI2A 2ELHA 1D1CA 2EV5A 2PMZN 2W25A 4YL0A 1A7EA 1XGSA 2HQ5A 5E18F 2KJCA 2DI3A 3K70D 4ENKA 2Y48A 1BW6A 3EFOB 1M1EB 4HDUA 1RKEB 1L3PA 4MGRA 3H3UA 4BXFA 2B0JA 2EIMH 2ZXRA 2Y0SN 1WPKA 3GLLA 4DYQA 4DIQA 4I09A 1A5JA 4LDKA 5HLTA 3LSTA 3Q9VA 2YL3A 1S72I 3CMAI 5HLHA 1X3ZB 1Z7LA 2EPMX 3B0VC 4I7HA 3IKVA 1QO0D 4FETA 3VDXA 4I76A 3ZXSA 3HTSB 4HPQA 1YARO 2KJGA 3QOEA 5DCFA 3IKTA 2D4UA 1G59A 3BJ6A 1DU6A 2QTVA 1EI7A 4C3IJ 1HKQA 5M5WJ 3CF2A 2I8DA 3C2HA 3D5RC 3VYSB 2K86A 1MW7A 3P9IA 1YW9A 3QAHA 1SMTA 4NTAA 3WTUC 2LC2A 4RM3A 4MVOA 1ZRDA 1IN7A 2DMTA 2R93J 2DYRC 2QUPA 2L4AA 2VJIA 3DKAA 1HXDA 4A3IJ 1WVRA 5FB2A 4O3MA 3MBGA 4Q7CA 5E3AA 4D4NA 1FIAA 5FZTA 2HDCA 1RMVA 4QTRA 2F5EA 2Q8KA 3W6KB 4UUSA 3IL2A 1AKHB 1JAFA 2FAPB 2EZIA 2L81A 5C3EJ 4BEMJ 5F6FA 5IPAA 1BL0A 4MTOA 1AEPA 1CF7B 5LGUA 5FROA 3CO7C 2ASRA 2P5VA 1T0FA 4RAZA 5IP9J 3MYIA 2HFHA 3NRHA 1O3TA 4HV6A 1LFBA 1G4DA 5IY5C 2EH3A 1BA5A 2W9YA 1YG2A 2DLLA 3RCOA 1NH3A 4Q47A 4A5NA 3COAC 3HPGA 2WZGA 3CESA 1I6HJ 3LESA 2AQFA 2PEXA 3I54A 2AVKA 1P9QC 2VXDA 2X85A 4XOPA 5D5XB 1P2FA 3UKGA 5CVVA 2MW8A 2P7VB 3E5QA 3IH2A 5HS9A 3C8ZA 4UUTA 2F5VA 1ST6A 4L9VA 1W5CC 3GUDA 3BR2A 2IS1A 3JTLO 3PMRA 3HOUJ 3FM5A 4A3CJ 3KMIA 1ZG1A 3W3CA 2FE3A 1XTAA 1J75A 2BHYA 2QLAA 3LEVA 3BQZA 3H9QA 4OIQF 1MMNA 2VQHA 2QY9A 2MG4A 3FKIJ 2HXOA 5K0IA 1S5LC 2VBXA 1OCPA 3DEWA 1BJAA 5D6FA 4B47A 3JSOA 4KDPA 4JCHA 1WFXA 5LD2C 4XWJA 5F5FA 5EEAA 4Y13A 2YKZA 3DTKA 4EJUA 3Q9SA 2ZCWA 1WKMA 2VH3A 2FX0A 2MWQA 2JA6J 3BTIA 1DU0A 4EWCA 2ESNA 4ON0A 1TP4A 2DT5A 3M8JA 3CP8A 5FKLA 2JUCA 3TO9A 5FJ8J 4HLXA 4L0YB 3GVAA 3ABTA 2Y69H 1LPQA 1O4XA 1VQLI 3EZHA 3U8PA 2IA0A 2KL4A 1YYXA 4CXFA 5DQZA 3NEUA 1VK5A 1WJAA 5FKMA 1WN0A 3GM2A 2CQXA 4IZZA 1IN6A 4RAFA 4GYGA 3TP0A 3S1RJ 4EIYA 2LSOA 2J9VA 4IHXA 1PUFB 3CLQA 3BR5A 3FF5A 4CZCA 2LR8A 3LL7A 2L3DA 5EG0B 3RQGA 1SFOJ 1K05A 2H8AA 5JUAA 4LIVA 3MMYB 3QPSA 1HC8A 2IXOA 4ZYDA 1YITI 4XLNF 3GFJA 2JSPA 4ABZA 2PX3A 1SD4A 4A3FJ 1JKOC 2ACJA 3P7NA 5E79C 3RTRA 2WA0A 5GP9A 4DZPA 4AVPA 3RVZA 1MSFC 3MEXA 1EKYA 3CC7I 2CO5A 4FX4A 1TWGA 2XLEA 4U5HA 3MZHA 2WAEA 4M6XA 1VTNC 4LLEA 5JSLA 3ZTZA 4A2NB 3CDIA 5CIVA 2EIJH 2D5VA 2ZSIB 4CCOA 3DJNB 1IG7A 1VQ6I 1GLNA 3B6CA 4CICA 4BY1J 3FXQA 1Q0GA 3JAMK 1PVEA 3ULQB 3ZQQA 4BU2A 4U5BE 3FZVA 4A0YA 3JRFA 4CS7A 3QVYA 1O57A 4Y7NJ 3DI5A 2ME6A 3BJAA 2W7NA 2XIGA 4ASNA 3H2UA 4F93B 5L0GA 1LDJA 3WGIA 3F0CA 3UGPA 2ESHA 3LAPA 5KYUA 1N75A 5IYBJ 4LFUA 3HBLA 2YR2A 2OJQA 2A0BA 2JSCA 1L0OC 3J7ZI 3KIOA 1W7PD 5F0CA 4G9YA 3G4SI 4KIFA 4A3JJ 1A0BA 3NMIA 1T08B 2L7ZA 1HW5A 1SR2A 2Y3DA 4PJNA 2JRMA 4KN4X 4CA0A 2EIKC 1ODDA 3I9V2 3GTLJ 1I1GA 5J1RA 1UJ8A 4BDYA 2IS4A 4DQ2A 1CGPA 3S93A 1ORSC 5DYMA 2YLDA 1VQ5I 3SHFA 5IYDJ 2XRHA 3SNHA 1OQCA 2BVLA 4IHWA 2E1MC 3L2QA 2J0XA 3LSPA 1KNYA 3L9FA 5L3BA 4FE7A 1OPCA 3QMKA 4IO9F 2QCOA 2I15A 1ZYRF 4N4WA 3T6JA 2STWA 2Y9YA 4CDVA 2OKUA 3F8BA 3DEUA 5KK1A 4BDZA 3DEEA 3ABLC 2VN2A 4NDLA 1DOWA 4BACA 1G3SA 3SEQA 1PYVA 3FX3A 3OYFA 3JT1A 3S3NA 2DMNA 3SEZA 4NB5A 1ONVA 5D5WB 3MKYB 2NUTA 2FBIA 2LY9A 1J2XA 2CW0F 2GLOA 2LRDA 4DW6A 4XL9A 2EFQA 2HYGD 2KZGA 2DT6A 2X9DA 3U1KA 1FEXA 3L2RA 4C3DA 4G6TB 4ZDOA 1IRXA 4L0ZB 3HJCA 2NPUA 3R60A 2KSFA 4IXAA 4U0YA 3V42A 3K4MA 1M2VA 3BPXA 2V79A 4M3EA 2IA2A 2HOEA 3HXLA 4BXUA 4O5VA 1LUJB 2YL7A 3KYDB 1QQ3A 2X6YA 1H9GA 1L7CA 1U5TC 5F0HA 2OZUA 1BBHA 1R4MB 1ZHFA 1FSEA 2M4KA 1IC8A 2Q4FA 1RESA 5JI6A 5JVTA 3ML6A 3HOTA 5FRNA 2CQ7A 3R0AA 5ILSA 1UMQA 2ZSHB 5JHUA 1R9TJ 2ZBKA 1ERDA 2KW3C 1CGOA 3ZCOA 4MTFA 1VQ9I 1M6TA 4P96A 3M3YJ 2LK4A 2PMUA 3ERMA 3RDIA 5CKTA 3CCJI 1BW5A 3JTGA 4UVAA 4DBRA 3BC8A 4A0ZA 3O8GA 3A03A 2COBA 3KEYA 4KA4A 4A3LJ 1B4AA 3K0LA 3ZMSA 2QSFX 1WTYA 4ZLDA 1A04A 2H8WA 3IV5A 3KLOA 4B8XA 3K4CA 2GOXB 1FT9A 1JUPA 2DTZA 3BG7A 2VI6A 1FWZA 3OIQA 4IF4A 2OUMA 1HF0A 1M2OA 3ISPA 3A0HC 2BE5F 4EJVA 3QRFF 2BY2A 1P92A 2KRCA 4GRIA 3H3ZA 1KU7A 1T01A 1ZW2A 2XS8A 5LRSA 5J1YA 4R32A 1GXPA 5CQGA 2LY1A 2AWCA 2IRFG 4IQJA 5BQIA 3F3XA 4AX2A 1IF1A 3OA1A 2FJ1A 2QEXI 5E3CA 2L6HA 3QPLA 4MO7A 1AA7A 3PO3J 2F4IA 4JYKA 4XKCA 5EYRA 1VB5A 3TMOA 3W6JB 2QVOA 4QPQA 1B72B 4E7IA 3DBRB 3W2VA 2EFPA 3BJOA 3S84A 4CCNA 1OR7C 2PG4A 5EZGA 1QLEC 3CTAA 4AE4B 3DPLC 1B8IA 3K2ZA 4X6AJ 1KA8A 2NNYA 3ZPLA 3HUGB 1V54C 3DM5A 3GTPJ 3O10A 3S17J 1GV2A 2VOPA 1XMXA 2A68F 2J9BA 4UB8C 3GCMA 3EUHC 2R0QC 2EZKA 1OCZC 2FQ3A 3LEOA 3VSKA 4XLPF 1LDKB 1OW6A 3SXZA 1Y1WJ 2VCCA 3V4GA 3W2WA 2FXAA 1JKRC 2CW7A 3C63A 1IZ1A 1MJAA 2M7BA 3L2WA 1HLVA 1QU3A 2DTRA 3WHCA 3L1PA 3AG3C 3JYHA 2OQGA 3A02A 3G50A 1B9MA 3AQCA 1IDYA 3FXMA 4DYCA 3HNLA 2Q1ZB 1R7JA 4BH9A 4PK4A 4E4HA 4BNCA 1F1MA 1NU9C 3KZZA 2HQNA 2UUZA 4XKBA 3GTOJ 2UUIA 4HQEA 1JT6A 3K66A 4P9TA 2WAFA 3EUAA 2ECBA 2E1MB 2LREA 5DCMA 2O0YA 3X2QC 3AG2H 3ZMTA 1GV5A 5GPCA 3M7GA 2VKHA 2NS7A 1QZEA 5LBQA 1FP2A 2L2OA 2KRFA 2E60A 1FMVA 2K9NA 5IOYA 1HKTA 4DJ9A 3EYIA 2HJ3A 1PJRA 4RD9A 2QF7A 4P9UA 3NMKA 3CUQC 1CGME 4HSTA 1OKKD 2XAUA 1W2WA 5JT4A 3X1OA 3OR1C 3UR3C 1SYQA 2IXPA 3ECHA 3FXRA 3E70C 2WTEA 3OL3A 5TJJA 4A6DA 3SXKA 2VOOA 2R5ZB 4PJJA 4XN0A 2XAFA 1FBQA 1YJWI 4JRZA 3M1CB 3A0BC 3V7RA 1V55C 2HV6A 3Q6MA 1D1BA 1ETQA 2IGKA 5BNGA 2OD5A 3DJUB 3OYIA 2QSGX 3V8LA 4HF2A 5HVQC 1USSA 1Y6IA 2JPBA 3TOLA 2XS1A 1QVUA 4RGSA 3S0XA 1TNTA 2XSDC 3E6DA 1JXSA 1B1BA 2HOSA 2XDVA 3R2PA 3JAMZ 3OL4A 1U5TB 2HXIA 1F1ZA 4A2UA 4J7YA 2XB5A 2H1LA 3ZP5A 2PMHA 3IQCA 5LGTA 2VBYA 2XM0A 3S32A 4DGWB 1SFUA 5J8FA 2MLGA 2L01A 3DPUA 3CC4I 1IXCA 2DYRH 4J30B 3PQKA 3JYYA 1SAUA 2K9SA 2ID3A 2YU3A 1LVKA 1T56A 3DWWA 2NNNA 1U9NA 4RS8A 3GTJJ 4MTGA 3U0CA 4FQGA 5E3LA 4AIHA 4B6IA 4LB5A 4J19A 2LVSA 4LK0F 2DPDA 2R9RB 1FPQA 2COMA 3DE8A 3QYFA 4X0RA 1Y1VJ 4B44A 4ZTFA 5IY5H 3TO7A 2KGOA 3BRJA 2X6WA 1SANA 2CJJA 4JQFA 4M9ZA 5FLXK 1O7FA 1LEAA 5F1RA 1ETXA 2GIVA 4YL3A 2HQAA 2MC3A 1U0JA 2E1NA 4YIFA 1IXSB 1YRNB 4IAOA 4ZYEA 4ZDLA 1J5YA 1IZMA 3RKYA 5GADJ 3SDBA 2DMPA 4OWRB 3I59A 3OY9A 3CUOA 2J9UA 2E35A 2L9VA 1JGGA 5DD4A 3BLYA 5J6XA 2OEXA 4KFCA 1ZREA 4XKWA 3I71A 3EQLF 3PIOF 2HYJA 2HDWA 4JIOA 1YVIA 4IWBA 3GBGA 3H36A 2Y0MA 3A2KA 2GA0A 1JMWA 4L9NA 1YDIA 5BQTA 4F7ZA 4A4AA 1R5HA 5KYYA 3C2BA 2HDDA 4MVZA 2L54A 1OCRC 2BL2A 4IOAF 3WTVC 3J80K 3M8FA 1HSJA 1SD5A 2NVXJ 1QVTA 3LS0A 5FKKA 3JTHA 1I4ZA 3M4BA 2M4EA 1YX3A 3FAJA 5B1BC 3T6BA 2DOAA 2DW4A 4RAYA 4RB1A 2P6VA 2E2HJ 1RKEA 5FCLA 5L0JA 3SZTA 3I0TA 5FFXA 5FKNA 2W85A 2L0KA 2A0UA 2P81A 5K5RA 2E5NA 3HSEA 1VFCA 3PNTA 2J5OA 1QQIA 5LGNA 4LLNA 3LJBA 1WJEA 3FWEA 1X1PA 3M9AA 4DJAA 1T38A 3CUQB 2R92J 1FAPB 2YPRA 2M3AA 3VB2A 1FJLA 5EHHA 5HSWA 2NVQJ 1Z21A 3ABMC 5IT3A 1ETKA 3Q0VA 1P6RA 4LG3A 1UHSA 4HE8D 1ZHTA 3C8GB 2QBYA 1X1AA 1UFBA 2W84A 3G4ZA 5KYWB 1ZKGA 2L7AA 2XLVA 1HY5A 2BW3B 1X4PA 4F4BA 3S3OA 3VSLA 5B1AC 4BEHB 2DFFA 1ACIA 3I56I 2P0WA 4HX4A 3LOCA 3WTWC 2RDPA 5EDNA 4KN7X 1E0EA 3KP3A 3TDUC 1G4US 3MN2A 4N6CA 2GFHA 4HF1A 3H5RA 2IA1A 2K4JA 2LKPA 2RQQA 2H6BA 2L4MA 4BYYA 2PFBA 1ORJA 2Y3BA 3IQ6A 4BBRJ 1J09A 4ZH4F 4II2A 2YVKA 2BV6A 4HSRA 1TWHJ 1O3SA 3Q5FA 3JR9A 4N9HA 4BEJA 2E1OA 2AP3A 4DRIB 3E9VA 4U5GA 2R5YB 1X19A 3HEFA 3IC7A 4ZJZA 3ATPA 3BCAA 2QKLB 2VIXA 4O79A 2CSOA 2EPOA 4PFPA 4RGXA 1IXRC 2W45A 4J32B 1BBYA 2NS0A 4ZDPA 5HS8A 5L3EA 3CCRI 2P7VA 2KP6A 2IP2A 2FNAA 3FK6A 1PCXA 2YLGA 3S2DJ 2LKXA 1YLFA 4HOBA 3KYCB 3MYFA 4WX9A 3GANA 4CSWA 2BBYA 2RAEA 2HOTA 4MHGA 3J7AY 4FHTA 2R02A 2EIKH 4DVZA 1FC3A 2M87A 3WAQA 3GEIA 4BJ1A 2OA4A 3B29A 4C7OA 2XAGA 4QPOA 1G6NA 1PD0A 1Z77A 5EEHA 1P4WA 1EH8A 2R7DA 5KYXA 1TFKB 5AC4A 3IHUA 4CS9A 3GZNB 3EGXB 3D0SA 2LNBA 3ZR8X 1O7LA 1VZ0A 5A6BD 1RETA 3ABLH 4R79A 4J00A 1V5FA 1W0UA 2NVTJ 2LFFA 4G78A 1CPRA 5F27A 2A6EF 1T6QA 3LLKA 2K27A 1R00A 2UV1A 1HBXG 1P7JA 3ZC4A 4LDRA 4CS8A 2N8GA 2M0MA 5H6RA 4CDYA 1TQGA 1XGOA 2KMUA 2Q2EB 3ZN0A 4ESBA 4D5CA 3J81K 3OYLA 5DM7F 4G7ZF 5EG0A 1EA8A 1QSPA 3N2ZB 3IAM2 4MVQA 3F8FA 3WE2A 1Q0FA 5COMA 4CUGA 2MSYA 3OYJA 3CCMI 4PR9A 3LQRA 1S7EA 3ABUA 2KLOA 1N1CA 3A11A 1ETWA 3PUBA 3U21A 5CI9A 3G6EI 3ZDLA 3GLXA 2X0LA 4UV9A 1YA9A 3PSFA 4WXDA 3ZQCA 1RRJA 3TJ5A 1DP7P 1D0ZA 3CDHA 3WGGA 1JPNA 1R58A 1WI3A 4FT8A 1JPJA 2IXMA 2YL1A 3FMSA 1WH7A 4G94A 1QZZA 3FIWA 2M30A 4XSXF 3DKYA 2NVUB 3ZQFA 3HOSA 1G2HA 2X4HA 4FESA 2H7BA 4M3GA 4Q48A 2CYYA 1MJ9A 2XF7A 2ZO4A 1NBBA 3OEOA 3U1DA 1B68A 3OYMA 2HV7A 4BQOA 2WV0A 4M3BA 3K4NA 2CQQA 4PCQA 4RB0A 2LBFB 2NRAC 2PJPA 2W1OA 4RLFA 1OCCC 1OCOC 4YIIA 1RPWA 2DK8A 3JRBA 4YFNF 1ZHXA 3RVYA 3HKZA 2AS5F 2UXXA 2KIUA 3KKBA 3BY6A 3DWLE 2XF6A 5FLXZ 4U9EA 1W7PB 3K1MA 3K7AJ 4KT5C 1ON2A 5BMZA 3Q7LA 1W4MA 4BGDA 4RAGA 4XKVA 1NU7D 4PACA 5B3SC 3WGHA 2DA2A 4XLFA 4CDGA 2Y3GA 1J8MF 2ISZA 2FMLA 4K7BA 4M71A 2TDXA 2HEOA 2L9SA 2WB7A 1MBGA 3H65A 4PZJA 5CVJA 2PJRB 1KONA 2V9PA 2CUFA 3FXJA 4EEFG 2XLHA 2JRTA 2YS9A 3F6OA 2E7XA 3CCUI 2CNWD 2HMZA 2ICWG 2EV6A 4ER9A 2PNOA 3U8VA 1Y4CA 1JHFA 3KFWX 2E87A 2ZJPF 2B7EA 1V54H 2KDZA 4KIGA 3QPHA 3KEOA 3HOZJ 3S90A 2QE9A 4I99C 1Z91A 4M6VA 1JJ6C 1OCZH 3KLNA 1SVLA 4D7MA 2HTSA 3LMMA 5L3VA 3FMRA 1FOKA 2XV4S 2O8KA 4QDLA 5BS6A 2UZKA 3J80Z 4G0HA 2DXIA 3E5UA 2F5CA 5K7HA 2UXNA 1YJGA 3AG3H 4CGZA 1XN7A 2MC4A 4GYIA 4WXCA 2P8TA 2E5ZA 2M0CA 2VC0A 3EHNA 4JCZA 1KYWA 3KYJA 1XD7A 2HPMA 2TRTA 3BR0A 4ENMA 2OF7A 2QQAA 2ZFUA 5M5YJ 1EQ1A 3X2QH 5C4XJ 1LEBA 4UY8I 2VBWA 3MD2A 2V6EA 3SJMA 4RBOA 4YFXF 2YX7A 3HOVJ 3PUFA 4RMNA 2A1DD 1SF8A 1QZYA 2R7TA 4CYCB 1LS1A 2YWAA 5CQEA 1OJLA 4MVSA 2GA1A 4KIBA 1R36A 5JFRA 4M9XA 2Z99A 2M8EA 4ZYHA 3WU0A 3MQ0A 3U9MA 4J7TA 3JCUC 2K3FA 4MVRA 4D4XA 1I4YA 2DDAA 2XSEA 2I10A 3WU2C 4XRSA 3FKJA 4S05A 3SXYA 1O3RA 2GWWA 1V55H 4L6RA 3C8GD 2K3PA 3BOQA 1JI8A 1HKSA 2QQBA 1XZPA 2J46A 4XLHA 1MNDA 4IEJA 3EHMA 2CMPA 5TGTA 5DS4A 2J5PA 1DDNA 4BJ5C 3WTTC 1E3HA 1PP7U 4EGYA 1HDDC 3O6BB 2PF4E 1YJNI 3DU5A 1IAWA 3ZQHA 1VQOI 2CUZA 4OMYA 3UMKA 4YELA 2HR3A 2XSJC 1BN5A 3GWZA 1W36D 3GZ6A 2B0LA 1X2MA 3V5YA 4HX8A 1U0BB 4XRMA 1YI2I 4CIHA 4OU0A 4XBFA 4ESJA 4MFDA 3CJNA 2E71A 2JA7J 4O6MA 3HNJA 1W5SA 1FTZA 4RB2C 2FA5A 2RN7A 1IDZA 2OCCC 4JTAB 3HM5A 3OIOA 4Q5SF 1WATA 3ZSUA 1B72A 3M4CA 1IRGA 2VODA 3NDBB 2QZ8A 1Z05A 1WSUA 1BJZA 2FBHA 1XPXA 1TNSA 5B66C 4AE4A 1MZBA 2PMZA 3NYJA 3V5XA 1DOVA 2YQYA 3VAYA 1P7IA 5M3FJ 4JVSA 4NQWB 3S14J 4G7OF 1TR2A 5JRAA 3OOPA 1IUYA 2OPTA 4HEA2 2XROA 5E1ZB 3HGYA 3HHHA 2X51A 2WL8A 4XONA 1ZHWA 256BA 5JVGF 2MD0A 4YL1A 1AWCA 3TO6A 2BOLA 1H0MA 2F48A 1QPIA 1I5NA 2WZLA 1Y8RB 1ZAOA 1LKXA 4DVYP 2DA3A 3T9OA 2AHQA 3IH3A 3SQNA 2Y0SA 3VWBA 4XPWA 5T3WA 3VYUB 2A61A 4IVNA 2IW5A 2Z3YA 3DLAA 4Z9HA 3U3FA 3QYBA 4H54A 1YS7A 1ZGAA 3T1BA 3HJEA 3OS0A 1ETOA 4FX0A 3CEXA 1IUFA 2FNPA 5EF6A 2GIZA 1WHUA 4C2UA 1YZAA 5E17F 4XEVA 1TT0A 5A6JA 2I8BA 5EZHA 2DBBA 1A7VA 1WH5A 2MABA 3HPHA 5IP6A 4I44A 1HCRA 4Y33A 1MGTA 2VQCA 1IN4A 2KQRA 3A01B 2OTLI 1VLSA 2GBYA 4BY7J 3HRUA 3J81Z 4MW3A 2A69F 5GTIC 3PDMP 2O9XA 4PJLA 3FISA 1OCRH 3GMEA 1XC5A 2MFZA 2UWMA 2XLWA 1S7ZA 2R7ZJ 2WB1A 3KZYA 3VOEA 1R4TA 1IRFA 4IHSA 5BQHA 1TWAJ 2CV2A 5BPDA 4A3GJ 2R5ZA 3ZG1A 1XSXA 2DOEA 1S29A 4R8HA 5B1BH 5J3LA 1ZLJA 1F5TA 3FDYA 2CDQA 3M15A 3VEPA 5DM6F 4UVCA 2GM4A 1TQIA 3EH2A 2Y31A 4EMSA 3I64A 3AAFA 2L7FP 1O3QA 1YIOA 1EH6A 4DBQA 4LDQA 1XCBA 2X1CA 1V74B 4JEBA 1RC9A 3HKKA 3NQOA 1Z67A 3K9TA 2Z15A 4NC6A 2RC4A 2PN6A 4A3DJ 1Y56A 2HNHA 1DGWY 3ERED 1XB4A 1RKTA 4QIWN 2ZFWA 2GAQA 3DU6A 3ABMH 4HNUA 1LE8B 3JSPA 1H6GA 3H35A 4IKFA 4F91B 1FBSA 3E1SA 2P0NA 2DJIA 4TV7A 5FD5A 2D45A 3BR3A 4CSAA 1WZ2A 5B1AH 2VL8A 2D2WA 2BY3A 1JKPC 1XX5A 1RI7A 1D8KA 1LVAA 4N9IA 1OYYA 4RA2A 1F9NA 2ISYA 3L00A 3QWLA 5E1WA 4Z6YA 2OQMA 4I1OB 1EA3A 2K7LA 1WJ5A 3RPUD 3AG1C 3HNKA 2LH9A 2VCAA 1JOGA 2K5CA 4OAZA 4N6HA 3GW2A 2R7WA 3NWTA 1S7AA 1T95A 2GXGA 1QHGA 2L7KA 3V7CA 3TW6A 5JHFA 3EG9B 3RQEA 3TEDA 5E8GA 4MVUA 2V1UA 4NTFA 1YRNA 3RF3A 2XAHA 4CHUA 4EV0A 1A35A 1RJ9B 1YYJA 5K7FA 4PJMA 4C3BA 3GXOA 2Q7RA 1OR7A 5K5OA 3O8HA 3K1PA 2VT3A 2DYSC 5J40A 1CQTA 5LLQA 4CO8A 2W82A 1K7AA 3HOXJ 1UG7A 2ZPAA 4FASD 3EUHA 1K78B 2J7PA 3NWSA 2KQ9A 5LEJA 4OD5A 1FTTA 4DZJA 2XGEA 3DD7A 3K69A 3B02A 5LFAA 3D1NI 3AOUA 1BIBA 2LDUA 3SXMA 1SMYF 2O61A 4MS2A 1TWHA 3W6VA 3TOMA 3GWLA 4GEHA 1GDTA 2M9HA 3Q3SA 2L6GA 3U9JA 2EPKX 5KYNA 1RR8C 4Q4ZF 1VQPI 4WGYA 4BE0A 1OLTA 3O55A 3CCYA 5LEKA 2JA5J 5LHGA 2JA2A 2FMYA 2KJBA 2LLKA 2MD5A 3F46A 1RR7A 1K6YA 3H3VK 2MH9A 2OCEA 2O5RA 5D4RA 2V1NA 3S1QJ 4ETSA 3T5XA 3NYLA 4LLCA 1VNDA 1MMSA 2KHMA 3HDDA 5E3OA 4C3HJ 4YFKF 3K6GA 5JLXA 1ITYA 2F5DA 3CUQA 2PX9A 1OXKA 5E1XA 2GXAA 2Q0OA 3H0DA 2O03A 1LE4A 3BPVA 2KT0A 1BI2A 2NG1A 3N05A 4N4OB 2WADA 5EGOA 2K02A 3LSKA 5L0IA 1VQNI 1V5EA 3TP3A 2BW3A 4E70A 2OOCA 1ZTRA 5DS6A 1BI1A 3ZQ7A 3PFIA 3SZPA 2H94A 4M6YA 1BR1A 2HKXA 2F6CA 5GTHC 1MDMA 4XRFA 5IP7J 1JGSA 3ZIBA 3LSHA 3PNYA 2J0WA 3KPHA 3BWGA 1TTYA 2Z16A 3MKWB 2IM8A 3RSNA 2VKDA 3E0JB 2EPLX 1ORYA 3F22A 2R5YA 3E7LA 2WAQN 3VPRA 2RKHA 1OCCH 3S2WA 1XGMA 1OCOH 5J8CA 2H27A 2XKPA 6PAXA 5E3MA 1NK3P 1AVOB 2IGMA 3M8EA 3E6CC 5GPGB 2LQGA 2OJED 3OYGA 2A5WA 2OBPA 1NG7A 3N4MA 5B3SH 1GT0C 1Z1DA 3K4LA 4CCMA 4J01A 2TMVP 3TL4X 1QA6A 2KPMA 1VYKA 2H7VC 1LDDA 4HV5A 4JEAA 3JRHA 5CVRA 3L34A 2HGCA 1FFHA 1W0TA 5D91A 1X2NA 2BY1A 3NKDA 5L3QA 3OS2A 1YYVA 3ZQVA 1XG1A 1G3YA 2WV1A 4IX7A 1NK2P 2DA4A 2DJNA 1AUEA 4L9JA 3CAXA 1C0WA 3F8NA 5KAFC 2OEVA 5ICFA 2D1VA 3BP8A 4E18A 2EFNA 1K40A 4ZZDA 3FXOA 5H20A 3VODA 4CH7A 5F08A 4XLEA 4IRHA 3I55I 1OCTC 5DS5A 2VE8A 4AU7A 2VC1A 4C3JJ 4BBSJ 2IYLD 1E17A 3C7JA 4HA8A 2A5YB 4D0PA 3K1IA 2YX4A 4RGUA 4YG2F 2EK5A 3FXKA 4LG0B 2JZYA 3K33A 5E33A 2VKVA 2LTPA 1YX5A 1R71A 2RQPA 2E7WA 3EETA 3IPMO 2Q2EA 1T33A 4I02A 2RGVA 2KZVA 4HRIA 3DZAA 2R7RA 1YAUO 1OFCX 4JX6A 1XMAA 1YW7A 2V26A 1KQ0A 3OS1A 3KYLA 5J4YA 2G62A 2OQRA 3WU1B 3D5SC 2DMUA 1W36C 4HF0A 2Y39A 5BUOA 1U9OA 3EGDA 3PL8A 3EJNA 4KNWA 3U2LA 2L9NA 4U5FE 1E83A 1H9TA 4E7JA 1TC3C 4BAYA 3L8JA 2F5FA 2K40A 3G1LA 3IP4B 3WG9A 1MMAA 5GAHJ 1YW8A 4BG0A 1VF9A 4IOCF 4MIMA 2W4SA 1ZW3A 4I6ZA 3RIRA 2LF7A 1MMGA 2JWTA 3MFNA 5DS9A 1ETVA 2IXSA 3QU3A 3QQAA 3CMYA 3M1EA 2W24A 4PSXA 4YT4A 4E7LA 2Z5UA 3SEOA 1ZRCA 1FR0A 3TQNA 3S15J 2O6GE 5DQTA 4XPYA 4IQ4A 3G1OA 3GORA 3CCVI 5DUIA 2ZJQF 4IHYA 2XRNA 3T0YA 3KP5A 4OIRF 1SAXA 2OU6A 2VB6A 3PIPF 3JRGA 1RZ4A 1MNEA 1W7PA 1TBXA 3U9GA 5DUKA 4QLCU 4U9DA 1I6XA 1QNTA 3BG5A 1N25A 3LNQA 1Y0NA 4BJTA 3UMHA 1JR8A 2OCCH 2PJRA 3FHZA 3GFLA 4H0EA 2EILC 1ZK8A 3LSMA 5D8KB 1I1SA 4E0IA 3KZIC 3QTHA 4JKVA 2R4GA 1Y8QB 1EKEA 1G3WA 2DOFA 2P6TA 1A36A 3CD6I 4LJZF 4OIOF 3HSRA 2I5UA 3BZ6A 4O7GA 1W1WE 3DLLF 4NCQA 3H0GJ 1HQCA 1B6AA 1GS9A 4ULVA 1OYIA 2B9SA 4YN0B 2GA2A 2NVYJ 3S8PA 3OWTA 4CJGA 3C3WA 3LQQA 3P9KA 4JX5A 3TGNA 5HLGA 2QM3A 4A3KJ 1XS9A 2BXZA 3L2UA 3OSGA 3HOYJ 4S0HB 5DLJA 3K2AA 5FKOA 3R0JA 2XLOA 2MA3A 5HODA 2ZC2A 1F43A 3V8JA 2V1XA 3LFUA 3DPTA 3PSIA 2J9WA 4CCJA 3LSRA 3LA3A 1K4SA 1R5ID 5EJCA 2BXYA 3LSJA 3EFOA 2NUTB 3ONQA 2ZXIA 5CYVA 5ED4A 3PO2J 2MYSA 3BG9A 4KUMA 3OYEA 2XL8A 4O6YA 5FGMA 1AU7A 1NG6A 2V6CA 3HSFA 3K10A 4MFEA 2VCBA 3OYKA 3G2BA 4BL0B 4AM3A 5DEQA 3LA7A 3RYPA 3RH3A 3NYMA 1LQ1A 2F2EA 3FXUA 2VUMJ 1MBKA 4E17A 3PHF2 2K9QA 2VJJA 1LJ9A 2A07F 5HLIA 2HJMA 3E3VA 1HDPA 4M73A 4MEXF 2XLMA 4U5DE 1R6RA 4BE2A 1FFTC 1R23A 3T4RA 3FXHA 3JRDA 3OYAA 2LY2A 3HZJA 2Y75A 4EUKB 2KIQA 3EYYA 5J47A 4Y17A 4ONSA 1O5HA 4A5MA 3QU6A 1Q1VA 1FY7A 2MBFA 4XMYA 3ECSA 1AKHA 2XAJA 1REPC 4JC7A 3I5QA 4U5EE 1T8IA 1CF7A 1E85A 4EKWA 1YLMA 4II3A 5TISC 5D4SA 4B09A 1MMDA 2YZSA 5E8IA 2EZHA 3OYDA 4HFKB 4EHPA 2O9LA 1Z23A 1MBEA 3S9OA 1T6IA 1TLHB 3F8MA 2XGDA 4XM3A 1ON1A 4X1EA 5COGA 4HG2A 4UVBA 1ZELA 4P55A 1Y0UA 4FE4A 1SD7A 3RJPA 3RKWA 1HMOA 4LLGF 4ANJA 2R03A 4BE1A 1B9NA 2JJ7A 2HMQA 1MIJA 4BJ6C 3V5ZA 4ULWA 4ITVA 1Z6RA 2OAZA 2R05A 1BI0A 1TWAA 1H7IA 3REOA 1MSEC 1DGRM 2VBZA 3C1DA 2WVNA 3RYRA 1QGPA 4HZFA 3C18A 2JPUA 4FCYA 2VJ5A 4Z9IA 3KEQA 1I27A 2R3SA 4NQWA 3VYTB 3ZWIA 1PP8F 1R49A 1YZCA 1LS4A 2V9KA 3AG1H 3Q0WA 1YHQI 1UELB 3NRVA 3ZQGA 1FYKA 3ZMUA 3U5SA 3LAYA 4BQAA 2MH2A 4UHTA 3L2VA 5JS5A 2VPRA 4O6JA 3IRRA 3BG6A 3CO6C 2FU4A 3MZ8A 1ETYA 1NTCA 3F6VA 3CSKA 1R1VA 4JJFA 4CX9A 3T8TA 4NC7A 1WJDA 4JP0A 5K5QA 3S29A 1Q0DA 2ELKA 1KYZA 1HMDA 1FMWA 4UXNA 3OSFA 4X0GA 5L0CA 1HSTA 1UB9A 3W2AA 3BG3A 3OMYA 2R7OA 2KK1A 2EQRA 2EB7A 4E7SA 3ZVRA 2A6TA 4KC9A 2LIGA 2E2IJ 2XL4A 5HS7A 4U88A 2DYSH 3L7WA 1Z3YA 5D8LB 1ENHA 4A6EA 2OC6A 3ZMDA 1YIJI 3I3LA 4QSHA 2RV8A 1XSVA 4JE9A 1QZXA 2R7FA 1PDNC 4KITB 1PUEE 1OKKA 5DCMB 3JRIA 1MD0A 1PUFA 1WWPA 5H6QA 1GVJA 2CCYA 3VFZA 2DQRA 2G7HA 3OYBA 4S04A 2MGQA 3CQZJ 5A6KA 4LERA 2DMQA 2VJ4A 3M07A 3UGOA 1C17M 2XF5A 2Q9CA 2IS2A 4ZLCA 4XLAA 2P61A 1DUXC 2LG4A 4AYBN 1NFOA 1TFOB 4BS9A 2W4MA 5B3IA 1WRJA 2XHKA 5D5VB 2HKOA 4RM2A 4WWCA 3RPQA 2M8GX 3BTJA 3KE2A 3IQTA 4UNOA 5C44J 3GODA 4ZTJA 1Q0MA 4MNDA 5DVWA 2XLDA 4KI2A 4MLOA 3BQYA 3O2PE 3DCFA 5DD8A 4ZZLA 1APCA 2B0HA 4GXOA 2R7SA 4GYTA 3WTZA 3DP7A 4E6KG 2CGPA 5ICEA 5DTDA 2VC9A 2Z2SB 2GXBA 3PQJA 3M4OJ 4WABA 4IJAA 4AIJA 4P9FA 3CC2I 1MH4A 3W8HA 3ITFA 2CV0A 1LE8A 2XGXA 4WF2A 4JZAA 5KCMA 4YRVA 1K61A 2NSGA 4I3MA 4FX5A 2MLKA 4Y52J 2Q00A 1C02A 4IB4A 1FZPB 1Y6DA 2YSRA 4HBLA 5EK0A 1ORKA 3RQ4A 3L2CA 1TWCJ 2QYOA 3A1YA 3GEZA 2E34A 3TULA 3VYWA 1USTA 3BCBA 5CJ9A 2NS8A 2O3FA 1ZG5A 2JUGA 3QPTA 4PUSA 1BOBA 2K4BA 2ZMEC 4W1UA 4LLLA 1FYLA 2JVGA 3DE9A 3JCUQ 5F5HA 1XWJA 1E2XA 1V5GA 3T8RA 3G1MA 3R61A 1Z3XA 3SYNA 1TW2A 2XUBA 3IAS2 3KP7A 3KCCA 4E7ZA 1IGNA 1I5ZA 3ASOC 3TQOA 3JSEO 3ELKA 5L3GA 1WCMJ 2NUPB 2HQRA 2OZ6A 1OW8A 5CPRB 2G7UA 1VQ7I 2C03A 3EG9A 1Z3IX 5HDNA 2HKVA 4DRHB 3QP6A 3SZRA 4AL1A 3BDDA 2VONA 4Y15A 1PV3A 3F21A 2GZWA 5F64A 4ENJA 3NMJA 1RUOA 4LOCA 1ZR2A 2YHSA 3N0TA 3VRCA 4A0XA 1P4AA 3AG4C 3HL2A 1SC7A 1G5ZA 4XOTA 3WG7C 2DT7B 5D92A 4A3EJ 2K9LA 4B1RA 5A6AA 5ICCA 2RSEB 1EH7A 4GGGA 3I59B 4HEAJ 3DTIA 1ZGJA 3DV8A 4BUPA 2XRLA 2AQEA 4P5OA 4EQQA 3CCQI 4NNJA 3TJ6A 3I4MJ 1MJBA 5AIPA 5F04A 2KYHA 2BC5A 2A6HF 1UHWA 1YJ9I 3HTUA 2XVCA 4CS8C 3BZCA 2FBKA 4BQNA 3GX4X 2ZJ2A 1RUNA 4AIDA 3BROA 1J59A 2XXAB 5KYYB 2AXLA 1O3UA 4IRUA 3MAJA 1D3YA 1QKRA 2QKMB 1ZG3A 2G0EA 3MCZA 5JLWA 5LRRA 3DKWA 1AOYA 2NOGA 2FGYA 3O6XA 3GWNA 4JTCB 1MBHA 3S16J 3M79A 1P4XA 5GAEJ 2RVCA 2LKSA 5IOZA 3TOBA 3S1NJ 3FBIB 2TCTA 3HRTA 1T98A 3DTEA 4GO1A 5AONA 3WE3A 5M5XJ 4DYRA 1OR2A 2EV0A 3HB9A 4MEYF 2M64A 5JP7A 5F28E 3RW0A 5FO5A 1QVXA 2HU9A 1D0XA 3OOUA 3UMIA 4D5FA 4EBKA 2KIMA 3AQBA 3RZDJ 1BOAA 2X1DA 3RFYA 3NKEA 1WJFA 5KVRA 1T6UA 2VPLA 2NAZA 2YU9J 4PDKA 3J7YJ 1OKRA 4KT6A 2P4WA 1WJCA 4A69C 2HZ8A 3GF2A 3LA2A 1SFXA 2KKOA 4GFBA 4BXXJ 3BR6A 2LD5A 2QBYB 4AUXA 3Q7GA 1JRAA 2IGNA 1SEUA 3MKZA 1XCVA 1LB2A 4KISA 1YE9A 1WASA 5KAIC 3PM1A 2EINC 4JURI 2M7AA 4JK1X 4CBEA 3CDLA 4IPAA 3I4NJ 4WGZA 4HQMA 4OMZA 1I3AA 2WB1N 1KTMA 1JHHA 1BM9A 2M45A 3JRMO 2IGOA 3F9KA 1AHDP 1WWXA 5A69A 2L5QA 1Z0XA 4KMFA 3QVZA 4D1QA 2DQLA 2BGCA 4E0HA 2ELJA 2R7XA 2FF4A 3RQFA 4FAPB 3HUGA 5D6EA 4V2GA 4YK5A 3IWFA 2ZXWC 2DA5A 2FFHA 4MQ9F 2FSWA 5L0FA 2ETHA 3O39A 1XDUA 1CPQA 2EPNA 2ZMEB 2OTJI 1ZRFA 2DA6A 3QOPA 4JJGA 2ID6A 2JVHA 2EILH 3RZOJ 1BDJB 1ZHYA 5AC5A 4IRIA 3B0PA 5BQGA 3ZRGA 3LUTB 3WTXC 4XR6A 2CUJA 4EM1A 3L09A 4HW0A 1JUSA 4RB3C 2IT0A 2W4BA 3S2HJ 5A6BA 4L5EA 4C7OB 2NSFA 3CJQB 3HGGA 1J0RA 2FOWA 4I0BA 1GXQA 3JREA 1YO5C 1BI3A 1LPEA 3EH1A 4M72A 3IEEA 4R1HA 5CI8A 1T39A 5E20A 2PBEA 4BPMA 5KYXB 2QSHX 2FUG2 4P6IC 4U87A 2P7CB 3SFIA 4WJ0A 5HDGA 5J1UA 3FOOA 2FRHA 4B48A 3CCEI 3DBHB 2F22A 1KU3A 4LG0A 1F4KA 1CGNA 4C9YA 1S6LA 3FHNA 3MZYA 3GEHA 3M1CA 1Z9CA 2HOAA 2QUFA 1QBJA 3CMMA 5FLMJ 4KMUX 5ILUA 1K4TA 2H7OA 2XM4A 4UV8A 1FIPA 2KFDA 3DXJF 1MQVA 1FLIA 1S05A 3U2MA 5IYCJ 3SYTA 4F3QA 4V19K 2UUHA 3JZ0A 2IEKA 4Z9JA 3G71I 3RIPA 2P6SA 2IBFA 1YS6A 2ZJRF 4RGRA 2M34A 1YA7O 2VASA 4PSWA 5E3NA 3C2GA 1U5TA 4K1OA 3LSGA 3DBLB 1KQ8A 3EPVA 3CZ6A 4CZZA 3ZQYA 2HVRA 3PFYA 1BZ4A 3LNRA 3PNVA 4PJ0C 1T0FC 3B73A 3CJTB 1A41A 2L02A 3LLIA 2MHRA 1STZA 3BTCA 2A3SA 2XC7A 3RKQA 2VQLA 1JKQC 2E2JJ 1TL8A 4I98B 4I2OA 4C3EA 2DPUA 2EBIA 4W97A 2V3CC 1ZN2A 2C04A 2DO7A 2XKOA 3F8CA 4E7HA 4RDAA 5EGYA 3CMEI 1KU9A 1KZHA 2EWNA 2P5KA 2WY8Q 3I4PA 4XK4A 1VQMI 1VLTA 4AWXB 3TBIA 3HNIA 1SFEA 4MQVA 1S9HA 1R5GA 1ZGWA 1APLC 4U5CE 2DODA 2JD3A 3R7CA 3P5JA 2O7OA 2DN0A 3FVYA 2ZXHA 2HVQA 3D5LA 1UHMA 3MKLA 2X6OA 4CIPA 1I50J 4CCKA 4AK9A 2F4OB 4NC3A 4CYDA 1Z5ZA 2CYDA 3S28A 5IT9K 4MNUA 1FP1D 4C30A 1OQYA 2CUEA 3W8IA 2GQQA 1FYMA 1GUUA 4IHTA 1WJBA 2CNWA 2HS5A 1O87A 1NZEA 1XDSA 4FWVA 4BHBA 3K1NA 3E97A 1SD6A 3N97A 1DPUA 3OIPA 3O3KA 4U7BA 2WC2A 5BPIA 2W00A 3J7AO 2KC3A 3GM3A 3E6BA 4EM2A 2LP4A 2Q9AA 3CLOA 3L8IA 5HOOA 1EV7A 3LWFA 4WK8F 2H8RA 1BC8C 1WGWA 4IRGA 5L0HA 2GWRA 3ABKC 3DM9B 2JMWA 2ZD9A 2CW8A 4L5IA 4YIRX 2DK5A 4E7KA 3FAPB 4B4CA 1MBJA 5DV5A 1U89A 4G6DA 3H2VA 4MTDA 3K1HA 3K7DA 5TJ5E 4CDAA 3GO5A 2CFOA 2H6CA 3LNMB 1FOWA 2W48A 2DFHA 2X1EA 3FM3A 2QQ9A 4IL6C 2K9MA 1UZCA 3L0IA 5E2QA 4A12A 2OU2A 2ZXOA 3S3MA 2M4GA 1VQ4I 4JW1A 2P1AA 5AGFA 2WBMA 1JJ8C 5HNHA 4KJZA 3I58A 4LMYA 4NHJA 1XSDA 5FLVA 2IAIA 4XEKA 4YT5A 3US6A 2IPQX 4XIDA 3IRQA 1IN8A 4EJTA 2C6YA 3FDQA 2CG4A 2KNHA 2O8XA 1BC7C 3U2RA 2ME0A 2GOMA 3TDZC 2HFIA 2DU9A 2V7FA 3A4CA 1MKMA 3OYCA 1HW2A 4EVIA 3CCSI 1Q0KA 3FXLA 1DQUA 3CCLI 3CP2A 3CF5F 1NLXA 2PX0A 4RBNA 4KNYA 5L0DA 2X48A 1DPRA 1X3UA 1H8AC 3F47A 4GQHA 4OOIA 1NSGB 4XORA 3C8GA 2KDOA 4H4KC 5L3FA 1TT5B 4A3MJ 5KYWA 3J06A 1HE1A 4BEHA 4FTHA 1JE8A 1JT0A 5L3DA 3VM6A 1IN5A 3GFMA 2LD6A 2XPWA 4CSAC 5GPAA 3IQ5A 1WI9A 2YEVA 3ASNC 4KBLA 2Z1DA 3RI4A 3GTKJ 4UUSB 2EA4A 4UDVA 5K7ZA 3FK7A 3Q0UA 4U7DA 1J7KA 2FEZA 2CRGA 3HHGA 4C2TA 1ZH5A 3DKXA 3H9JA 3K4JA 5K1YA 5FD6A 5B5EC 2HSBA 2OG2A 4EJOA 3TK0A 4NTBA 1XMKA 1VTMP 2RD9A 2QWWA 2F4MB 3A9CA 3AFHA 1V4RA 1A7DA 4MTEA 1Z7Qc 3CQZA 4KICA 4OIPF 3DQVC 4FISA 2OV7A 2VQGA 3FBNB 4A93J 2DB4A 4K0DA 1S8NA 4LK1F 4CCLA 3R6SA 5KHDA 5COFA 1VQ8I 2XAQA 1U3EM 2NYXA 1ZHZA 2AO9A 4Z2YA 5M3MJ 1OR3A 1VMAA 1SVMA 3SDGA 4EATA 4W8PA 1GVDA 4F92B 1X4OA 3ASOH 3ZTMA 3HOWJ 2LYCA 1GM5A 2EPFA 4G8XA 3Q6NA 1DP3A 2L9RA 3F72A 4M3DA 4LITA 5C4JJ 2YLIA 3G73A 1WQ2A 4OAYA 4DNCA 3EGXA 5H2FC 3BEHA 1FOXA 1ZLKA 5FRMA 4CJOA 3I53A 4KNVA 4M3FA 1FTSA 1T9KA 3K70C 3AG4H 2J45A 1R22A 1TWCA 4HDVA 2JA8J 4YT8A 3WG7H 3GTMJ 2BYVE 1UFMA 3RKXA 2LCHA 4M9SA 4ZC3A 5ILVA 5CLSA 4U0WA 1R4NB 4HX7A 2RREA 2HYFA 2EIMC 2FD5A 2EZLA 4NUBA 4XQFA 1QPUA 4JTDB 1ZU4A 5T3TA 3K4KA 3HRMA 2ZKZA 4L18B 1U78A 1D1AA 1FBUA 1BR2A 2LK2A 4DRJB 2IOQA 2VE9A 1UG0A 5A2QK 1XZQA 3DAGA 3JRTA 1LI7A 2ZNZA 2WWYA 1UCRA 1RCPA 2YUSA 4B3XA 1U2WA 1X1BA 3QW0A 4LGWA 1EF4A 1KU2A 3MX3A 3W4YA 2HUJA 4BQQA 1VOMA 2H1KA 3ZGKA 1IV8A 1N78A 1MBFA 2LFBA 3KP4A 2Y3HA 3QP5A 3P9CA 2Q3TA 2WAQA 4NY3A 3ZN1A 1PD1A 1WGXA 2CV1A 3ZOBA 3G4XA 1FOYA 2WVQA 3QZCA 3QYEA 4AVZA 1K79A 1HOMA 1V4AA 2Q9BA 5D5UB 1RKWA 4ESFA 2JQ7A 3PCVA 1W5TA 4N4NB 2E1CA 4O6NA 1J9IA 4XSZF 3WTSC 1I39A 1L3LA 4IGGA 2BEOA 2CWEA 3B9QA 4LB6B 2EFWA 2R7VA 2LBFA 4N0BA 2PFDA 4OINF 3AKZA 1OW7A 3DMDA 4W8KA 2ZXPA 4G12A 2AU5A 3K4BA 1FX7A 1XGNA 4HLYA 2KRHA 4P1WA 3N24A 4F55A 4AC0A 1D8JA 2VT2A 5IT9Z 1LIHA 4XTKA 4MW8A 1U6GA 1OMIA 5KYUB 4NC8A 1VYIA 3RPUA 4IARA 3MWMA 2EINH 2G9WA 2VXZA 2BY0A 3WHBA 1H89C 2R7QA 4EGZA 3R4KA 3GYHX 1RNLA 3F23A 3RQIA 1GQAA 3HIFA 2DFEA 4EBBA 1X3WB 5DDGA 3HYIA 1OXBA 4PFOA 3JW4A 1HW1A 2NUPA 1BIAA 2AXTC 1LNWA 2ECCA 1T2KA 1WOLA 1E86A 2EJRA 3ZMZA 3B6AA 1A6QA 3E5XA 1KQ9A 2ZXWH 1ZQ3P 4BJ6A 3IWZA 2HWVA 2VKEA 5HDKA 2E19A 1EJ9A 3NG1A 1ZR4A 1QRYA 1G8XA 1R1TA 5LHIA 2JN6A 9ANTA 3MFKA 1TQPA 3QW1A 1TWGJ 2XPUA 2ETSA 4JOMA 2RNGA 3KH2A 5TRDA 2Y69C 3GTQJ 2HSQA 2V4JC 3B71A 3LFKA 4PGHA 1X1DA 3H92A 3FMQA 4BHCA 5T1DB 4GDFA 2BHZA 3FOPA 3T6GB 3EDPA 3TW7A 3K1IC 4Y3OA 5F0FA 3B0UX 4I0AA 1LI5A 4XICA 3ESWB 1J8YF 3UNGC 2PBIA 4M63A 2XL6A 2A05A 3LSIA 2XXAA 1C03A 2CS3A 4MVMA 2XB0X 3CJRB 4CYCA 4XN3A 1IJWC 4A3BJ 1M2VB 1YTYA 2WZFA 2JT1A 4AD9A 3KETA 4HNVA 4LIUA 1ZU5A 5KNLA 4ZYGA 2WY7Q 3ZMVA 3LAJA 2HVSA 2HZDA 2IS6A 1QHHD
chains in the Genus database with same CATH topology
2ICWG 3KPHA 2OJED 1R5ID
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ICW G;  3KPH A;  2OJE D;  1R5I D; 
#chains in the Genus database with same CATH topology
 3RYL A;  2X6X A;  1D5Y A;  2DCE A;  1VQK I;  4DOZ A;  3G3Z A;  4JX4 A;  1TZL A;  2EA2 A;  4C2M J;  2IXN A;  2HTJ A;  1A31 A;  3DAF A;  2BVM A;  1YQA A;  2EIJ C;  5GAG J;  2D5R B;  1LFU P;  3E6M A;  1GGQ A;  3AL0 C;  1H88 C;  1HA8 A;  2WVO A;  3I5P A;  2P5L C;  4IAQ A;  4XLC A;  1OYW A;  2CU7 A;  2Y2Z A;  1E84 A;  4GCV A;  2EFO A;  4HFF B;  3S27 A;  5BOX A;  4I01 A;  1U6H A;  2CGE A;  3HLZ A;  3ROU A;  1TW3 A;  4XEF A;  1D0Y A;  1SFK A;  5EGO B;  3VF0 A;  2LOO A;  1HE9 A;  1SZI A;  1F36 A;  4EJW A;  2PP4 A;  3GEE A;  5HV9 A;  4NQF A;  3ZQI A;  3IH4 A;  1S7O A;  3GTG J;  1K83 J;  3OR2 C;  5L3C A;  2JPC A;  1M57 C;  2CQK A;  5AIQ A;  2Y9Z A;  4EM0 B;  1MDM B;  3TKY A;  3SP1 A;  5FFZ A;  2FQ4 A;  4QI0 A;  3PJR A;  2D1H A;  2DGJ A;  3WHN A;  3JRA A;  1T5O A;  3GM1 A;  2E36 A;  1K04 A;  5CVI A;  4WXH A;  1LFP A;  1YOV B;  1Z6A A;  1IW7 F;  3H5N A;  3NAR A;  3VYR B;  2M2E A;  3I4U A;  4XNF A;  1Z7U A;  1R1U A;  4IJJ A;  1B8I B;  1FNT c;  2R25 A;  1IO2 A;  2HI3 A;  2QQ8 A;  2PQ8 A;  2JX0 A;  2ZME A;  4K2E A;  2B63 J;  3K6B A;  1U8B A;  4D9J A;  2M1B A;  2G3K A;  3H1C A;  4XQ1 A;  4EBJ A;  2RNJ A;  1V3F A;  5ICG A;  1LM3 B;  4N06 A;  2DDB A;  3HG9 A;  4HNT A;  2XPV A;  2LMD A;  1RKC A;  2G3V A;  1FNN A;  3IUO A;  1E3P A;  1VI0 A;  1TKN A;  3POV A;  1LE2 A;  2R7U A;  4G7H F;  1X1C A;  4NBQ A;  1A6I A;  2Z9O A;  1POG A;  3H5A A;  3TD7 A;  2NXN B;  3BZK A;  3QOD A;  3HKZ N;  3KX2 A;  4L5J A;  3U3B A;  3MLG A;  4KYW A;  4UB6 C;  2X0C A;  2DAO A;  4JBA A;  3V7S A;  3A01 A;  3OYH A;  4RDU A;  2DA7 A;  2ZXJ A;  3ABK H;  1TWF J;  3HRS A;  4QWQ A;  4LAC B;  2LSE A;  4XRS G;  2LF8 A;  4BKX A;  1I3Q J;  3NAU A;  1MH3 A;  2ZB9 A;  5A2Q Z;  3GZ5 A;  5JLI A;  1ZZP A;  1ULY A;  4OD4 A;  3JRC A;  3KYI A;  4XPX A;  2FOK A;  1N77 A;  3I5U A;  2J8W A;  1JUM A;  2V1D A;  2DA1 A;  1G4W R;  2YL0 A;  1S3J A;  3HC7 A;  4M74 A;  4F52 A;  3EPZ A;  2JK3 A;  2K85 A;  1BR4 A;  3L1M A;  1UAA A;  1RIO H;  1Q1H A;  3HTK C;  3WTY C;  2AWY A;  1T6S A;  5JR3 A;  2QNL A;  1TQM A;  3V8K A;  1JTY A;  3SZG A;  1D5V A;  4HAM A;  2LFD A;  4Y4R A;  1YFH A;  3OV8 A;  5EEG A;  2STT A;  4I1M A;  2H09 A;  4D7N A;  3S1M J;  3EGD B;  4B3A A;  4G6Q A;  5J4V A;  2VLA A;  3SFZ A;  3DF8 A;  4LD5 A;  4U0V A;  4RLQ A;  4BHP A;  3WOD F;  3H9G A;  3EUK L;  1FSH A;  1ZAR A;  4IHV A;  2IJL A;  1NFN A;  1OIS A;  2M5W A;  4UUV A;  2XGC A;  3AL0 B;  4YT2 A;  3AJM A;  4BJ5 A;  2ADU A;  5JVE A;  2GDC A;  2JTV A;  2IBD A;  3AGU A;  3DFG A;  4ENN A;  3ASN H;  1B59 A;  1IRZ A;  2Y30 A;  1GHC A;  1NG1 A;  2NOJ B;  3MVP A;  1MNM C;  1Y39 A;  5CVU A;  5LHH A;  3ZQL A;  3KL4 A;  5ERI A;  2QA4 I;  4AL0 A;  2KIS A;  3BTL A;  1Z6T A;  2QEN A;  3AGT A;  2QLZ A;  4YEJ A;  3FHD A;  3BT9 A;  2L9J A;  1SVO A;  2CQN A;  3KP2 A;  1RJ9 A;  2DFI A;  5F1J A;  3JSZ A;  3V7O A;  1ZVZ A;  1U8R A;  2QGU A;  1QPM A;  3KP6 A;  4AIK A;  2KIF A;  2LP0 A;  4CS9 C;  1JTX A;  4YWQ A;  4L9T A;  2W57 A;  4ZYA A;  3OYN A;  3ECO A;  3C62 A;  2CFX A;  3BR1 A;  1E3O C;  1X58 A;  1M56 C;  4DXW A;  2HPI A;  1K78 A;  1G3T A;  2L6F A;  3EZI A;  2XAS A;  4V2F A;  2L7M P;  4AYB A;  4YJW A;  1RXQ A;  4B43 A;  3RKO F;  1IV6 A;  2HZT A;  3AG2 C;  2PLY A;  5HNF A;  2GAU A;  4PGG A;  3LS1 A;  2V9V A;  4HYE A;  3GFI A;  2IVM A;  2BZT A;  2ZNY A;  2YRF A;  1KGS A;  1K6O A;  2PI0 A;  1Z63 A;  4WCG A;  1UG2 A;  2Z33 A;  2J7P D;  1NHA A;  2CH0 A;  3TOA A;  4QI2 A;  2ELH A;  1D1C A;  2EV5 A;  2PMZ N;  2W25 A;  4YL0 A;  1A7E A;  1XGS A;  2HQ5 A;  5E18 F;  2KJC A;  2DI3 A;  3K70 D;  4ENK A;  2Y48 A;  1BW6 A;  3EFO B;  1M1E B;  4HDU A;  1RKE B;  1L3P A;  4MGR A;  3H3U A;  4BXF A;  2B0J A;  2EIM H;  2ZXR A;  2Y0S N;  1WPK A;  3GLL A;  4DYQ A;  4DIQ A;  4I09 A;  1A5J A;  4LDK A;  5HLT A;  3LST A;  3Q9V A;  2YL3 A;  1S72 I;  3CMA I;  5HLH A;  1X3Z B;  1Z7L A;  2EPM X;  3B0V C;  4I7H A;  3IKV A;  1QO0 D;  4FET A;  3VDX A;  4I76 A;  3ZXS A;  3HTS B;  4HPQ A;  1YAR O;  2KJG A;  3QOE A;  5DCF A;  3IKT A;  2D4U A;  1G59 A;  3BJ6 A;  1DU6 A;  2QTV A;  1EI7 A;  4C3I J;  1HKQ A;  5M5W J;  3CF2 A;  2I8D A;  3C2H A;  3D5R C;  3VYS B;  2K86 A;  1MW7 A;  3P9I A;  1YW9 A;  3QAH A;  1SMT A;  4NTA A;  3WTU C;  2LC2 A;  4RM3 A;  4MVO A;  1ZRD A;  1IN7 A;  2DMT A;  2R93 J;  2DYR C;  2QUP A;  2L4A A;  2VJI A;  3DKA A;  1HXD A;  4A3I J;  1WVR A;  5FB2 A;  4O3M A;  3MBG A;  4Q7C A;  5E3A A;  4D4N A;  1FIA A;  5FZT A;  2HDC A;  1RMV A;  4QTR A;  2F5E A;  2Q8K A;  3W6K B;  4UUS A;  3IL2 A;  1AKH B;  1JAF A;  2FAP B;  2EZI A;  2L81 A;  5C3E J;  4BEM J;  5F6F A;  5IPA A;  1BL0 A;  4MTO A;  1AEP A;  1CF7 B;  5LGU A;  5FRO A;  3CO7 C;  2ASR A;  2P5V A;  1T0F A;  4RAZ A;  5IP9 J;  3MYI A;  2HFH A;  3NRH A;  1O3T A;  4HV6 A;  1LFB A;  1G4D A;  5IY5 C;  2EH3 A;  1BA5 A;  2W9Y A;  1YG2 A;  2DLL A;  3RCO A;  1NH3 A;  4Q47 A;  4A5N A;  3COA C;  3HPG A;  2WZG A;  3CES A;  1I6H J;  3LES A;  2AQF A;  2PEX A;  3I54 A;  2AVK A;  1P9Q C;  2VXD A;  2X85 A;  4XOP A;  5D5X B;  1P2F A;  3UKG A;  5CVV A;  2MW8 A;  2P7V B;  3E5Q A;  3IH2 A;  5HS9 A;  3C8Z A;  4UUT A;  2F5V A;  1ST6 A;  4L9V A;  1W5C C;  3GUD A;  3BR2 A;  2IS1 A;  3JTL O;  3PMR A;  3HOU J;  3FM5 A;  4A3C J;  3KMI A;  1ZG1 A;  3W3C A;  2FE3 A;  1XTA A;  1J75 A;  2BHY A;  2QLA A;  3LEV A;  3BQZ A;  3H9Q A;  4OIQ F;  1MMN A;  2VQH A;  2QY9 A;  2MG4 A;  3FKI J;  2HXO A;  5K0I A;  1S5L C;  2VBX A;  1OCP A;  3DEW A;  1BJA A;  5D6F A;  4B47 A;  3JSO A;  4KDP A;  4JCH A;  1WFX A;  5LD2 C;  4XWJ A;  5F5F A;  5EEA A;  4Y13 A;  2YKZ A;  3DTK A;  4EJU A;  3Q9S A;  2ZCW A;  1WKM A;  2VH3 A;  2FX0 A;  2MWQ A;  2JA6 J;  3BTI A;  1DU0 A;  4EWC A;  2ESN A;  4ON0 A;  1TP4 A;  2DT5 A;  3M8J A;  3CP8 A;  5FKL A;  2JUC A;  3TO9 A;  5FJ8 J;  4HLX A;  4L0Y B;  3GVA A;  3ABT A;  2Y69 H;  1LPQ A;  1O4X A;  1VQL I;  3EZH A;  3U8P A;  2IA0 A;  2KL4 A;  1YYX A;  4CXF A;  5DQZ A;  3NEU A;  1VK5 A;  1WJA A;  5FKM A;  1WN0 A;  3GM2 A;  2CQX A;  4IZZ A;  1IN6 A;  4RAF A;  4GYG A;  3TP0 A;  3S1R J;  4EIY A;  2LSO A;  2J9V A;  4IHX A;  1PUF B;  3CLQ A;  3BR5 A;  3FF5 A;  4CZC A;  2LR8 A;  3LL7 A;  2L3D A;  5EG0 B;  3RQG A;  1SFO J;  1K05 A;  2H8A A;  5JUA A;  4LIV A;  3MMY B;  3QPS A;  1HC8 A;  2IXO A;  4ZYD A;  1YIT I;  4XLN F;  3GFJ A;  2JSP A;  4ABZ A;  2PX3 A;  1SD4 A;  4A3F J;  1JKO C;  2ACJ A;  3P7N A;  5E79 C;  3RTR A;  2WA0 A;  5GP9 A;  4DZP A;  4AVP A;  3RVZ A;  1MSF C;  3MEX A;  1EKY A;  3CC7 I;  2CO5 A;  4FX4 A;  1TWG A;  2XLE A;  4U5H A;  3MZH A;  2WAE A;  4M6X A;  1VTN C;  4LLE A;  5JSL A;  3ZTZ A;  4A2N B;  3CDI A;  5CIV A;  2EIJ H;  2D5V A;  2ZSI B;  4CCO A;  3DJN B;  1IG7 A;  1VQ6 I;  1GLN A;  3B6C A;  4CIC A;  4BY1 J;  3FXQ A;  1Q0G A;  3JAM K;  1PVE A;  3ULQ B;  3ZQQ A;  4BU2 A;  4U5B E;  3FZV A;  4A0Y A;  3JRF A;  4CS7 A;  3QVY A;  1O57 A;  4Y7N J;  3DI5 A;  2ME6 A;  3BJA A;  2W7N A;  2XIG A;  4ASN A;  3H2U A;  4F93 B;  5L0G A;  1LDJ A;  3WGI A;  3F0C A;  3UGP A;  2ESH A;  3LAP A;  5KYU A;  1N75 A;  5IYB J;  4LFU A;  3HBL A;  2YR2 A;  2OJQ A;  2A0B A;  2JSC A;  1L0O C;  3J7Z I;  3KIO A;  1W7P D;  5F0C A;  4G9Y A;  3G4S I;  4KIF A;  4A3J J;  1A0B A;  3NMI A;  1T08 B;  2L7Z A;  1HW5 A;  1SR2 A;  2Y3D A;  4PJN A;  2JRM A;  4KN4 X;  4CA0 A;  2EIK C;  1ODD A;  3I9V 2;  3GTL J;  1I1G A;  5J1R A;  1UJ8 A;  4BDY A;  2IS4 A;  4DQ2 A;  1CGP A;  3S93 A;  1ORS C;  5DYM A;  2YLD A;  1VQ5 I;  3SHF A;  5IYD J;  2XRH A;  3SNH A;  1OQC A;  2BVL A;  4IHW A;  2E1M C;  3L2Q A;  2J0X A;  3LSP A;  1KNY A;  3L9F A;  5L3B A;  4FE7 A;  1OPC A;  3QMK A;  4IO9 F;  2QCO A;  2I15 A;  1ZYR F;  4N4W A;  3T6J A;  2STW A;  2Y9Y A;  4CDV A;  2OKU A;  3F8B A;  3DEU A;  5KK1 A;  4BDZ A;  3DEE A;  3ABL C;  2VN2 A;  4NDL A;  1DOW A;  4BAC A;  1G3S A;  3SEQ A;  1PYV A;  3FX3 A;  3OYF A;  3JT1 A;  3S3N A;  2DMN A;  3SEZ A;  4NB5 A;  1ONV A;  5D5W B;  3MKY B;  2NUT A;  2FBI A;  2LY9 A;  1J2X A;  2CW0 F;  2GLO A;  2LRD A;  4DW6 A;  4XL9 A;  2EFQ A;  2HYG D;  2KZG A;  2DT6 A;  2X9D A;  3U1K A;  1FEX A;  3L2R A;  4C3D A;  4G6T B;  4ZDO A;  1IRX A;  4L0Z B;  3HJC A;  2NPU A;  3R60 A;  2KSF A;  4IXA A;  4U0Y A;  3V42 A;  3K4M A;  1M2V A;  3BPX A;  2V79 A;  4M3E A;  2IA2 A;  2HOE A;  3HXL A;  4BXU A;  4O5V A;  1LUJ B;  2YL7 A;  3KYD B;  1QQ3 A;  2X6Y A;  1H9G A;  1L7C A;  1U5T C;  5F0H A;  2OZU A;  1BBH A;  1R4M B;  1ZHF A;  1FSE A;  2M4K A;  1IC8 A;  2Q4F A;  1RES A;  5JI6 A;  5JVT A;  3ML6 A;  3HOT A;  5FRN A;  2CQ7 A;  3R0A A;  5ILS A;  1UMQ A;  2ZSH B;  5JHU A;  1R9T J;  2ZBK A;  1ERD A;  2KW3 C;  1CGO A;  3ZCO A;  4MTF A;  1VQ9 I;  1M6T A;  4P96 A;  3M3Y J;  2LK4 A;  2PMU A;  3ERM A;  3RDI A;  5CKT A;  3CCJ I;  1BW5 A;  3JTG A;  4UVA A;  4DBR A;  3BC8 A;  4A0Z A;  3O8G A;  3A03 A;  2COB A;  3KEY A;  4KA4 A;  4A3L J;  1B4A A;  3K0L A;  3ZMS A;  2QSF X;  1WTY A;  4ZLD A;  1A04 A;  2H8W A;  3IV5 A;  3KLO A;  4B8X A;  3K4C A;  2GOX B;  1FT9 A;  1JUP A;  2DTZ A;  3BG7 A;  2VI6 A;  1FWZ A;  3OIQ A;  4IF4 A;  2OUM A;  1HF0 A;  1M2O A;  3ISP A;  3A0H C;  2BE5 F;  4EJV A;  3QRF F;  2BY2 A;  1P92 A;  2KRC A;  4GRI A;  3H3Z A;  1KU7 A;  1T01 A;  1ZW2 A;  2XS8 A;  5LRS A;  5J1Y A;  4R32 A;  1GXP A;  5CQG A;  2LY1 A;  2AWC A;  2IRF G;  4IQJ A;  5BQI A;  3F3X A;  4AX2 A;  1IF1 A;  3OA1 A;  2FJ1 A;  2QEX I;  5E3C A;  2L6H A;  3QPL A;  4MO7 A;  1AA7 A;  3PO3 J;  2F4I A;  4JYK A;  4XKC A;  5EYR A;  1VB5 A;  3TMO A;  3W6J B;  2QVO A;  4QPQ A;  1B72 B;  4E7I A;  3DBR B;  3W2V A;  2EFP A;  3BJO A;  3S84 A;  4CCN A;  1OR7 C;  2PG4 A;  5EZG A;  1QLE C;  3CTA A;  4AE4 B;  3DPL C;  1B8I A;  3K2Z A;  4X6A J;  1KA8 A;  2NNY A;  3ZPL A;  3HUG B;  1V54 C;  3DM5 A;  3GTP J;  3O10 A;  3S17 J;  1GV2 A;  2VOP A;  1XMX A;  2A68 F;  2J9B A;  4UB8 C;  3GCM A;  3EUH C;  2R0Q C;  2EZK A;  1OCZ C;  2FQ3 A;  3LEO A;  3VSK A;  4XLP F;  1LDK B;  1OW6 A;  3SXZ A;  1Y1W J;  2VCC A;  3V4G A;  3W2W A;  2FXA A;  1JKR C;  2CW7 A;  3C63 A;  1IZ1 A;  1MJA A;  2M7B A;  3L2W A;  1HLV A;  1QU3 A;  2DTR A;  3WHC A;  3L1P A;  3AG3 C;  3JYH A;  2OQG A;  3A02 A;  3G50 A;  1B9M A;  3AQC A;  1IDY A;  3FXM A;  4DYC A;  3HNL A;  2Q1Z B;  1R7J A;  4BH9 A;  4PK4 A;  4E4H A;  4BNC A;  1F1M A;  1NU9 C;  3KZZ A;  2HQN A;  2UUZ A;  4XKB A;  3GTO J;  2UUI A;  4HQE A;  1JT6 A;  3K66 A;  4P9T A;  2WAF A;  3EUA A;  2ECB A;  2E1M B;  2LRE A;  5DCM A;  2O0Y A;  3X2Q C;  3AG2 H;  3ZMT A;  1GV5 A;  5GPC A;  3M7G A;  2VKH A;  2NS7 A;  1QZE A;  5LBQ A;  1FP2 A;  2L2O A;  2KRF A;  2E60 A;  1FMV A;  2K9N A;  5IOY A;  1HKT A;  4DJ9 A;  3EYI A;  2HJ3 A;  1PJR A;  4RD9 A;  2QF7 A;  4P9U A;  3NMK A;  3CUQ C;  1CGM E;  4HST A;  1OKK D;  2XAU A;  1W2W A;  5JT4 A;  3X1O A;  3OR1 C;  3UR3 C;  1SYQ A;  2IXP A;  3ECH A;  3FXR A;  3E70 C;  2WTE A;  3OL3 A;  5TJJ A;  4A6D A;  3SXK A;  2VOO A;  2R5Z B;  4PJJ A;  4XN0 A;  2XAF A;  1FBQ A;  1YJW I;  4JRZ A;  3M1C B;  3A0B C;  3V7R A;  1V55 C;  2HV6 A;  3Q6M A;  1D1B A;  1ETQ A;  2IGK A;  5BNG A;  2OD5 A;  3DJU B;  3OYI A;  2QSG X;  3V8L A;  4HF2 A;  5HVQ C;  1USS A;  1Y6I A;  2JPB A;  3TOL A;  2XS1 A;  1QVU A;  4RGS A;  3S0X A;  1TNT A;  2XSD C;  3E6D A;  1JXS A;  1B1B A;  2HOS A;  2XDV A;  3R2P A;  3JAM Z;  3OL4 A;  1U5T B;  2HXI A;  1F1Z A;  4A2U A;  4J7Y A;  2XB5 A;  2H1L A;  3ZP5 A;  2PMH A;  3IQC A;  5LGT A;  2VBY A;  2XM0 A;  3S32 A;  4DGW B;  1SFU A;  5J8F A;  2MLG A;  2L01 A;  3DPU A;  3CC4 I;  1IXC A;  2DYR H;  4J30 B;  3PQK A;  3JYY A;  1SAU A;  2K9S A;  2ID3 A;  2YU3 A;  1LVK A;  1T56 A;  3DWW A;  2NNN A;  1U9N A;  4RS8 A;  3GTJ J;  4MTG A;  3U0C A;  4FQG A;  5E3L A;  4AIH A;  4B6I A;  4LB5 A;  4J19 A;  2LVS A;  4LK0 F;  2DPD A;  2R9R B;  1FPQ A;  2COM A;  3DE8 A;  3QYF A;  4X0R A;  1Y1V J;  4B44 A;  4ZTF A;  5IY5 H;  3TO7 A;  2KGO A;  3BRJ A;  2X6W A;  1SAN A;  2CJJ A;  4JQF A;  4M9Z A;  5FLX K;  1O7F A;  1LEA A;  5F1R A;  1ETX A;  2GIV A;  4YL3 A;  2HQA A;  2MC3 A;  1U0J A;  2E1N A;  4YIF A;  1IXS B;  1YRN B;  4IAO A;  4ZYE A;  4ZDL A;  1J5Y A;  1IZM A;  3RKY A;  5GAD J;  3SDB A;  2DMP A;  4OWR B;  3I59 A;  3OY9 A;  3CUO A;  2J9U A;  2E35 A;  2L9V A;  1JGG A;  5DD4 A;  3BLY A;  5J6X A;  2OEX A;  4KFC A;  1ZRE A;  4XKW A;  3I71 A;  3EQL F;  3PIO F;  2HYJ A;  2HDW A;  4JIO A;  1YVI A;  4IWB A;  3GBG A;  3H36 A;  2Y0M A;  3A2K A;  2GA0 A;  1JMW A;  4L9N A;  1YDI A;  5BQT A;  4F7Z A;  4A4A A;  1R5H A;  5KYY A;  3C2B A;  2HDD A;  4MVZ A;  2L54 A;  1OCR C;  2BL2 A;  4IOA F;  3WTV C;  3J80 K;  3M8F A;  1HSJ A;  1SD5 A;  2NVX J;  1QVT A;  3LS0 A;  5FKK A;  3JTH A;  1I4Z A;  3M4B A;  2M4E A;  1YX3 A;  3FAJ A;  5B1B C;  3T6B A;  2DOA A;  2DW4 A;  4RAY A;  4RB1 A;  2P6V A;  2E2H J;  1RKE A;  5FCL A;  5L0J A;  3SZT A;  3I0T A;  5FFX A;  5FKN A;  2W85 A;  2L0K A;  2A0U A;  2P81 A;  5K5R A;  2E5N A;  3HSE A;  1VFC A;  3PNT A;  2J5O A;  1QQI A;  5LGN A;  4LLN A;  3LJB A;  1WJE A;  3FWE A;  1X1P A;  3M9A A;  4DJA A;  1T38 A;  3CUQ B;  2R92 J;  1FAP B;  2YPR A;  2M3A A;  3VB2 A;  1FJL A;  5EHH A;  5HSW A;  2NVQ J;  1Z21 A;  3ABM C;  5IT3 A;  1ETK A;  3Q0V A;  1P6R A;  4LG3 A;  1UHS A;  4HE8 D;  1ZHT A;  3C8G B;  2QBY A;  1X1A A;  1UFB A;  2W84 A;  3G4Z A;  5KYW B;  1ZKG A;  2L7A A;  2XLV A;  1HY5 A;  2BW3 B;  1X4P A;  4F4B A;  3S3O A;  3VSL A;  5B1A C;  4BEH B;  2DFF A;  1ACI A;  3I56 I;  2P0W A;  4HX4 A;  3LOC A;  3WTW C;  2RDP A;  5EDN A;  4KN7 X;  1E0E A;  3KP3 A;  3TDU C;  1G4U S;  3MN2 A;  4N6C A;  2GFH A;  4HF1 A;  3H5R A;  2IA1 A;  2K4J A;  2LKP A;  2RQQ A;  2H6B A;  2L4M A;  4BYY A;  2PFB A;  1ORJ A;  2Y3B A;  3IQ6 A;  4BBR J;  1J09 A;  4ZH4 F;  4II2 A;  2YVK A;  2BV6 A;  4HSR A;  1TWH J;  1O3S A;  3Q5F A;  3JR9 A;  4N9H A;  4BEJ A;  2E1O A;  2AP3 A;  4DRI B;  3E9V A;  4U5G A;  2R5Y B;  1X19 A;  3HEF A;  3IC7 A;  4ZJZ A;  3ATP A;  3BCA A;  2QKL B;  2VIX A;  4O79 A;  2CSO A;  2EPO A;  4PFP A;  4RGX A;  1IXR C;  2W45 A;  4J32 B;  1BBY A;  2NS0 A;  4ZDP A;  5HS8 A;  5L3E A;  3CCR I;  2P7V A;  2KP6 A;  2IP2 A;  2FNA A;  3FK6 A;  1PCX A;  2YLG A;  3S2D J;  2LKX A;  1YLF A;  4HOB A;  3KYC B;  3MYF A;  4WX9 A;  3GAN A;  4CSW A;  2BBY A;  2RAE A;  2HOT A;  4MHG A;  3J7A Y;  4FHT A;  2R02 A;  2EIK H;  4DVZ A;  1FC3 A;  2M87 A;  3WAQ A;  3GEI A;  4BJ1 A;  2OA4 A;  3B29 A;  4C7O A;  2XAG A;  4QPO A;  1G6N A;  1PD0 A;  1Z77 A;  5EEH A;  1P4W A;  1EH8 A;  2R7D A;  5KYX A;  1TFK B;  5AC4 A;  3IHU A;  4CS9 A;  3GZN B;  3EGX B;  3D0S A;  2LNB A;  3ZR8 X;  1O7L A;  1VZ0 A;  5A6B D;  1RET A;  3ABL H;  4R79 A;  4J00 A;  1V5F A;  1W0U A;  2NVT J;  2LFF A;  4G78 A;  1CPR A;  5F27 A;  2A6E F;  1T6Q A;  3LLK A;  2K27 A;  1R00 A;  2UV1 A;  1HBX G;  1P7J A;  3ZC4 A;  4LDR A;  4CS8 A;  2N8G A;  2M0M A;  5H6R A;  4CDY A;  1TQG A;  1XGO A;  2KMU A;  2Q2E B;  3ZN0 A;  4ESB A;  4D5C A;  3J81 K;  3OYL A;  5DM7 F;  4G7Z F;  5EG0 A;  1EA8 A;  1QSP A;  3N2Z B;  3IAM 2;  4MVQ A;  3F8F A;  3WE2 A;  1Q0F A;  5COM A;  4CUG A;  2MSY A;  3OYJ A;  3CCM I;  4PR9 A;  3LQR A;  1S7E A;  3ABU A;  2KLO A;  1N1C A;  3A11 A;  1ETW A;  3PUB A;  3U21 A;  5CI9 A;  3G6E I;  3ZDL A;  3GLX A;  2X0L A;  4UV9 A;  1YA9 A;  3PSF A;  4WXD A;  3ZQC A;  1RRJ A;  3TJ5 A;  1DP7 P;  1D0Z A;  3CDH A;  3WGG A;  1JPN A;  1R58 A;  1WI3 A;  4FT8 A;  1JPJ A;  2IXM A;  2YL1 A;  3FMS A;  1WH7 A;  4G94 A;  1QZZ A;  3FIW A;  2M30 A;  4XSX F;  3DKY A;  2NVU B;  3ZQF A;  3HOS A;  1G2H A;  2X4H A;  4FES A;  2H7B A;  4M3G A;  4Q48 A;  2CYY A;  1MJ9 A;  2XF7 A;  2ZO4 A;  1NBB A;  3OEO A;  3U1D A;  1B68 A;  3OYM A;  2HV7 A;  4BQO A;  2WV0 A;  4M3B A;  3K4N A;  2CQQ A;  4PCQ A;  4RB0 A;  2LBF B;  2NRA C;  2PJP A;  2W1O A;  4RLF A;  1OCC C;  1OCO C;  4YII A;  1RPW A;  2DK8 A;  3JRB A;  4YFN F;  1ZHX A;  3RVY A;  3HKZ A;  2AS5 F;  2UXX A;  2KIU A;  3KKB A;  3BY6 A;  3DWL E;  2XF6 A;  5FLX Z;  4U9E A;  1W7P B;  3K1M A;  3K7A J;  4KT5 C;  1ON2 A;  5BMZ A;  3Q7L A;  1W4M A;  4BGD A;  4RAG A;  4XKV A;  1NU7 D;  4PAC A;  5B3S C;  3WGH A;  2DA2 A;  4XLF A;  4CDG A;  2Y3G A;  1J8M F;  2ISZ A;  2FML A;  4K7B A;  4M71 A;  2TDX A;  2HEO A;  2L9S A;  2WB7 A;  1MBG A;  3H65 A;  4PZJ A;  5CVJ A;  2PJR B;  1KON A;  2V9P A;  2CUF A;  3FXJ A;  4EEF G;  2XLH A;  2JRT A;  2YS9 A;  3F6O A;  2E7X A;  3CCU I;  2CNW D;  2HMZ A;  2ICW G;  2EV6 A;  4ER9 A;  2PNO A;  3U8V A;  1Y4C A;  1JHF A;  3KFW X;  2E87 A;  2ZJP F;  2B7E A;  1V54 H;  2KDZ A;  4KIG A;  3QPH A;  3KEO A;  3HOZ J;  3S90 A;  2QE9 A;  4I99 C;  1Z91 A;  4M6V A;  1JJ6 C;  1OCZ H;  3KLN A;  1SVL A;  4D7M A;  2HTS A;  3LMM A;  5L3V A;  3FMR A;  1FOK A;  2XV4 S;  2O8K A;  4QDL A;  5BS6 A;  2UZK A;  3J80 Z;  4G0H A;  2DXI A;  3E5U A;  2F5C A;  5K7H A;  2UXN A;  1YJG A;  3AG3 H;  4CGZ A;  1XN7 A;  2MC4 A;  4GYI A;  4WXC A;  2P8T A;  2E5Z A;  2M0C A;  2VC0 A;  3EHN A;  4JCZ A;  1KYW A;  3KYJ A;  1XD7 A;  2HPM A;  2TRT A;  3BR0 A;  4ENM A;  2OF7 A;  2QQA A;  2ZFU A;  5M5Y J;  1EQ1 A;  3X2Q H;  5C4X J;  1LEB A;  4UY8 I;  2VBW A;  3MD2 A;  2V6E A;  3SJM A;  4RBO A;  4YFX F;  2YX7 A;  3HOV J;  3PUF A;  4RMN A;  2A1D D;  1SF8 A;  1QZY A;  2R7T A;  4CYC B;  1LS1 A;  2YWA A;  5CQE A;  1OJL A;  4MVS A;  2GA1 A;  4KIB A;  1R36 A;  5JFR A;  4M9X A;  2Z99 A;  2M8E A;  4ZYH A;  3WU0 A;  3MQ0 A;  3U9M A;  4J7T A;  3JCU C;  2K3F A;  4MVR A;  4D4X A;  1I4Y A;  2DDA A;  2XSE A;  2I10 A;  3WU2 C;  4XRS A;  3FKJ A;  4S05 A;  3SXY A;  1O3R A;  2GWW A;  1V55 H;  4L6R A;  3C8G D;  2K3P A;  3BOQ A;  1JI8 A;  1HKS A;  2QQB A;  1XZP A;  2J46 A;  4XLH A;  1MND A;  4IEJ A;  3EHM A;  2CMP A;  5TGT A;  5DS4 A;  2J5P A;  1DDN A;  4BJ5 C;  3WTT C;  1E3H A;  1PP7 U;  4EGY A;  1HDD C;  3O6B B;  2PF4 E;  1YJN I;  3DU5 A;  1IAW A;  3ZQH A;  1VQO I;  2CUZ A;  4OMY A;  3UMK A;  4YEL A;  2HR3 A;  2XSJ C;  1BN5 A;  3GWZ A;  1W36 D;  3GZ6 A;  2B0L A;  1X2M A;  3V5Y A;  4HX8 A;  1U0B B;  4XRM A;  1YI2 I;  4CIH A;  4OU0 A;  4XBF A;  4ESJ A;  4MFD A;  3CJN A;  2E71 A;  2JA7 J;  4O6M A;  3HNJ A;  1W5S A;  1FTZ A;  4RB2 C;  2FA5 A;  2RN7 A;  1IDZ A;  2OCC C;  4JTA B;  3HM5 A;  3OIO A;  4Q5S F;  1WAT A;  3ZSU A;  1B72 A;  3M4C A;  1IRG A;  2VOD A;  3NDB B;  2QZ8 A;  1Z05 A;  1WSU A;  1BJZ A;  2FBH A;  1XPX A;  1TNS A;  5B66 C;  4AE4 A;  1MZB A;  2PMZ A;  3NYJ A;  3V5X A;  1DOV A;  2YQY A;  3VAY A;  1P7I A;  5M3F J;  4JVS A;  4NQW B;  3S14 J;  4G7O F;  1TR2 A;  5JRA A;  3OOP A;  1IUY A;  2OPT A;  4HEA 2;  2XRO A;  5E1Z B;  3HGY A;  3HHH A;  2X51 A;  2WL8 A;  4XON A;  1ZHW A;  256B A;  5JVG F;  2MD0 A;  4YL1 A;  1AWC A;  3TO6 A;  2BOL A;  1H0M A;  2F48 A;  1QPI A;  1I5N A;  2WZL A;  1Y8R B;  1ZAO A;  1LKX A;  4DVY P;  2DA3 A;  3T9O A;  2AHQ A;  3IH3 A;  3SQN A;  2Y0S A;  3VWB A;  4XPW A;  5T3W A;  3VYU B;  2A61 A;  4IVN A;  2IW5 A;  2Z3Y A;  3DLA A;  4Z9H A;  3U3F A;  3QYB A;  4H54 A;  1YS7 A;  1ZGA A;  3T1B A;  3HJE A;  3OS0 A;  1ETO A;  4FX0 A;  3CEX A;  1IUF A;  2FNP A;  5EF6 A;  2GIZ A;  1WHU A;  4C2U A;  1YZA A;  5E17 F;  4XEV A;  1TT0 A;  5A6J A;  2I8B A;  5EZH A;  2DBB A;  1A7V A;  1WH5 A;  2MAB A;  3HPH A;  5IP6 A;  4I44 A;  1HCR A;  4Y33 A;  1MGT A;  2VQC A;  1IN4 A;  2KQR A;  3A01 B;  2OTL I;  1VLS A;  2GBY A;  4BY7 J;  3HRU A;  3J81 Z;  4MW3 A;  2A69 F;  5GTI C;  3PDM P;  2O9X A;  4PJL A;  3FIS A;  1OCR H;  3GME A;  1XC5 A;  2MFZ A;  2UWM A;  2XLW A;  1S7Z A;  2R7Z J;  2WB1 A;  3KZY A;  3VOE A;  1R4T A;  1IRF A;  4IHS A;  5BQH A;  1TWA J;  2CV2 A;  5BPD A;  4A3G J;  2R5Z A;  3ZG1 A;  1XSX A;  2DOE A;  1S29 A;  4R8H A;  5B1B H;  5J3L A;  1ZLJ A;  1F5T A;  3FDY A;  2CDQ A;  3M15 A;  3VEP A;  5DM6 F;  4UVC A;  2GM4 A;  1TQI A;  3EH2 A;  2Y31 A;  4EMS A;  3I64 A;  3AAF A;  2L7F P;  1O3Q A;  1YIO A;  1EH6 A;  4DBQ A;  4LDQ A;  1XCB A;  2X1C A;  1V74 B;  4JEB A;  1RC9 A;  3HKK A;  3NQO A;  1Z67 A;  3K9T A;  2Z15 A;  4NC6 A;  2RC4 A;  2PN6 A;  4A3D J;  1Y56 A;  2HNH A;  1DGW Y;  3ERE D;  1XB4 A;  1RKT A;  4QIW N;  2ZFW A;  2GAQ A;  3DU6 A;  3ABM H;  4HNU A;  1LE8 B;  3JSP A;  1H6G A;  3H35 A;  4IKF A;  4F91 B;  1FBS A;  3E1S A;  2P0N A;  2DJI A;  4TV7 A;  5FD5 A;  2D45 A;  3BR3 A;  4CSA A;  1WZ2 A;  5B1A H;  2VL8 A;  2D2W A;  2BY3 A;  1JKP C;  1XX5 A;  1RI7 A;  1D8K A;  1LVA A;  4N9I A;  1OYY A;  4RA2 A;  1F9N A;  2ISY A;  3L00 A;  3QWL A;  5E1W A;  4Z6Y A;  2OQM A;  4I1O B;  1EA3 A;  2K7L A;  1WJ5 A;  3RPU D;  3AG1 C;  3HNK A;  2LH9 A;  2VCA A;  1JOG A;  2K5C A;  4OAZ A;  4N6H A;  3GW2 A;  2R7W A;  3NWT A;  1S7A A;  1T95 A;  2GXG A;  1QHG A;  2L7K A;  3V7C A;  3TW6 A;  5JHF A;  3EG9 B;  3RQE A;  3TED A;  5E8G A;  4MVU A;  2V1U A;  4NTF A;  1YRN A;  3RF3 A;  2XAH A;  4CHU A;  4EV0 A;  1A35 A;  1RJ9 B;  1YYJ A;  5K7F A;  4PJM A;  4C3B A;  3GXO A;  2Q7R A;  1OR7 A;  5K5O A;  3O8H A;  3K1P A;  2VT3 A;  2DYS C;  5J40 A;  1CQT A;  5LLQ A;  4CO8 A;  2W82 A;  1K7A A;  3HOX J;  1UG7 A;  2ZPA A;  4FAS D;  3EUH A;  1K78 B;  2J7P A;  3NWS A;  2KQ9 A;  5LEJ A;  4OD5 A;  1FTT A;  4DZJ A;  2XGE A;  3DD7 A;  3K69 A;  3B02 A;  5LFA A;  3D1N I;  3AOU A;  1BIB A;  2LDU A;  3SXM A;  1SMY F;  2O61 A;  4MS2 A;  1TWH A;  3W6V A;  3TOM A;  3GWL A;  4GEH A;  1GDT A;  2M9H A;  3Q3S A;  2L6G A;  3U9J A;  2EPK X;  5KYN A;  1RR8 C;  4Q4Z F;  1VQP I;  4WGY A;  4BE0 A;  1OLT A;  3O55 A;  3CCY A;  5LEK A;  2JA5 J;  5LHG A;  2JA2 A;  2FMY A;  2KJB A;  2LLK A;  2MD5 A;  3F46 A;  1RR7 A;  1K6Y A;  3H3V K;  2MH9 A;  2OCE A;  2O5R A;  5D4R A;  2V1N A;  3S1Q J;  4ETS A;  3T5X A;  3NYL A;  4LLC A;  1VND A;  1MMS A;  2KHM A;  3HDD A;  5E3O A;  4C3H J;  4YFK F;  3K6G A;  5JLX A;  1ITY A;  2F5D A;  3CUQ A;  2PX9 A;  1OXK A;  5E1X A;  2GXA A;  2Q0O A;  3H0D A;  2O03 A;  1LE4 A;  3BPV A;  2KT0 A;  1BI2 A;  2NG1 A;  3N05 A;  4N4O B;  2WAD A;  5EGO A;  2K02 A;  3LSK A;  5L0I A;  1VQN I;  1V5E A;  3TP3 A;  2BW3 A;  4E70 A;  2OOC A;  1ZTR A;  5DS6 A;  1BI1 A;  3ZQ7 A;  3PFI A;  3SZP A;  2H94 A;  4M6Y A;  1BR1 A;  2HKX A;  2F6C A;  5GTH C;  1MDM A;  4XRF A;  5IP7 J;  1JGS A;  3ZIB A;  3LSH A;  3PNY A;  2J0W A;  3KPH A;  3BWG A;  1TTY A;  2Z16 A;  3MKW B;  2IM8 A;  3RSN A;  2VKD A;  3E0J B;  2EPL X;  1ORY A;  3F22 A;  2R5Y A;  3E7L A;  2WAQ N;  3VPR A;  2RKH A;  1OCC H;  3S2W A;  1XGM A;  1OCO H;  5J8C A;  2H27 A;  2XKP A;  6PAX A;  5E3M A;  1NK3 P;  1AVO B;  2IGM A;  3M8E A;  3E6C C;  5GPG B;  2LQG A;  2OJE D;  3OYG A;  2A5W A;  2OBP A;  1NG7 A;  3N4M A;  5B3S H;  1GT0 C;  1Z1D A;  3K4L A;  4CCM A;  4J01 A;  2TMV P;  3TL4 X;  1QA6 A;  2KPM A;  1VYK A;  2H7V C;  1LDD A;  4HV5 A;  4JEA A;  3JRH A;  5CVR A;  3L34 A;  2HGC A;  1FFH A;  1W0T A;  5D91 A;  1X2N A;  2BY1 A;  3NKD A;  5L3Q A;  3OS2 A;  1YYV A;  3ZQV A;  1XG1 A;  1G3Y A;  2WV1 A;  4IX7 A;  1NK2 P;  2DA4 A;  2DJN A;  1AUE A;  4L9J A;  3CAX A;  1C0W A;  3F8N A;  5KAF C;  2OEV A;  5ICF A;  2D1V A;  3BP8 A;  4E18 A;  2EFN A;  1K40 A;  4ZZD A;  3FXO A;  5H20 A;  3VOD A;  4CH7 A;  5F08 A;  4XLE A;  4IRH A;  3I55 I;  1OCT C;  5DS5 A;  2VE8 A;  4AU7 A;  2VC1 A;  4C3J J;  4BBS J;  2IYL D;  1E17 A;  3C7J A;  4HA8 A;  2A5Y B;  4D0P A;  3K1I A;  2YX4 A;  4RGU A;  4YG2 F;  2EK5 A;  3FXK A;  4LG0 B;  2JZY A;  3K33 A;  5E33 A;  2VKV A;  2LTP A;  1YX5 A;  1R71 A;  2RQP A;  2E7W A;  3EET A;  3IPM O;  2Q2E A;  1T33 A;  4I02 A;  2RGV A;  2KZV A;  4HRI A;  3DZA A;  2R7R A;  1YAU O;  1OFC X;  4JX6 A;  1XMA A;  1YW7 A;  2V26 A;  1KQ0 A;  3OS1 A;  3KYL A;  5J4Y A;  2G62 A;  2OQR A;  3WU1 B;  3D5S C;  2DMU A;  1W36 C;  4HF0 A;  2Y39 A;  5BUO A;  1U9O A;  3EGD A;  3PL8 A;  3EJN A;  4KNW A;  3U2L A;  2L9N A;  4U5F E;  1E83 A;  1H9T A;  4E7J A;  1TC3 C;  4BAY A;  3L8J A;  2F5F A;  2K40 A;  3G1L A;  3IP4 B;  3WG9 A;  1MMA A;  5GAH J;  1YW8 A;  4BG0 A;  1VF9 A;  4IOC F;  4MIM A;  2W4S A;  1ZW3 A;  4I6Z A;  3RIR A;  2LF7 A;  1MMG A;  2JWT A;  3MFN A;  5DS9 A;  1ETV A;  2IXS A;  3QU3 A;  3QQA A;  3CMY A;  3M1E A;  2W24 A;  4PSX A;  4YT4 A;  4E7L A;  2Z5U A;  3SEO A;  1ZRC A;  1FR0 A;  3TQN A;  3S15 J;  2O6G E;  5DQT A;  4XPY A;  4IQ4 A;  3G1O A;  3GOR A;  3CCV I;  5DUI A;  2ZJQ F;  4IHY A;  2XRN A;  3T0Y A;  3KP5 A;  4OIR F;  1SAX A;  2OU6 A;  2VB6 A;  3PIP F;  3JRG A;  1RZ4 A;  1MNE A;  1W7P A;  1TBX A;  3U9G A;  5DUK A;  4QLC U;  4U9D A;  1I6X A;  1QNT A;  3BG5 A;  1N25 A;  3LNQ A;  1Y0N A;  4BJT A;  3UMH A;  1JR8 A;  2OCC H;  2PJR A;  3FHZ A;  3GFL A;  4H0E A;  2EIL C;  1ZK8 A;  3LSM A;  5D8K B;  1I1S A;  4E0I A;  3KZI C;  3QTH A;  4JKV A;  2R4G A;  1Y8Q B;  1EKE A;  1G3W A;  2DOF A;  2P6T A;  1A36 A;  3CD6 I;  4LJZ F;  4OIO F;  3HSR A;  2I5U A;  3BZ6 A;  4O7G A;  1W1W E;  3DLL F;  4NCQ A;  3H0G J;  1HQC A;  1B6A A;  1GS9 A;  4ULV A;  1OYI A;  2B9S A;  4YN0 B;  2GA2 A;  2NVY J;  3S8P A;  3OWT A;  4CJG A;  3C3W A;  3LQQ A;  3P9K A;  4JX5 A;  3TGN A;  5HLG A;  2QM3 A;  4A3K J;  1XS9 A;  2BXZ A;  3L2U A;  3OSG A;  3HOY J;  4S0H B;  5DLJ A;  3K2A A;  5FKO A;  3R0J A;  2XLO A;  2MA3 A;  5HOD A;  2ZC2 A;  1F43 A;  3V8J A;  2V1X A;  3LFU A;  3DPT A;  3PSI A;  2J9W A;  4CCJ A;  3LSR A;  3LA3 A;  1K4S A;  1R5I D;  5EJC A;  2BXY A;  3LSJ A;  3EFO A;  2NUT B;  3ONQ A;  2ZXI A;  5CYV A;  5ED4 A;  3PO2 J;  2MYS A;  3BG9 A;  4KUM A;  3OYE A;  2XL8 A;  4O6Y A;  5FGM A;  1AU7 A;  1NG6 A;  2V6C A;  3HSF A;  3K10 A;  4MFE A;  2VCB A;  3OYK A;  3G2B A;  4BL0 B;  4AM3 A;  5DEQ A;  3LA7 A;  3RYP A;  3RH3 A;  3NYM A;  1LQ1 A;  2F2E A;  3FXU A;  2VUM J;  1MBK A;  4E17 A;  3PHF 2;  2K9Q A;  2VJJ A;  1LJ9 A;  2A07 F;  5HLI A;  2HJM A;  3E3V A;  1HDP A;  4M73 A;  4MEX F;  2XLM A;  4U5D E;  1R6R A;  4BE2 A;  1FFT C;  1R23 A;  3T4R A;  3FXH A;  3JRD A;  3OYA A;  2LY2 A;  3HZJ A;  2Y75 A;  4EUK B;  2KIQ A;  3EYY A;  5J47 A;  4Y17 A;  4ONS A;  1O5H A;  4A5M A;  3QU6 A;  1Q1V A;  1FY7 A;  2MBF A;  4XMY A;  3ECS A;  1AKH A;  2XAJ A;  1REP C;  4JC7 A;  3I5Q A;  4U5E E;  1T8I A;  1CF7 A;  1E85 A;  4EKW A;  1YLM A;  4II3 A;  5TIS C;  5D4S A;  4B09 A;  1MMD A;  2YZS A;  5E8I A;  2EZH A;  3OYD A;  4HFK B;  4EHP A;  2O9L A;  1Z23 A;  1MBE A;  3S9O A;  1T6I A;  1TLH B;  3F8M A;  2XGD A;  4XM3 A;  1ON1 A;  4X1E A;  5COG A;  4HG2 A;  4UVB A;  1ZEL A;  4P55 A;  1Y0U A;  4FE4 A;  1SD7 A;  3RJP A;  3RKW A;  1HMO A;  4LLG F;  4ANJ A;  2R03 A;  4BE1 A;  1B9N A;  2JJ7 A;  2HMQ A;  1MIJ A;  4BJ6 C;  3V5Z A;  4ULW A;  4ITV A;  1Z6R A;  2OAZ A;  2R05 A;  1BI0 A;  1TWA A;  1H7I A;  3REO A;  1MSE C;  1DGR M;  2VBZ A;  3C1D A;  2WVN A;  3RYR A;  1QGP A;  4HZF A;  3C18 A;  2JPU A;  4FCY A;  2VJ5 A;  4Z9I A;  3KEQ A;  1I27 A;  2R3S A;  4NQW A;  3VYT B;  3ZWI A;  1PP8 F;  1R49 A;  1YZC A;  1LS4 A;  2V9K A;  3AG1 H;  3Q0W A;  1YHQ I;  1UEL B;  3NRV A;  3ZQG A;  1FYK A;  3ZMU A;  3U5S A;  3LAY A;  4BQA A;  2MH2 A;  4UHT A;  3L2V A;  5JS5 A;  2VPR A;  4O6J A;  3IRR A;  3BG6 A;  3CO6 C;  2FU4 A;  3MZ8 A;  1ETY A;  1NTC A;  3F6V A;  3CSK A;  1R1V A;  4JJF A;  4CX9 A;  3T8T A;  4NC7 A;  1WJD A;  4JP0 A;  5K5Q A;  3S29 A;  1Q0D A;  2ELK A;  1KYZ A;  1HMD A;  1FMW A;  4UXN A;  3OSF A;  4X0G A;  5L0C A;  1HST A;  1UB9 A;  3W2A A;  3BG3 A;  3OMY A;  2R7O A;  2KK1 A;  2EQR A;  2EB7 A;  4E7S A;  3ZVR A;  2A6T A;  4KC9 A;  2LIG A;  2E2I J;  2XL4 A;  5HS7 A;  4U88 A;  2DYS H;  3L7W A;  1Z3Y A;  5D8L B;  1ENH A;  4A6E A;  2OC6 A;  3ZMD A;  1YIJ I;  3I3L A;  4QSH A;  2RV8 A;  1XSV A;  4JE9 A;  1QZX A;  2R7F A;  1PDN C;  4KIT B;  1PUE E;  1OKK A;  5DCM B;  3JRI A;  1MD0 A;  1PUF A;  1WWP A;  5H6Q A;  1GVJ A;  2CCY A;  3VFZ A;  2DQR A;  2G7H A;  3OYB A;  4S04 A;  2MGQ A;  3CQZ J;  5A6K A;  4LER A;  2DMQ A;  2VJ4 A;  3M07 A;  3UGO A;  1C17 M;  2XF5 A;  2Q9C A;  2IS2 A;  4ZLC A;  4XLA A;  2P61 A;  1DUX C;  2LG4 A;  4AYB N;  1NFO A;  1TFO B;  4BS9 A;  2W4M A;  5B3I A;  1WRJ A;  2XHK A;  5D5V B;  2HKO A;  4RM2 A;  4WWC A;  3RPQ A;  2M8G X;  3BTJ A;  3KE2 A;  3IQT A;  4UNO A;  5C44 J;  3GOD A;  4ZTJ A;  1Q0M A;  4MND A;  5DVW A;  2XLD A;  4KI2 A;  4MLO A;  3BQY A;  3O2P E;  3DCF A;  5DD8 A;  4ZZL A;  1APC A;  2B0H A;  4GXO A;  2R7S A;  4GYT A;  3WTZ A;  3DP7 A;  4E6K G;  2CGP A;  5ICE A;  5DTD A;  2VC9 A;  2Z2S B;  2GXB A;  3PQJ A;  3M4O J;  4WAB A;  4IJA A;  4AIJ A;  4P9F A;  3CC2 I;  1MH4 A;  3W8H A;  3ITF A;  2CV0 A;  1LE8 A;  2XGX A;  4WF2 A;  4JZA A;  5KCM A;  4YRV A;  1K61 A;  2NSG A;  4I3M A;  4FX5 A;  2MLK A;  4Y52 J;  2Q00 A;  1C02 A;  4IB4 A;  1FZP B;  1Y6D A;  2YSR A;  4HBL A;  5EK0 A;  1ORK A;  3RQ4 A;  3L2C A;  1TWC J;  2QYO A;  3A1Y A;  3GEZ A;  2E34 A;  3TUL A;  3VYW A;  1UST A;  3BCB A;  5CJ9 A;  2NS8 A;  2O3F A;  1ZG5 A;  2JUG A;  3QPT A;  4PUS A;  1BOB A;  2K4B A;  2ZME C;  4W1U A;  4LLL A;  1FYL A;  2JVG A;  3DE9 A;  3JCU Q;  5F5H A;  1XWJ A;  1E2X A;  1V5G A;  3T8R A;  3G1M A;  3R61 A;  1Z3X A;  3SYN A;  1TW2 A;  2XUB A;  3IAS 2;  3KP7 A;  3KCC A;  4E7Z A;  1IGN A;  1I5Z A;  3ASO C;  3TQO A;  3JSE O;  3ELK A;  5L3G A;  1WCM J;  2NUP B;  2HQR A;  2OZ6 A;  1OW8 A;  5CPR B;  2G7U A;  1VQ7 I;  2C03 A;  3EG9 A;  1Z3I X;  5HDN A;  2HKV A;  4DRH B;  3QP6 A;  3SZR A;  4AL1 A;  3BDD A;  2VON A;  4Y15 A;  1PV3 A;  3F21 A;  2GZW A;  5F64 A;  4ENJ A;  3NMJ A;  1RUO A;  4LOC A;  1ZR2 A;  2YHS A;  3N0T A;  3VRC A;  4A0X A;  1P4A A;  3AG4 C;  3HL2 A;  1SC7 A;  1G5Z A;  4XOT A;  3WG7 C;  2DT7 B;  5D92 A;  4A3E J;  2K9L A;  4B1R A;  5A6A A;  5ICC A;  2RSE B;  1EH7 A;  4GGG A;  3I59 B;  4HEA J;  3DTI A;  1ZGJ A;  3DV8 A;  4BUP A;  2XRL A;  2AQE A;  4P5O A;  4EQQ A;  3CCQ I;  4NNJ A;  3TJ6 A;  3I4M J;  1MJB A;  5AIP A;  5F04 A;  2KYH A;  2BC5 A;  2A6H F;  1UHW A;  1YJ9 I;  3HTU A;  2XVC A;  4CS8 C;  3BZC A;  2FBK A;  4BQN A;  3GX4 X;  2ZJ2 A;  1RUN A;  4AID A;  3BRO A;  1J59 A;  2XXA B;  5KYY B;  2AXL A;  1O3U A;  4IRU A;  3MAJ A;  1D3Y A;  1QKR A;  2QKM B;  1ZG3 A;  2G0E A;  3MCZ A;  5JLW A;  5LRR A;  3DKW A;  1AOY A;  2NOG A;  2FGY A;  3O6X A;  3GWN A;  4JTC B;  1MBH A;  3S16 J;  3M79 A;  1P4X A;  5GAE J;  2RVC A;  2LKS A;  5IOZ A;  3TOB A;  3S1N J;  3FBI B;  2TCT A;  3HRT A;  1T98 A;  3DTE A;  4GO1 A;  5AON A;  3WE3 A;  5M5X J;  4DYR A;  1OR2 A;  2EV0 A;  3HB9 A;  4MEY F;  2M64 A;  5JP7 A;  5F28 E;  3RW0 A;  5FO5 A;  1QVX A;  2HU9 A;  1D0X A;  3OOU A;  3UMI A;  4D5F A;  4EBK A;  2KIM A;  3AQB A;  3RZD J;  1BOA A;  2X1D A;  3RFY A;  3NKE A;  1WJF A;  5KVR A;  1T6U A;  2VPL A;  2NAZ A;  2YU9 J;  4PDK A;  3J7Y J;  1OKR A;  4KT6 A;  2P4W A;  1WJC A;  4A69 C;  2HZ8 A;  3GF2 A;  3LA2 A;  1SFX A;  2KKO A;  4GFB A;  4BXX J;  3BR6 A;  2LD5 A;  2QBY B;  4AUX A;  3Q7G A;  1JRA A;  2IGN A;  1SEU A;  3MKZ A;  1XCV A;  1LB2 A;  4KIS A;  1YE9 A;  1WAS A;  5KAI C;  3PM1 A;  2EIN C;  4JUR I;  2M7A A;  4JK1 X;  4CBE A;  3CDL A;  4IPA A;  3I4N J;  4WGZ A;  4HQM A;  4OMZ A;  1I3A A;  2WB1 N;  1KTM A;  1JHH A;  1BM9 A;  2M45 A;  3JRM O;  2IGO A;  3F9K A;  1AHD P;  1WWX A;  5A69 A;  2L5Q A;  1Z0X A;  4KMF A;  3QVZ A;  4D1Q A;  2DQL A;  2BGC A;  4E0H A;  2ELJ A;  2R7X A;  2FF4 A;  3RQF A;  4FAP B;  3HUG A;  5D6E A;  4V2G A;  4YK5 A;  3IWF A;  2ZXW C;  2DA5 A;  2FFH A;  4MQ9 F;  2FSW A;  5L0F A;  2ETH A;  3O39 A;  1XDU A;  1CPQ A;  2EPN A;  2ZME B;  2OTJ I;  1ZRF A;  2DA6 A;  3QOP A;  4JJG A;  2ID6 A;  2JVH A;  2EIL H;  3RZO J;  1BDJ B;  1ZHY A;  5AC5 A;  4IRI A;  3B0P A;  5BQG A;  3ZRG A;  3LUT B;  3WTX C;  4XR6 A;  2CUJ A;  4EM1 A;  3L09 A;  4HW0 A;  1JUS A;  4RB3 C;  2IT0 A;  2W4B A;  3S2H J;  5A6B A;  4L5E A;  4C7O B;  2NSF A;  3CJQ B;  3HGG A;  1J0R A;  2FOW A;  4I0B A;  1GXQ A;  3JRE A;  1YO5 C;  1BI3 A;  1LPE A;  3EH1 A;  4M72 A;  3IEE A;  4R1H A;  5CI8 A;  1T39 A;  5E20 A;  2PBE A;  4BPM A;  5KYX B;  2QSH X;  2FUG 2;  4P6I C;  4U87 A;  2P7C B;  3SFI A;  4WJ0 A;  5HDG A;  5J1U A;  3FOO A;  2FRH A;  4B48 A;  3CCE I;  3DBH B;  2F22 A;  1KU3 A;  4LG0 A;  1F4K A;  1CGN A;  4C9Y A;  1S6L A;  3FHN A;  3MZY A;  3GEH A;  3M1C A;  1Z9C A;  2HOA A;  2QUF A;  1QBJ A;  3CMM A;  5FLM J;  4KMU X;  5ILU A;  1K4T A;  2H7O A;  2XM4 A;  4UV8 A;  1FIP A;  2KFD A;  3DXJ F;  1MQV A;  1FLI A;  1S05 A;  3U2M A;  5IYC J;  3SYT A;  4F3Q A;  4V19 K;  2UUH A;  3JZ0 A;  2IEK A;  4Z9J A;  3G71 I;  3RIP A;  2P6S A;  2IBF A;  1YS6 A;  2ZJR F;  4RGR A;  2M34 A;  1YA7 O;  2VAS A;  4PSW A;  5E3N A;  3C2G A;  1U5T A;  4K1O A;  3LSG A;  3DBL B;  1KQ8 A;  3EPV A;  3CZ6 A;  4CZZ A;  3ZQY A;  2HVR A;  3PFY A;  1BZ4 A;  3LNR A;  3PNV A;  4PJ0 C;  1T0F C;  3B73 A;  3CJT B;  1A41 A;  2L02 A;  3LLI A;  2MHR A;  1STZ A;  3BTC A;  2A3S A;  2XC7 A;  3RKQ A;  2VQL A;  1JKQ C;  2E2J J;  1TL8 A;  4I98 B;  4I2O A;  4C3E A;  2DPU A;  2EBI A;  4W97 A;  2V3C C;  1ZN2 A;  2C04 A;  2DO7 A;  2XKO A;  3F8C A;  4E7H A;  4RDA A;  5EGY A;  3CME I;  1KU9 A;  1KZH A;  2EWN A;  2P5K A;  2WY8 Q;  3I4P A;  4XK4 A;  1VQM I;  1VLT A;  4AWX B;  3TBI A;  3HNI A;  1SFE A;  4MQV A;  1S9H A;  1R5G A;  1ZGW A;  1APL C;  4U5C E;  2DOD A;  2JD3 A;  3R7C A;  3P5J A;  2O7O A;  2DN0 A;  3FVY A;  2ZXH A;  2HVQ A;  3D5L A;  1UHM A;  3MKL A;  2X6O A;  4CIP A;  1I50 J;  4CCK A;  4AK9 A;  2F4O B;  4NC3 A;  4CYD A;  1Z5Z A;  2CYD A;  3S28 A;  5IT9 K;  4MNU A;  1FP1 D;  4C30 A;  1OQY A;  2CUE A;  3W8I A;  2GQQ A;  1FYM A;  1GUU A;  4IHT A;  1WJB A;  2CNW A;  2HS5 A;  1O87 A;  1NZE A;  1XDS A;  4FWV A;  4BHB A;  3K1N A;  3E97 A;  1SD6 A;  3N97 A;  1DPU A;  3OIP A;  3O3K A;  4U7B A;  2WC2 A;  5BPI A;  2W00 A;  3J7A O;  2KC3 A;  3GM3 A;  3E6B A;  4EM2 A;  2LP4 A;  2Q9A A;  3CLO A;  3L8I A;  5HOO A;  1EV7 A;  3LWF A;  4WK8 F;  2H8R A;  1BC8 C;  1WGW A;  4IRG A;  5L0H A;  2GWR A;  3ABK C;  3DM9 B;  2JMW A;  2ZD9 A;  2CW8 A;  4L5I A;  4YIR X;  2DK5 A;  4E7K A;  3FAP B;  4B4C A;  1MBJ A;  5DV5 A;  1U89 A;  4G6D A;  3H2V A;  4MTD A;  3K1H A;  3K7D A;  5TJ5 E;  4CDA A;  3GO5 A;  2CFO A;  2H6C A;  3LNM B;  1FOW A;  2W48 A;  2DFH A;  2X1E A;  3FM3 A;  2QQ9 A;  4IL6 C;  2K9M A;  1UZC A;  3L0I A;  5E2Q A;  4A12 A;  2OU2 A;  2ZXO A;  3S3M A;  2M4G A;  1VQ4 I;  4JW1 A;  2P1A A;  5AGF A;  2WBM A;  1JJ8 C;  5HNH A;  4KJZ A;  3I58 A;  4LMY A;  4NHJ A;  1XSD A;  5FLV A;  2IAI A;  4XEK A;  4YT5 A;  3US6 A;  2IPQ X;  4XID A;  3IRQ A;  1IN8 A;  4EJT A;  2C6Y A;  3FDQ A;  2CG4 A;  2KNH A;  2O8X A;  1BC7 C;  3U2R A;  2ME0 A;  2GOM A;  3TDZ C;  2HFI A;  2DU9 A;  2V7F A;  3A4C A;  1MKM A;  3OYC A;  1HW2 A;  4EVI A;  3CCS I;  1Q0K A;  3FXL A;  1DQU A;  3CCL I;  3CP2 A;  3CF5 F;  1NLX A;  2PX0 A;  4RBN A;  4KNY A;  5L0D A;  2X48 A;  1DPR A;  1X3U A;  1H8A C;  3F47 A;  4GQH A;  4OOI A;  1NSG B;  4XOR A;  3C8G A;  2KDO A;  4H4K C;  5L3F A;  1TT5 B;  4A3M J;  5KYW A;  3J06 A;  1HE1 A;  4BEH A;  4FTH A;  1JE8 A;  1JT0 A;  5L3D A;  3VM6 A;  1IN5 A;  3GFM A;  2LD6 A;  2XPW A;  4CSA C;  5GPA A;  3IQ5 A;  1WI9 A;  2YEV A;  3ASN C;  4KBL A;  2Z1D A;  3RI4 A;  3GTK J;  4UUS B;  2EA4 A;  4UDV A;  5K7Z A;  3FK7 A;  3Q0U A;  4U7D A;  1J7K A;  2FEZ A;  2CRG A;  3HHG A;  4C2T A;  1ZH5 A;  3DKX A;  3H9J A;  3K4J A;  5K1Y A;  5FD6 A;  5B5E C;  2HSB A;  2OG2 A;  4EJO A;  3TK0 A;  4NTB A;  1XMK A;  1VTM P;  2RD9 A;  2QWW A;  2F4M B;  3A9C A;  3AFH A;  1V4R A;  1A7D A;  4MTE A;  1Z7Q c;  3CQZ A;  4KIC A;  4OIP F;  3DQV C;  4FIS A;  2OV7 A;  2VQG A;  3FBN B;  4A93 J;  2DB4 A;  4K0D A;  1S8N A;  4LK1 F;  4CCL A;  3R6S A;  5KHD A;  5COF A;  1VQ8 I;  2XAQ A;  1U3E M;  2NYX A;  1ZHZ A;  2AO9 A;  4Z2Y A;  5M3M J;  1OR3 A;  1VMA A;  1SVM A;  3SDG A;  4EAT A;  4W8P A;  1GVD A;  4F92 B;  1X4O A;  3ASO H;  3ZTM A;  3HOW J;  2LYC A;  1GM5 A;  2EPF A;  4G8X A;  3Q6N A;  1DP3 A;  2L9R A;  3F72 A;  4M3D A;  4LIT A;  5C4J J;  2YLI A;  3G73 A;  1WQ2 A;  4OAY A;  4DNC A;  3EGX A;  5H2F C;  3BEH A;  1FOX A;  1ZLK A;  5FRM A;  4CJO A;  3I53 A;  4KNV A;  4M3F A;  1FTS A;  1T9K A;  3K70 C;  3AG4 H;  2J45 A;  1R22 A;  1TWC A;  4HDV A;  2JA8 J;  4YT8 A;  3WG7 H;  3GTM J;  2BYV E;  1UFM A;  3RKX A;  2LCH A;  4M9S A;  4ZC3 A;  5ILV A;  5CLS A;  4U0W A;  1R4N B;  4HX7 A;  2RRE A;  2HYF A;  2EIM C;  2FD5 A;  2EZL A;  4NUB A;  4XQF A;  1QPU A;  4JTD B;  1ZU4 A;  5T3T A;  3K4K A;  3HRM A;  2ZKZ A;  4L18 B;  1U78 A;  1D1A A;  1FBU A;  1BR2 A;  2LK2 A;  4DRJ B;  2IOQ A;  2VE9 A;  1UG0 A;  5A2Q K;  1XZQ A;  3DAG A;  3JRT A;  1LI7 A;  2ZNZ A;  2WWY A;  1UCR A;  1RCP A;  2YUS A;  4B3X A;  1U2W A;  1X1B A;  3QW0 A;  4LGW A;  1EF4 A;  1KU2 A;  3MX3 A;  3W4Y A;  2HUJ A;  4BQQ A;  1VOM A;  2H1K A;  3ZGK A;  1IV8 A;  1N78 A;  1MBF A;  2LFB A;  3KP4 A;  2Y3H A;  3QP5 A;  3P9C A;  2Q3T A;  2WAQ A;  4NY3 A;  3ZN1 A;  1PD1 A;  1WGX A;  2CV1 A;  3ZOB A;  3G4X A;  1FOY A;  2WVQ A;  3QZC A;  3QYE A;  4AVZ A;  1K79 A;  1HOM A;  1V4A A;  2Q9B A;  5D5U B;  1RKW A;  4ESF A;  2JQ7 A;  3PCV A;  1W5T A;  4N4N B;  2E1C A;  4O6N A;  1J9I A;  4XSZ F;  3WTS C;  1I39 A;  1L3L A;  4IGG A;  2BEO A;  2CWE A;  3B9Q A;  4LB6 B;  2EFW A;  2R7V A;  2LBF A;  4N0B A;  2PFD A;  4OIN F;  3AKZ A;  1OW7 A;  3DMD A;  4W8K A;  2ZXP A;  4G12 A;  2AU5 A;  3K4B A;  1FX7 A;  1XGN A;  4HLY A;  2KRH A;  4P1W A;  3N24 A;  4F55 A;  4AC0 A;  1D8J A;  2VT2 A;  5IT9 Z;  1LIH A;  4XTK A;  4MW8 A;  1U6G A;  1OMI A;  5KYU B;  4NC8 A;  1VYI A;  3RPU A;  4IAR A;  3MWM A;  2EIN H;  2G9W A;  2VXZ A;  2BY0 A;  3WHB A;  1H89 C;  2R7Q A;  4EGZ A;  3R4K A;  3GYH X;  1RNL A;  3F23 A;  3RQI A;  1GQA A;  3HIF A;  2DFE A;  4EBB A;  1X3W B;  5DDG A;  3HYI A;  1OXB A;  4PFO A;  3JW4 A;  1HW1 A;  2NUP A;  1BIA A;  2AXT C;  1LNW A;  2ECC A;  1T2K A;  1WOL A;  1E86 A;  2EJR A;  3ZMZ A;  3B6A A;  1A6Q A;  3E5X A;  1KQ9 A;  2ZXW H;  1ZQ3 P;  4BJ6 A;  3IWZ A;  2HWV A;  2VKE A;  5HDK A;  2E19 A;  1EJ9 A;  3NG1 A;  1ZR4 A;  1QRY A;  1G8X A;  1R1T A;  5LHI A;  2JN6 A;  9ANT A;  3MFK A;  1TQP A;  3QW1 A;  1TWG J;  2XPU A;  2ETS A;  4JOM A;  2RNG A;  3KH2 A;  5TRD A;  2Y69 C;  3GTQ J;  2HSQ A;  2V4J C;  3B71 A;  3LFK A;  4PGH A;  1X1D A;  3H92 A;  3FMQ A;  4BHC A;  5T1D B;  4GDF A;  2BHZ A;  3FOP A;  3T6G B;  3EDP A;  3TW7 A;  3K1I C;  4Y3O A;  5F0F A;  3B0U X;  4I0A A;  1LI5 A;  4XIC A;  3ESW B;  1J8Y F;  3UNG C;  2PBI A;  4M63 A;  2XL6 A;  2A05 A;  3LSI A;  2XXA A;  1C03 A;  2CS3 A;  4MVM A;  2XB0 X;  3CJR B;  4CYC A;  4XN3 A;  1IJW C;  4A3B J;  1M2V B;  1YTY A;  2WZF A;  2JT1 A;  4AD9 A;  3KET A;  4HNV A;  4LIU A;  1ZU5 A;  5KNL A;  4ZYG A;  2WY7 Q;  3ZMV A;  3LAJ A;  2HVS A;  2HZD A;  2IS6 A;  1QHH D; 
#chains in the Genus database with same CATH homology
 2ICW G;  3KPH A;  2OJE D;  1R5I D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...