3KPHA

Crystal structure of mycoplasma arthritidis-derived mitogen
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
196
structure length
196
Chain Sequence
QNLNNVVFTNKELEDIYNLSNKEETKEVLKLFKLKVNQFYRHAFGIVNDYNGLLEYKEIFNMMFLKLSVVFDTQRKEANNVEQIKRNIAILDEIMAKADNDLSYFISQNKNFQELWDKAVKLTKEMKIKLKGQKLDLRDGEVAINKVRELFGSDKNVKELWWFRSLLVKGVYLIKRYYEGDIELATTSDFAKAVFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Mycoplasma arthritidis-Derived Mitogen in Apo Form Reveals a 3D Domain-Swapped Dimer.
pubmed doi rcsb
source organism Mycoplasma arthritidis
molecule tags Immune system
molecule keywords Superantigen
total genus 73
structure length 196
sequence length 196
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-11-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.530 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A mam-mhc complex, Chain D, Domain 2 3kphA02
1.20.120.390 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Hla class ii histocompatibility antigen, dr alpha chain. Chain D, domain 1 3kphA01
2ICWG 1R5ID 2OJED 3KPHA
chains in the Genus database with same CATH superfamily
1XTAA 4WABA 4OAZA 4M6XA 1GQAA 4N9HA 3KH2A 3CCRI 4ZYHA 1MNMC 4XK4A 4IZZA 4HG2A 4M3EA 4IHVA 3PNVA 1B72B 5EG0B 3F23A 2FNAA 3LSIA 5M5WJ 1ZZPA 3K69A 3CQZA 2L02A 1W7PA 1K83J 2FOWA 4CDGA 5HSWA 4D7MA 2XAFA 3ONQA 4B3XA 2DTRA 1OCCH 2IA1A 4PFOA 4XSZF 2DPDA 1IZMA 4CYCB 3GTGJ 3RH3A 2RNGA 4OAYA 3VF0A 3ZQLA 1ORSC 3LSTA 5E3NA 1HW1A 3FVYA 1STZA 3L2CA 3HOVJ 3EUKL 3QP5A 5ED4A 5E1WA 1OLTA 4F52A 3HIFA 1QBJA 2DA6A 4GRIA 3ELKA 3PIOF 1PD0A 3RI4A 3QOPA 2UZKA 4IPAA 3RQFA 2V26A 2OG2A 4PJLA 5LRSA 2FGYA 2OBPA 2WB7A 2P6SA 2OCEA 1E0EA 2DODA 1H88C 2LG4A 1DP7P 2A07F 1IGNA 2MBFA 3ABMC 2OPTA 5IPAA 2ASRA 3WHCA 2WZFA 3WODF 4U87A 2YL1A 4G7OF 4FHTA 2PBIA 4E18A 4G6QA 5HNFA 3ISPA 4IAQA 1MKMA 4RB3C 4LIUA 1E17A 5FD5A 2Y30A 2LK2A 3C8GB 3CJRB 1FYMA 3TO7A 4A6EA 2KT0A 3OS2A 2VJJA 4AIKA 2AHQA 1K05A 2NUTA 4R1HA 2GFHA 2M0CA 4N4NB 2XAJA 1YFHA 1YIJI 3L8JA 5BS6A 3X2QC 2CNWA 3COAC 2AWCA 2J5OA 4Z9IA 4O6NA 2MWQA 4F3QA 4A3LJ 4RGRA 3OL4A 5HLGA 3GFLA 4I3MA 4B1RA 1A7VA 2E1NA 3FMQA 3ECSA 3CTAA 3F72A 3E70C 2X4HA 5AIQA 5LRRA 1JOGA 2XSJC 2X51A 3OIQA 3EGXB 2QKMB 1OKRA 1IRZA 2NAZA 3HSRA 4RAFA 5IYCJ 2A69F 2OCCH 5GAHJ 1E3PA 3QYFA 4BL0B 1ZHYA 2CU7A 2ECCA 3LL7A 1S72I 4IJJA 5HLTA 5TJ5E 2W9YA 5F28E 2L81A 2GXAA 4E0IA 1Q1VA 3DJNB 2JZYA 2VQHA 4JCZA 1U89A 1GS9A 3EPVA 4YL0A 1KA8A 2X9DA 4A69C 1TR2A 1D1AA 1LE2A 2FFHA 5L3FA 1ON1A 2FMLA 1WASA 1ZHTA 3GYHX 5AC4A 1G8XA 4H4KC 1W36C 3UKGA 1ORJA 3GEEA 2VC1A 4WWCA 1APLC 3CJQB 1TT5B 4I1MA 4XLHA 4KDPA 2HV7A 1K61A 5FFXA 3C18A 1SD4A 1EV7A 1O4XA 2K3PA 1BL0A 1K6OA 3QTHA 5L3BA 1OCZH 3DPUA 3ZGKA 1WQ2A 3IQTA 3U9MA 3SHFA 1FYLA 4MGRA 1VQ6I 1Z0XA 4XKCA 3S1QJ 2KYHA 4FWVA 2ESNA 1WTYA 2K7LA 3RF3A 3VM6A 3CJTB 4EJOA 2CFOA 2NUPB 1Z3YA 4LJZF 2IAIA 1GT0C 4FAPB 2JRMA 1NZEA 1LDDA 2E7WA 3JYHA 4AVZA 3PSFA 2P0NA 3K1NA 2ADUA 1Q0GA 1ZHFA 5DD8A 1CPRA 3JRBA 2LY1A 1LE8A 5LEJA 4JTCB 3T6BA 2DJIA 4BHPA 3CLOA 3ML6A 2DA2A 2DOEA 4LG3A 3S17J 4KI2A 3VYUB 2G7UA 5BPDA 4OD4A 1FNNA 2JMWA 4EM2A 4A3EJ 3EH1A 5C44J 2HUJA 3ZTZA 3LAPA 1HMOA 2ELKA 1IN6A 3RW0A 3FF5A 1V74B 2HDWA 2XGEA 3PQJA 3HEFA 3S1RJ 1NU9C 1QZXA 4BJTA 1YJ9I 2QGUA 3IHUA 2CYDA 4G6TB 1A0BA 2MC4A 3K1MA 2XRLA 3AL0B 4RDAA 2LF7A 1P2FA 3KCCA 4PUSA 2Y3BA 5DVWA 1JAFA 3FX3A 2I5UA 4JTAB 3TOAA 4DJ9A 3CCSI 2ZMEB 4EJWA 3R2PA 4CIPA 4IAOA 3HOYJ 3Q6MA 2KJGA 2H7OA 3FZVA 4XONA 2OZUA 2O8KA 4KJZA 1C02A 2D4UA 5K7FA 3DEWA 4BEJA 3TO9A 1VQKI 3LSRA 1Y4CA 1U8BA 2OV7A 3NKDA 1ZKGA 2Y0SN 1SFUA 3A02A 4DBQA 4ETSA 2DDBA 3FMRA 2P4WA 3LNMB 2ISZA 4PZJA 1AEPA 2YU3A 5COFA 2YZSA 2HFHA 4KICA 3GCMA 4AE4B 2L7ZA 4CDVA 2OU2A 4M72A 5HS9A 3SDGA 3AFHA 3O6XA 4AIJA 1ZR2A 4J30B 2YX7A 3OS1A 4J19A 4G6DA 3K4CA 4IQJA 4AUXA 2XDVA 1MQVA 3B71A 3N97A 5L3VA 5IYDJ 3R0JA 1YQAA 4ESFA 1JTYA 1LVKA 2ZSIB 2Q4FA 4U5HA 2HTJA 1NG1A 3L34A 1J8YF 5KAIC 5CVRA 3F8MA 2K9SA 2GM4A 3GFMA 3W6VA 4BBRJ 1GUUA 1BJAA 2PX9A 3MKZA 1LDJA 1UFBA 1C17M 3M8FA 5B5EC 2JT1A 4BXUA 2Y3GA 2Q7RA 4EWCA 3BPXA 3FXOA 5E1XA 3JTLO 1UG2A 1ZGWA 4C3JJ 3DI5A 3WG7H 2Z99A 4PSWA 5J1UA 4AYBA 3MFNA 1YLMA 2WL8A 1IRXA 2R7QA 2CQXA 3KYIA 2OOCA 2QENA 2OJQA 4LACB 2ME0A 5E79C 3CMMA 5EHHA 5A2QK 5FKMA 2W7NA 1WJCA 3IH3A 5L0JA 1H7IA 1LS4A 3L9FA 4I44A 1YDIA 2Q9BA 5L0CA 2L9NA 1LIHA 5E3CA 5DS4A 1WHUA 3R60A 1EJ9A 1XGOA 2DXIA 4CDAA 2NVTJ 2VQGA 2VT2A 2XROA 3HXLA 2XF6A 3X1OA 1VMAA 3EG9B 1UHWA 1R5GA 3PQKA 2HSBA 2RKHA 3N0TA 5L0FA 3LLKA 3S93A 4IHTA 4B3AA 5CIVA 2O7OA 5DQTA 3SEQA 3CC7I 5JFRA 3HPGA 1YG2A 1JKOC 4D5FA 3I56I 1T6SA 2XLVA 4MVMA 3JAMZ 3HJCA 1X1CA 1OKKD 1OR7A 2XAGA 4A4AA 3GWZA 4RM3A 4BGDA 2UUIA 3VEPA 1J0RA 3MCZA 4NNJA 2L54A 2J7PD 2DMTA 3I53A 2Z9OA 3L8IA 4B47A 4Y52J 1RZ4A 2EPMX 3U9GA 1J75A 4C3DA 3S2WA 4YL1A 3RKWA 5H2FC 1SFEA 4HQMA 4IX7A 4WGZA 3EJNA 2EZIA 4X0RA 1XZQA 1OXBA 4EIYA 1XSVA 2DT7B 4P9TA 2X6YA 3U2MA 2GWRA 4D5CA 3J7AY 3LSGA 2DA7A 2KGOA 2AO9A 1JPNA 3S3NA 3NKEA 2VC9A 3R61A 2P6TA 2ZNZA 3GF2A 4XIDA 2PEXA 4CYCA 2KDOA 1MNEA 3BR5A 2CV2A 1QPUA 2TCTA 1NG6A 2BY1A 1Y8RB 2J9WA 2HPMA 1B8IA 1D8KA 1H0MA 3LJBA 2OQGA 1KGSA 2UWMA 2EH3A 4ON0A 4V2GA 2BEOA 1K78A 1OW6A 4XEVA 1ZW2A 3RDIA 2WVQA 3RKYA 5T3WA 3OYNA 3M07A 3B0VC 4A0XA 4MO7A 5JLXA 2NVXJ 1U2WA 2G3KA 1KU9A 3TO6A 3WAQA 1X3UA 4XBFA 2NS8A 3C2BA 2OZ6A 4C9YA 3CMAI 2VQCA 1YJWI 2CCYA 2IOQA 1IV6A 4X1EA 1ZGJA 1RJ9A 3G1MA 2J8WA 3U1KA 4U0YA 3QWLA 1VB5A 1LM3B 2CRGA 1FJLA 1I39A 2YL3A 2H6BA 4MW3A 4P55A 4XWJA 3ZQQA 1UMQA 2J5PA 2L6GA 5L0HA 4U7DA 2M64A 5DS5A 4XNFA 2PMZN 3K4BA 3ZMZA 3GTOJ 2L4MA 3OYLA 4YIIA 1G6NA 3ZMSA 3DPLC 2ACJA 2R7ZJ 3LEVA 2KMUA 3FHZA 3ZPLA 4JZAA 4QLCU 3EHNA 3K7AJ 2KDZA 1MMSA 1XD7A 1CGME 2QE9A 1H8AC 3LSHA 1FLIA 3HNJA 3BEHA 2B0LA 1L0OC 1I3QJ 5EEGA 4CCJA 4XM3A 2AXLA 4IRIA 1I50J 2PJRB 1IDZA 2PX3A 4KIBA 5L0DA 4N6CA 3SP1A 3HPHA 1T56A 1R1TA 3KKBA 1S5LC 1L3PA 3POVA 2XRNA 1OCCC 2IXMA 1XSDA 5K7ZA 4L0ZB 3M79A 1Z21A 4AIDA 4L9JA 3J7AO 1XWJA 1WH5A 3GZ5A 3JSZA 1GHCA 2OF7A 3KYJA 4IRGA 5JLWA 4J00A 1BDJB 3RPQA 3DLLF 1T95A 1LFPA 3V7CA 3S28A 3HB9A 3K9TA 4M6YA 1JJ8C 3MBGA 3S8PA 2H1LA 1TQIA 3W2AA 4G9YA 2B0HA 3SZPA 4AX2A 4BJ5A 2BY2A 4UB8C 4G7ZF 2DGJA 2GAUA 4W1UA 3RYLA 1UFMA 2H6CA 4Q4ZF 1WN0A 2QQ9A 3HOXJ 3OS0A 1SZIA 4ENMA 2LVSA 4IRHA 2ZXWC 4IEJA 3ZP5A 1RKWA 2EV0A 1BBHA 3W2WA 1LQ1A 1RKTA 1GDTA 3E5UA 2JSCA 4I0AA 1FSHA 4UUSA 1T38A 3M4CA 3HOSA 4MW8A 4XSXF 4KFCA 1R5ID 4XOTA 1WOLA 1LKXA 1X1AA 1G4DA 4OIOF 2AWYA 1IF1A 2JUCA 2GIVA 2VKVA 3KP2A 2LY9A 3NAUA 3PUFA 4LK0F 4PK4A 5GADJ 2NOJB 1AOYA 2NPUA 3BTIA 4MFEA 2JPBA 2TDXA 2CS3A 3T4RA 4MTGA 2FAPB 1A35A 3GXOA 2PFBA 1U78A 3L00A 3C3WA 2HEOA 1SR2A 2H7VC 2NSFA 1Z91A 4XQFA 2X1EA 1RR8C 5LBQA 2A6TA 2L9RA 2XRHA 1R58A 1ZELA 3UNGC 1ZU5A 1SMYF 1KTMA 4D9JA 2M45A 2W45A 3C7JA 3K1PA 4OIQF 1CPQA 5IYBJ 1E85A 1S7AA 1R00A 3K4KA 3JRIA 3RYPA 3V4GA 3TDZC 4W8PA 1VOMA 3W6JB 2EA2A 1M1EB 1SFXA 1XDUA 2CUJA 3WGGA 1OW8A 5D5VB 3BR3A 2DMNA 2GIZA 3AAFA 3V5XA 3K6GA 4RBOA 2F5VA 1TWGA 4Q47A 2EZLA 1J5YA 2OU6A 2XLDA 4WJ0A 4ZTJA 3ZQYA 3EPZA 2CO5A 2KZVA 1W5TA 5IOYA 1UHSA 3RQ4A 4LLCA 1S8NA 2NVQJ 2VXDA 4BY7J 2DA4A 3TQNA 4AYBN 1CGNA 1MDMA 1HE9A 1OKKA 3O55A 3GEHA 3K4MA 2ETSA 2RDPA 1ZARA 4E7IA 1YYXA 2STWA 2A0UA 4BKXA 3SZRA 4XKWA 2QA4I 4BNCA 2KIQA 2QM3A 4IHXA 1J8MF 5JSLA 1BZ4A 3CLQA 4RGUA 2ZNYA 1NTCA 4HLYA 1CGOA 4D7NA 1U6GA 3CUOA 5L3EA 2DBBA 3IRQA 2BW3A 1WSUA 4I02A 3PNYA 3ZQCA 3JRHA 1R4MB 4B8XA 2XM4A 1LDKB 4GO1A 4P1WA 2EIKC 2MG4A 3K4NA 1JKQC 1VQ5I 1QVUA 2PP4A 4ESJA 4IRUA 3RZOJ 3FOOA 5JT4A 1R9TJ 3KLNA 1K79A 2W4BA 2WAFA 3TULA 1HSJA 5BUOA 2H09A 3HOTA 2WAQN 1DGRM 1TWCJ 2BZTA 4NQWA 3OOPA 5FCLA 2NNNA 3G4SI 2TRTA 5FKNA 3I5UA 2PMUA 3I55I 2BY3A 2R7UA 5JUAA 2FD5A 5E3MA 4N06A 1FAPB 4G0HA 5BQHA 3CDLA 4CXFA 3L0IA 3RFYA 4PDKA 4CCKA 4YIFA 2HVSA 1RRJA 1H6GA 1PD1A 1REPC 3E6BA 2AQEA 2EPLX 3WGHA 2L7AA 4EATA 2IXNA 3DTKA 1ST6A 1FBSA 3CSKA 3GLLA 1E2XA 4NC3A 3N05A 4QIWN 1G4WR 3K70C 2IGKA 3DKWA 4HF1A 5D92A 3PDMP 4GCVA 5FGMA 2E5NA 1NG7A 3G1LA 5K5QA 2QCOA 3BJ6A 5J8CA 1XZPA 2Y3HA 4IHWA 4KT5C 1H9GA 1TNSA 2CYYA 4XL9A 1YTYA 1DUXC 1QRYA 3EGDA 1NU7D 3F47A 2VJ5A 2ZXHA 4M74A 4QPQA 3CCLI 2HR3A 2KIMA 1JI8A 2HYFA 4IL6C 2PFDA 2YL7A 3LWFA 4MVQA 1IDYA 3K7DA 1TLHB 3HRSA 3RPUD 4AK9A 1Z77A 2CDQA 1QNTA 1RI7A 3Q9SA 4BPMA 1OW7A 2XAHA 2XB0X 2YS9A 1B68A 4R32A 1R7JA 1S3JA 1YA9A 2E87A 3IV5A 3JW4A 3TOBA 3I5PA 4Q48A 1TW3A 5AONA 3DP7A 1ZN2A 5LEKA 2UUZA 2F5EA 3BQYA 1B1BA 2LKSA 4M9XA 3JRAA 4HA8A 2D1HA 4WXDA 2R0QC 2IS2A 3GWNA 4XORA 2XHKA 3BG9A 1WVRA 2VE8A 1MJ9A 2RNJA 4P9UA 3HNIA 1ZG3A 2FQ4A 3DV8A 2BVMA 3IUOA 3AKZA 2V7FA 2F22A 3E6DA 2J0WA 1VLSA 4FASD 4CS9C 1WGXA 4A3BJ 3DD7A 2Y48A 4IHYA 1IUYA 1G3TA 2WVOA 2YHSA 5LHHA 2VE9A 1DPUA 4E6KG 3U0CA 4IHSA 2ELJA 3A0HC 3MAJA 3EDPA 5JHFA 4C30A 4I1OB 2IBFA 3H3VK 2J9BA 2VKDA 3HSEA 1JT0A 2MW8A 4Z9HA 1SFKA 4V2FA 3VYRB 2NUTB 5A6KA 2WV0A 1HMDA 3CF2A 2IA0A 1P4XA 4JRZA 4JYKA 1ULYA 2OA4A 3OSFA 2VOOA 1Y6DA 2EZKA 1B8IB 3WU2C 1A6QA 5B3IA 1VZ0A 2FRHA 3RCOA 3JSOA 2QUFA 4A0YA 4I76A 3GTPJ 4HNVA 1UAAA 3RKQA 2EILC 2QUPA 3ITFA 2Q3TA 4M9ZA 3H2VA 2CW8A 2BYVE 3A4CA 1EA8A 2VB6A 5HDKA 2RREA 2CQKA 4DZJA 4MVRA 1O7LA 4U5BE 1NHAA 2LD6A 2MLKA 3F6VA 3E97A 1R22A 1OPCA 3U1DA 1ZQ3P 2BHYA 4XN0A 3QU3A 4HF0A 1QHHD 1OCRH 2H7BA 4PR9A 1XDSA 4U5DE 3CDHA 2MGQA 5FJ8J 3DU6A 3CCJI 2IS1A 1M6TA 1TNTA 4BJ5C 2XLMA 3B73A 1FOWA 4U9EA 2GXGA 3AG1H 2X0CA 2BVLA 3WG9A 3VB2A 4DOZA 2R7TA 3C62A 2O03A 2V1UA 1J59A 4G8XA 1X1DA 3OOUA 2LKPA 2XSEA 2DTZA 3Q9VA 3HL2A 4FE4A 2COMA 2EV5A 2HZDA 4ZYAA 2O9XA 3O39A 4EKWA 4E7LA 5D91A 3RTRA 3U8VA 2VL8A 2W84A 4M3GA 1KYZA 1BM9A 3RKXA 3F22A 3T6GB 3IQCA 1MZBA 3BG7A 5JRAA 4G12A 4XRFA 3GODA 2B63J 3ZQGA 4BQAA 3E5QA 2DK5A 3ABUA 1MSFC 3HHHA 4LLNA 2R7SA 3J80Z 3BR2A 4S04A 1OCRC 3MX3A 1GGQA 1JGGA 1OCZC 3CZ6A 4ZLCA 2NVYJ 2CUFA 3CESA 3SZGA 2ZBKA 4CSWA 1BC7C 2XV4S 4F91B 3HTUA 5K5RA 3IKTA 1YRNA 2F5DA 2OUMA 1ZG5A 1BI2A 2DFFA 2P5LC 4KN7X 2VKHA 2FXAA 2A05A 3IKVA 3T5XA 3Q6NA 3CMYA 3ESWB 4XLFA 1KQ0A 3CP2A 2BC5A 3RQGA 2YKZA 1QQIA 5K0IA 4Y33A 2XPVA 2R4GA 2IXPA 3ZMVA 1V5EA 2JA5J 4HX7A 3I9V2 2QLAA 4Z9JA 3X2QH 1P4AA 1IXRC 4GFBA 1VYIA 3ABTA 2IM8A 2R25A 3DAFA 3HYIA 3JRDA 1V3FA 1UCRA 4AU7A 4ZH4F 4NHJA 2DU9A 4BU2A 2P81A 3RQIA 2KK1A 3H1CA 2JPCA 3DWLE 3BOQA 4U0VA 3VFZA 3QODA 1TBXA 4JX6A 4NTBA 1QSPA 4JJFA 3FBNB 1RUOA 4A3KJ 4U0WA 4A3IJ 4JJGA 3TP3A 2DOAA 3RZDJ 1XX5A 3MEXA 2A5YB 3H9GA 3AG2H 1PV3A 3JZ0A 3CUQA 3HDDA 5ILVA 1V55H 2MFZA 1H9TA 2DB4A 2I8DA 1Z67A 4CDYA 1MBJA 5FO5A 3G73A 1LVAA 2FQ3A 1HQCA 3WU1B 1BBYA 2VXZA 2QVOA 2HMZA 1YJNI 2Q9CA 2M4GA 4HDVA 2WWYA 1M2VA 2E2JJ 2OAZA 4MLOA 2XC7A 3F6OA 4CS8C 3DWWA 3FK6A 1OYYA 3RPUA 2KRFA 4JP0A 2KNHA 3IH4A 2HVRA 2HSQA 2GLOA 5EZGA 3RJPA 4DW6A 3KFWX 5ICCA 3BRJA 5E2QA 1MJAA 2HXOA 3U3FA 2DN0A 3ZN1A 1ODDA 3OR1C 1T0FA 2QEXI 1MBFA 1B59A 4XPWA 5K1YA 3RKOF 4CSAA 3RVYA 3RSNA 2J7PA 2DYRH 5HVQC 1W7PB 2DJNA 1RC9A 1OMIA 4HW0A 5DUKA 2DDAA 3G6EI 1DGWY 2RAEA 3BJAA 2VONA 3ABLC 3O10A 5F64A 4AD9A 3OV8A 3CCUI 2O9LA 2PJPA 2D1VA 2YLIA 1WJDA 3NYJA 2GZWA 3U3BA 2E1MB 1U5TC 1V54H 4RS8A 3GUDA 4BXFA 4YFNF 2O61A 5GPCA 3LA2A 1KYWA 1PJRA 2LH9A 3DE8A 1FT9A 5E3OA 1XMAA 2WAEA 5DD4A 2W4MA 2WY8Q 1FP1D 4I0BA 1LI5A 5B1AC 1YARO 3HRTA 5EG0A 1CGPA 4NTAA 1U0JA 4FCYA 5HODA 2K02A 1FBUA 4K2EA 1U9NA 2KJBA 4EGYA 1NH3A 1D1CA 4D1QA 5FLXZ 2CGPA 1D0ZA 5M3MJ 5EK0A 2Z1DA 2DYSC 2KC3A 4I7HA 4E7KA 1S7EA 5LHIA 4C7OA 5E17F 2ISYA 1TQGA 2CUZA 3LFKA 1IRFA 1KZHA 5KYWA 1POGA 2IVMA 2LDUA 4CH7A 5D4RA 3NQOA 3H5AA 3W4YA 2D45A 3F8FA 5D4SA 4YL3A 2PG4A 4UHTA 5J1YA 2M0MA 2IBDA 3NWSA 3ZQ7A 4A3DJ 1IW7F 2MLGA 3A01A 1ACIA 2WADA 5JVTA 2X1DA 4U88A 2IEKA 4BH9A 1DQUA 1AVOB 2KIFA 1Z6AA 2JK3A 1D3YA 1XS9A 4NQWB 2L9JA 3NMJA 1BR4A 3EETA 3NYLA 2QQAA 4ABZA 4XKBA 3KZYA 3GM1A 1X58A 5A69A 4II2A 4IKFA 3HRUA 2FMYA 3OYBA 1G4US 3KP4A 1O5HA 3GM2A 2R7OA 2OTJI 1ERDA 4F55A 4ZTFA 2R5YB 3O6BB 2HKOA 3DE9A 3MN2A 3SYNA 2C03A 3GW2A 2EIKH 3D0SA 3M1EA 1JJ6C 1E84A 3GTMJ 3C8GA 3IWZA 4JC7A 3HRMA 3H36A 5KCMA 1R5HA 1RR7A 3GEIA 1TWCA 2Y69C 5DYMA 3G50A 2DA5A 1HBXG 4CS9A 3B0PA 2CQQA 2X85A 2PBEA 3HM5A 4JEAA 1Z6TA 2X6OA 4JE9A 2HQRA 3ASOH 3SZTA 1A5JA 3DJUB 4C3EA 4ASNA 3LA7A 2FNPA 1QLEC 2L7FP 2IP2A 3BR1A 4C2UA 2C6YA 4BQOA 4LLLA 3FXJA 5IY5H 3G71I 4GGGA 3I58A 2XAQA 3AJMA 4Y7NJ 4S0HB 1OCOH 1ZR4A 2EV6A 2PQ8A 3DZAA 1A36A 3M7GA 1TZLA 2CV1A 4LK1F 4ZJZA 2XF7A 5J3LA 4IO9F 4ULVA 4A3MJ 5E18F 2IXSA 1J09A 1FP2A 4F93B 2G0EA 3IAS2 4NY3A 1BI1A 2L2OA 4FX0A 3ZQFA 1TWFJ 5JR3A 3ZN0A 4Y15A 3PL8A 3JREA 4MEXF 1T6IA 4U5CE 3E7LA 4N4OB 1Z3IX 2DPUA 3QPLA 4JURI 5LD2C 1FOYA 2EFOA 4CZZA 2L6HA 1MDMB 2P5VA 2Y69H 3F46A 2ICWG 4CCNA 1MW7A 2JVGA 3EZHA 2M4EA 4ESBA 2Y0MA 2CW0F 2E19A 5CLSA 4JEBA 3A9CA 2XL6A 1N77A 3H5NA 4DYCA 2OD5A 1MD0A 1VQ7I 4NB5A 2J46A 5IOZA 3QAHA 4E7HA 4OINF 4OMYA 4N6HA 2V3CC 1YE9A 2JD3A 2H27A 1ZTRA 2M4KA 4MIMA 5BMZA 1IXCA 5EZHA 1VQPI 5CQGA 5ICGA 1D8JA 3JSEO 3MWMA 4KNYA 4QI2A 3U2RA 3FAPB 2LOOA 3FMSA 1LS1A 5HOOA 3H3UA 3W8IA 4IJAA 1D1BA 1AWCA 2V9VA 3IWFA 1P92A 4PJNA 3BG3A 1PUFB 3AQCA 4J01A 4L6RA 1NK2P 5BQIA 3FBIB 2KP6A 4DRIB 4JTDB 4CUGA 1LEAA 2WV1A 2DT6A 3QYEA 2LQGA 5IP7J 2JA2A 3NEUA 4BE2A 3H2UA 1LJ9A 1YRNB 1QGPA 3NMKA 2ZXWH 3ABMH 3L09A 1EKYA 5J4YA 2XLHA 3SNHA 2E36A 3P7NA 5JHUA 1IN7A 3JTHA 1VQ4I 3DBRB 2KW3C 2YVKA 3WTSC 2ZJQF 4HPQA 4CCLA 3FDQA 2A61A 2F4IA 2LNBA 1EQ1A 2WTEA 3V7OA 1BR2A 3S3OA 1USSA 4FE7A 3ZXSA 3C8GD 3LNQA 1OISA 1U3EM 4E7JA 3BTJA 1Z7UA 3FDYA 3GTJJ 1FSEA 2L9SA 1BW6A 9ANTA 2EILH 5CI9A 4PFPA 3LESA 1AHDP 1YO5C 2DFHA 3OWTA 4CHUA 4XLNF 1FMVA 4N0BA 2V9KA 1FZPB 3AG4C 2IGOA 5JI6A 2BXYA 4UUTA 4BJ6C 4J7TA 2V1NA 2IGMA 1G2HA 5F27A 3I59A 5GPAA 3GZ6A 1HW2A 2VBZA 1Z6RA 4KN4X 3CJNA 4UVAA 3TKYA 1I4YA 4C3IJ 3OEOA 1JGSA 3JTGA 3E0JB 2L7MP 1EKEA 4JX4A 4AVPA 1JHHA 4RB1A 5COGA 4DBRA 5AGFA 5EEHA 1GXPA 3JSPA 1S7OA 2ZJRF 3K1IC 2XPWA 3CCYA 3CP8A 2V6EA 3ZIBA 2KL4A 1JR8A 2ZXPA 2LY2A 1MNDA 5EDNA 2M9HA 3KP6A 4ENNA 2Y3DA 1DU0A 3WTUC 4YFXF 3F8CA 3KYLA 2LCHA 2LP4A 4EM1A 1RJ9B 3HKKA 3SQNA 3AGTA 2JA6J 1MBEA 4YN0B 3EYIA 3H0GJ 3J80K 5CQEA 3TEDA 2VH3A 2DA3A 5B3SC 5FLVA 4IF4A 4ZDOA 3MZHA 4Z6YA 3VODA 4O7GA 3E6MA 2W85A 5B1AH 4NTFA 1RNLA 1VQLI 3S16J 4CA0A 1GLNA 1RETA 4YG2F 3GM3A 5CI8A 3K2ZA 5HDGA 1XCBA 3C63A 3QPTA 4S05A 3DKXA 2V1XA 2GOXB 1OXKA 3WHBA 2AVKA 2JSPA 2XVCA 2HVQA 1BI3A 5KK1A 1VQMI 3B0UX 3OYFA 5GTHC 1VTNC 2MH9A 2CJJA 2ID3A 1TWGJ 5KYWB 1VLTA 5AC5A 3U5SA 3L2WA 3MFKA 2FBKA 1XPXA 3ZG1A 3OR2C 3O8HA 4MTFA 2NOGA 1WH7A 3M1CB 1M2VB 1JKRC 1DOWA 3LMMA 2WZGA 3DMDA 3PMRA 4FETA 3Q7GA 1Y56A 1Z3XA 1ORYA 2GA0A 3DFGA 2AXTC 3O2PE 1R49A 2YQYA 1T08B 3FXKA 4DXWA 2XSDC 2KPMA 4ZZLA 1SYQA 2YLDA 3I59B 5JVGF 3GANA 4F4BA 3ZWIA 2HQ5A 4H0EA 2M8EA 2MC3A 1L7CA 1YLFA 3BCBA 4JK1X 3PO2J 1T01A 2PN6A 2EIJC 5EJCA 4RD9A 3T6JA 4O79A 2ZXOA 2DAOA 1YYJA 1ZHZA 1U9OA 4KMFA 2W25A 2MA3A 1XGNA 3K2AA 3REOA 1FFHA 1FTSA 4GYTA 1BI0A 4IARA 4IGGA 4B48A 2K3FA 2R93J 1RMVA 1BR1A 3R0AA 3L2RA 1I5NA 2RVCA 2VBXA 3HBLA 2HQNA 3JRTA 1FIAA 2KFDA 2L4AA 5DDGA 3QRFF 5IT9K 3K4LA 3DBLB 2CW7A 5FLXK 2PLYA 3EZIA 2G9WA 1LNWA 5L3CA 2QYOA 3TL4X 1OYWA 3HUGA 4A3CJ 2IXOA 4EHPA 1Z63A 3QPSA 1K7AA 2LTPA 4HNUA 5F5FA 1Z7Qc 4PJMA 5FKOA 4HF2A 3K4JA 1I3AA 4R79A 4JW1A 2AU5A 2IPQX 5C4XJ 1FC3A 4QI0A 2X0LA 4BE0A 3RVZA 5CVIA 4KC9A 2EB7A 3O3KA 2YSRA 2EIJH 1YJGA 1JUSA 4M63A 3TBIA 3KP3A 3A01B 3KEQA 4BQQA 1MJBA 1RKEB 2HOSA 4LFUA 1TFKB 3ZQHA 2EFQA 1S9HA 2HWVA 3DM9B 4XQ1A 3S90A 4BAYA 2LYCA 4D4NA 4KITB 3CMEI 1ZRDA 3BT9A 4J7YA 3FWEA 2FOKA 5L0GA 2R7DA 1E86A 2F5CA 2E35A 1VFCA 4DGWB 1U8RA 2EPKX 1SD5A 3ZMTA 4OOIA 3ZCOA 3OY9A 2YEVA 2BE5F 3U9JA 2XL8A 4HOBA 2BW3B 3U21A 2L7KA 2ZFUA 3VWBA 2VT3A 2WZLA 4XN3A 2DMQA 4QTRA 2QBYB 4JKVA 3WU0A 2WA0A 1TWHJ 3ZOBA 3RIRA 4Y13A 3F0CA 1BJZA 2P5KA 3T1BA 1B72A 2MABA 1NK3P 2N8GA 2HQAA 4L9TA 5F0HA 2LIGA 4I98B 3ASNH 4MEYF 1V4AA 4EQQA 2IS6A 5M5YJ 2VIXA 5DCMB 5IT3A 4OWRB 3QVYA 3DTEA 4YK5A 1YIOA 3A0BC 3MKYB 4MS2A 5ERIA 1VNDA 3QZCA 4I09A 1P7JA 1YW9A 2KQRA 2AP3A 3KZZA 2LRDA 1Q0DA 3JRFA 1T8IA 4EJUA 5J1RA 4W8KA 1F1ZA 3EUAA 1D5VA 1AUEA 2RGVA 3DF8A 4HSTA 2VUMJ 1C03A 1XSXA 5D8KB 4LMYA 1OR7C 3E5XA 3ATPA 4ZC3A 1WCMJ 1T39A 4CJGA 3GTQJ 3M4BA 1O7FA 1KU2A 2W82A 4A6DA 1Z9CA 1LPEA 2ZFWA 3B02A 5IT9Z 2KQ9A 3LSMA 2LF8A 3WE3A 1VTMP 4MNUA 4I2OA 3IC7A 2F2EA 1K40A 3TW7A 3ZMDA 2MH2A 4BJ6A 2VCBA 3L2UA 2EPNA 1Y0NA 3VPRA 1A41A 3V8KA 1PP7U 1O87A 2F4OB 2GAQA 1SFOJ 4P96A 1HXDA 3ZTMA 2KJCA 1TW2A 4YEJA 2W24A 3DEEA 3B6CA 3PM1A 2R5ZB 1FBQA 3K0LA 2K9LA 1NLXA 2LFFA 3J81K 5EGYA 2W4SA 5KYYA 4HAMA 3FXMA 4HRIA 4Y3OA 1HKTA 1S6LA 1NFOA 2LK4A 1QZZA 1X1PA 3WGIA 5J47A 1W36D 3S15J 1JXSA 2UXXA 4GYIA 2J45A 3AOUA 4MVSA 1EH6A 5K5OA 1FTTA 4BHBA 5T1DB 2HOAA 4UV8A 4DQ2A 3E9VA 1J7KA 5LLQA 5F6FA 1T9KA 1R4TA 4XEKA 2UXNA 4BXXJ 4AL1A 4X0GA 1O3QA 4E0HA 4HZFA 4KNVA 2FJ1A 3FHNA 2OQRA 4L5EA 5LFAA 2LBFA 3GTKJ 3N2ZB 5DQZA 4ZLDA 3GEZA 5BNGA 3TGNA 1E3HA 5J40A 4A0ZA 2L5QA 5JS5A 3OSGA 5E33A 5HLHA 3MLGA 2L6FA 4YELA 1ITYA 4P9FA 4EBKA 1TWAJ 1ZHXA 5CVVA 1V5FA 4A3FJ 4D0PA 2QQBA 5KHDA 2M8GX 2CFXA 2ZMEC 2JQ7A 4PCQA 4IWBA 4MFDA 5HNHA 5CKTA 4CSAC 2G62A 3NWTA 2NVUB 2OQMA 3TP0A 4NBQA 1I1SA 3HNKA 4RBNA 3UGOA 4II3A 4DJAA 3ABKC 1I27A 1CF7A 3JRMO 1UELB 4U5FE 3LQRA 3BTLA 3KYCB 1GV5A 5A6AA 1JKPC 2W00A 1ZU4A 2XM0A 2DI3A 4JBAA 2BGCA 4YRVA 4IVNA 3JCUQ 3F8BA 2HKXA 3I3LA 2W1OA 4IXAA 1PVEA 1IZ1A 1XG1A 4RM2A 1R36A 4RB0A 4A3GJ 2ZCWA 2FF4A 1FNTc 1ETXA 4Q7CA 2OJED 4MTDA 4N9IA 1OQYA 1DU6A 4BEMJ 1HOMA 1Y39A 3S1MJ 4OU0A 2QSFX 4LIVA 4JCHA 2LP0A 4B4CA 1QVTA 2GA2A 4WK8F 1OQCA 2XLWA 2KRCA 2R5YA 3QMKA 5A6BD 3A03A 1USTA 1TP4A 4HFKB 4U5GA 5HDNA 4TV7A 4HX4A 1HE1A 2DO7A 3HUGB 3I4NJ 1YVIA 1ZYRF 1YHQI 3CDIA 5LGUA 5B1BC 1WJFA 4XMYA 3CCEI 4RLFA 3HHGA 1LI7A 4M3DA 2NRAC 1ZW3A 2XKPA 2HDDA 2PX0A 4BJ1A 1I4ZA 1QZEA 4BUPA 1TQPA 3EUHC 4M6VA 4XR6A 1N78A 3PUBA 1WJAA 2VLAA 1LEBA 3HKZA 4JX5A 3SXMA 2FX0A 1D0XA 1MGTA 5ICFA 5J6XA 3M3YJ 4ER9A 3SYTA 1ZLJA 4ZYEA 2RSEB 3DAGA 1XGSA 5F1RA 1BOBA 3HJEA 2P7VA 1IXSB 2E71A 3I4PA 2R7FA 2OC6A 4FT8A 2B7EA 3CUQC 4GEHA 4FESA 3HGGA 2RV8A 1CF7B 2TMVP 2HTSA 3PHF2 2HOEA 2ID6A 3PFIA 1Q0KA 3KP7A 2LSOA 3WG7C 3S0XA 2NS0A 3EH2A 3SFZA 2Q9AA 2PMHA 1IV8A 3WHNA 3T0YA 4CIHA 4L18B 2QZ8A 3CO6C 2EWNA 4UV9A 1W1WE 3BR6A 3NYMA 4CO8A 3KL4A 2ZJPF 3BQZA 2XAUA 2OTLI 4K1OA 1Y0UA 1X2MA 2ZD9A 1V4RA 3JT1A 5E1ZB 1TWHA 2E34A 1OCPA 2LMDA 3OYDA 4A12A 2YU9J 5FRNA 2VN2A 2EZHA 5FFZA 2Q2EB 2ZC2A 4HNTA 3OYJA 2QLZA 4EBBA 5CPRB 4EUKB 4UVBA 1IN8A 4NC6A 5LGTA 1HC8A 1MBGA 3FXQA 3CC4I 1ZVZA 2HZTA 2EFPA 2CQNA 2EK5A 3I71A 4A3JJ 3RQEA 4ZDLA 4RAGA 5DCFA 2OKUA 2Q8KA 2BHZA 2Y31A 4ZDPA 4EVIA 4B6IA 2M30A 1W0UA 1BA5A 3WTVC 3I5QA 2RC4A 2XLOA 4E17A 1W5SA 3F8NA 1XN7A 2ESHA 3FM5A 1OCTC 2GWWA 3TDUC 2K85A 2XXAA 1HKQA 3DBHB 4B43A 4YT5A 3JYYA 2DQLA 2DFIA 3I4MJ 3EHMA 4MTEA 4NC7A 3HGYA 2CV0A 3B9QA 5DLJA 2H8AA 4LD5A 3AGUA 1ETWA 2XIGA 4A2UA 4KA4A 1YX5A 2YLGA 4UUSB 3MZYA 5FKKA 1ZH5A 1TT0A 1CQTA 2GBYA 3Q0VA 4PGGA 4HLXA 1QQ3A 2O0YA 2K9NA 2AQFA 4LG0A 3S32A 3HTSB 1Q0FA 1IUFA 1MMNA 1DDNA 5EF6A 3IH2A 3LA3A 3BR0A 3MYFA 3H0DA 1OR3A 2Z2SB 3D1NI 2Y39A 3F3XA 1O3RA 1IJWC 2WBMA 3KPHA 3P5JA 3QW1A 4LERA 4KMUX 3BZ6A 2E7XA 4O5VA 1AA7A 1ENHA 3CUQB 3M4OJ 3VYWA 2DMPA 2RD9A 3QOEA 3B6AA 5DTDA 3V7RA 1YYVA 4IQ4A 3WTZA 1L3LA 3E3VA 1VQ8I 1HA8A 2HKVA 3ERED 3S14J 2A0BA 5CJ9A 3LAYA 2L3DA 2LBFB 1YITI 3J7ZI 2D5RB 1HF0A 2Y75A 1Z23A 3GFIA 4NCQA 2GA1A 4W97A 2VKEA 2X48A 4RGSA 2NUPA 3C8ZA 3FAJA 5IY5C 3SXZA 1A7DA 2EJRA 3C1DA 2WY7Q 1SMTA 2ELHA 5TJJA 2ZXRA 4CX9A 3HKZN 4CJOA 2FEZA 4XRSG 4DRJB 3ZMUA 3HC7A 5D5UB 3D5LA 5LGNA 4HBLA 2CNWD 3JRGA 2M87A 4E7ZA 1X1BA 1PYVA 3VSLA 4O6YA 4DNCA 1PDNC 1ZRFA 1T98A 4B44A 2HJMA 3LOCA 2RN7A 2XKOA 2Z5UA 4CCMA 3L1PA 4UNOA 2E60A 3OMYA 5B66C 1XMXA 2JTVA 3FXUA 3CD6I 3GORA 5L3QA 3Q3SA 2ZPAA 1RIOH 1PUFA 3E1SA 2MSYA 2V6CA 3L1MA 2J9UA 2MD0A 1MMAA 3I0TA 2PI0A 4U5EE 4PACA 3Q0WA 3ZQVA 3H9JA 4RB2C 2IRFG 1G3WA 2BY0A 5GPGB 4BG0A 5LHGA 2ZXIA 2LD5A 4JIOA 4XPXA 2VBYA 1F1MA 3VAYA 3T8TA 2QSGX 3PIPF 3ROUA 1BOAA 1P6RA 2I8BA 1ETYA 4BE1A 1IN5A 1TC3C 4KISA 2EA4A 2LKXA 5TGTA 1K78B 4PJJA 1YZAA 2HFIA 3P9CA 4BBSJ 4ITVA 1FY7A 5F0FA 4LB6B 2R05A 1MIJA 2K4JA 3K6BA 3LLIA 4DVZA 4LB5A 3AG3H 4CGZA 1FOKA 1T6QA 3K1IA 3K70D 2K4BA 3K10A 4RGXA 5IP6A 4XTKA 2KISA 3HZJA 2P6VA 4LLEA 1W4MA 3QQAA 4AWXB 3JRCA 2HU9A 1R71A 1IG7A 2C04A 2LLKA 4QPOA 1OFCX 3FXRA 1WJBA 1IN4A 3R6SA 3GX4X 4CS8A 1J9IA 4LDRA 2W57A 3M9AA 2J9VA 1FWZA 3NARA 2R92J 2X6WA 4A93J 2K9MA 1YI2I 2Z33A 3W6KB 3J81Z 3G1OA 1O3SA 5H6RA 5D8LB 2ZKZA 3EQLF 5EGOB 1B9NA 1K4TA 3FM3A 4YFKF 2H8WA 2JA7J 1OYIA 4UXNA 4KNWA 3MYIA 2M3AA 3HTKC 2VQLA 1O57A 4ULWA 4A2NB 1Y1VJ 2FE3A 4QDLA 2XB5A 3AG4H 5BOXA 1D0YA 1ETKA 3LFUA 4LGWA 4EEFG 1ZLKA 1FFTC 3AG3C 2DQRA 3LUTB 2Y2ZA 3KIOA 3O8GA 2CH0A 4C2TA 2M7BA 4WXHA 3Q7LA 3S2HJ 1M56C 2HV6A 1R6RA 4R8HA 4EM0B 2KSFA 4M9SA 5FRMA 3KX2A 1C0WA 2VASA 3OIPA 3KMIA 3OYAA 3HOWJ 1UG0A 2F5FA 4DZPA 3ZVRA 1W5CC 1AKHA 2Q2EA 1UJ8A 3AG1C 4YJWA 3KEYA 4XEFA 5KYUA 3DCFA 3MQ0A 3NDBB 3JR9A 2NNYA 5J8FA 1TWAA 3SEZA 1BIAA 1JMWA 4RAZA 1FOXA 2YL0A 4NDLA 3A11A 1YZCA 3F9KA 4BYYA 1ZREA 3EGDB 1I6XA 4L0YB 1M2OA 2HMQA 1G3YA 1S7ZA 3EG9A 2DOFA 3K1HA 2BOLA 1F5TA 3ZRGA 5HLIA 2LFBA 1HLVA 3W2VA 4I99C 2PMZA 1HDPA 5T3TA 1WFXA 4E70A 1SVOA 1UZCA 2GOMA 1Y1WJ 3OYCA 2IYLD 2A6EF 2DW4A 2XASA 2K27A 3DKAA 3CO7C 2JVHA 1X2NA 2A6HF 2KZGA 1G3SA 3HOZJ 3DU5A 5ILSA 2PJRA 2LFDA 2NSGA 2FU4A 4M3FA 4MTOA 1VF9A 5J4VA 5M5XJ 1P7IA 4BDZA 5DS9A 3MMYB 1ON2A 2KKOA 3WTWC 1Y8QB 3DQVC 4L5JA 5GAGJ 1QO0D 5E20A 1EA3A 4EJVA 1IAWA 3BG5A 5FD6A 1MBKA 5KAFC 1V5GA 3G2BA 3QYBA 3H92A 3KETA 4FQGA 5F0CA 4HV5A 5FROA 4E4HA 4YIRX 3G4ZA 1BW5A 1T0FC 3CCMI 1A6IA 2Z15A 1U0BB 4HQEA 4BDYA 3FKIJ 2HPIA 5KYUB 2DT5A 3CCQI 3TMOA 2YPRA 3I4UA 2EPOA 2BBYA 4A5MA 1WKMA 2R7WA 4HE8D 4HSRA 4DYQA 2YWAA 3HLZA 5DS6A 3BP8A 3EFOB 1SVMA 3V8LA 1I1GA 1VI0A 1E3OC 1JUMA 3H9QA 1DP3A 4LLGF 3VDXA 1GM5A 3FISA 1F43A 5JLIA 3I54A 3ZQIA 4KUMA 3P9KA 3PJRA 1K04A 3FK7A 1XC5A 1HSTA 4DRHB 1UHMA 1U5TB 5F08A 5EEAA 4BY1J 4FISA 2HZ8A 2A5WA 4FX4A 2LREA 4M3BA 1ORKA 1FMWA 1JUPA 3SJMA 2WAQA 1X4OA 1P9QC 2FUG2 2Q0OA 1DPRA 3WE2A 1LB2A 4Q5SF 2UUHA 4XRMA 4CCOA 2VODA 4CBEA 5DM6F 3E6CC 4MVUA 2EFWA 2IA2A 2QWWA 3GTLJ 5L0IA 3RIPA 3LSJA 3BPVA 1LE8B 1TFOB 3K33A 4EGZA 3NRVA 3BY6A 4BEHA 3LS0A 2CUEA 5ILUA 1N25A 5K7HA 4UY8I 5FZTA 3OYGA 1I6HJ 3TD7A 2XGXA 4BHCA 3H3ZA 3A2KA 2WB1A 3SFIA 1QHGA 4L9VA 1ZK8A 1QU3A 4MHGA 5B1BH 3ZR8X 1TTYA 1MSEC 5F5HA 1JT6A 4MQ9F 4L9NA 5HS7A 5D5XB 1M57C 4G7HF 2VPLA 3UMKA 2VI6A 2Z16A 2XPUA 5TRDA 1GVJA 5D6FA 5HS8A 2L0KA 3EYYA 3TOLA 1B6AA 1LUJB 2COBA 1FPQA 3DTIA 2IJLA 2RQQA 3V42A 3TOMA 4YWQA 3IL2A 1Z1DA 4HV6A 4LOCA 4F92B 2G7HA 4ENKA 4RDUA 2KRHA 3LAJA 2ME6A 2CWEA 4M71A 2IW5A 1APCA 3PNTA 3QPHA 2F4MB 2FSWA 1ETOA 3P9IA 5GAEJ 3T9OA 1YAUO 3TW6A 4I6ZA 2JA8J 3UR3C 3OYHA 3CF5F 3S1NJ 1GVDA 4K0DA 3IQ6A 3GWLA 3FIWA 4Z2YA 2B0JA 2DK8A 2XXAB 1T6UA 5H6QA 1RXQA 1H89C 4LITA 2STTA 1IRGA 2PNOA 2O5RA 4MQVA 256BA 2Y9YA 4DYRA 1S29A 1Y6IA 2XGCA 1X4PA 1P4WA 5KYXB 4XRSA 3HNLA 2DCEA 2KIUA 1XMKA 3FXHA 3EUHA 5KVRA 5C4JJ 1SEUA 3OYIA 4FX5A 4AM3A 3LSPA 2XUBA 4MNDA 4BACA 1A04A 2I15A 1V54C 2XS1A 4KBLA 2LR8A 4CZCA 3M8EA 1O3TA 5DCMA 2NS7A 2D5VA 2ZO4A 1R1UA 2M1BA 4ANJA 3SEOA 2CSOA 4EJTA 1ETQA 1I5ZA 2EQRA 3BG6A 2R7XA 1UB9A 3DXJF 1UG7A 1VQOI 1FX7A 2HI3A 1IO2A 2VJIA 4GYGA 3GZNB 4CICA 2F6CA 2QY9A 2P1AA 3VYSB 2J0XA 2M7AA 3BDDA 2JUGA 4N4WA 2E5ZA 3SXYA 1TKNA 1YS6A 3KP5A 2HXIA 2JPUA 4NQFA 3SDBA 2K5CA 3LSKA 5CVJA 3S3MA 2VJ4A 4HX8A 2R3SA 3BC8A 1TL8A 2E2HJ 3T8RA 1U6HA 2F48A 5C3EJ 1ZRCA 4OIPF 1SC7A 3OYEA 1HDDC 3ECHA 1T5OA 5E3LA 1FYKA 2JJ7A 3H5RA 2XGDA 2FBIA 1HCRA 2WVNA 1QZYA 1X19A 4U9DA 1LPQA 1QPIA 1QVXA 4U7BA 1F9NA 2P0WA 1WWXA 2YX4A 1MMGA 2H94A 2Q1ZB 3S29A 2AS5F 1WATA 4Y4RA 3MZ8A 4O3MA 2ZB9A 1SVLA 2ECBA 2LSEA 1O3UA 2ZXJA 3GMEA 2HGCA 4ENJA 4RA2A 3SXKA 4OMZA 2QTVA 3LNRA 1BC8C 1ONVA 4O6MA 1F36A 3BLYA 2V4JC 3JAMK 2JWTA 4XPYA 2HYGD 2R02A 1PP8F 1HY5A 2M5WA 3KYDB 3ASOC 3UGPA 2OCCC 3ASNC 1WJEA 3WTXC 1KU3A 4HDUA 4MVZA 6PAXA 5E8GA 1RCPA 2H1KA 3KLOA 1IC8A 3S84A 3K66A 4BS9A 3V8JA 5M3FJ 3U8PA 2ZSHB 3I64A 1LE4A 1JPJA 3QU6A 4C3HJ 1OCOC 2BXZA 2E1OA 1WWPA 4L5IA 1WZ2A 4KIGA 2HOTA 3FOPA 1SF8A 4RMNA 4P5OA 1Q1HA 4UB6C 2YRFA 1N1CA 1SD6A 3RYRA 4DIQA 2VOPA 2EIMH 4QSHA 1A31A 3C2HA 3EFOA 5GTIC 3ABKH 4RAYA 1PCXA 2NYXA 3NMIA 3TJ6A 1EH8A 5F04A 3N4MA 2HDCA 1T33A 2W48A 2QSHX 4IB4A 2IS4A 3GFJA 4CS7A 5TISC 4WGYA 1XCVA 3HG9A 3NG1A 2DMUA 5ICEA 3L7WA 1RKEA 2H8RA 2VC0A 2QBYA 4KT6A 2XLEA 1YX3A 2CGEA 2GDCA 3AG2C 1PUEE 2X1CA 5DUIA 3WTTC 4YT2A 5EYRA 1EH7A 4LDQA 4XLAA 2HS5A 3M1CA 5A2QZ 1V55C 1JRAA 3S27A 5JVEA 2VBWA 5L3DA 2XS8A 4XICA 2D2WA 5F1JA 1NBBA 2JRTA 1X3WB 2YUSA 3LS1A 2EBIA 2M2EA 3CEXA 4O6JA 4BQNA 3AL0C 2QKLB 3FKJA 3W8HA 2L9VA 5B3SH 4WXCA 3OA1A 3FHDA 3UMHA 3V7SA 2VCAA 5DEQA 1BN5A 2V1DA 1F4KA 5HV9A 2A68F 3VYTB 2EPFA 3D5SC 4UUVA 2GXBA 4X6AJ 4ONSA 1MH4A 5D6EA 2PF4E 3IQ5A 3TJ5A 1MMDA 2O6GE 4E7SA 2Q00A 1FTZA 3LEOA 4D4XA 1N75A 1J2XA 1W0TA 5CVUA 3BROA 1WRJA 1G5ZA 1LFUP 3WTYC 3PCVA 3UMIA 3CC2I 1BIBA 3GO5A 1R1VA 3MD2A 4B09A 5KNLA 3L2VA 1AKHB 5FKLA 2VCCA 4I01A 1VK5A 2P7VB 1VQ9I 2NG1A 4IOAF 4C3BA 4J32B 3BTCA 1KQ8A 3VSKA 3V5ZA 4YT8A 1R23A 1SAUA 2X6XA 3DPTA 3ECOA 2OEXA 1YS7A 4HFFB 5IP9J 1WGWA 3TK0A 2QQ8A 2ZJ2A 4XKVA 1Z7LA 3L2QA 5KYNA 3PO3J 3S9OA 2Z3YA 1FR0A 1KU7A 1NFNA 1T2KA 2DYRC 5GP9A 2R03A 5FLMJ 1HKSA 2DYSH 2V79A 5EGOA 2DA1A 4LDKA 4UDVA 2JN6A 3ABLH 1W7PD 1SAXA 3G4XA 3KZIC 2QF7A 5E3AA 5AIPA 3ZSUA 1E83A 2K40A 4GDFA 1KONA 2E1CA 1XGMA 5CYVA 4OIRF 1SANA 3IPMO 4M73A 2KLOA 4HYEA 2I10A 1R4NB 3OYKA 3DM5A 1ZAOA 3AQBA 2DFEA 1K6YA 2MD5A 5FB2A 3BJOA 4P6IC 1ZG1A 2P61A 1FEXA 1VYKA 2FA5A 4A5NA 4WCGA 3F21A 3B29A 2ZMEA 3IAM2 2B9SA 2KHMA 1ZGAA 3HSFA 2EINH 2UV1A 2HYJA 1QPMA 3DEUA 2R9RB 4YT4A 3ZC4A 1YW8A 3R7CA 4CYDA 4ZYDA 4GQHA 1WJ5A 5KYXA 5BQGA 1W2WA 1FIPA 4GXOA 4WF2A 2R7RA 2E2IJ 1TQMA 4OD5A 1Q0MA 3OYMA 1ETVA 4AIHA 3H65A 4PJ0C 2Y0SA 1K4SA 1HW5A 1GXQA 1MBHA 3C2GA 3J7YJ 1ZHWA 2O3FA 5COMA 3G3ZA 3U2LA 2M34A 4AL0A 1RESA 2NXNB 1B9MA 2P8TA 3W3CA 1YA7O 3R4KA 2GQQA 2MHRA 3V5YA 1OJLA 3MKLA 2O8XA 4PSXA 3M8JA 4WX9A 1AU7A 1EI7A 4KIFA 5L3GA 4BEHB 1RUNA 1LFBA 2G3VA 5A6BA 1VQNI 3CAXA 3EGXA 4MVOA 2K9QA 1EF4A 3KEOA 2CG4A 3ULQB 2K86A 4C2MJ 3IEEA 2FBHA 2HNHA 4HEA2 4F7ZA 4JOMA 4UVCA 4XLPF 4AE4A 2RQPA 3ZDLA 3PSIA 2E1MC 1JTXA 3H35A 1DOVA 1S05A 1A7EA 2EINC 3VOEA 3BWGA 3GBGA 4Y17A 3JCUC 1KNYA 2ETHA 2P7CB 3OL3A 3GLXA 2A3SA 4AC0A 2WC2A 2BL2A 2HJ3A 3QVZA 3VRCA 5A6JA 4JQFA 5DV5A 1U5TA 2MYSA 1JE8A 4KYWA 1KQ9A 2EFNA 2R7VA 2WB1N 2CQ7A 1YOVB 5BQTA 3J06A 1RKCA 3FXLA 2IGNA 4PGHA 5KYYB 4LG0B 1RPWA 2R5ZA 5DM7F 2DLLA 4XOPA 2OEVA 2CMPA 4NC8A 4JVSA 4RLQA 2XL4A 3Q0UA 1B4AA 3DLAA 3TQOA 1XB4A 1GV2A 3BZKA 4HEAJ 1D5YA 2YR2A 2Y9ZA 3DKYA 2QNLA 3IP4B 1SD7A 2BV6A 3M15A 4H54A 2L01A 3BCAA 2VPRA 4EV0A 4C7OB 3BZCA 1X3ZB 3KE2A 3QP6A 4V19K 1Z05A 3Q5FA 3NRHA 4EMSA 1JHFA 5E8IA 1QA6A 5D5WB 3PFYA 4IOCF 1OR2A 1WI9A 2XF5A 2JX0A 3HOUJ 4ZYGA 4EBJA 2LC2A 2IT0A 3S2DJ 5H20A 3CQZJ 1Z5ZA 3D5RC 4QWQA 4G78A 3N24A 1WI3A 3A1YA 4NUBA 3GVAA 3QW0A 1G59A 4DVYP 3IRRA 3LQQA 3ERMA 2A1DD 4K7BA 5BPIA 1QKRA 3OIOA 1YW7A 3MVPA 1WPKA 3US6A 3CCVI 4G94A 4XLCA 2EIMC 3MKWB 1MH3A 5JP7A 2V9PA 1NSGB 4XLEA 4FTHA 4ZZDA
chains in the Genus database with same CATH topology
2ICWG 1R5ID 2OJED 3KPHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ICW G;  1R5I D;  2OJE D;  3KPH A; 
#chains in the Genus database with same CATH topology
 1XTA A;  4WAB A;  4OAZ A;  4M6X A;  1GQA A;  4N9H A;  3KH2 A;  3CCR I;  4ZYH A;  1MNM C;  4XK4 A;  4IZZ A;  4HG2 A;  4M3E A;  4IHV A;  3PNV A;  1B72 B;  5EG0 B;  3F23 A;  2FNA A;  3LSI A;  5M5W J;  1ZZP A;  3K69 A;  3CQZ A;  2L02 A;  1W7P A;  1K83 J;  2FOW A;  4CDG A;  5HSW A;  4D7M A;  2XAF A;  3ONQ A;  4B3X A;  2DTR A;  1OCC H;  2IA1 A;  4PFO A;  4XSZ F;  2DPD A;  1IZM A;  4CYC B;  3GTG J;  3RH3 A;  2RNG A;  4OAY A;  3VF0 A;  3ZQL A;  1ORS C;  3LST A;  5E3N A;  1HW1 A;  3FVY A;  1STZ A;  3L2C A;  3HOV J;  3EUK L;  3QP5 A;  5ED4 A;  5E1W A;  1OLT A;  4F52 A;  3HIF A;  1QBJ A;  2DA6 A;  4GRI A;  3ELK A;  3PIO F;  1PD0 A;  3RI4 A;  3QOP A;  2UZK A;  4IPA A;  3RQF A;  2V26 A;  2OG2 A;  4PJL A;  5LRS A;  2FGY A;  2OBP A;  2WB7 A;  2P6S A;  2OCE A;  1E0E A;  2DOD A;  1H88 C;  2LG4 A;  1DP7 P;  2A07 F;  1IGN A;  2MBF A;  3ABM C;  2OPT A;  5IPA A;  2ASR A;  3WHC A;  2WZF A;  3WOD F;  4U87 A;  2YL1 A;  4G7O F;  4FHT A;  2PBI A;  4E18 A;  4G6Q A;  5HNF A;  3ISP A;  4IAQ A;  1MKM A;  4RB3 C;  4LIU A;  1E17 A;  5FD5 A;  2Y30 A;  2LK2 A;  3C8G B;  3CJR B;  1FYM A;  3TO7 A;  4A6E A;  2KT0 A;  3OS2 A;  2VJJ A;  4AIK A;  2AHQ A;  1K05 A;  2NUT A;  4R1H A;  2GFH A;  2M0C A;  4N4N B;  2XAJ A;  1YFH A;  1YIJ I;  3L8J A;  5BS6 A;  3X2Q C;  2CNW A;  3COA C;  2AWC A;  2J5O A;  4Z9I A;  4O6N A;  2MWQ A;  4F3Q A;  4A3L J;  4RGR A;  3OL4 A;  5HLG A;  3GFL A;  4I3M A;  4B1R A;  1A7V A;  2E1N A;  3FMQ A;  3ECS A;  3CTA A;  3F72 A;  3E70 C;  2X4H A;  5AIQ A;  5LRR A;  1JOG A;  2XSJ C;  2X51 A;  3OIQ A;  3EGX B;  2QKM B;  1OKR A;  1IRZ A;  2NAZ A;  3HSR A;  4RAF A;  5IYC J;  2A69 F;  2OCC H;  5GAH J;  1E3P A;  3QYF A;  4BL0 B;  1ZHY A;  2CU7 A;  2ECC A;  3LL7 A;  1S72 I;  4IJJ A;  5HLT A;  5TJ5 E;  2W9Y A;  5F28 E;  2L81 A;  2GXA A;  4E0I A;  1Q1V A;  3DJN B;  2JZY A;  2VQH A;  4JCZ A;  1U89 A;  1GS9 A;  3EPV A;  4YL0 A;  1KA8 A;  2X9D A;  4A69 C;  1TR2 A;  1D1A A;  1LE2 A;  2FFH A;  5L3F A;  1ON1 A;  2FML A;  1WAS A;  1ZHT A;  3GYH X;  5AC4 A;  1G8X A;  4H4K C;  1W36 C;  3UKG A;  1ORJ A;  3GEE A;  2VC1 A;  4WWC A;  1APL C;  3CJQ B;  1TT5 B;  4I1M A;  4XLH A;  4KDP A;  2HV7 A;  1K61 A;  5FFX A;  3C18 A;  1SD4 A;  1EV7 A;  1O4X A;  2K3P A;  1BL0 A;  1K6O A;  3QTH A;  5L3B A;  1OCZ H;  3DPU A;  3ZGK A;  1WQ2 A;  3IQT A;  3U9M A;  3SHF A;  1FYL A;  4MGR A;  1VQ6 I;  1Z0X A;  4XKC A;  3S1Q J;  2KYH A;  4FWV A;  2ESN A;  1WTY A;  2K7L A;  3RF3 A;  3VM6 A;  3CJT B;  4EJO A;  2CFO A;  2NUP B;  1Z3Y A;  4LJZ F;  2IAI A;  1GT0 C;  4FAP B;  2JRM A;  1NZE A;  1LDD A;  2E7W A;  3JYH A;  4AVZ A;  3PSF A;  2P0N A;  3K1N A;  2ADU A;  1Q0G A;  1ZHF A;  5DD8 A;  1CPR A;  3JRB A;  2LY1 A;  1LE8 A;  5LEJ A;  4JTC B;  3T6B A;  2DJI A;  4BHP A;  3CLO A;  3ML6 A;  2DA2 A;  2DOE A;  4LG3 A;  3S17 J;  4KI2 A;  3VYU B;  2G7U A;  5BPD A;  4OD4 A;  1FNN A;  2JMW A;  4EM2 A;  4A3E J;  3EH1 A;  5C44 J;  2HUJ A;  3ZTZ A;  3LAP A;  1HMO A;  2ELK A;  1IN6 A;  3RW0 A;  3FF5 A;  1V74 B;  2HDW A;  2XGE A;  3PQJ A;  3HEF A;  3S1R J;  1NU9 C;  1QZX A;  4BJT A;  1YJ9 I;  2QGU A;  3IHU A;  2CYD A;  4G6T B;  1A0B A;  2MC4 A;  3K1M A;  2XRL A;  3AL0 B;  4RDA A;  2LF7 A;  1P2F A;  3KCC A;  4PUS A;  2Y3B A;  5DVW A;  1JAF A;  3FX3 A;  2I5U A;  4JTA B;  3TOA A;  4DJ9 A;  3CCS I;  2ZME B;  4EJW A;  3R2P A;  4CIP A;  4IAO A;  3HOY J;  3Q6M A;  2KJG A;  2H7O A;  3FZV A;  4XON A;  2OZU A;  2O8K A;  4KJZ A;  1C02 A;  2D4U A;  5K7F A;  3DEW A;  4BEJ A;  3TO9 A;  1VQK I;  3LSR A;  1Y4C A;  1U8B A;  2OV7 A;  3NKD A;  1ZKG A;  2Y0S N;  1SFU A;  3A02 A;  4DBQ A;  4ETS A;  2DDB A;  3FMR A;  2P4W A;  3LNM B;  2ISZ A;  4PZJ A;  1AEP A;  2YU3 A;  5COF A;  2YZS A;  2HFH A;  4KIC A;  3GCM A;  4AE4 B;  2L7Z A;  4CDV A;  2OU2 A;  4M72 A;  5HS9 A;  3SDG A;  3AFH A;  3O6X A;  4AIJ A;  1ZR2 A;  4J30 B;  2YX7 A;  3OS1 A;  4J19 A;  4G6D A;  3K4C A;  4IQJ A;  4AUX A;  2XDV A;  1MQV A;  3B71 A;  3N97 A;  5L3V A;  5IYD J;  3R0J A;  1YQA A;  4ESF A;  1JTY A;  1LVK A;  2ZSI B;  2Q4F A;  4U5H A;  2HTJ A;  1NG1 A;  3L34 A;  1J8Y F;  5KAI C;  5CVR A;  3F8M A;  2K9S A;  2GM4 A;  3GFM A;  3W6V A;  4BBR J;  1GUU A;  1BJA A;  2PX9 A;  3MKZ A;  1LDJ A;  1UFB A;  1C17 M;  3M8F A;  5B5E C;  2JT1 A;  4BXU A;  2Y3G A;  2Q7R A;  4EWC A;  3BPX A;  3FXO A;  5E1X A;  3JTL O;  1UG2 A;  1ZGW A;  4C3J J;  3DI5 A;  3WG7 H;  2Z99 A;  4PSW A;  5J1U A;  4AYB A;  3MFN A;  1YLM A;  2WL8 A;  1IRX A;  2R7Q A;  2CQX A;  3KYI A;  2OOC A;  2QEN A;  2OJQ A;  4LAC B;  2ME0 A;  5E79 C;  3CMM A;  5EHH A;  5A2Q K;  5FKM A;  2W7N A;  1WJC A;  3IH3 A;  5L0J A;  1H7I A;  1LS4 A;  3L9F A;  4I44 A;  1YDI A;  2Q9B A;  5L0C A;  2L9N A;  1LIH A;  5E3C A;  5DS4 A;  1WHU A;  3R60 A;  1EJ9 A;  1XGO A;  2DXI A;  4CDA A;  2NVT J;  2VQG A;  2VT2 A;  2XRO A;  3HXL A;  2XF6 A;  3X1O A;  1VMA A;  3EG9 B;  1UHW A;  1R5G A;  3PQK A;  2HSB A;  2RKH A;  3N0T A;  5L0F A;  3LLK A;  3S93 A;  4IHT A;  4B3A A;  5CIV A;  2O7O A;  5DQT A;  3SEQ A;  3CC7 I;  5JFR A;  3HPG A;  1YG2 A;  1JKO C;  4D5F A;  3I56 I;  1T6S A;  2XLV A;  4MVM A;  3JAM Z;  3HJC A;  1X1C A;  1OKK D;  1OR7 A;  2XAG A;  4A4A A;  3GWZ A;  4RM3 A;  4BGD A;  2UUI A;  3VEP A;  1J0R A;  3MCZ A;  4NNJ A;  2L54 A;  2J7P D;  2DMT A;  3I53 A;  2Z9O A;  3L8I A;  4B47 A;  4Y52 J;  1RZ4 A;  2EPM X;  3U9G A;  1J75 A;  4C3D A;  3S2W A;  4YL1 A;  3RKW A;  5H2F C;  1SFE A;  4HQM A;  4IX7 A;  4WGZ A;  3EJN A;  2EZI A;  4X0R A;  1XZQ A;  1OXB A;  4EIY A;  1XSV A;  2DT7 B;  4P9T A;  2X6Y A;  3U2M A;  2GWR A;  4D5C A;  3J7A Y;  3LSG A;  2DA7 A;  2KGO A;  2AO9 A;  1JPN A;  3S3N A;  3NKE A;  2VC9 A;  3R61 A;  2P6T A;  2ZNZ A;  3GF2 A;  4XID A;  2PEX A;  4CYC A;  2KDO A;  1MNE A;  3BR5 A;  2CV2 A;  1QPU A;  2TCT A;  1NG6 A;  2BY1 A;  1Y8R B;  2J9W A;  2HPM A;  1B8I A;  1D8K A;  1H0M A;  3LJB A;  2OQG A;  1KGS A;  2UWM A;  2EH3 A;  4ON0 A;  4V2G A;  2BEO A;  1K78 A;  1OW6 A;  4XEV A;  1ZW2 A;  3RDI A;  2WVQ A;  3RKY A;  5T3W A;  3OYN A;  3M07 A;  3B0V C;  4A0X A;  4MO7 A;  5JLX A;  2NVX J;  1U2W A;  2G3K A;  1KU9 A;  3TO6 A;  3WAQ A;  1X3U A;  4XBF A;  2NS8 A;  3C2B A;  2OZ6 A;  4C9Y A;  3CMA I;  2VQC A;  1YJW I;  2CCY A;  2IOQ A;  1IV6 A;  4X1E A;  1ZGJ A;  1RJ9 A;  3G1M A;  2J8W A;  3U1K A;  4U0Y A;  3QWL A;  1VB5 A;  1LM3 B;  2CRG A;  1FJL A;  1I39 A;  2YL3 A;  2H6B A;  4MW3 A;  4P55 A;  4XWJ A;  3ZQQ A;  1UMQ A;  2J5P A;  2L6G A;  5L0H A;  4U7D A;  2M64 A;  5DS5 A;  4XNF A;  2PMZ N;  3K4B A;  3ZMZ A;  3GTO J;  2L4M A;  3OYL A;  4YII A;  1G6N A;  3ZMS A;  3DPL C;  2ACJ A;  2R7Z J;  3LEV A;  2KMU A;  3FHZ A;  3ZPL A;  4JZA A;  4QLC U;  3EHN A;  3K7A J;  2KDZ A;  1MMS A;  1XD7 A;  1CGM E;  2QE9 A;  1H8A C;  3LSH A;  1FLI A;  3HNJ A;  3BEH A;  2B0L A;  1L0O C;  1I3Q J;  5EEG A;  4CCJ A;  4XM3 A;  2AXL A;  4IRI A;  1I50 J;  2PJR B;  1IDZ A;  2PX3 A;  4KIB A;  5L0D A;  4N6C A;  3SP1 A;  3HPH A;  1T56 A;  1R1T A;  3KKB A;  1S5L C;  1L3P A;  3POV A;  2XRN A;  1OCC C;  2IXM A;  1XSD A;  5K7Z A;  4L0Z B;  3M79 A;  1Z21 A;  4AID A;  4L9J A;  3J7A O;  1XWJ A;  1WH5 A;  3GZ5 A;  3JSZ A;  1GHC A;  2OF7 A;  3KYJ A;  4IRG A;  5JLW A;  4J00 A;  1BDJ B;  3RPQ A;  3DLL F;  1T95 A;  1LFP A;  3V7C A;  3S28 A;  3HB9 A;  3K9T A;  4M6Y A;  1JJ8 C;  3MBG A;  3S8P A;  2H1L A;  1TQI A;  3W2A A;  4G9Y A;  2B0H A;  3SZP A;  4AX2 A;  4BJ5 A;  2BY2 A;  4UB8 C;  4G7Z F;  2DGJ A;  2GAU A;  4W1U A;  3RYL A;  1UFM A;  2H6C A;  4Q4Z F;  1WN0 A;  2QQ9 A;  3HOX J;  3OS0 A;  1SZI A;  4ENM A;  2LVS A;  4IRH A;  2ZXW C;  4IEJ A;  3ZP5 A;  1RKW A;  2EV0 A;  1BBH A;  3W2W A;  1LQ1 A;  1RKT A;  1GDT A;  3E5U A;  2JSC A;  4I0A A;  1FSH A;  4UUS A;  1T38 A;  3M4C A;  3HOS A;  4MW8 A;  4XSX F;  4KFC A;  1R5I D;  4XOT A;  1WOL A;  1LKX A;  1X1A A;  1G4D A;  4OIO F;  2AWY A;  1IF1 A;  2JUC A;  2GIV A;  2VKV A;  3KP2 A;  2LY9 A;  3NAU A;  3PUF A;  4LK0 F;  4PK4 A;  5GAD J;  2NOJ B;  1AOY A;  2NPU A;  3BTI A;  4MFE A;  2JPB A;  2TDX A;  2CS3 A;  3T4R A;  4MTG A;  2FAP B;  1A35 A;  3GXO A;  2PFB A;  1U78 A;  3L00 A;  3C3W A;  2HEO A;  1SR2 A;  2H7V C;  2NSF A;  1Z91 A;  4XQF A;  2X1E A;  1RR8 C;  5LBQ A;  2A6T A;  2L9R A;  2XRH A;  1R58 A;  1ZEL A;  3UNG C;  1ZU5 A;  1SMY F;  1KTM A;  4D9J A;  2M45 A;  2W45 A;  3C7J A;  3K1P A;  4OIQ F;  1CPQ A;  5IYB J;  1E85 A;  1S7A A;  1R00 A;  3K4K A;  3JRI A;  3RYP A;  3V4G A;  3TDZ C;  4W8P A;  1VOM A;  3W6J B;  2EA2 A;  1M1E B;  1SFX A;  1XDU A;  2CUJ A;  3WGG A;  1OW8 A;  5D5V B;  3BR3 A;  2DMN A;  2GIZ A;  3AAF A;  3V5X A;  3K6G A;  4RBO A;  2F5V A;  1TWG A;  4Q47 A;  2EZL A;  1J5Y A;  2OU6 A;  2XLD A;  4WJ0 A;  4ZTJ A;  3ZQY A;  3EPZ A;  2CO5 A;  2KZV A;  1W5T A;  5IOY A;  1UHS A;  3RQ4 A;  4LLC A;  1S8N A;  2NVQ J;  2VXD A;  4BY7 J;  2DA4 A;  3TQN A;  4AYB N;  1CGN A;  1MDM A;  1HE9 A;  1OKK A;  3O55 A;  3GEH A;  3K4M A;  2ETS A;  2RDP A;  1ZAR A;  4E7I A;  1YYX A;  2STW A;  2A0U A;  4BKX A;  3SZR A;  4XKW A;  2QA4 I;  4BNC A;  2KIQ A;  2QM3 A;  4IHX A;  1J8M F;  5JSL A;  1BZ4 A;  3CLQ A;  4RGU A;  2ZNY A;  1NTC A;  4HLY A;  1CGO A;  4D7N A;  1U6G A;  3CUO A;  5L3E A;  2DBB A;  3IRQ A;  2BW3 A;  1WSU A;  4I02 A;  3PNY A;  3ZQC A;  3JRH A;  1R4M B;  4B8X A;  2XM4 A;  1LDK B;  4GO1 A;  4P1W A;  2EIK C;  2MG4 A;  3K4N A;  1JKQ C;  1VQ5 I;  1QVU A;  2PP4 A;  4ESJ A;  4IRU A;  3RZO J;  3FOO A;  5JT4 A;  1R9T J;  3KLN A;  1K79 A;  2W4B A;  2WAF A;  3TUL A;  1HSJ A;  5BUO A;  2H09 A;  3HOT A;  2WAQ N;  1DGR M;  1TWC J;  2BZT A;  4NQW A;  3OOP A;  5FCL A;  2NNN A;  3G4S I;  2TRT A;  5FKN A;  3I5U A;  2PMU A;  3I55 I;  2BY3 A;  2R7U A;  5JUA A;  2FD5 A;  5E3M A;  4N06 A;  1FAP B;  4G0H A;  5BQH A;  3CDL A;  4CXF A;  3L0I A;  3RFY A;  4PDK A;  4CCK A;  4YIF A;  2HVS A;  1RRJ A;  1H6G A;  1PD1 A;  1REP C;  3E6B A;  2AQE A;  2EPL X;  3WGH A;  2L7A A;  4EAT A;  2IXN A;  3DTK A;  1ST6 A;  1FBS A;  3CSK A;  3GLL A;  1E2X A;  4NC3 A;  3N05 A;  4QIW N;  1G4W R;  3K70 C;  2IGK A;  3DKW A;  4HF1 A;  5D92 A;  3PDM P;  4GCV A;  5FGM A;  2E5N A;  1NG7 A;  3G1L A;  5K5Q A;  2QCO A;  3BJ6 A;  5J8C A;  1XZP A;  2Y3H A;  4IHW A;  4KT5 C;  1H9G A;  1TNS A;  2CYY A;  4XL9 A;  1YTY A;  1DUX C;  1QRY A;  3EGD A;  1NU7 D;  3F47 A;  2VJ5 A;  2ZXH A;  4M74 A;  4QPQ A;  3CCL I;  2HR3 A;  2KIM A;  1JI8 A;  2HYF A;  4IL6 C;  2PFD A;  2YL7 A;  3LWF A;  4MVQ A;  1IDY A;  3K7D A;  1TLH B;  3HRS A;  3RPU D;  4AK9 A;  1Z77 A;  2CDQ A;  1QNT A;  1RI7 A;  3Q9S A;  4BPM A;  1OW7 A;  2XAH A;  2XB0 X;  2YS9 A;  1B68 A;  4R32 A;  1R7J A;  1S3J A;  1YA9 A;  2E87 A;  3IV5 A;  3JW4 A;  3TOB A;  3I5P A;  4Q48 A;  1TW3 A;  5AON A;  3DP7 A;  1ZN2 A;  5LEK A;  2UUZ A;  2F5E A;  3BQY A;  1B1B A;  2LKS A;  4M9X A;  3JRA A;  4HA8 A;  2D1H A;  4WXD A;  2R0Q C;  2IS2 A;  3GWN A;  4XOR A;  2XHK A;  3BG9 A;  1WVR A;  2VE8 A;  1MJ9 A;  2RNJ A;  4P9U A;  3HNI A;  1ZG3 A;  2FQ4 A;  3DV8 A;  2BVM A;  3IUO A;  3AKZ A;  2V7F A;  2F22 A;  3E6D A;  2J0W A;  1VLS A;  4FAS D;  4CS9 C;  1WGX A;  4A3B J;  3DD7 A;  2Y48 A;  4IHY A;  1IUY A;  1G3T A;  2WVO A;  2YHS A;  5LHH A;  2VE9 A;  1DPU A;  4E6K G;  3U0C A;  4IHS A;  2ELJ A;  3A0H C;  3MAJ A;  3EDP A;  5JHF A;  4C30 A;  4I1O B;  2IBF A;  3H3V K;  2J9B A;  2VKD A;  3HSE A;  1JT0 A;  2MW8 A;  4Z9H A;  1SFK A;  4V2F A;  3VYR B;  2NUT B;  5A6K A;  2WV0 A;  1HMD A;  3CF2 A;  2IA0 A;  1P4X A;  4JRZ A;  4JYK A;  1ULY A;  2OA4 A;  3OSF A;  2VOO A;  1Y6D A;  2EZK A;  1B8I B;  3WU2 C;  1A6Q A;  5B3I A;  1VZ0 A;  2FRH A;  3RCO A;  3JSO A;  2QUF A;  4A0Y A;  4I76 A;  3GTP J;  4HNV A;  1UAA A;  3RKQ A;  2EIL C;  2QUP A;  3ITF A;  2Q3T A;  4M9Z A;  3H2V A;  2CW8 A;  2BYV E;  3A4C A;  1EA8 A;  2VB6 A;  5HDK A;  2RRE A;  2CQK A;  4DZJ A;  4MVR A;  1O7L A;  4U5B E;  1NHA A;  2LD6 A;  2MLK A;  3F6V A;  3E97 A;  1R22 A;  1OPC A;  3U1D A;  1ZQ3 P;  2BHY A;  4XN0 A;  3QU3 A;  4HF0 A;  1QHH D;  1OCR H;  2H7B A;  4PR9 A;  1XDS A;  4U5D E;  3CDH A;  2MGQ A;  5FJ8 J;  3DU6 A;  3CCJ I;  2IS1 A;  1M6T A;  1TNT A;  4BJ5 C;  2XLM A;  3B73 A;  1FOW A;  4U9E A;  2GXG A;  3AG1 H;  2X0C A;  2BVL A;  3WG9 A;  3VB2 A;  4DOZ A;  2R7T A;  3C62 A;  2O03 A;  2V1U A;  1J59 A;  4G8X A;  1X1D A;  3OOU A;  2LKP A;  2XSE A;  2DTZ A;  3Q9V A;  3HL2 A;  4FE4 A;  2COM A;  2EV5 A;  2HZD A;  4ZYA A;  2O9X A;  3O39 A;  4EKW A;  4E7L A;  5D91 A;  3RTR A;  3U8V A;  2VL8 A;  2W84 A;  4M3G A;  1KYZ A;  1BM9 A;  3RKX A;  3F22 A;  3T6G B;  3IQC A;  1MZB A;  3BG7 A;  5JRA A;  4G12 A;  4XRF A;  3GOD A;  2B63 J;  3ZQG A;  4BQA A;  3E5Q A;  2DK5 A;  3ABU A;  1MSF C;  3HHH A;  4LLN A;  2R7S A;  3J80 Z;  3BR2 A;  4S04 A;  1OCR C;  3MX3 A;  1GGQ A;  1JGG A;  1OCZ C;  3CZ6 A;  4ZLC A;  2NVY J;  2CUF A;  3CES A;  3SZG A;  2ZBK A;  4CSW A;  1BC7 C;  2XV4 S;  4F91 B;  3HTU A;  5K5R A;  3IKT A;  1YRN A;  2F5D A;  2OUM A;  1ZG5 A;  1BI2 A;  2DFF A;  2P5L C;  4KN7 X;  2VKH A;  2FXA A;  2A05 A;  3IKV A;  3T5X A;  3Q6N A;  3CMY A;  3ESW B;  4XLF A;  1KQ0 A;  3CP2 A;  2BC5 A;  3RQG A;  2YKZ A;  1QQI A;  5K0I A;  4Y33 A;  2XPV A;  2R4G A;  2IXP A;  3ZMV A;  1V5E A;  2JA5 J;  4HX7 A;  3I9V 2;  2QLA A;  4Z9J A;  3X2Q H;  1P4A A;  1IXR C;  4GFB A;  1VYI A;  3ABT A;  2IM8 A;  2R25 A;  3DAF A;  3HYI A;  3JRD A;  1V3F A;  1UCR A;  4AU7 A;  4ZH4 F;  4NHJ A;  2DU9 A;  4BU2 A;  2P81 A;  3RQI A;  2KK1 A;  3H1C A;  2JPC A;  3DWL E;  3BOQ A;  4U0V A;  3VFZ A;  3QOD A;  1TBX A;  4JX6 A;  4NTB A;  1QSP A;  4JJF A;  3FBN B;  1RUO A;  4A3K J;  4U0W A;  4A3I J;  4JJG A;  3TP3 A;  2DOA A;  3RZD J;  1XX5 A;  3MEX A;  2A5Y B;  3H9G A;  3AG2 H;  1PV3 A;  3JZ0 A;  3CUQ A;  3HDD A;  5ILV A;  1V55 H;  2MFZ A;  1H9T A;  2DB4 A;  2I8D A;  1Z67 A;  4CDY A;  1MBJ A;  5FO5 A;  3G73 A;  1LVA A;  2FQ3 A;  1HQC A;  3WU1 B;  1BBY A;  2VXZ A;  2QVO A;  2HMZ A;  1YJN I;  2Q9C A;  2M4G A;  4HDV A;  2WWY A;  1M2V A;  2E2J J;  2OAZ A;  4MLO A;  2XC7 A;  3F6O A;  4CS8 C;  3DWW A;  3FK6 A;  1OYY A;  3RPU A;  2KRF A;  4JP0 A;  2KNH A;  3IH4 A;  2HVR A;  2HSQ A;  2GLO A;  5EZG A;  3RJP A;  4DW6 A;  3KFW X;  5ICC A;  3BRJ A;  5E2Q A;  1MJA A;  2HXO A;  3U3F A;  2DN0 A;  3ZN1 A;  1ODD A;  3OR1 C;  1T0F A;  2QEX I;  1MBF A;  1B59 A;  4XPW A;  5K1Y A;  3RKO F;  4CSA A;  3RVY A;  3RSN A;  2J7P A;  2DYR H;  5HVQ C;  1W7P B;  2DJN A;  1RC9 A;  1OMI A;  4HW0 A;  5DUK A;  2DDA A;  3G6E I;  1DGW Y;  2RAE A;  3BJA A;  2VON A;  3ABL C;  3O10 A;  5F64 A;  4AD9 A;  3OV8 A;  3CCU I;  2O9L A;  2PJP A;  2D1V A;  2YLI A;  1WJD A;  3NYJ A;  2GZW A;  3U3B A;  2E1M B;  1U5T C;  1V54 H;  4RS8 A;  3GUD A;  4BXF A;  4YFN F;  2O61 A;  5GPC A;  3LA2 A;  1KYW A;  1PJR A;  2LH9 A;  3DE8 A;  1FT9 A;  5E3O A;  1XMA A;  2WAE A;  5DD4 A;  2W4M A;  2WY8 Q;  1FP1 D;  4I0B A;  1LI5 A;  5B1A C;  1YAR O;  3HRT A;  5EG0 A;  1CGP A;  4NTA A;  1U0J A;  4FCY A;  5HOD A;  2K02 A;  1FBU A;  4K2E A;  1U9N A;  2KJB A;  4EGY A;  1NH3 A;  1D1C A;  4D1Q A;  5FLX Z;  2CGP A;  1D0Z A;  5M3M J;  5EK0 A;  2Z1D A;  2DYS C;  2KC3 A;  4I7H A;  4E7K A;  1S7E A;  5LHI A;  4C7O A;  5E17 F;  2ISY A;  1TQG A;  2CUZ A;  3LFK A;  1IRF A;  1KZH A;  5KYW A;  1POG A;  2IVM A;  2LDU A;  4CH7 A;  5D4R A;  3NQO A;  3H5A A;  3W4Y A;  2D45 A;  3F8F A;  5D4S A;  4YL3 A;  2PG4 A;  4UHT A;  5J1Y A;  2M0M A;  2IBD A;  3NWS A;  3ZQ7 A;  4A3D J;  1IW7 F;  2MLG A;  3A01 A;  1ACI A;  2WAD A;  5JVT A;  2X1D A;  4U88 A;  2IEK A;  4BH9 A;  1DQU A;  1AVO B;  2KIF A;  1Z6A A;  2JK3 A;  1D3Y A;  1XS9 A;  4NQW B;  2L9J A;  3NMJ A;  1BR4 A;  3EET A;  3NYL A;  2QQA A;  4ABZ A;  4XKB A;  3KZY A;  3GM1 A;  1X58 A;  5A69 A;  4II2 A;  4IKF A;  3HRU A;  2FMY A;  3OYB A;  1G4U S;  3KP4 A;  1O5H A;  3GM2 A;  2R7O A;  2OTJ I;  1ERD A;  4F55 A;  4ZTF A;  2R5Y B;  3O6B B;  2HKO A;  3DE9 A;  3MN2 A;  3SYN A;  2C03 A;  3GW2 A;  2EIK H;  3D0S A;  3M1E A;  1JJ6 C;  1E84 A;  3GTM J;  3C8G A;  3IWZ A;  4JC7 A;  3HRM A;  3H36 A;  5KCM A;  1R5H A;  1RR7 A;  3GEI A;  1TWC A;  2Y69 C;  5DYM A;  3G50 A;  2DA5 A;  1HBX G;  4CS9 A;  3B0P A;  2CQQ A;  2X85 A;  2PBE A;  3HM5 A;  4JEA A;  1Z6T A;  2X6O A;  4JE9 A;  2HQR A;  3ASO H;  3SZT A;  1A5J A;  3DJU B;  4C3E A;  4ASN A;  3LA7 A;  2FNP A;  1QLE C;  2L7F P;  2IP2 A;  3BR1 A;  4C2U A;  2C6Y A;  4BQO A;  4LLL A;  3FXJ A;  5IY5 H;  3G71 I;  4GGG A;  3I58 A;  2XAQ A;  3AJM A;  4Y7N J;  4S0H B;  1OCO H;  1ZR4 A;  2EV6 A;  2PQ8 A;  3DZA A;  1A36 A;  3M7G A;  1TZL A;  2CV1 A;  4LK1 F;  4ZJZ A;  2XF7 A;  5J3L A;  4IO9 F;  4ULV A;  4A3M J;  5E18 F;  2IXS A;  1J09 A;  1FP2 A;  4F93 B;  2G0E A;  3IAS 2;  4NY3 A;  1BI1 A;  2L2O A;  4FX0 A;  3ZQF A;  1TWF J;  5JR3 A;  3ZN0 A;  4Y15 A;  3PL8 A;  3JRE A;  4MEX F;  1T6I A;  4U5C E;  3E7L A;  4N4O B;  1Z3I X;  2DPU A;  3QPL A;  4JUR I;  5LD2 C;  1FOY A;  2EFO A;  4CZZ A;  2L6H A;  1MDM B;  2P5V A;  2Y69 H;  3F46 A;  2ICW G;  4CCN A;  1MW7 A;  2JVG A;  3EZH A;  2M4E A;  4ESB A;  2Y0M A;  2CW0 F;  2E19 A;  5CLS A;  4JEB A;  3A9C A;  2XL6 A;  1N77 A;  3H5N A;  4DYC A;  2OD5 A;  1MD0 A;  1VQ7 I;  4NB5 A;  2J46 A;  5IOZ A;  3QAH A;  4E7H A;  4OIN F;  4OMY A;  4N6H A;  2V3C C;  1YE9 A;  2JD3 A;  2H27 A;  1ZTR A;  2M4K A;  4MIM A;  5BMZ A;  1IXC A;  5EZH A;  1VQP I;  5CQG A;  5ICG A;  1D8J A;  3JSE O;  3MWM A;  4KNY A;  4QI2 A;  3U2R A;  3FAP B;  2LOO A;  3FMS A;  1LS1 A;  5HOO A;  3H3U A;  3W8I A;  4IJA A;  1D1B A;  1AWC A;  2V9V A;  3IWF A;  1P92 A;  4PJN A;  3BG3 A;  1PUF B;  3AQC A;  4J01 A;  4L6R A;  1NK2 P;  5BQI A;  3FBI B;  2KP6 A;  4DRI B;  4JTD B;  4CUG A;  1LEA A;  2WV1 A;  2DT6 A;  3QYE A;  2LQG A;  5IP7 J;  2JA2 A;  3NEU A;  4BE2 A;  3H2U A;  1LJ9 A;  1YRN B;  1QGP A;  3NMK A;  2ZXW H;  3ABM H;  3L09 A;  1EKY A;  5J4Y A;  2XLH A;  3SNH A;  2E36 A;  3P7N A;  5JHU A;  1IN7 A;  3JTH A;  1VQ4 I;  3DBR B;  2KW3 C;  2YVK A;  3WTS C;  2ZJQ F;  4HPQ A;  4CCL A;  3FDQ A;  2A61 A;  2F4I A;  2LNB A;  1EQ1 A;  2WTE A;  3V7O A;  1BR2 A;  3S3O A;  1USS A;  4FE7 A;  3ZXS A;  3C8G D;  3LNQ A;  1OIS A;  1U3E M;  4E7J A;  3BTJ A;  1Z7U A;  3FDY A;  3GTJ J;  1FSE A;  2L9S A;  1BW6 A;  9ANT A;  2EIL H;  5CI9 A;  4PFP A;  3LES A;  1AHD P;  1YO5 C;  2DFH A;  3OWT A;  4CHU A;  4XLN F;  1FMV A;  4N0B A;  2V9K A;  1FZP B;  3AG4 C;  2IGO A;  5JI6 A;  2BXY A;  4UUT A;  4BJ6 C;  4J7T A;  2V1N A;  2IGM A;  1G2H A;  5F27 A;  3I59 A;  5GPA A;  3GZ6 A;  1HW2 A;  2VBZ A;  1Z6R A;  4KN4 X;  3CJN A;  4UVA A;  3TKY A;  1I4Y A;  4C3I J;  3OEO A;  1JGS A;  3JTG A;  3E0J B;  2L7M P;  1EKE A;  4JX4 A;  4AVP A;  1JHH A;  4RB1 A;  5COG A;  4DBR A;  5AGF A;  5EEH A;  1GXP A;  3JSP A;  1S7O A;  2ZJR F;  3K1I C;  2XPW A;  3CCY A;  3CP8 A;  2V6E A;  3ZIB A;  2KL4 A;  1JR8 A;  2ZXP A;  2LY2 A;  1MND A;  5EDN A;  2M9H A;  3KP6 A;  4ENN A;  2Y3D A;  1DU0 A;  3WTU C;  4YFX F;  3F8C A;  3KYL A;  2LCH A;  2LP4 A;  4EM1 A;  1RJ9 B;  3HKK A;  3SQN A;  3AGT A;  2JA6 J;  1MBE A;  4YN0 B;  3EYI A;  3H0G J;  3J80 K;  5CQE A;  3TED A;  2VH3 A;  2DA3 A;  5B3S C;  5FLV A;  4IF4 A;  4ZDO A;  3MZH A;  4Z6Y A;  3VOD A;  4O7G A;  3E6M A;  2W85 A;  5B1A H;  4NTF A;  1RNL A;  1VQL I;  3S16 J;  4CA0 A;  1GLN A;  1RET A;  4YG2 F;  3GM3 A;  5CI8 A;  3K2Z A;  5HDG A;  1XCB A;  3C63 A;  3QPT A;  4S05 A;  3DKX A;  2V1X A;  2GOX B;  1OXK A;  3WHB A;  2AVK A;  2JSP A;  2XVC A;  2HVQ A;  1BI3 A;  5KK1 A;  1VQM I;  3B0U X;  3OYF A;  5GTH C;  1VTN C;  2MH9 A;  2CJJ A;  2ID3 A;  1TWG J;  5KYW B;  1VLT A;  5AC5 A;  3U5S A;  3L2W A;  3MFK A;  2FBK A;  1XPX A;  3ZG1 A;  3OR2 C;  3O8H A;  4MTF A;  2NOG A;  1WH7 A;  3M1C B;  1M2V B;  1JKR C;  1DOW A;  3LMM A;  2WZG A;  3DMD A;  3PMR A;  4FET A;  3Q7G A;  1Y56 A;  1Z3X A;  1ORY A;  2GA0 A;  3DFG A;  2AXT C;  3O2P E;  1R49 A;  2YQY A;  1T08 B;  3FXK A;  4DXW A;  2XSD C;  2KPM A;  4ZZL A;  1SYQ A;  2YLD A;  3I59 B;  5JVG F;  3GAN A;  4F4B A;  3ZWI A;  2HQ5 A;  4H0E A;  2M8E A;  2MC3 A;  1L7C A;  1YLF A;  3BCB A;  4JK1 X;  3PO2 J;  1T01 A;  2PN6 A;  2EIJ C;  5EJC A;  4RD9 A;  3T6J A;  4O79 A;  2ZXO A;  2DAO A;  1YYJ A;  1ZHZ A;  1U9O A;  4KMF A;  2W25 A;  2MA3 A;  1XGN A;  3K2A A;  3REO A;  1FFH A;  1FTS A;  4GYT A;  1BI0 A;  4IAR A;  4IGG A;  4B48 A;  2K3F A;  2R93 J;  1RMV A;  1BR1 A;  3R0A A;  3L2R A;  1I5N A;  2RVC A;  2VBX A;  3HBL A;  2HQN A;  3JRT A;  1FIA A;  2KFD A;  2L4A A;  5DDG A;  3QRF F;  5IT9 K;  3K4L A;  3DBL B;  2CW7 A;  5FLX K;  2PLY A;  3EZI A;  2G9W A;  1LNW A;  5L3C A;  2QYO A;  3TL4 X;  1OYW A;  3HUG A;  4A3C J;  2IXO A;  4EHP A;  1Z63 A;  3QPS A;  1K7A A;  2LTP A;  4HNU A;  5F5F A;  1Z7Q c;  4PJM A;  5FKO A;  4HF2 A;  3K4J A;  1I3A A;  4R79 A;  4JW1 A;  2AU5 A;  2IPQ X;  5C4X J;  1FC3 A;  4QI0 A;  2X0L A;  4BE0 A;  3RVZ A;  5CVI A;  4KC9 A;  2EB7 A;  3O3K A;  2YSR A;  2EIJ H;  1YJG A;  1JUS A;  4M63 A;  3TBI A;  3KP3 A;  3A01 B;  3KEQ A;  4BQQ A;  1MJB A;  1RKE B;  2HOS A;  4LFU A;  1TFK B;  3ZQH A;  2EFQ A;  1S9H A;  2HWV A;  3DM9 B;  4XQ1 A;  3S90 A;  4BAY A;  2LYC A;  4D4N A;  4KIT B;  3CME I;  1ZRD A;  3BT9 A;  4J7Y A;  3FWE A;  2FOK A;  5L0G A;  2R7D A;  1E86 A;  2F5C A;  2E35 A;  1VFC A;  4DGW B;  1U8R A;  2EPK X;  1SD5 A;  3ZMT A;  4OOI A;  3ZCO A;  3OY9 A;  2YEV A;  2BE5 F;  3U9J A;  2XL8 A;  4HOB A;  2BW3 B;  3U21 A;  2L7K A;  2ZFU A;  3VWB A;  2VT3 A;  2WZL A;  4XN3 A;  2DMQ A;  4QTR A;  2QBY B;  4JKV A;  3WU0 A;  2WA0 A;  1TWH J;  3ZOB A;  3RIR A;  4Y13 A;  3F0C A;  1BJZ A;  2P5K A;  3T1B A;  1B72 A;  2MAB A;  1NK3 P;  2N8G A;  2HQA A;  4L9T A;  5F0H A;  2LIG A;  4I98 B;  3ASN H;  4MEY F;  1V4A A;  4EQQ A;  2IS6 A;  5M5Y J;  2VIX A;  5DCM B;  5IT3 A;  4OWR B;  3QVY A;  3DTE A;  4YK5 A;  1YIO A;  3A0B C;  3MKY B;  4MS2 A;  5ERI A;  1VND A;  3QZC A;  4I09 A;  1P7J A;  1YW9 A;  2KQR A;  2AP3 A;  3KZZ A;  2LRD A;  1Q0D A;  3JRF A;  1T8I A;  4EJU A;  5J1R A;  4W8K A;  1F1Z A;  3EUA A;  1D5V A;  1AUE A;  2RGV A;  3DF8 A;  4HST A;  2VUM J;  1C03 A;  1XSX A;  5D8K B;  4LMY A;  1OR7 C;  3E5X A;  3ATP A;  4ZC3 A;  1WCM J;  1T39 A;  4CJG A;  3GTQ J;  3M4B A;  1O7F A;  1KU2 A;  2W82 A;  4A6D A;  1Z9C A;  1LPE A;  2ZFW A;  3B02 A;  5IT9 Z;  2KQ9 A;  3LSM A;  2LF8 A;  3WE3 A;  1VTM P;  4MNU A;  4I2O A;  3IC7 A;  2F2E A;  1K40 A;  3TW7 A;  3ZMD A;  2MH2 A;  4BJ6 A;  2VCB A;  3L2U A;  2EPN A;  1Y0N A;  3VPR A;  1A41 A;  3V8K A;  1PP7 U;  1O87 A;  2F4O B;  2GAQ A;  1SFO J;  4P96 A;  1HXD A;  3ZTM A;  2KJC A;  1TW2 A;  4YEJ A;  2W24 A;  3DEE A;  3B6C A;  3PM1 A;  2R5Z B;  1FBQ A;  3K0L A;  2K9L A;  1NLX A;  2LFF A;  3J81 K;  5EGY A;  2W4S A;  5KYY A;  4HAM A;  3FXM A;  4HRI A;  4Y3O A;  1HKT A;  1S6L A;  1NFO A;  2LK4 A;  1QZZ A;  1X1P A;  3WGI A;  5J47 A;  1W36 D;  3S15 J;  1JXS A;  2UXX A;  4GYI A;  2J45 A;  3AOU A;  4MVS A;  1EH6 A;  5K5O A;  1FTT A;  4BHB A;  5T1D B;  2HOA A;  4UV8 A;  4DQ2 A;  3E9V A;  1J7K A;  5LLQ A;  5F6F A;  1T9K A;  1R4T A;  4XEK A;  2UXN A;  4BXX J;  4AL1 A;  4X0G A;  1O3Q A;  4E0H A;  4HZF A;  4KNV A;  2FJ1 A;  3FHN A;  2OQR A;  4L5E A;  5LFA A;  2LBF A;  3GTK J;  3N2Z B;  5DQZ A;  4ZLD A;  3GEZ A;  5BNG A;  3TGN A;  1E3H A;  5J40 A;  4A0Z A;  2L5Q A;  5JS5 A;  3OSG A;  5E33 A;  5HLH A;  3MLG A;  2L6F A;  4YEL A;  1ITY A;  4P9F A;  4EBK A;  1TWA J;  1ZHX A;  5CVV A;  1V5F A;  4A3F J;  4D0P A;  2QQB A;  5KHD A;  2M8G X;  2CFX A;  2ZME C;  2JQ7 A;  4PCQ A;  4IWB A;  4MFD A;  5HNH A;  5CKT A;  4CSA C;  2G62 A;  3NWT A;  2NVU B;  2OQM A;  3TP0 A;  4NBQ A;  1I1S A;  3HNK A;  4RBN A;  3UGO A;  4II3 A;  4DJA A;  3ABK C;  1I27 A;  1CF7 A;  3JRM O;  1UEL B;  4U5F E;  3LQR A;  3BTL A;  3KYC B;  1GV5 A;  5A6A A;  1JKP C;  2W00 A;  1ZU4 A;  2XM0 A;  2DI3 A;  4JBA A;  2BGC A;  4YRV A;  4IVN A;  3JCU Q;  3F8B A;  2HKX A;  3I3L A;  2W1O A;  4IXA A;  1PVE A;  1IZ1 A;  1XG1 A;  4RM2 A;  1R36 A;  4RB0 A;  4A3G J;  2ZCW A;  2FF4 A;  1FNT c;  1ETX A;  4Q7C A;  2OJE D;  4MTD A;  4N9I A;  1OQY A;  1DU6 A;  4BEM J;  1HOM A;  1Y39 A;  3S1M J;  4OU0 A;  2QSF X;  4LIV A;  4JCH A;  2LP0 A;  4B4C A;  1QVT A;  2GA2 A;  4WK8 F;  1OQC A;  2XLW A;  2KRC A;  2R5Y A;  3QMK A;  5A6B D;  3A03 A;  1UST A;  1TP4 A;  4HFK B;  4U5G A;  5HDN A;  4TV7 A;  4HX4 A;  1HE1 A;  2DO7 A;  3HUG B;  3I4N J;  1YVI A;  1ZYR F;  1YHQ I;  3CDI A;  5LGU A;  5B1B C;  1WJF A;  4XMY A;  3CCE I;  4RLF A;  3HHG A;  1LI7 A;  4M3D A;  2NRA C;  1ZW3 A;  2XKP A;  2HDD A;  2PX0 A;  4BJ1 A;  1I4Z A;  1QZE A;  4BUP A;  1TQP A;  3EUH C;  4M6V A;  4XR6 A;  1N78 A;  3PUB A;  1WJA A;  2VLA A;  1LEB A;  3HKZ A;  4JX5 A;  3SXM A;  2FX0 A;  1D0X A;  1MGT A;  5ICF A;  5J6X A;  3M3Y J;  4ER9 A;  3SYT A;  1ZLJ A;  4ZYE A;  2RSE B;  3DAG A;  1XGS A;  5F1R A;  1BOB A;  3HJE A;  2P7V A;  1IXS B;  2E71 A;  3I4P A;  2R7F A;  2OC6 A;  4FT8 A;  2B7E A;  3CUQ C;  4GEH A;  4FES A;  3HGG A;  2RV8 A;  1CF7 B;  2TMV P;  2HTS A;  3PHF 2;  2HOE A;  2ID6 A;  3PFI A;  1Q0K A;  3KP7 A;  2LSO A;  3WG7 C;  3S0X A;  2NS0 A;  3EH2 A;  3SFZ A;  2Q9A A;  2PMH A;  1IV8 A;  3WHN A;  3T0Y A;  4CIH A;  4L18 B;  2QZ8 A;  3CO6 C;  2EWN A;  4UV9 A;  1W1W E;  3BR6 A;  3NYM A;  4CO8 A;  3KL4 A;  2ZJP F;  3BQZ A;  2XAU A;  2OTL I;  4K1O A;  1Y0U A;  1X2M A;  2ZD9 A;  1V4R A;  3JT1 A;  5E1Z B;  1TWH A;  2E34 A;  1OCP A;  2LMD A;  3OYD A;  4A12 A;  2YU9 J;  5FRN A;  2VN2 A;  2EZH A;  5FFZ A;  2Q2E B;  2ZC2 A;  4HNT A;  3OYJ A;  2QLZ A;  4EBB A;  5CPR B;  4EUK B;  4UVB A;  1IN8 A;  4NC6 A;  5LGT A;  1HC8 A;  1MBG A;  3FXQ A;  3CC4 I;  1ZVZ A;  2HZT A;  2EFP A;  2CQN A;  2EK5 A;  3I71 A;  4A3J J;  3RQE A;  4ZDL A;  4RAG A;  5DCF A;  2OKU A;  2Q8K A;  2BHZ A;  2Y31 A;  4ZDP A;  4EVI A;  4B6I A;  2M30 A;  1W0U A;  1BA5 A;  3WTV C;  3I5Q A;  2RC4 A;  2XLO A;  4E17 A;  1W5S A;  3F8N A;  1XN7 A;  2ESH A;  3FM5 A;  1OCT C;  2GWW A;  3TDU C;  2K85 A;  2XXA A;  1HKQ A;  3DBH B;  4B43 A;  4YT5 A;  3JYY A;  2DQL A;  2DFI A;  3I4M J;  3EHM A;  4MTE A;  4NC7 A;  3HGY A;  2CV0 A;  3B9Q A;  5DLJ A;  2H8A A;  4LD5 A;  3AGU A;  1ETW A;  2XIG A;  4A2U A;  4KA4 A;  1YX5 A;  2YLG A;  4UUS B;  3MZY A;  5FKK A;  1ZH5 A;  1TT0 A;  1CQT A;  2GBY A;  3Q0V A;  4PGG A;  4HLX A;  1QQ3 A;  2O0Y A;  2K9N A;  2AQF A;  4LG0 A;  3S32 A;  3HTS B;  1Q0F A;  1IUF A;  1MMN A;  1DDN A;  5EF6 A;  3IH2 A;  3LA3 A;  3BR0 A;  3MYF A;  3H0D A;  1OR3 A;  2Z2S B;  3D1N I;  2Y39 A;  3F3X A;  1O3R A;  1IJW C;  2WBM A;  3KPH A;  3P5J A;  3QW1 A;  4LER A;  4KMU X;  3BZ6 A;  2E7X A;  4O5V A;  1AA7 A;  1ENH A;  3CUQ B;  3M4O J;  3VYW A;  2DMP A;  2RD9 A;  3QOE A;  3B6A A;  5DTD A;  3V7R A;  1YYV A;  4IQ4 A;  3WTZ A;  1L3L A;  3E3V A;  1VQ8 I;  1HA8 A;  2HKV A;  3ERE D;  3S14 J;  2A0B A;  5CJ9 A;  3LAY A;  2L3D A;  2LBF B;  1YIT I;  3J7Z I;  2D5R B;  1HF0 A;  2Y75 A;  1Z23 A;  3GFI A;  4NCQ A;  2GA1 A;  4W97 A;  2VKE A;  2X48 A;  4RGS A;  2NUP A;  3C8Z A;  3FAJ A;  5IY5 C;  3SXZ A;  1A7D A;  2EJR A;  3C1D A;  2WY7 Q;  1SMT A;  2ELH A;  5TJJ A;  2ZXR A;  4CX9 A;  3HKZ N;  4CJO A;  2FEZ A;  4XRS G;  4DRJ B;  3ZMU A;  3HC7 A;  5D5U B;  3D5L A;  5LGN A;  4HBL A;  2CNW D;  3JRG A;  2M87 A;  4E7Z A;  1X1B A;  1PYV A;  3VSL A;  4O6Y A;  4DNC A;  1PDN C;  1ZRF A;  1T98 A;  4B44 A;  2HJM A;  3LOC A;  2RN7 A;  2XKO A;  2Z5U A;  4CCM A;  3L1P A;  4UNO A;  2E60 A;  3OMY A;  5B66 C;  1XMX A;  2JTV A;  3FXU A;  3CD6 I;  3GOR A;  5L3Q A;  3Q3S A;  2ZPA A;  1RIO H;  1PUF A;  3E1S A;  2MSY A;  2V6C A;  3L1M A;  2J9U A;  2MD0 A;  1MMA A;  3I0T A;  2PI0 A;  4U5E E;  4PAC A;  3Q0W A;  3ZQV A;  3H9J A;  4RB2 C;  2IRF G;  1G3W A;  2BY0 A;  5GPG B;  4BG0 A;  5LHG A;  2ZXI A;  2LD5 A;  4JIO A;  4XPX A;  2VBY A;  1F1M A;  3VAY A;  3T8T A;  2QSG X;  3PIP F;  3ROU A;  1BOA A;  1P6R A;  2I8B A;  1ETY A;  4BE1 A;  1IN5 A;  1TC3 C;  4KIS A;  2EA4 A;  2LKX A;  5TGT A;  1K78 B;  4PJJ A;  1YZA A;  2HFI A;  3P9C A;  4BBS J;  4ITV A;  1FY7 A;  5F0F A;  4LB6 B;  2R05 A;  1MIJ A;  2K4J A;  3K6B A;  3LLI A;  4DVZ A;  4LB5 A;  3AG3 H;  4CGZ A;  1FOK A;  1T6Q A;  3K1I A;  3K70 D;  2K4B A;  3K10 A;  4RGX A;  5IP6 A;  4XTK A;  2KIS A;  3HZJ A;  2P6V A;  4LLE A;  1W4M A;  3QQA A;  4AWX B;  3JRC A;  2HU9 A;  1R71 A;  1IG7 A;  2C04 A;  2LLK A;  4QPO A;  1OFC X;  3FXR A;  1WJB A;  1IN4 A;  3R6S A;  3GX4 X;  4CS8 A;  1J9I A;  4LDR A;  2W57 A;  3M9A A;  2J9V A;  1FWZ A;  3NAR A;  2R92 J;  2X6W A;  4A93 J;  2K9M A;  1YI2 I;  2Z33 A;  3W6K B;  3J81 Z;  3G1O A;  1O3S A;  5H6R A;  5D8L B;  2ZKZ A;  3EQL F;  5EGO B;  1B9N A;  1K4T A;  3FM3 A;  4YFK F;  2H8W A;  2JA7 J;  1OYI A;  4UXN A;  4KNW A;  3MYI A;  2M3A A;  3HTK C;  2VQL A;  1O57 A;  4ULW A;  4A2N B;  1Y1V J;  2FE3 A;  4QDL A;  2XB5 A;  3AG4 H;  5BOX A;  1D0Y A;  1ETK A;  3LFU A;  4LGW A;  4EEF G;  1ZLK A;  1FFT C;  3AG3 C;  2DQR A;  3LUT B;  2Y2Z A;  3KIO A;  3O8G A;  2CH0 A;  4C2T A;  2M7B A;  4WXH A;  3Q7L A;  3S2H J;  1M56 C;  2HV6 A;  1R6R A;  4R8H A;  4EM0 B;  2KSF A;  4M9S A;  5FRM A;  3KX2 A;  1C0W A;  2VAS A;  3OIP A;  3KMI A;  3OYA A;  3HOW J;  1UG0 A;  2F5F A;  4DZP A;  3ZVR A;  1W5C C;  1AKH A;  2Q2E A;  1UJ8 A;  3AG1 C;  4YJW A;  3KEY A;  4XEF A;  5KYU A;  3DCF A;  3MQ0 A;  3NDB B;  3JR9 A;  2NNY A;  5J8F A;  1TWA A;  3SEZ A;  1BIA A;  1JMW A;  4RAZ A;  1FOX A;  2YL0 A;  4NDL A;  3A11 A;  1YZC A;  3F9K A;  4BYY A;  1ZRE A;  3EGD B;  1I6X A;  4L0Y B;  1M2O A;  2HMQ A;  1G3Y A;  1S7Z A;  3EG9 A;  2DOF A;  3K1H A;  2BOL A;  1F5T A;  3ZRG A;  5HLI A;  2LFB A;  1HLV A;  3W2V A;  4I99 C;  2PMZ A;  1HDP A;  5T3T A;  1WFX A;  4E70 A;  1SVO A;  1UZC A;  2GOM A;  1Y1W J;  3OYC A;  2IYL D;  2A6E F;  2DW4 A;  2XAS A;  2K27 A;  3DKA A;  3CO7 C;  2JVH A;  1X2N A;  2A6H F;  2KZG A;  1G3S A;  3HOZ J;  3DU5 A;  5ILS A;  2PJR A;  2LFD A;  2NSG A;  2FU4 A;  4M3F A;  4MTO A;  1VF9 A;  5J4V A;  5M5X J;  1P7I A;  4BDZ A;  5DS9 A;  3MMY B;  1ON2 A;  2KKO A;  3WTW C;  1Y8Q B;  3DQV C;  4L5J A;  5GAG J;  1QO0 D;  5E20 A;  1EA3 A;  4EJV A;  1IAW A;  3BG5 A;  5FD6 A;  1MBK A;  5KAF C;  1V5G A;  3G2B A;  3QYB A;  3H92 A;  3KET A;  4FQG A;  5F0C A;  4HV5 A;  5FRO A;  4E4H A;  4YIR X;  3G4Z A;  1BW5 A;  1T0F C;  3CCM I;  1A6I A;  2Z15 A;  1U0B B;  4HQE A;  4BDY A;  3FKI J;  2HPI A;  5KYU B;  2DT5 A;  3CCQ I;  3TMO A;  2YPR A;  3I4U A;  2EPO A;  2BBY A;  4A5M A;  1WKM A;  2R7W A;  4HE8 D;  4HSR A;  4DYQ A;  2YWA A;  3HLZ A;  5DS6 A;  3BP8 A;  3EFO B;  1SVM A;  3V8L A;  1I1G A;  1VI0 A;  1E3O C;  1JUM A;  3H9Q A;  1DP3 A;  4LLG F;  3VDX A;  1GM5 A;  3FIS A;  1F43 A;  5JLI A;  3I54 A;  3ZQI A;  4KUM A;  3P9K A;  3PJR A;  1K04 A;  3FK7 A;  1XC5 A;  1HST A;  4DRH B;  1UHM A;  1U5T B;  5F08 A;  5EEA A;  4BY1 J;  4FIS A;  2HZ8 A;  2A5W A;  4FX4 A;  2LRE A;  4M3B A;  1ORK A;  1FMW A;  1JUP A;  3SJM A;  2WAQ A;  1X4O A;  1P9Q C;  2FUG 2;  2Q0O A;  1DPR A;  3WE2 A;  1LB2 A;  4Q5S F;  2UUH A;  4XRM A;  4CCO A;  2VOD A;  4CBE A;  5DM6 F;  3E6C C;  4MVU A;  2EFW A;  2IA2 A;  2QWW A;  3GTL J;  5L0I A;  3RIP A;  3LSJ A;  3BPV A;  1LE8 B;  1TFO B;  3K33 A;  4EGZ A;  3NRV A;  3BY6 A;  4BEH A;  3LS0 A;  2CUE A;  5ILU A;  1N25 A;  5K7H A;  4UY8 I;  5FZT A;  3OYG A;  1I6H J;  3TD7 A;  2XGX A;  4BHC A;  3H3Z A;  3A2K A;  2WB1 A;  3SFI A;  1QHG A;  4L9V A;  1ZK8 A;  1QU3 A;  4MHG A;  5B1B H;  3ZR8 X;  1TTY A;  1MSE C;  5F5H A;  1JT6 A;  4MQ9 F;  4L9N A;  5HS7 A;  5D5X B;  1M57 C;  4G7H F;  2VPL A;  3UMK A;  2VI6 A;  2Z16 A;  2XPU A;  5TRD A;  1GVJ A;  5D6F A;  5HS8 A;  2L0K A;  3EYY A;  3TOL A;  1B6A A;  1LUJ B;  2COB A;  1FPQ A;  3DTI A;  2IJL A;  2RQQ A;  3V42 A;  3TOM A;  4YWQ A;  3IL2 A;  1Z1D A;  4HV6 A;  4LOC A;  4F92 B;  2G7H A;  4ENK A;  4RDU A;  2KRH A;  3LAJ A;  2ME6 A;  2CWE A;  4M71 A;  2IW5 A;  1APC A;  3PNT A;  3QPH A;  2F4M B;  2FSW A;  1ETO A;  3P9I A;  5GAE J;  3T9O A;  1YAU O;  3TW6 A;  4I6Z A;  2JA8 J;  3UR3 C;  3OYH A;  3CF5 F;  3S1N J;  1GVD A;  4K0D A;  3IQ6 A;  3GWL A;  3FIW A;  4Z2Y A;  2B0J A;  2DK8 A;  2XXA B;  1T6U A;  5H6Q A;  1RXQ A;  1H89 C;  4LIT A;  2STT A;  1IRG A;  2PNO A;  2O5R A;  4MQV A;  256B A;  2Y9Y A;  4DYR A;  1S29 A;  1Y6I A;  2XGC A;  1X4P A;  1P4W A;  5KYX B;  4XRS A;  3HNL A;  2DCE A;  2KIU A;  1XMK A;  3FXH A;  3EUH A;  5KVR A;  5C4J J;  1SEU A;  3OYI A;  4FX5 A;  4AM3 A;  3LSP A;  2XUB A;  4MND A;  4BAC A;  1A04 A;  2I15 A;  1V54 C;  2XS1 A;  4KBL A;  2LR8 A;  4CZC A;  3M8E A;  1O3T A;  5DCM A;  2NS7 A;  2D5V A;  2ZO4 A;  1R1U A;  2M1B A;  4ANJ A;  3SEO A;  2CSO A;  4EJT A;  1ETQ A;  1I5Z A;  2EQR A;  3BG6 A;  2R7X A;  1UB9 A;  3DXJ F;  1UG7 A;  1VQO I;  1FX7 A;  2HI3 A;  1IO2 A;  2VJI A;  4GYG A;  3GZN B;  4CIC A;  2F6C A;  2QY9 A;  2P1A A;  3VYS B;  2J0X A;  2M7A A;  3BDD A;  2JUG A;  4N4W A;  2E5Z A;  3SXY A;  1TKN A;  1YS6 A;  3KP5 A;  2HXI A;  2JPU A;  4NQF A;  3SDB A;  2K5C A;  3LSK A;  5CVJ A;  3S3M A;  2VJ4 A;  4HX8 A;  2R3S A;  3BC8 A;  1TL8 A;  2E2H J;  3T8R A;  1U6H A;  2F48 A;  5C3E J;  1ZRC A;  4OIP F;  1SC7 A;  3OYE A;  1HDD C;  3ECH A;  1T5O A;  5E3L A;  1FYK A;  2JJ7 A;  3H5R A;  2XGD A;  2FBI A;  1HCR A;  2WVN A;  1QZY A;  1X19 A;  4U9D A;  1LPQ A;  1QPI A;  1QVX A;  4U7B A;  1F9N A;  2P0W A;  1WWX A;  2YX4 A;  1MMG A;  2H94 A;  2Q1Z B;  3S29 A;  2AS5 F;  1WAT A;  4Y4R A;  3MZ8 A;  4O3M A;  2ZB9 A;  1SVL A;  2ECB A;  2LSE A;  1O3U A;  2ZXJ A;  3GME A;  2HGC A;  4ENJ A;  4RA2 A;  3SXK A;  4OMZ A;  2QTV A;  3LNR A;  1BC8 C;  1ONV A;  4O6M A;  1F36 A;  3BLY A;  2V4J C;  3JAM K;  2JWT A;  4XPY A;  2HYG D;  2R02 A;  1PP8 F;  1HY5 A;  2M5W A;  3KYD B;  3ASO C;  3UGP A;  2OCC C;  3ASN C;  1WJE A;  3WTX C;  1KU3 A;  4HDU A;  4MVZ A;  6PAX A;  5E8G A;  1RCP A;  2H1K A;  3KLO A;  1IC8 A;  3S84 A;  3K66 A;  4BS9 A;  3V8J A;  5M3F J;  3U8P A;  2ZSH B;  3I64 A;  1LE4 A;  1JPJ A;  3QU6 A;  4C3H J;  1OCO C;  2BXZ A;  2E1O A;  1WWP A;  4L5I A;  1WZ2 A;  4KIG A;  2HOT A;  3FOP A;  1SF8 A;  4RMN A;  4P5O A;  1Q1H A;  4UB6 C;  2YRF A;  1N1C A;  1SD6 A;  3RYR A;  4DIQ A;  2VOP A;  2EIM H;  4QSH A;  1A31 A;  3C2H A;  3EFO A;  5GTI C;  3ABK H;  4RAY A;  1PCX A;  2NYX A;  3NMI A;  3TJ6 A;  1EH8 A;  5F04 A;  3N4M A;  2HDC A;  1T33 A;  2W48 A;  2QSH X;  4IB4 A;  2IS4 A;  3GFJ A;  4CS7 A;  5TIS C;  4WGY A;  1XCV A;  3HG9 A;  3NG1 A;  2DMU A;  5ICE A;  3L7W A;  1RKE A;  2H8R A;  2VC0 A;  2QBY A;  4KT6 A;  2XLE A;  1YX3 A;  2CGE A;  2GDC A;  3AG2 C;  1PUE E;  2X1C A;  5DUI A;  3WTT C;  4YT2 A;  5EYR A;  1EH7 A;  4LDQ A;  4XLA A;  2HS5 A;  3M1C A;  5A2Q Z;  1V55 C;  1JRA A;  3S27 A;  5JVE A;  2VBW A;  5L3D A;  2XS8 A;  4XIC A;  2D2W A;  5F1J A;  1NBB A;  2JRT A;  1X3W B;  2YUS A;  3LS1 A;  2EBI A;  2M2E A;  3CEX A;  4O6J A;  4BQN A;  3AL0 C;  2QKL B;  3FKJ A;  3W8H A;  2L9V A;  5B3S H;  4WXC A;  3OA1 A;  3FHD A;  3UMH A;  3V7S A;  2VCA A;  5DEQ A;  1BN5 A;  2V1D A;  1F4K A;  5HV9 A;  2A68 F;  3VYT B;  2EPF A;  3D5S C;  4UUV A;  2GXB A;  4X6A J;  4ONS A;  1MH4 A;  5D6E A;  2PF4 E;  3IQ5 A;  3TJ5 A;  1MMD A;  2O6G E;  4E7S A;  2Q00 A;  1FTZ A;  3LEO A;  4D4X A;  1N75 A;  1J2X A;  1W0T A;  5CVU A;  3BRO A;  1WRJ A;  1G5Z A;  1LFU P;  3WTY C;  3PCV A;  3UMI A;  3CC2 I;  1BIB A;  3GO5 A;  1R1V A;  3MD2 A;  4B09 A;  5KNL A;  3L2V A;  1AKH B;  5FKL A;  2VCC A;  4I01 A;  1VK5 A;  2P7V B;  1VQ9 I;  2NG1 A;  4IOA F;  4C3B A;  4J32 B;  3BTC A;  1KQ8 A;  3VSK A;  3V5Z A;  4YT8 A;  1R23 A;  1SAU A;  2X6X A;  3DPT A;  3ECO A;  2OEX A;  1YS7 A;  4HFF B;  5IP9 J;  1WGW A;  3TK0 A;  2QQ8 A;  2ZJ2 A;  4XKV A;  1Z7L A;  3L2Q A;  5KYN A;  3PO3 J;  3S9O A;  2Z3Y A;  1FR0 A;  1KU7 A;  1NFN A;  1T2K A;  2DYR C;  5GP9 A;  2R03 A;  5FLM J;  1HKS A;  2DYS H;  2V79 A;  5EGO A;  2DA1 A;  4LDK A;  4UDV A;  2JN6 A;  3ABL H;  1W7P D;  1SAX A;  3G4X A;  3KZI C;  2QF7 A;  5E3A A;  5AIP A;  3ZSU A;  1E83 A;  2K40 A;  4GDF A;  1KON A;  2E1C A;  1XGM A;  5CYV A;  4OIR F;  1SAN A;  3IPM O;  4M73 A;  2KLO A;  4HYE A;  2I10 A;  1R4N B;  3OYK A;  3DM5 A;  1ZAO A;  3AQB A;  2DFE A;  1K6Y A;  2MD5 A;  5FB2 A;  3BJO A;  4P6I C;  1ZG1 A;  2P61 A;  1FEX A;  1VYK A;  2FA5 A;  4A5N A;  4WCG A;  3F21 A;  3B29 A;  2ZME A;  3IAM 2;  2B9S A;  2KHM A;  1ZGA A;  3HSF A;  2EIN H;  2UV1 A;  2HYJ A;  1QPM A;  3DEU A;  2R9R B;  4YT4 A;  3ZC4 A;  1YW8 A;  3R7C A;  4CYD A;  4ZYD A;  4GQH A;  1WJ5 A;  5KYX A;  5BQG A;  1W2W A;  1FIP A;  4GXO A;  4WF2 A;  2R7R A;  2E2I J;  1TQM A;  4OD5 A;  1Q0M A;  3OYM A;  1ETV A;  4AIH A;  3H65 A;  4PJ0 C;  2Y0S A;  1K4S A;  1HW5 A;  1GXQ A;  1MBH A;  3C2G A;  3J7Y J;  1ZHW A;  2O3F A;  5COM A;  3G3Z A;  3U2L A;  2M34 A;  4AL0 A;  1RES A;  2NXN B;  1B9M A;  2P8T A;  3W3C A;  1YA7 O;  3R4K A;  2GQQ A;  2MHR A;  3V5Y A;  1OJL A;  3MKL A;  2O8X A;  4PSX A;  3M8J A;  4WX9 A;  1AU7 A;  1EI7 A;  4KIF A;  5L3G A;  4BEH B;  1RUN A;  1LFB A;  2G3V A;  5A6B A;  1VQN I;  3CAX A;  3EGX A;  4MVO A;  2K9Q A;  1EF4 A;  3KEO A;  2CG4 A;  3ULQ B;  2K86 A;  4C2M J;  3IEE A;  2FBH A;  2HNH A;  4HEA 2;  4F7Z A;  4JOM A;  4UVC A;  4XLP F;  4AE4 A;  2RQP A;  3ZDL A;  3PSI A;  2E1M C;  1JTX A;  3H35 A;  1DOV A;  1S05 A;  1A7E A;  2EIN C;  3VOE A;  3BWG A;  3GBG A;  4Y17 A;  3JCU C;  1KNY A;  2ETH A;  2P7C B;  3OL3 A;  3GLX A;  2A3S A;  4AC0 A;  2WC2 A;  2BL2 A;  2HJ3 A;  3QVZ A;  3VRC A;  5A6J A;  4JQF A;  5DV5 A;  1U5T A;  2MYS A;  1JE8 A;  4KYW A;  1KQ9 A;  2EFN A;  2R7V A;  2WB1 N;  2CQ7 A;  1YOV B;  5BQT A;  3J06 A;  1RKC A;  3FXL A;  2IGN A;  4PGH A;  5KYY B;  4LG0 B;  1RPW A;  2R5Z A;  5DM7 F;  2DLL A;  4XOP A;  2OEV A;  2CMP A;  4NC8 A;  4JVS A;  4RLQ A;  2XL4 A;  3Q0U A;  1B4A A;  3DLA A;  3TQO A;  1XB4 A;  1GV2 A;  3BZK A;  4HEA J;  1D5Y A;  2YR2 A;  2Y9Z A;  3DKY A;  2QNL A;  3IP4 B;  1SD7 A;  2BV6 A;  3M15 A;  4H54 A;  2L01 A;  3BCA A;  2VPR A;  4EV0 A;  4C7O B;  3BZC A;  1X3Z B;  3KE2 A;  3QP6 A;  4V19 K;  1Z05 A;  3Q5F A;  3NRH A;  4EMS A;  1JHF A;  5E8I A;  1QA6 A;  5D5W B;  3PFY A;  4IOC F;  1OR2 A;  1WI9 A;  2XF5 A;  2JX0 A;  3HOU J;  4ZYG A;  4EBJ A;  2LC2 A;  2IT0 A;  3S2D J;  5H20 A;  3CQZ J;  1Z5Z A;  3D5R C;  4QWQ A;  4G78 A;  3N24 A;  1WI3 A;  3A1Y A;  4NUB A;  3GVA A;  3QW0 A;  1G59 A;  4DVY P;  3IRR A;  3LQQ A;  3ERM A;  2A1D D;  4K7B A;  5BPI A;  1QKR A;  3OIO A;  1YW7 A;  3MVP A;  1WPK A;  3US6 A;  3CCV I;  4G94 A;  4XLC A;  2EIM C;  3MKW B;  1MH3 A;  5JP7 A;  2V9P A;  1NSG B;  4XLE A;  4FTH A;  4ZZD A; 
#chains in the Genus database with same CATH homology
 2ICW G;  1R5I D;  2OJE D;  3KPH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...