2LIGA

Three-dimensional structures of the ligand-binding domain of the bacterial aspartate receptor with and without a ligand
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
157
structure length
157
Chain Sequence
MGGLLFSSLQHCQQGFVISNELRQQQSELTSTWDLMLQTRINLSRSAARMMMDASNQQSSAKTDLLQNAKTTLAQAAAHYANFKNMTPLPAMAEASANVDEKYQRYQAALAELIQFLDNGNMDAYFAQPTQGMQNALGEALGNYARVSENLYRQTFD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chemotaxis
molecule keywords ASPARTATE RECEPTOR
publication title Three-dimensional structures of the ligand-binding domain of the bacterial aspartate receptor with and without a ligand.
pubmed rcsb
source organism Salmonella typhimurium
total genus 62
structure length 157
sequence length 157
chains with identical sequence B
ec nomenclature
pdb deposition date 1995-04-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.30 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Aspartate receptor, ligand-binding domain 2ligA00
1WASA 1WATA 4H54A 2D4UA 1VLSA 2LIGA 4Z9HA 1VLTA 4Z9JA 3ATPA 1JMWA 1LIHA 3T9OA 4Z9IA 2ASRA
chains in the Genus database with same CATH superfamily
1G5ZA 2HZ8A 5A6BD 2OU6A 3EG9A 4JRZA 2UUIA 3PCVA 1QPUA 4AK9A 1U0BB 1M57C 1S7ZA 1O3UA 2VASA 3DWWA 1B68A 4YWQA 1VOMA 4MQ9F 2GDCA 3RVZA 1ZZPA 2GWWA 5B1BC 1EKYA 4MW8A 4Z9HA 1LPEA 2E87A 4JKVA 1TQGA 2ZXOA 1WWPA 2PBEA 3DE8A 3K1IA 4DVZA 3S90A 2M4EA 3HKKA 1WASA 1XWJA 4PFPA 3SXZA 3SNHA 4JIOA 1V54C 2J0WA 2NSFA 4U5DE 2AU5A 4N6CA 2XL8A 1NSGB 2WVQA 2YEVA 3ATPA 3SXMA 2R7SA 3H2VA 4BJ6C 4BJ6A 2NUTA 1LVKA 3F46A 2XLHA 4XPYA 4IRUA 2JPUA 3DKAA 1YZCA 1ST6A 3IEEA 4FESA 4HEAJ 1E2XA 4MVMA 4AL1A 2CNWD 2P61A 4E17A 2A6HF 1YARO 2M64A 2B0HA 1ORYA 5A6BA 2FGYA 3UGPA 2MWQA 4YK5A 5EGYA 5KYUB 3J06A 2A69F 2XM0A 4IWBA 2J9UA 1Z6AA 4XTKA 4G7ZF 2XLOA 2YL7A 1YAUO 2EPLX 2KJGA 3CEXA 1DOVA 2HJMA 3C8GD 2Q4FA 3FOOA 3LJBA 4PJNA 3RQEA 5B3IA 1E85A 3BRJA 4J7YA 4NQFA 1NFNA 1CGNA 2QLAA 1UFBA 2L81A 2GA0A 2KK1A 2W4MA 2YZSA 3CQZA 3EFOA 3NMKA 4MVOA 1JPJA 2LSEA 3Q6MA 1AEPA 4BJTA 3RQFA 4CS8C 3EQLF 2OJQA 1UG7A 2LCHA 4F4BA 1CPRA 4W8PA 5DQZA 4U5GA 4C7OB 4GQHA 1FR0A 4Q4ZF 1N1CA 1TFKB 4EUKB 5FZTA 1G8XA 3VAYA 3FMSA 1RCPA 1HMOA 3HLZA 2PNOA 3TK0A 2J45A 1E84A 3ITFA 2VCAA 5T3TA 1VB5A 1ORSC 2J9BA 2Y3BA 3B9QA 3NRHA 3NYJA 2VH3A 4OD4A 4PR9A 5JP7A 5T3WA 4BJ5C 2V26A 5COMA 1A0BA 3L8JA 4BJ5A 4H54A 2HJ3A 2XXAB 4EHPA 2HS5A 5TJ5E 1CGME 2VC9A 4O79A 4FWVA 1D1AA 3M15A 4AE4B 2KSFA 4CDVA 4EIYA 1NFOA 2XS8A 1YA9A 1FFHA 2J9VA 3IQ6A 2R03A 4K0DA 3POVA 5L3QA 2NSGA 2Q3TA 3HJCA 3AQBA 4KC9A 2IXMA 2DB4A 5L0FA 3B0UX 4CDYA 4QI2A 4XLNF 4JW1A 5CI9A 3UR3C 3V5ZA 2PX0A 3RFYA 2KNHA 2P7VA 3U0CA 2B0JA 4XPXA 4C3EA 3KPHA 3TJ6A 2MHRA 3L34A 3WHNA 4ZLDA 3G4ZA 2UUHA 1RMVA 4RD9A 3W8IA 1GQAA 1Q0GA 3KYIA 5K0IA 1J8MF 2NUPA 3LUTB 1T5OA 1BDJB 4K7BA 1GS9A 2A1DD 1H7IA 3FVYA 5IY5C 4O6MA 1OR3A 5L0DA 2G3VA 2EIMC 1TKNA 1M2VB 4Q7CA 1D0XA 1VYIA 1XZQA 3DZAA 2R7XA 3Q7GA 2YQYA 5CIVA 2R02A 2WVOA 3ABMC 3T6BA 3EZIA 2LFFA 4EBBA 5KYWA 5L0IA 1T6IA 3AOUA 2VCBA 2PFDA 2OG2A 2LQGA 3DJNB 5JVEA 3UMKA 1JAFA 1OR2A 3JSEO 2A6EF 2G3KA 3JYYA 3MYIA 4J32B 4JEAA 4XPWA 4U5EE 5AC5A 3NMIA 3U9JA 2XSEA 1O87A 2CDQA 1RJ9A 1ZHTA 3HNLA 1G4WR 3U2MA 3AJMA 3U8VA 4I1OB 4LDKA 1Z23A 3UGOA 3EZHA 2H7OA 2YLGA 1RXQA 4CDAA 1ZU4A 2CNWA 4IB4A 3ABLC 4Z9IA 5JT4A 1NZEA 2J7PA 3S0XA 4MTOA 3NKDA 5KYXB 4DBQA 3HNJA 4N06A 5E2QA 3O6XA 2IYLD 1K40A 3N24A 1R5ID 2AVKA 1R4TA 1D1CA 2Y3GA 2LK4A 3G50A 2KGOA 1HW1A 3S9OA 3U2LA 3EGXB 4NY3A 2DYRC 3JT1A 3L8IA 4MVZA 3AG3C 2LFDA 3VM6A 1KTMA 1QLEC 5L0JA 3H2UA 2LD6A 4H4KC 4ER9A 4E0HA 1YVIA 1T6QA 3DAGA 3LEVA 4GYTA 2EIKC 2O9XA 3TQOA 3EH1A 2FFHA 3CZ6A 3OEOA 4IGGA 3B0VC 2NPUA 3K1IC 3TJ5A 1OCCC 3FAPB 4QDLA 5F5FA 1VLSA 3DXJF 1ORJA 1MMNA 1HE9A 3DM9B 5A69A 2L9JA 2F22A 2C04A 4EWCA 3C62A 1QSPA 2HUJA 1PCXA 2JX0A 3JRTA 3H65A 4I3MA 3ZSUA 1H6GA 1YYXA 3ABKC 3PMRA 4WGYA 3GWNA 4DRJB 2L6HA 2P6VA 5B1AC 1MQVA 1T01A 3U3FA 1BBHA 1WN0A 1I5NA 3FDQA 2J7PD 4P9TA 2A0UA 1AVOB 3Q6NA 4O7GA 2XS1A 4K1OA 3TOLA 2A0BA 3C8GB 2FAPB 1TWAA 1HMDA 1K05A 3G4XA 3N0TA 4HE8D 2PX3A 1RKCA 4I44A 2XRHA 4ULVA 4AX2A 1VK5A 1Q0KA 2Y39A 2Y69C 3GEHA 1J8YF 5D92A 4C7OA 3V5XA 1VLTA 1D0ZA 2LP4A 2QUPA 4JTAB 2ZXRA 3GM3A 2P0NA 3I5QA 1Z3IX 3SYNA 2X51A 2XLMA 3RKOF 4J7TA 4XEFA 3T6GB 4DVYP 3LEOA 3HNKA 1HE1A 1JOGA 1PV3A 1JMWA 4QI0A 3TD7A 5KYYB 2DYSC 2H8AA 3VRCA 2W45A 1CGOA 4OIQF 3IHUA 4ZLCA 4ANJA 4JEBA 2EPNA 1Z5ZA 4IAQA 2Q9AA 4DBRA 2YL1A 4NTAA 3I4UA 2CYDA 3O39A 4CS7A 3S29A 3OWTA 1V4AA 3SZRA 3ASNC 1ZU5A 1M6TA 1KNYA 3JYHA 2J46A 2WZGA 4AE4A 3R2PA 4U9EA 2CW0F 1ZVZA 2H7BA 3HNIA 3MBGA 5E33A 5DQTA 1BR2A 2WZLA 1I4ZA 1HW2A 4J30B 3NMJA 3EGDB 4JZAA 3LS0A 1OW8A 4XEVA 2I8BA 1YA7O 4MVUA 3UNGC 5BUOA 1Q0DA 2L7AA 3JZ0A 4UDVA 5DS5A 5E3AA 1A7EA 1Q0FA 1A7DA 2HFIA 3W2VA 1JPNA 3PDMP 1Y6DA 1YZAA 4LLEA 3DE9A 2AWCA 1D1BA 3K1HA 2OKUA 1YYJA 4MS2A 2IXOA 3KH2A 1ZW2A 2IXNA 3RF3A 1PD0A 3RW0A 2H7VC 4G0HA 1SF8A 4IJJA 4CJGA 3GM2A 3ZQVA 1OCRC 3IQ5A 4PJMA 3W4YA 4OD5A 2WB7A 1M2VA 4D4XA 1XZPA 4LDRA 3NG1A 3DI5A 2KW3C 3QVZA 4YT5A 1MNDA 2XM4A 4MVSA 1ZHYA 3GEIA 4HFKB 4ONSA 4IARA 4XEKA 5COFA 5F28E 3VYWA 5DLJA 3ZIBA 4YT2A 2P1AA 1LS4A 4XLPF 1WGWA 2WZFA 2GFHA 4JTDB 2Q9BA 3C7JA 3EH2A 3L1MA 4BPMA 4EBJA 5JUAA 2R7TA 3JTLO 1FFTC 2R7QA 4O6YA 2IOQA 2VB6A 3AGTA 3T9OA 3TOMA 4PACA 4YL3A 5DS4A 2QY9A 3DMDA 3GORA 1OKKA 1NU7D 3X1OA 4KNVA 4U5CE 2R25A 3M4CA 4B6IA 4FAPB 2JD3A 4JTCB 3SP1A 1E86A 4PJLA 1TWGA 3CSKA 4XWJA 3ZG1A 5BQIA 1OXKA 1RKEB 2YRFA 4FX5A 4NC3A 3MFNA 4X0RA 4Q5SF 4U5FE 4OIOF 2Q9CA 3FHDA 4AL0A 1IW7F 1OXBA 4P9FA 3EGXA 4U5HA 1V55C 2ZXPA 2C03A 1QKRA 2I15A 5DVWA 2RD9A 1ZHWA 5A6KA 5JRAA 2X0CA 4CIHA 1EA8A 2R9RB 2HV7A 3U9MA 5F5HA 3JSZA 1BZ4A 2IBFA 3A11A 1F1MA 1LE4A 1NBBA 2J8WA 3KYJA 2W9YA 4R32A 2BL2A 1S05A 3T4RA 2PP4A 1WOLA 1C03A 2EPKX 2OEVA 3K33A 3FOPA 4CBEA 3I5PA 4JCHA 4N6HA 3LLKA 3TULA 1NG1A 3SEOA 2L6FA 2D5RB 4LDQA 4KNWA 2CCYA 1OCOC 2HKVA 3KKBA 3AG4C 4MVQA 2J0XA 3WG7C 3ZC4A 2VCCA 3AG2C 3N2ZB 3U5SA 4YT4A 1O5HA 3FXHA 1C02A 1OKKD 5COGA 5HSWA 3LNMB 2R7WA 4DJ9A 1U89A 1JRAA 1ZHXA 1QQ3A 2IM8A 3IPMO 2W4BA 1OCZC 1RJ9B 5KYUA 4PK4A 3UMHA 2ICWG 3LNRA 1FMWA 3NYLA 5A6JA 4MVRA 1PD1A 2ZD9A 1BR4A 4EKWA 1ZW3A 4E0IA 5L0GA 2YKZA 4CIPA 4A2NB 1EQ1A 3C8ZA 3O55A 3X2QC 4CJOA 2EPOA 4JC7A 2XLEA 3B0PA 3SXYA 4LACB 3B29A 2KYHA 1FAPB 1V74B 1SMYF 3JRMO 4WJ0A 3T6JA 5L0CA 3UMIA 3W8HA 4BG0A 4OIPF 4G78A 4YN0B 3QTHA 5HV9A 3EG9B 1CPQA 2YVKA 2HSBA 5JLIA 1A7VA 2TMVP 4YL1A 1BR1A 1H9TA 1LM3B 1QZXA 3NYMA 5KYYA 2Y3DA 5BQGA 3E9VA 2QTVA 1W2WA 4C3BA 3QW0A 3RH3A 1LE2A 1ZYRF 5DS6A 5E3CA 5EHHA 3EHMA 4GEHA 5CI8A 1H9GA 1D0YA 1T9KA 4KBLA 2WVNA 1YDIA 1Z7Qc 1IZMA 2Z15A 4JJGA 3VF0A 1M2OA 2NUTB 2HSQA 2Q00A 1SYQA 4G7HF 4OIRF 2YWAA 4E18A 2XXAA 1A41A 1L3PA 4IAOA 3EGDA 3AQCA 1MMGA 2G62A 2DGJA 3SXKA 1T6UA 3M79A 3ZWIA 5A6AA 5AC4A 1Q0MA 1DOWA 4KI2A 3GEEA 2KQ9A 2OJED 3JCUQ 4A4AA 3QVYA 5B3SC 4G7OF 4YJWA 5JS5A 3K66A 4CS8A 1LS1A 4U9DA 3GM1A 3EHNA 4MNDA 1FNTc 3W2WA 3M4BA 1Z63A 2LIGA 5FCLA 2L6GA 2HMQA 1TFOB 3AG1C 3IQCA 3U3BA 4WABA 1YLMA 2PF4E 3C63A 4OINF 3ZVRA 1ZHZA 3EFOB 2NG1A 2HV6A 3K7DA 3RIPA 4L6RA 4LERA 3MX3A 1K04A 5D91A 4E7SA 4EBKA 3ZTMA 3WODF 4PFOA 4JE9A 1LI5A 4D4NA 2BC5A 1NU9C 4CSAC 5T1DB 3OA1A 2V3CC 2EIJC 4ULWA 2GAQA 1MNEA 3QZCA 4JVSA 4JJFA 4CSAA 4RBNA 2HMZA 1G4US 2DI3A 2OEXA 1WATA 5L0HA 2R7UA 4YL0A 2R7VA 4MW3A 3BEHA 4JURI 1HY5A 2YLDA 3ECSA 1VTMP 5EK0A 2AP3A 2D4UA 1OW6A 256BA 3RVYA 2KC3A 3DD7A 4NTBA 1C17M 1TWHA 2R7RA 4MTGA 3GANA 3IQTA 3KMIA 3MLGA 1OQCA 2QE9A 3RQGA 4DOZA 5KYNA 3LAYA 3Q7LA 1TR2A 3LLIA 4I1MA 3S27A 1RKEA 2EILC 3EPVA 4W8KA 3V5YA 1TWCA 4LLCA 3E70C 4RDAA 4CX9A 3R7CA 3QMKA 1QVXA 5L3VA 1E83A 3QW1A 2CGEA 2ZPAA 3MYFA 2YHSA 4MTFA 2YL0A 4Z9JA 3GWLA 4P6IC 1VMAA 3U8PA 1I4YA 2Y3HA 3F47A 3KL4A 5KYXA 1FMVA 2XL4A 1U6HA 1WTYA 2XLWA 3FAJA 1KU2A 1GGQA 1L7CA 2Q7RA 4JCZA 4C3DA 3LESA 4HFFB 1GM5A 3ZQYA 4CS9C 2QNLA 2ETSA 3CAXA 4CS9A 2RSEB 2XLVA 5GPGB 2ZXWC 2EINC 5BQHA 5AGFA 3L0IA 4DRIB 2A68F 4YT8A 2NUPB 3B71A 3M1CB 1LIHA 2WL8A 2YL3A 3EJNA 3O10A 4NTFA 3US6A 3ZDLA 1SR2A 1VYKA 3ASOC 3K6BA 2IXPA 4M63A 2YLIA 4E7ZA 2EPMX 4BEJA 1LKXA 3NDBB 1APCA 4NCQA 3S28A 2AWYA 3GODA 5KYWB 4BEMJ 1LI7A 2OOCA 1EI7A 4PJJA 3PHF2 4N4WA 2MYSA 1MMAA 5JSLA 3V7OA 2BE5F 3AGUA 3A9CA 4WGZA 4BJ1A 4DXWA 1FTSA 2J9WA 2OCCC 2XL6A 3C18A 2R7OA 3ZTZA 2XLDA 3DJUB 4XQ1A 2ASRA 2OQMA 3RYLA 3WAQA 4DRHB 3S84A 3HTKC 3DAFA 1M56C 1MMDA 1Y4CA 3LS1A 4U5BE 1OW7A 1NLXA 1SZIA 2R05A 1JR8A 3DM5A 1AUEA 1YJGA 3C8GA 3NKEA 4O6NA
chains in the Genus database with same CATH topology
1WASA 1WATA 4H54A 2D4UA 1VLSA 2LIGA 4Z9HA 1VLTA 4Z9JA 3ATPA 1JMWA 1LIHA 3T9OA 4Z9IA 2ASRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WAS A;  1WAT A;  4H54 A;  2D4U A;  1VLS A;  2LIG A;  4Z9H A;  1VLT A;  4Z9J A;  3ATP A;  1JMW A;  1LIH A;  3T9O A;  4Z9I A;  2ASR A; 
#chains in the Genus database with same CATH topology
 1G5Z A;  2HZ8 A;  5A6B D;  2OU6 A;  3EG9 A;  4JRZ A;  2UUI A;  3PCV A;  1QPU A;  4AK9 A;  1U0B B;  1M57 C;  1S7Z A;  1O3U A;  2VAS A;  3DWW A;  1B68 A;  4YWQ A;  1VOM A;  4MQ9 F;  2GDC A;  3RVZ A;  1ZZP A;  2GWW A;  5B1B C;  1EKY A;  4MW8 A;  4Z9H A;  1LPE A;  2E87 A;  4JKV A;  1TQG A;  2ZXO A;  1WWP A;  2PBE A;  3DE8 A;  3K1I A;  4DVZ A;  3S90 A;  2M4E A;  3HKK A;  1WAS A;  1XWJ A;  4PFP A;  3SXZ A;  3SNH A;  4JIO A;  1V54 C;  2J0W A;  2NSF A;  4U5D E;  2AU5 A;  4N6C A;  2XL8 A;  1NSG B;  2WVQ A;  2YEV A;  3ATP A;  3SXM A;  2R7S A;  3H2V A;  4BJ6 C;  4BJ6 A;  2NUT A;  1LVK A;  3F46 A;  2XLH A;  4XPY A;  4IRU A;  2JPU A;  3DKA A;  1YZC A;  1ST6 A;  3IEE A;  4FES A;  4HEA J;  1E2X A;  4MVM A;  4AL1 A;  2CNW D;  2P61 A;  4E17 A;  2A6H F;  1YAR O;  2M64 A;  2B0H A;  1ORY A;  5A6B A;  2FGY A;  3UGP A;  2MWQ A;  4YK5 A;  5EGY A;  5KYU B;  3J06 A;  2A69 F;  2XM0 A;  4IWB A;  2J9U A;  1Z6A A;  4XTK A;  4G7Z F;  2XLO A;  2YL7 A;  1YAU O;  2EPL X;  2KJG A;  3CEX A;  1DOV A;  2HJM A;  3C8G D;  2Q4F A;  3FOO A;  3LJB A;  4PJN A;  3RQE A;  5B3I A;  1E85 A;  3BRJ A;  4J7Y A;  4NQF A;  1NFN A;  1CGN A;  2QLA A;  1UFB A;  2L81 A;  2GA0 A;  2KK1 A;  2W4M A;  2YZS A;  3CQZ A;  3EFO A;  3NMK A;  4MVO A;  1JPJ A;  2LSE A;  3Q6M A;  1AEP A;  4BJT A;  3RQF A;  4CS8 C;  3EQL F;  2OJQ A;  1UG7 A;  2LCH A;  4F4B A;  1CPR A;  4W8P A;  5DQZ A;  4U5G A;  4C7O B;  4GQH A;  1FR0 A;  4Q4Z F;  1N1C A;  1TFK B;  4EUK B;  5FZT A;  1G8X A;  3VAY A;  3FMS A;  1RCP A;  1HMO A;  3HLZ A;  2PNO A;  3TK0 A;  2J45 A;  1E84 A;  3ITF A;  2VCA A;  5T3T A;  1VB5 A;  1ORS C;  2J9B A;  2Y3B A;  3B9Q A;  3NRH A;  3NYJ A;  2VH3 A;  4OD4 A;  4PR9 A;  5JP7 A;  5T3W A;  4BJ5 C;  2V26 A;  5COM A;  1A0B A;  3L8J A;  4BJ5 A;  4H54 A;  2HJ3 A;  2XXA B;  4EHP A;  2HS5 A;  5TJ5 E;  1CGM E;  2VC9 A;  4O79 A;  4FWV A;  1D1A A;  3M15 A;  4AE4 B;  2KSF A;  4CDV A;  4EIY A;  1NFO A;  2XS8 A;  1YA9 A;  1FFH A;  2J9V A;  3IQ6 A;  2R03 A;  4K0D A;  3POV A;  5L3Q A;  2NSG A;  2Q3T A;  3HJC A;  3AQB A;  4KC9 A;  2IXM A;  2DB4 A;  5L0F A;  3B0U X;  4CDY A;  4QI2 A;  4XLN F;  4JW1 A;  5CI9 A;  3UR3 C;  3V5Z A;  2PX0 A;  3RFY A;  2KNH A;  2P7V A;  3U0C A;  2B0J A;  4XPX A;  4C3E A;  3KPH A;  3TJ6 A;  2MHR A;  3L34 A;  3WHN A;  4ZLD A;  3G4Z A;  2UUH A;  1RMV A;  4RD9 A;  3W8I A;  1GQA A;  1Q0G A;  3KYI A;  5K0I A;  1J8M F;  2NUP A;  3LUT B;  1T5O A;  1BDJ B;  4K7B A;  1GS9 A;  2A1D D;  1H7I A;  3FVY A;  5IY5 C;  4O6M A;  1OR3 A;  5L0D A;  2G3V A;  2EIM C;  1TKN A;  1M2V B;  4Q7C A;  1D0X A;  1VYI A;  1XZQ A;  3DZA A;  2R7X A;  3Q7G A;  2YQY A;  5CIV A;  2R02 A;  2WVO A;  3ABM C;  3T6B A;  3EZI A;  2LFF A;  4EBB A;  5KYW A;  5L0I A;  1T6I A;  3AOU A;  2VCB A;  2PFD A;  2OG2 A;  2LQG A;  3DJN B;  5JVE A;  3UMK A;  1JAF A;  1OR2 A;  3JSE O;  2A6E F;  2G3K A;  3JYY A;  3MYI A;  4J32 B;  4JEA A;  4XPW A;  4U5E E;  5AC5 A;  3NMI A;  3U9J A;  2XSE A;  1O87 A;  2CDQ A;  1RJ9 A;  1ZHT A;  3HNL A;  1G4W R;  3U2M A;  3AJM A;  3U8V A;  4I1O B;  4LDK A;  1Z23 A;  3UGO A;  3EZH A;  2H7O A;  2YLG A;  1RXQ A;  4CDA A;  1ZU4 A;  2CNW A;  4IB4 A;  3ABL C;  4Z9I A;  5JT4 A;  1NZE A;  2J7P A;  3S0X A;  4MTO A;  3NKD A;  5KYX B;  4DBQ A;  3HNJ A;  4N06 A;  5E2Q A;  3O6X A;  2IYL D;  1K40 A;  3N24 A;  1R5I D;  2AVK A;  1R4T A;  1D1C A;  2Y3G A;  2LK4 A;  3G50 A;  2KGO A;  1HW1 A;  3S9O A;  3U2L A;  3EGX B;  4NY3 A;  2DYR C;  3JT1 A;  3L8I A;  4MVZ A;  3AG3 C;  2LFD A;  3VM6 A;  1KTM A;  1QLE C;  5L0J A;  3H2U A;  2LD6 A;  4H4K C;  4ER9 A;  4E0H A;  1YVI A;  1T6Q A;  3DAG A;  3LEV A;  4GYT A;  2EIK C;  2O9X A;  3TQO A;  3EH1 A;  2FFH A;  3CZ6 A;  3OEO A;  4IGG A;  3B0V C;  2NPU A;  3K1I C;  3TJ5 A;  1OCC C;  3FAP B;  4QDL A;  5F5F A;  1VLS A;  3DXJ F;  1ORJ A;  1MMN A;  1HE9 A;  3DM9 B;  5A69 A;  2L9J A;  2F22 A;  2C04 A;  4EWC A;  3C62 A;  1QSP A;  2HUJ A;  1PCX A;  2JX0 A;  3JRT A;  3H65 A;  4I3M A;  3ZSU A;  1H6G A;  1YYX A;  3ABK C;  3PMR A;  4WGY A;  3GWN A;  4DRJ B;  2L6H A;  2P6V A;  5B1A C;  1MQV A;  1T01 A;  3U3F A;  1BBH A;  1WN0 A;  1I5N A;  3FDQ A;  2J7P D;  4P9T A;  2A0U A;  1AVO B;  3Q6N A;  4O7G A;  2XS1 A;  4K1O A;  3TOL A;  2A0B A;  3C8G B;  2FAP B;  1TWA A;  1HMD A;  1K05 A;  3G4X A;  3N0T A;  4HE8 D;  2PX3 A;  1RKC A;  4I44 A;  2XRH A;  4ULV A;  4AX2 A;  1VK5 A;  1Q0K A;  2Y39 A;  2Y69 C;  3GEH A;  1J8Y F;  5D92 A;  4C7O A;  3V5X A;  1VLT A;  1D0Z A;  2LP4 A;  2QUP A;  4JTA B;  2ZXR A;  3GM3 A;  2P0N A;  3I5Q A;  1Z3I X;  3SYN A;  2X51 A;  2XLM A;  3RKO F;  4J7T A;  4XEF A;  3T6G B;  4DVY P;  3LEO A;  3HNK A;  1HE1 A;  1JOG A;  1PV3 A;  1JMW A;  4QI0 A;  3TD7 A;  5KYY B;  2DYS C;  2H8A A;  3VRC A;  2W45 A;  1CGO A;  4OIQ F;  3IHU A;  4ZLC A;  4ANJ A;  4JEB A;  2EPN A;  1Z5Z A;  4IAQ A;  2Q9A A;  4DBR A;  2YL1 A;  4NTA A;  3I4U A;  2CYD A;  3O39 A;  4CS7 A;  3S29 A;  3OWT A;  1V4A A;  3SZR A;  3ASN C;  1ZU5 A;  1M6T A;  1KNY A;  3JYH A;  2J46 A;  2WZG A;  4AE4 A;  3R2P A;  4U9E A;  2CW0 F;  1ZVZ A;  2H7B A;  3HNI A;  3MBG A;  5E33 A;  5DQT A;  1BR2 A;  2WZL A;  1I4Z A;  1HW2 A;  4J30 B;  3NMJ A;  3EGD B;  4JZA A;  3LS0 A;  1OW8 A;  4XEV A;  2I8B A;  1YA7 O;  4MVU A;  3UNG C;  5BUO A;  1Q0D A;  2L7A A;  3JZ0 A;  4UDV A;  5DS5 A;  5E3A A;  1A7E A;  1Q0F A;  1A7D A;  2HFI A;  3W2V A;  1JPN A;  3PDM P;  1Y6D A;  1YZA A;  4LLE A;  3DE9 A;  2AWC A;  1D1B A;  3K1H A;  2OKU A;  1YYJ A;  4MS2 A;  2IXO A;  3KH2 A;  1ZW2 A;  2IXN A;  3RF3 A;  1PD0 A;  3RW0 A;  2H7V C;  4G0H A;  1SF8 A;  4IJJ A;  4CJG A;  3GM2 A;  3ZQV A;  1OCR C;  3IQ5 A;  4PJM A;  3W4Y A;  4OD5 A;  2WB7 A;  1M2V A;  4D4X A;  1XZP A;  4LDR A;  3NG1 A;  3DI5 A;  2KW3 C;  3QVZ A;  4YT5 A;  1MND A;  2XM4 A;  4MVS A;  1ZHY A;  3GEI A;  4HFK B;  4ONS A;  4IAR A;  4XEK A;  5COF A;  5F28 E;  3VYW A;  5DLJ A;  3ZIB A;  4YT2 A;  2P1A A;  1LS4 A;  4XLP F;  1WGW A;  2WZF A;  2GFH A;  4JTD B;  2Q9B A;  3C7J A;  3EH2 A;  3L1M A;  4BPM A;  4EBJ A;  5JUA A;  2R7T A;  3JTL O;  1FFT C;  2R7Q A;  4O6Y A;  2IOQ A;  2VB6 A;  3AGT A;  3T9O A;  3TOM A;  4PAC A;  4YL3 A;  5DS4 A;  2QY9 A;  3DMD A;  3GOR A;  1OKK A;  1NU7 D;  3X1O A;  4KNV A;  4U5C E;  2R25 A;  3M4C A;  4B6I A;  4FAP B;  2JD3 A;  4JTC B;  3SP1 A;  1E86 A;  4PJL A;  1TWG A;  3CSK A;  4XWJ A;  3ZG1 A;  5BQI A;  1OXK A;  1RKE B;  2YRF A;  4FX5 A;  4NC3 A;  3MFN A;  4X0R A;  4Q5S F;  4U5F E;  4OIO F;  2Q9C A;  3FHD A;  4AL0 A;  1IW7 F;  1OXB A;  4P9F A;  3EGX A;  4U5H A;  1V55 C;  2ZXP A;  2C03 A;  1QKR A;  2I15 A;  5DVW A;  2RD9 A;  1ZHW A;  5A6K A;  5JRA A;  2X0C A;  4CIH A;  1EA8 A;  2R9R B;  2HV7 A;  3U9M A;  5F5H A;  3JSZ A;  1BZ4 A;  2IBF A;  3A11 A;  1F1M A;  1LE4 A;  1NBB A;  2J8W A;  3KYJ A;  2W9Y A;  4R32 A;  2BL2 A;  1S05 A;  3T4R A;  2PP4 A;  1WOL A;  1C03 A;  2EPK X;  2OEV A;  3K33 A;  3FOP A;  4CBE A;  3I5P A;  4JCH A;  4N6H A;  3LLK A;  3TUL A;  1NG1 A;  3SEO A;  2L6F A;  2D5R B;  4LDQ A;  4KNW A;  2CCY A;  1OCO C;  2HKV A;  3KKB A;  3AG4 C;  4MVQ A;  2J0X A;  3WG7 C;  3ZC4 A;  2VCC A;  3AG2 C;  3N2Z B;  3U5S A;  4YT4 A;  1O5H A;  3FXH A;  1C02 A;  1OKK D;  5COG A;  5HSW A;  3LNM B;  2R7W A;  4DJ9 A;  1U89 A;  1JRA A;  1ZHX A;  1QQ3 A;  2IM8 A;  3IPM O;  2W4B A;  1OCZ C;  1RJ9 B;  5KYU A;  4PK4 A;  3UMH A;  2ICW G;  3LNR A;  1FMW A;  3NYL A;  5A6J A;  4MVR A;  1PD1 A;  2ZD9 A;  1BR4 A;  4EKW A;  1ZW3 A;  4E0I A;  5L0G A;  2YKZ A;  4CIP A;  4A2N B;  1EQ1 A;  3C8Z A;  3O55 A;  3X2Q C;  4CJO A;  2EPO A;  4JC7 A;  2XLE A;  3B0P A;  3SXY A;  4LAC B;  3B29 A;  2KYH A;  1FAP B;  1V74 B;  1SMY F;  3JRM O;  4WJ0 A;  3T6J A;  5L0C A;  3UMI A;  3W8H A;  4BG0 A;  4OIP F;  4G78 A;  4YN0 B;  3QTH A;  5HV9 A;  3EG9 B;  1CPQ A;  2YVK A;  2HSB A;  5JLI A;  1A7V A;  2TMV P;  4YL1 A;  1BR1 A;  1H9T A;  1LM3 B;  1QZX A;  3NYM A;  5KYY A;  2Y3D A;  5BQG A;  3E9V A;  2QTV A;  1W2W A;  4C3B A;  3QW0 A;  3RH3 A;  1LE2 A;  1ZYR F;  5DS6 A;  5E3C A;  5EHH A;  3EHM A;  4GEH A;  5CI8 A;  1H9G A;  1D0Y A;  1T9K A;  4KBL A;  2WVN A;  1YDI A;  1Z7Q c;  1IZM A;  2Z15 A;  4JJG A;  3VF0 A;  1M2O A;  2NUT B;  2HSQ A;  2Q00 A;  1SYQ A;  4G7H F;  4OIR F;  2YWA A;  4E18 A;  2XXA A;  1A41 A;  1L3P A;  4IAO A;  3EGD A;  3AQC A;  1MMG A;  2G62 A;  2DGJ A;  3SXK A;  1T6U A;  3M79 A;  3ZWI A;  5A6A A;  5AC4 A;  1Q0M A;  1DOW A;  4KI2 A;  3GEE A;  2KQ9 A;  2OJE D;  3JCU Q;  4A4A A;  3QVY A;  5B3S C;  4G7O F;  4YJW A;  5JS5 A;  3K66 A;  4CS8 A;  1LS1 A;  4U9D A;  3GM1 A;  3EHN A;  4MND A;  1FNT c;  3W2W A;  3M4B A;  1Z63 A;  2LIG A;  5FCL A;  2L6G A;  2HMQ A;  1TFO B;  3AG1 C;  3IQC A;  3U3B A;  4WAB A;  1YLM A;  2PF4 E;  3C63 A;  4OIN F;  3ZVR A;  1ZHZ A;  3EFO B;  2NG1 A;  2HV6 A;  3K7D A;  3RIP A;  4L6R A;  4LER A;  3MX3 A;  1K04 A;  5D91 A;  4E7S A;  4EBK A;  3ZTM A;  3WOD F;  4PFO A;  4JE9 A;  1LI5 A;  4D4N A;  2BC5 A;  1NU9 C;  4CSA C;  5T1D B;  3OA1 A;  2V3C C;  2EIJ C;  4ULW A;  2GAQ A;  1MNE A;  3QZC A;  4JVS A;  4JJF A;  4CSA A;  4RBN A;  2HMZ A;  1G4U S;  2DI3 A;  2OEX A;  1WAT A;  5L0H A;  2R7U A;  4YL0 A;  2R7V A;  4MW3 A;  3BEH A;  4JUR I;  1HY5 A;  2YLD A;  3ECS A;  1VTM P;  5EK0 A;  2AP3 A;  2D4U A;  1OW6 A;  256B A;  3RVY A;  2KC3 A;  3DD7 A;  4NTB A;  1C17 M;  1TWH A;  2R7R A;  4MTG A;  3GAN A;  3IQT A;  3KMI A;  3MLG A;  1OQC A;  2QE9 A;  3RQG A;  4DOZ A;  5KYN A;  3LAY A;  3Q7L A;  1TR2 A;  3LLI A;  4I1M A;  3S27 A;  1RKE A;  2EIL C;  3EPV A;  4W8K A;  3V5Y A;  1TWC A;  4LLC A;  3E70 C;  4RDA A;  4CX9 A;  3R7C A;  3QMK A;  1QVX A;  5L3V A;  1E83 A;  3QW1 A;  2CGE A;  2ZPA A;  3MYF A;  2YHS A;  4MTF A;  2YL0 A;  4Z9J A;  3GWL A;  4P6I C;  1VMA A;  3U8P A;  1I4Y A;  2Y3H A;  3F47 A;  3KL4 A;  5KYX A;  1FMV A;  2XL4 A;  1U6H A;  1WTY A;  2XLW A;  3FAJ A;  1KU2 A;  1GGQ A;  1L7C A;  2Q7R A;  4JCZ A;  4C3D A;  3LES A;  4HFF B;  1GM5 A;  3ZQY A;  4CS9 C;  2QNL A;  2ETS A;  3CAX A;  4CS9 A;  2RSE B;  2XLV A;  5GPG B;  2ZXW C;  2EIN C;  5BQH A;  5AGF A;  3L0I A;  4DRI B;  2A68 F;  4YT8 A;  2NUP B;  3B71 A;  3M1C B;  1LIH A;  2WL8 A;  2YL3 A;  3EJN A;  3O10 A;  4NTF A;  3US6 A;  3ZDL A;  1SR2 A;  1VYK A;  3ASO C;  3K6B A;  2IXP A;  4M63 A;  2YLI A;  4E7Z A;  2EPM X;  4BEJ A;  1LKX A;  3NDB B;  1APC A;  4NCQ A;  3S28 A;  2AWY A;  3GOD A;  5KYW B;  4BEM J;  1LI7 A;  2OOC A;  1EI7 A;  4PJJ A;  3PHF 2;  4N4W A;  2MYS A;  1MMA A;  5JSL A;  3V7O A;  2BE5 F;  3AGU A;  3A9C A;  4WGZ A;  4BJ1 A;  4DXW A;  1FTS A;  2J9W A;  2OCC C;  2XL6 A;  3C18 A;  2R7O A;  3ZTZ A;  2XLD A;  3DJU B;  4XQ1 A;  2ASR A;  2OQM A;  3RYL A;  3WAQ A;  4DRH B;  3S84 A;  3HTK C;  3DAF A;  1M56 C;  1MMD A;  1Y4C A;  3LS1 A;  4U5B E;  1OW7 A;  1NLX A;  1SZI A;  2R05 A;  1JR8 A;  3DM5 A;  1AUE A;  1YJG A;  3C8G A;  3NKE A;  4O6N A; 
#chains in the Genus database with same CATH homology
 1WAS A;  1WAT A;  4H54 A;  2D4U A;  1VLS A;  2LIG A;  4Z9H A;  1VLT A;  4Z9J A;  3ATP A;  1JMW A;  1LIH A;  3T9O A;  4Z9I A;  2ASR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...