2LIGA

Three-dimensional structures of the ligand-binding domain of the bacterial aspartate receptor with and without a ligand
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
157
structure length
157
Chain Sequence
MGGLLFSSLQHCQQGFVISNELRQQQSELTSTWDLMLQTRINLSRSAARMMMDASNQQSSAKTDLLQNAKTTLAQAAAHYANFKNMTPLPAMAEASANVDEKYQRYQAALAELIQFLDNGNMDAYFAQPTQGMQNALGEALGNYARVSENLYRQTFD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ASPARTATE RECEPTOR
publication title Three-dimensional structures of the ligand-binding domain of the bacterial aspartate receptor with and without a ligand.
pubmed rcsb
source organism Salmonella typhimurium
molecule tags Chemotaxis
total genus 62
structure length 157
sequence length 157
chains with identical sequence B
ec nomenclature
pdb deposition date 1995-04-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.30 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Aspartate receptor, ligand-binding domain 2ligA00
1VLSA 4Z9HA 1JMWA 4Z9JA 4Z9IA 2D4UA 2LIGA 1LIHA 3ATPA 1WASA 1VLTA 3T9OA 2ASRA 4H54A 1WATA
chains in the Genus database with same CATH superfamily
1O3UA 2YEVA 4IAQA 4R32A 5HSWA 3GANA 4PJLA 2OQMA 3ZDLA 4P9FA 1T5OA 3VYWA 4LACB 4DBQA 1G4US 4IB4A 4CS8A 4JW1A 3LLKA 3BRJA 1LM3B 3KKBA 4J32B 3RYLA 1CPRA 4MW8A 2J45A 3FXHA 1ZHTA 1ORJA 2E87A 3C63A 3T6JA 5KYWA 2PF4E 4CS9A 3ABLC 3MBGA 5T3WA 4E7ZA 2R7SA 1NU9C 1HW2A 3O55A 4HFKB 2R7TA 2Q00A 4BJ5C 3NYLA 1YJGA 3EHNA 5AGFA 4CJGA 3UGPA 3EH1A 1D1AA 1T6QA 4IJJA 2WB7A 2J8WA 3DE8A 5CI8A 3CZ6A 4Z9JA 3U5SA 1JOGA 3LEOA 1LKXA 1YZAA 2NPUA 1YVIA 3IPMO 3JRMO 2YLGA 5DS6A 2Q9BA 1VB5A 3N24A 1BDJB 3ABKC 3LEVA 5COGA 5DS5A 3SYNA 3VRCA 2R7UA 3C8GB 4K1OA 5CI9A 2ASRA 3I5QA 2LQGA 1RKCA 2XLDA 4LDRA 3HJCA 3M79A 4AE4A 1Y4CA 1YA7O 1RMVA 1NFOA 3L8JA 4LDQA 2YL1A 2GFHA 1E2XA 3JRTA 3ZWIA 2PX3A 2WVOA 5D91A 1EQ1A 4ER9A 3M4CA 4L6RA 4IRUA 2IM8A 3U3BA 1W2WA 1JR8A 2OU6A 1K04A 2OG2A 2CDQA 3EQLF 3SP1A 3VM6A 2KK1A 1L3PA 3U3FA 4BG0A 3W4YA 1VK5A 1V54C 1Z23A 3N2ZB 1OCRC 1KU2A 5JRAA 2XLOA 1JPJA 2NSGA 3HNIA 1H9GA 3K33A 1D1CA 2CNWD 1SZIA 2J0XA 4YL1A 1YZCA 1TR2A 3RVYA 4QI0A 3FVYA 3LNRA 1WN0A 2ZXPA 4WGYA 5COMA 5TJ5E 3LUTB 2J0WA 3B0PA 5KYWB 5T1DB 3SZRA 4WABA 4PJMA 4YWQA 1MNDA 3GM1A 1R5ID 5KYYB 1GQAA 3L8IA 2CCYA 1YLMA 4FX5A 4IGGA 4U5CE 4CDYA 3KL4A 1UG7A 4DRJB 4CSAC 2XXAB 4I1MA 4N4WA 4D4NA 3C8GD 2LCHA 2YWAA 3TULA 1JAFA 3BEHA 2JD3A 3EJNA 4CS7A 5B1AC 4OIQF 3K1IA 1JPNA 3NMIA 4PK4A 2HFIA 2PP4A 1LPEA 3G4ZA 3K6BA 4O6NA 2EIKC 1Q0GA 3B71A 3FOOA 1GM5A 2AU5A 2XLWA 4MVZA 3C8ZA 2KJGA 2L81A 1LE4A 1QQ3A 1M2OA 2EPMX 3CEXA 3NKDA 4AL0A 4EBBA 3S28A 1ORYA 2DYSC 2YL7A 2LP4A 2H7VC 2LK4A 2IYLD 2Y3GA 2Q7RA 3UMKA 1QZXA 1UFBA 3R7CA 3OA1A 4HEAJ 4N6HA 5B3IA 1Q0MA 4RBNA 3EFOA 1BR4A 4MTOA 3DM9B 4XWJA 4JEBA 4I1OB 1NZEA 3ATPA 5L0CA 1LS4A 3MYFA 4MTFA 1G5ZA 2DI3A 2XLMA 4YT5A 1YAUO 3EZIA 2H7OA 3FAPB 3HTKC 2C04A 3SXMA 4JJFA 2P6VA 2OEXA 3R2PA 3KPHA 3T9OA 3AGTA 4YT8A 3AGUA 1ZW3A 1OKKA 4HE8D 4U9DA 2YVKA 4A2NB 1U6HA 2HJ3A 1FMVA 4C3DA 3S90A 2UUIA 2KW3C 4J7YA 5L0GA 3J06A 4H4KC 1QPUA 3B0VC 1XZPA 1PD0A 3LJBA 3LLIA 4MS2A 2XRHA 3EZHA 3GEEA 4JRZA 2XL8A 3PDMP 2WZGA 4CJOA 1XZQA 3KYIA 4ONSA 2HSBA 4BJ6A 3GORA 4E7SA 3QW0A 1A7VA 5DQZA 5A6JA 3AG1C 1FMWA 4W8PA 2R7QA 2A0BA 3O6XA 4BJ1A 4OIOF 1OR3A 4G7ZF 2YHSA 3NMJA 1Y6DA 2NUPB 2EPNA 2W4BA 2YLIA 4MNDA 3S9OA 1RJ9A 2R02A 2YKZA 1BBHA 2DGJA 1LI5A 2Y69C 5E3CA 2HMQA 3H2VA 4K0DA 3F46A 4OIPF 3N0TA 3PHF2 4JIOA 4PFPA 2KSFA 2H8AA 2HV7A 2KNHA 3EPVA 4LLCA 2P61A 4XEVA 5KYNA 3FDQA 1H7IA 1A0BA 3ECSA 4XPYA 1J8YF 2AWCA 2XS8A 3Q7GA 4A4AA 5JLIA 2FAPB 2W4MA 4Z9HA 2TMVP 4ZLDA 3TOMA 3U8VA 2P0NA 3EGDB 1S7ZA 1ZW2A 5B1BC 4GYTA 3E9VA 4XLNF 5A6BA 1MQVA 3DXJF 4G7OF 3EG9A 1OR2A 4EBJA 3DD7A 2YLDA 1QLEC 3C7JA 1ZHWA 2R7XA 2DYRC 2X51A 2IXMA 3U8PA 1MMDA 2Q9CA 4G7HF 3RQGA 1PD1A 4MVRA 2H7BA 4NTAA 2NUTA 1D0ZA 1YARO 2FGYA 3Q7LA 2J7PD 4IWBA 2L6FA 1C02A 1YYXA 1TWHA 2QLAA 4P9TA 2Y3DA 5BQGA 2VCBA 4JC7A 4MVOA 3EGXA 2DB4A 3HKKA 1ORSC 1PCXA 2XL6A 1ZVZA 3U9JA 4PFOA 1E86A 1HMOA 3QW1A 3ZTMA 2R7RA 1SMYF 4XQ1A 5COFA 1E85A 2R7WA 1Z63A 2AWYA 1MMAA 3A11A 3K7DA 1M2VA 4IAOA 5E3AA 2UUHA 1JRAA 2J9WA 2JX0A 2WZFA 3IQCA 3SNHA 2OJED 4DOZA 5KYXA 1LS1A 2GDCA 2Y3HA 4CBEA 1VYKA 2R7OA 2GWWA 256BA 2HS5A 4WJ0A 4RD9A 4X0RA 3LNMB 4DVZA 2IBFA 1D0XA 3AQCA 3AG2C 1VLTA 3RH3A 1B68A 3RF3A 4XPWA 5KYUB 2LFFA 3AJMA 4M63A 2HZ8A 4MVUA 1NFNA 4C7OB 1HE1A 2Z15A 3FHDA 3KYJA 3LESA 4MVMA 4P6IC 4EIYA 5BQHA 5EGYA 5L0FA 3T6GB 3SXKA 3AQBA 2GA0A 1M56C 3ZQVA 4BJ5A 2A68F 1RKEA 1SF8A 2G62A 1ZYRF 1ZU4A 2J9BA 1OQCA 2Q9AA 4CDAA 3RQFA 2KYHA 3TD7A 4G78A 3QTHA 2KC3A 1HY5A 2J9VA 1OKKD 2R9RB 3NRHA 1ZU5A 4NCQA 2A69F 4PACA 5F5FA 1BR1A 2IXOA 5E33A 1K40A 3UNGC 1TWCA 4DBRA 2D5RB 1H9TA 2WVNA 2J46A 4OD5A 3VF0A 1O87A 4B6IA 3I4UA 3B29A 4Z9IA 3HNKA 1M57C 4JKVA 1LIHA 4JURI 4ANJA 1MMGA 3JSZA 4U5HA 2HV6A 2XM4A 2R05A 3WAQA 4E0IA 3JSEO 3M15A 2VASA 1NU7D 1TFOB 3US6A 3F47A 2BC5A 4YK5A 1NSGB 4BEJA 4EKWA 3RIPA 5DQTA 1HE9A 2KQ9A 3LS0A 2Q3TA 2VC9A 2ZXOA 3QVZA 4MQ9F 1SYQA 5AC4A 4EUKB 4Q7CA 2QUPA 1C17M 1CGOA 1ZHXA 3AOUA 3EHMA 2IXPA 3FAJA 3NYMA 3RQEA 4AE4B 3C18A 1TFKB 4O6MA 5EHHA 3S27A 2B0HA 4W8KA 3UMHA 1OW6A 3POVA 2IXNA 1Z5ZA 3DAFA 5JSLA 4DRIB 1LVKA 1NLXA 2J9UA 4U5EE 1LE2A 3UGOA 3IQ5A 3OWTA 5A6KA 2B0JA 2R25A 4U5BE 4G0HA 4FWVA 2LD6A 3DE9A 1LI7A 3AG4C 4J7TA 3SXZA 1BZ4A 3ZIBA 4ZLCA 5L3VA 1FR0A 1VLSA 2F22A 1V74B 3GEIA 3IEEA 4FESA 1R4TA 3W2VA 2XM0A 4CSAA 1GGQA 4F4BA 3V5ZA 4OD4A 4YJWA 4XEFA 1E84A 1TWAA 2YZSA 3H2UA 3FOPA 5T3TA 3C62A 3ZC4A 1H6GA 1T01A 4XEKA 3ZSUA 4DVYP 3X1OA 1IZMA 4GEHA 3V7OA 4U5GA 1Z3IX 5BQIA 3L0IA 4YT2A 3RFYA 5D92A 5GPGB 4YN0B 1WOLA 1YYJA 2BE5F 3X2QC 1GS9A 2HJMA 1FTSA 4RDAA 3NMKA 4QDLA 1APCA 3DMDA 3RVZA 1AEPA 3DZAA 3JTLO 4XPXA 1I4ZA 1JMWA 1D0YA 3ABMC 4ULWA 2OCCC 2EIMC 3IHUA 3ITFA 3L34A 3ZTZA 1OXBA 3HNLA 1Q0KA 2RSEB 3NKEA 2CNWA 2ZXRA 1VOMA 4MTGA 2EPLX 3E70C 4LLEA 3GM3A 1OXKA 3TJ5A 4CS8C 3DI5A 3FMSA 4DJ9A 5DLJA 4JCZA 1TWGA 1FFHA 2C03A 4I44A 1KTMA 2A6HF 3W2WA 3B0UX 4O79A 4C7OA 2EINC 1VTMP 1OCOC 1U89A 3MX3A 3C8GA 5A6AA 2EPKX 1KNYA 4CDVA 3EFOB 1NBBA 3PMRA 4BEMJ 2VCCA 1FFTC 2A6EF 2EIJC 2RD9A 3WODF 1WWPA 2L9JA 1ZHZA 3JYYA 3JCUQ 3V5YA 4K7BA 5EK0A 3U2MA 1F1MA 2WL8A 1WTYA 2OKUA 4FAPB 4UDVA 2CYDA 4NTFA 3M4BA 2XS1A 2OEVA 4NC3A 3CAXA 1VYIA 2VH3A 1CPQA 3A9CA 4N6CA 1Z7Qc 3DKAA 1DOVA 2EILC 5L0JA 2A0UA 2OJQA 4IARA 3S84A 2I8BA 3WG7C 2R7VA 2G3KA 1FNTc 4JVSA 1SR2A 3DJUB 4CX9A 4KNVA 3CQZA 2XSEA 1QKRA 3CSKA 2D4UA 3K66A 3TK0A 5KYYA 3OEOA 2GAQA 5L3QA 2MYSA 4KI2A 2XXAA 1RJ9B 1TQGA 3Q6NA 2HUJA 4Q4ZF 1DOWA 2QNLA 2V26A 1L7CA 4QI2A 5CIVA 3IQ6A 4E17A 1IW7F 1E83A 3GM2A 4PJJA 1O5HA 2LIGA 3ZQYA 3DJNB 5JP7A 4HFFB 4JE9A 1VMAA 1OW7A 2QE9A 1OCCC 5JS5A 2YRFA 5L0HA 2XLEA 4NY3A 4U9EA 1M6TA 3ASNC 2ZD9A 3EG9B 1MNEA 1PV3A 3S0XA 1A41A 3K1IC 4DXWA 1S05A 1QSPA 3MFNA 4J30B 5A69A 1EI7A 4JEAA 3DAGA 1AUEA 5FCLA 2YL3A 3TQOA 1RXQA 1EKYA 3IQTA 1RCPA 1G8XA 2M4EA 2NUTB 3DM5A 2Y39A 4JTAB 5IY5C 2HMZA 1TKNA 5E2QA 4AK9A 4BJTA 5JUAA 2PFDA 3Q6MA 2I15A 1I5NA 3EGXB 4PR9A 1XWJA 5DVWA 5L0DA 4XLPF 1YA9A 3HLZA 2VCAA 4E18A 4Q5SF 4YT4A 1A7EA 2HKVA 4JTDB 2QY9A 1Q0FA 3MYIA 2W45A 3W8IA 4PJNA 2CGEA 1M2VB 3JYHA 2M64A 4CIPA 3JT1A 4NTBA 3T4RA 5KYXB 1T9KA 3PCVA 1ST6A 3B9QA 2AVKA 3TJ6A 2L6GA 2V3CC 3I5PA 2J7PA 1YDIA 3GWLA 4N06A 3SXYA 4EBKA 5JT4A 1HMDA 1V55C 5K0IA 3MLGA 4O6YA 4O7GA 4KNWA 1NG1A 1QVXA 4KC9A 3RW0A 4U5DE 5HV9A 1C03A 5A6BD 2L7AA 3EH2A 4GQHA 2FFHA 1EA8A 2NUPA 4MVQA 3UMIA 4JCHA 4YL0A 1T6IA 3ASOC 4BPMA 1OCZC 2IOQA 4DRHB 1CGME 1G4WR 2OOCA 2CW0F 1HW1A 1RKEB 4LDKA 2NG1A 4BJ6C 4C3EA 4LERA 1WGWA 1N1CA 3QMKA 3NDBB 2O9XA 2AP3A 4MVSA 5DS4A 2ICWG 3HNJA 1A7DA 1FAPB 3ZVRA 3RKOF 3QVYA 4YL3A 2L6HA 2PNOA 1WASA 2MWQA 4C3BA 1CGNA 3GEHA 1U0BB 1K05A 1Z6AA 1ZZPA 3EGDA 3G4XA 5F5HA 4MW3A 5AC5A 5JVEA 1J8MF 3QZCA 4OIRF 3GODA 2XLVA 2A1DD 2YL0A 4I3MA 5B3SC 4KBLA 1D1BA 2VB6A 2X0CA 4EHPA 2ZXWC 3K1HA 2BL2A 3AG3C 3ZG1A 4JTCB 2MHRA 2KGOA 3LAYA 2LSEA 3H65A 4D4XA 1ZHYA 3WHNA 2PX0A 4WGZA 4EWCA 4CIHA 2EPOA 4OINF 3LS1A 3SEOA 2JPUA 2NSFA 3NG1A 2R03A 2LFDA 1AVOB 2YQYA 4U5FE 3W8HA 1BR2A 3O39A 3UR3C 4CS9C 3M1CB 4ULVA 2WVQA 3U2LA 2XLHA 3JZ0A 3S29A 3G50A 2WZLA 3V5XA 2W9YA 3L1MA 2Y3BA 1T6UA 1V4AA 3DWWA 2P1AA 3KH2A 2HSQA 4H54A 3U0CA 3KMIA 4JZAA 2QTVA 2ETSA 2PBEA 4NQFA 4AL1A 4JJGA 2XL4A 3GWNA 4XTKA 4AX2A 1I4YA 5F28E 3T6BA 4E0HA 1WATA 1OW8A 5L0IA 2P7VA 3TOLA 3U9MA 3O10A 1MMNA 2ZPAA 5KYUA 1Q0DA 2G3VA 2Q4FA 3NYJA 3VAYA 5FZTA 5BUOA
chains in the Genus database with same CATH topology
1VLSA 4Z9HA 1JMWA 4Z9JA 4Z9IA 2D4UA 2LIGA 1LIHA 3ATPA 1WASA 1VLTA 3T9OA 2ASRA 4H54A 1WATA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VLS A;  4Z9H A;  1JMW A;  4Z9J A;  4Z9I A;  2D4U A;  2LIG A;  1LIH A;  3ATP A;  1WAS A;  1VLT A;  3T9O A;  2ASR A;  4H54 A;  1WAT A; 
#chains in the Genus database with same CATH topology
 1O3U A;  2YEV A;  4IAQ A;  4R32 A;  5HSW A;  3GAN A;  4PJL A;  2OQM A;  3ZDL A;  4P9F A;  1T5O A;  3VYW A;  4LAC B;  4DBQ A;  1G4U S;  4IB4 A;  4CS8 A;  4JW1 A;  3LLK A;  3BRJ A;  1LM3 B;  3KKB A;  4J32 B;  3RYL A;  1CPR A;  4MW8 A;  2J45 A;  3FXH A;  1ZHT A;  1ORJ A;  2E87 A;  3C63 A;  3T6J A;  5KYW A;  2PF4 E;  4CS9 A;  3ABL C;  3MBG A;  5T3W A;  4E7Z A;  2R7S A;  1NU9 C;  1HW2 A;  3O55 A;  4HFK B;  2R7T A;  2Q00 A;  4BJ5 C;  3NYL A;  1YJG A;  3EHN A;  5AGF A;  4CJG A;  3UGP A;  3EH1 A;  1D1A A;  1T6Q A;  4IJJ A;  2WB7 A;  2J8W A;  3DE8 A;  5CI8 A;  3CZ6 A;  4Z9J A;  3U5S A;  1JOG A;  3LEO A;  1LKX A;  1YZA A;  2NPU A;  1YVI A;  3IPM O;  3JRM O;  2YLG A;  5DS6 A;  2Q9B A;  1VB5 A;  3N24 A;  1BDJ B;  3ABK C;  3LEV A;  5COG A;  5DS5 A;  3SYN A;  3VRC A;  2R7U A;  3C8G B;  4K1O A;  5CI9 A;  2ASR A;  3I5Q A;  2LQG A;  1RKC A;  2XLD A;  4LDR A;  3HJC A;  3M79 A;  4AE4 A;  1Y4C A;  1YA7 O;  1RMV A;  1NFO A;  3L8J A;  4LDQ A;  2YL1 A;  2GFH A;  1E2X A;  3JRT A;  3ZWI A;  2PX3 A;  2WVO A;  5D91 A;  1EQ1 A;  4ER9 A;  3M4C A;  4L6R A;  4IRU A;  2IM8 A;  3U3B A;  1W2W A;  1JR8 A;  2OU6 A;  1K04 A;  2OG2 A;  2CDQ A;  3EQL F;  3SP1 A;  3VM6 A;  2KK1 A;  1L3P A;  3U3F A;  4BG0 A;  3W4Y A;  1VK5 A;  1V54 C;  1Z23 A;  3N2Z B;  1OCR C;  1KU2 A;  5JRA A;  2XLO A;  1JPJ A;  2NSG A;  3HNI A;  1H9G A;  3K33 A;  1D1C A;  2CNW D;  1SZI A;  2J0X A;  4YL1 A;  1YZC A;  1TR2 A;  3RVY A;  4QI0 A;  3FVY A;  3LNR A;  1WN0 A;  2ZXP A;  4WGY A;  5COM A;  5TJ5 E;  3LUT B;  2J0W A;  3B0P A;  5KYW B;  5T1D B;  3SZR A;  4WAB A;  4PJM A;  4YWQ A;  1MND A;  3GM1 A;  1R5I D;  5KYY B;  1GQA A;  3L8I A;  2CCY A;  1YLM A;  4FX5 A;  4IGG A;  4U5C E;  4CDY A;  3KL4 A;  1UG7 A;  4DRJ B;  4CSA C;  2XXA B;  4I1M A;  4N4W A;  4D4N A;  3C8G D;  2LCH A;  2YWA A;  3TUL A;  1JAF A;  3BEH A;  2JD3 A;  3EJN A;  4CS7 A;  5B1A C;  4OIQ F;  3K1I A;  1JPN A;  3NMI A;  4PK4 A;  2HFI A;  2PP4 A;  1LPE A;  3G4Z A;  3K6B A;  4O6N A;  2EIK C;  1Q0G A;  3B71 A;  3FOO A;  1GM5 A;  2AU5 A;  2XLW A;  4MVZ A;  3C8Z A;  2KJG A;  2L81 A;  1LE4 A;  1QQ3 A;  1M2O A;  2EPM X;  3CEX A;  3NKD A;  4AL0 A;  4EBB A;  3S28 A;  1ORY A;  2DYS C;  2YL7 A;  2LP4 A;  2H7V C;  2LK4 A;  2IYL D;  2Y3G A;  2Q7R A;  3UMK A;  1QZX A;  1UFB A;  3R7C A;  3OA1 A;  4HEA J;  4N6H A;  5B3I A;  1Q0M A;  4RBN A;  3EFO A;  1BR4 A;  4MTO A;  3DM9 B;  4XWJ A;  4JEB A;  4I1O B;  1NZE A;  3ATP A;  5L0C A;  1LS4 A;  3MYF A;  4MTF A;  1G5Z A;  2DI3 A;  2XLM A;  4YT5 A;  1YAU O;  3EZI A;  2H7O A;  3FAP B;  3HTK C;  2C04 A;  3SXM A;  4JJF A;  2P6V A;  2OEX A;  3R2P A;  3KPH A;  3T9O A;  3AGT A;  4YT8 A;  3AGU A;  1ZW3 A;  1OKK A;  4HE8 D;  4U9D A;  2YVK A;  4A2N B;  1U6H A;  2HJ3 A;  1FMV A;  4C3D A;  3S90 A;  2UUI A;  2KW3 C;  4J7Y A;  5L0G A;  3J06 A;  4H4K C;  1QPU A;  3B0V C;  1XZP A;  1PD0 A;  3LJB A;  3LLI A;  4MS2 A;  2XRH A;  3EZH A;  3GEE A;  4JRZ A;  2XL8 A;  3PDM P;  2WZG A;  4CJO A;  1XZQ A;  3KYI A;  4ONS A;  2HSB A;  4BJ6 A;  3GOR A;  4E7S A;  3QW0 A;  1A7V A;  5DQZ A;  5A6J A;  3AG1 C;  1FMW A;  4W8P A;  2R7Q A;  2A0B A;  3O6X A;  4BJ1 A;  4OIO F;  1OR3 A;  4G7Z F;  2YHS A;  3NMJ A;  1Y6D A;  2NUP B;  2EPN A;  2W4B A;  2YLI A;  4MND A;  3S9O A;  1RJ9 A;  2R02 A;  2YKZ A;  1BBH A;  2DGJ A;  1LI5 A;  2Y69 C;  5E3C A;  2HMQ A;  3H2V A;  4K0D A;  3F46 A;  4OIP F;  3N0T A;  3PHF 2;  4JIO A;  4PFP A;  2KSF A;  2H8A A;  2HV7 A;  2KNH A;  3EPV A;  4LLC A;  2P61 A;  4XEV A;  5KYN A;  3FDQ A;  1H7I A;  1A0B A;  3ECS A;  4XPY A;  1J8Y F;  2AWC A;  2XS8 A;  3Q7G A;  4A4A A;  5JLI A;  2FAP B;  2W4M A;  4Z9H A;  2TMV P;  4ZLD A;  3TOM A;  3U8V A;  2P0N A;  3EGD B;  1S7Z A;  1ZW2 A;  5B1B C;  4GYT A;  3E9V A;  4XLN F;  5A6B A;  1MQV A;  3DXJ F;  4G7O F;  3EG9 A;  1OR2 A;  4EBJ A;  3DD7 A;  2YLD A;  1QLE C;  3C7J A;  1ZHW A;  2R7X A;  2DYR C;  2X51 A;  2IXM A;  3U8P A;  1MMD A;  2Q9C A;  4G7H F;  3RQG A;  1PD1 A;  4MVR A;  2H7B A;  4NTA A;  2NUT A;  1D0Z A;  1YAR O;  2FGY A;  3Q7L A;  2J7P D;  4IWB A;  2L6F A;  1C02 A;  1YYX A;  1TWH A;  2QLA A;  4P9T A;  2Y3D A;  5BQG A;  2VCB A;  4JC7 A;  4MVO A;  3EGX A;  2DB4 A;  3HKK A;  1ORS C;  1PCX A;  2XL6 A;  1ZVZ A;  3U9J A;  4PFO A;  1E86 A;  1HMO A;  3QW1 A;  3ZTM A;  2R7R A;  1SMY F;  4XQ1 A;  5COF A;  1E85 A;  2R7W A;  1Z63 A;  2AWY A;  1MMA A;  3A11 A;  3K7D A;  1M2V A;  4IAO A;  5E3A A;  2UUH A;  1JRA A;  2J9W A;  2JX0 A;  2WZF A;  3IQC A;  3SNH A;  2OJE D;  4DOZ A;  5KYX A;  1LS1 A;  2GDC A;  2Y3H A;  4CBE A;  1VYK A;  2R7O A;  2GWW A;  256B A;  2HS5 A;  4WJ0 A;  4RD9 A;  4X0R A;  3LNM B;  4DVZ A;  2IBF A;  1D0X A;  3AQC A;  3AG2 C;  1VLT A;  3RH3 A;  1B68 A;  3RF3 A;  4XPW A;  5KYU B;  2LFF A;  3AJM A;  4M63 A;  2HZ8 A;  4MVU A;  1NFN A;  4C7O B;  1HE1 A;  2Z15 A;  3FHD A;  3KYJ A;  3LES A;  4MVM A;  4P6I C;  4EIY A;  5BQH A;  5EGY A;  5L0F A;  3T6G B;  3SXK A;  3AQB A;  2GA0 A;  1M56 C;  3ZQV A;  4BJ5 A;  2A68 F;  1RKE A;  1SF8 A;  2G62 A;  1ZYR F;  1ZU4 A;  2J9B A;  1OQC A;  2Q9A A;  4CDA A;  3RQF A;  2KYH A;  3TD7 A;  4G78 A;  3QTH A;  2KC3 A;  1HY5 A;  2J9V A;  1OKK D;  2R9R B;  3NRH A;  1ZU5 A;  4NCQ A;  2A69 F;  4PAC A;  5F5F A;  1BR1 A;  2IXO A;  5E33 A;  1K40 A;  3UNG C;  1TWC A;  4DBR A;  2D5R B;  1H9T A;  2WVN A;  2J46 A;  4OD5 A;  3VF0 A;  1O87 A;  4B6I A;  3I4U A;  3B29 A;  4Z9I A;  3HNK A;  1M57 C;  4JKV A;  1LIH A;  4JUR I;  4ANJ A;  1MMG A;  3JSZ A;  4U5H A;  2HV6 A;  2XM4 A;  2R05 A;  3WAQ A;  4E0I A;  3JSE O;  3M15 A;  2VAS A;  1NU7 D;  1TFO B;  3US6 A;  3F47 A;  2BC5 A;  4YK5 A;  1NSG B;  4BEJ A;  4EKW A;  3RIP A;  5DQT A;  1HE9 A;  2KQ9 A;  3LS0 A;  2Q3T A;  2VC9 A;  2ZXO A;  3QVZ A;  4MQ9 F;  1SYQ A;  5AC4 A;  4EUK B;  4Q7C A;  2QUP A;  1C17 M;  1CGO A;  1ZHX A;  3AOU A;  3EHM A;  2IXP A;  3FAJ A;  3NYM A;  3RQE A;  4AE4 B;  3C18 A;  1TFK B;  4O6M A;  5EHH A;  3S27 A;  2B0H A;  4W8K A;  3UMH A;  1OW6 A;  3POV A;  2IXN A;  1Z5Z A;  3DAF A;  5JSL A;  4DRI B;  1LVK A;  1NLX A;  2J9U A;  4U5E E;  1LE2 A;  3UGO A;  3IQ5 A;  3OWT A;  5A6K A;  2B0J A;  2R25 A;  4U5B E;  4G0H A;  4FWV A;  2LD6 A;  3DE9 A;  1LI7 A;  3AG4 C;  4J7T A;  3SXZ A;  1BZ4 A;  3ZIB A;  4ZLC A;  5L3V A;  1FR0 A;  1VLS A;  2F22 A;  1V74 B;  3GEI A;  3IEE A;  4FES A;  1R4T A;  3W2V A;  2XM0 A;  4CSA A;  1GGQ A;  4F4B A;  3V5Z A;  4OD4 A;  4YJW A;  4XEF A;  1E84 A;  1TWA A;  2YZS A;  3H2U A;  3FOP A;  5T3T A;  3C62 A;  3ZC4 A;  1H6G A;  1T01 A;  4XEK A;  3ZSU A;  4DVY P;  3X1O A;  1IZM A;  4GEH A;  3V7O A;  4U5G A;  1Z3I X;  5BQI A;  3L0I A;  4YT2 A;  3RFY A;  5D92 A;  5GPG B;  4YN0 B;  1WOL A;  1YYJ A;  2BE5 F;  3X2Q C;  1GS9 A;  2HJM A;  1FTS A;  4RDA A;  3NMK A;  4QDL A;  1APC A;  3DMD A;  3RVZ A;  1AEP A;  3DZA A;  3JTL O;  4XPX A;  1I4Z A;  1JMW A;  1D0Y A;  3ABM C;  4ULW A;  2OCC C;  2EIM C;  3IHU A;  3ITF A;  3L34 A;  3ZTZ A;  1OXB A;  3HNL A;  1Q0K A;  2RSE B;  3NKE A;  2CNW A;  2ZXR A;  1VOM A;  4MTG A;  2EPL X;  3E70 C;  4LLE A;  3GM3 A;  1OXK A;  3TJ5 A;  4CS8 C;  3DI5 A;  3FMS A;  4DJ9 A;  5DLJ A;  4JCZ A;  1TWG A;  1FFH A;  2C03 A;  4I44 A;  1KTM A;  2A6H F;  3W2W A;  3B0U X;  4O79 A;  4C7O A;  2EIN C;  1VTM P;  1OCO C;  1U89 A;  3MX3 A;  3C8G A;  5A6A A;  2EPK X;  1KNY A;  4CDV A;  3EFO B;  1NBB A;  3PMR A;  4BEM J;  2VCC A;  1FFT C;  2A6E F;  2EIJ C;  2RD9 A;  3WOD F;  1WWP A;  2L9J A;  1ZHZ A;  3JYY A;  3JCU Q;  3V5Y A;  4K7B A;  5EK0 A;  3U2M A;  1F1M A;  2WL8 A;  1WTY A;  2OKU A;  4FAP B;  4UDV A;  2CYD A;  4NTF A;  3M4B A;  2XS1 A;  2OEV A;  4NC3 A;  3CAX A;  1VYI A;  2VH3 A;  1CPQ A;  3A9C A;  4N6C A;  1Z7Q c;  3DKA A;  1DOV A;  2EIL C;  5L0J A;  2A0U A;  2OJQ A;  4IAR A;  3S84 A;  2I8B A;  3WG7 C;  2R7V A;  2G3K A;  1FNT c;  4JVS A;  1SR2 A;  3DJU B;  4CX9 A;  4KNV A;  3CQZ A;  2XSE A;  1QKR A;  3CSK A;  2D4U A;  3K66 A;  3TK0 A;  5KYY A;  3OEO A;  2GAQ A;  5L3Q A;  2MYS A;  4KI2 A;  2XXA A;  1RJ9 B;  1TQG A;  3Q6N A;  2HUJ A;  4Q4Z F;  1DOW A;  2QNL A;  2V26 A;  1L7C A;  4QI2 A;  5CIV A;  3IQ6 A;  4E17 A;  1IW7 F;  1E83 A;  3GM2 A;  4PJJ A;  1O5H A;  2LIG A;  3ZQY A;  3DJN B;  5JP7 A;  4HFF B;  4JE9 A;  1VMA A;  1OW7 A;  2QE9 A;  1OCC C;  5JS5 A;  2YRF A;  5L0H A;  2XLE A;  4NY3 A;  4U9E A;  1M6T A;  3ASN C;  2ZD9 A;  3EG9 B;  1MNE A;  1PV3 A;  3S0X A;  1A41 A;  3K1I C;  4DXW A;  1S05 A;  1QSP A;  3MFN A;  4J30 B;  5A69 A;  1EI7 A;  4JEA A;  3DAG A;  1AUE A;  5FCL A;  2YL3 A;  3TQO A;  1RXQ A;  1EKY A;  3IQT A;  1RCP A;  1G8X A;  2M4E A;  2NUT B;  3DM5 A;  2Y39 A;  4JTA B;  5IY5 C;  2HMZ A;  1TKN A;  5E2Q A;  4AK9 A;  4BJT A;  5JUA A;  2PFD A;  3Q6M A;  2I15 A;  1I5N A;  3EGX B;  4PR9 A;  1XWJ A;  5DVW A;  5L0D A;  4XLP F;  1YA9 A;  3HLZ A;  2VCA A;  4E18 A;  4Q5S F;  4YT4 A;  1A7E A;  2HKV A;  4JTD B;  2QY9 A;  1Q0F A;  3MYI A;  2W45 A;  3W8I A;  4PJN A;  2CGE A;  1M2V B;  3JYH A;  2M64 A;  4CIP A;  3JT1 A;  4NTB A;  3T4R A;  5KYX B;  1T9K A;  3PCV A;  1ST6 A;  3B9Q A;  2AVK A;  3TJ6 A;  2L6G A;  2V3C C;  3I5P A;  2J7P A;  1YDI A;  3GWL A;  4N06 A;  3SXY A;  4EBK A;  5JT4 A;  1HMD A;  1V55 C;  5K0I A;  3MLG A;  4O6Y A;  4O7G A;  4KNW A;  1NG1 A;  1QVX A;  4KC9 A;  3RW0 A;  4U5D E;  5HV9 A;  1C03 A;  5A6B D;  2L7A A;  3EH2 A;  4GQH A;  2FFH A;  1EA8 A;  2NUP A;  4MVQ A;  3UMI A;  4JCH A;  4YL0 A;  1T6I A;  3ASO C;  4BPM A;  1OCZ C;  2IOQ A;  4DRH B;  1CGM E;  1G4W R;  2OOC A;  2CW0 F;  1HW1 A;  1RKE B;  4LDK A;  2NG1 A;  4BJ6 C;  4C3E A;  4LER A;  1WGW A;  1N1C A;  3QMK A;  3NDB B;  2O9X A;  2AP3 A;  4MVS A;  5DS4 A;  2ICW G;  3HNJ A;  1A7D A;  1FAP B;  3ZVR A;  3RKO F;  3QVY A;  4YL3 A;  2L6H A;  2PNO A;  1WAS A;  2MWQ A;  4C3B A;  1CGN A;  3GEH A;  1U0B B;  1K05 A;  1Z6A A;  1ZZP A;  3EGD A;  3G4X A;  5F5H A;  4MW3 A;  5AC5 A;  5JVE A;  1J8M F;  3QZC A;  4OIR F;  3GOD A;  2XLV A;  2A1D D;  2YL0 A;  4I3M A;  5B3S C;  4KBL A;  1D1B A;  2VB6 A;  2X0C A;  4EHP A;  2ZXW C;  3K1H A;  2BL2 A;  3AG3 C;  3ZG1 A;  4JTC B;  2MHR A;  2KGO A;  3LAY A;  2LSE A;  3H65 A;  4D4X A;  1ZHY A;  3WHN A;  2PX0 A;  4WGZ A;  4EWC A;  4CIH A;  2EPO A;  4OIN F;  3LS1 A;  3SEO A;  2JPU A;  2NSF A;  3NG1 A;  2R03 A;  2LFD A;  1AVO B;  2YQY A;  4U5F E;  3W8H A;  1BR2 A;  3O39 A;  3UR3 C;  4CS9 C;  3M1C B;  4ULV A;  2WVQ A;  3U2L A;  2XLH A;  3JZ0 A;  3S29 A;  3G50 A;  2WZL A;  3V5X A;  2W9Y A;  3L1M A;  2Y3B A;  1T6U A;  1V4A A;  3DWW A;  2P1A A;  3KH2 A;  2HSQ A;  4H54 A;  3U0C A;  3KMI A;  4JZA A;  2QTV A;  2ETS A;  2PBE A;  4NQF A;  4AL1 A;  4JJG A;  2XL4 A;  3GWN A;  4XTK A;  4AX2 A;  1I4Y A;  5F28 E;  3T6B A;  4E0H A;  1WAT A;  1OW8 A;  5L0I A;  2P7V A;  3TOL A;  3U9M A;  3O10 A;  1MMN A;  2ZPA A;  5KYU A;  1Q0D A;  2G3V A;  2Q4F A;  3NYJ A;  3VAY A;  5FZT A;  5BUO A; 
#chains in the Genus database with same CATH homology
 1VLS A;  4Z9H A;  1JMW A;  4Z9J A;  4Z9I A;  2D4U A;  2LIG A;  1LIH A;  3ATP A;  1WAS A;  1VLT A;  3T9O A;  2ASR A;  4H54 A;  1WAT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...