2LIGA

Three-dimensional structures of the ligand-binding domain of the bacterial aspartate receptor with and without a ligand
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
157
structure length
157
Chain Sequence
MGGLLFSSLQHCQQGFVISNELRQQQSELTSTWDLMLQTRINLSRSAARMMMDASNQQSSAKTDLLQNAKTTLAQAAAHYANFKNMTPLPAMAEASANVDEKYQRYQAALAELIQFLDNGNMDAYFAQPTQGMQNALGEALGNYARVSENLYRQTFD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Three-dimensional structures of the ligand-binding domain of the bacterial aspartate receptor with and without a ligand.
pubmed rcsb
source organism Salmonella typhimurium
molecule tags Chemotaxis
molecule keywords ASPARTATE RECEPTOR
total genus 62
structure length 157
sequence length 157
chains with identical sequence B
ec nomenclature
pdb deposition date 1995-04-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.30 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Aspartate receptor, ligand-binding domain 2ligA00
1WATA 3T9OA 2ASRA 4Z9HA 1LIHA 4Z9JA 1VLSA 1VLTA 4H54A 4Z9IA 1JMWA 1WASA 2D4UA 3ATPA 2LIGA
chains in the Genus database with same CATH superfamily
4IGGA 4XPWA 2QY9A 2LQGA 4XEVA 1GM5A 4DRHB 3CZ6A 2NUTB 5COGA 4QI2A 1N1CA 2XLEA 3NMJA 3DAFA 3HNLA 1WASA 4EWCA 1OXBA 1JRAA 3U0CA 1ZYRF 4CDYA 5KYUA 3UR3C 2UUIA 5GPGB 3VM6A 3DJNB 1ZW2A 4JE9A 3LNRA 5EHHA 3C7JA 3C8GB 1WOLA 4K1OA 3G4ZA 2GA0A 1A7VA 3JYYA 3A9CA 2IOQA 2H7VC 2H7OA 1NU7D 4KNVA 3VYWA 3VAYA 2WZLA 1HE9A 5KYNA 2Q00A 1VTMP 4AL0A 1UG7A 3B71A 4JW1A 1D1CA 1CGME 2WL8A 4BJ6C 2C04A 2WZFA 4LLCA 1FFHA 3KYJA 4DXWA 1K40A 1NG1A 1LI7A 1ZVZA 1YARO 5B3IA 3EQLF 3M79A 4JEBA 5E3AA 3TJ5A 2C03A 2A68F 1S7ZA 4D4XA 1HMOA 1LI5A 2L6GA 3JZ0A 3U2MA 4CJGA 3H2VA 3MBGA 3S84A 2WVNA 2LK4A 1APCA 3OWTA 4B6IA 4O7GA 3NRHA 3RVYA 1L3PA 4MVQA 4N06A 5JT4A 2V3CC 2J46A 2XLMA 2YLIA 2R05A 1QSPA 1SMYF 3LEOA 3SXMA 1W2WA 1ZW3A 2HKVA 2R02A 4FWVA 2A6HF 4HE8D 2GAQA 4BJ5C 3S90A 1WWPA 4MTOA 3U9MA 5L0JA 1Q0KA 2XLOA 3K66A 2LIGA 4U5FE 2DGJA 1FFTC 1YLMA 1OQCA 4IJJA 1VK5A 2ZXWC 3L8JA 1DOVA 4OIRF 5BQIA 4ULVA 4XLPF 1PD0A 2Y3GA 3B9QA 3DAGA 1QVXA 4XEKA 2J9WA 3FXHA 2D5RB 1U6HA 4AE4A 4EHPA 4MVOA 1CPQA 5T1DB 3EFOA 4NY3A 1NFNA 2NUTA 4ONSA 3EGXB 3V5YA 2AP3A 5JRAA 2FFHA 3B0PA 2L81A 2PNOA 2A1DD 2F22A 3ASNC 3L0IA 2NUPB 1Z5ZA 4BEMJ 3KYIA 3VF0A 2L6FA 3GM2A 1H7IA 2W45A 4RBNA 3LAYA 3AG4C 3MYFA 4YT8A 1IZMA 1OKKA 3DMDA 4QI0A 2YKZA 3IQCA 3X1OA 1KNYA 1T6UA 3F47A 4CS8C 3FVYA 3OEOA 3V5ZA 1FAPB 4E18A 3KH2A 2KGOA 2GDCA 3I4UA 1H9TA 4MTFA 2I15A 3UNGC 3GANA 1OCRC 3E9VA 4KBLA 4U5EE 2Q7RA 4EKWA 4EBBA 2NSGA 4YJWA 3SXKA 4MQ9F 4DJ9A 3TULA 1ZHYA 3HTKC 4J32B 2XLVA 4JZAA 2LD6A 1F1MA 4RDAA 1WGWA 2DI3A 4CSAA 2XXAB 3M4BA 4PACA 3RH3A 2OEXA 5HSWA 4P9FA 1TWCA 2PX0A 4CIPA 3ZIBA 4EIYA 2EIJC 2Q9AA 4JRZA 2P1AA 2PX3A 1NZEA 3X2QC 1NFOA 1FTSA 4HEAJ 3LLKA 4ZLDA 1HMDA 1HW2A 5L0HA 4U5DE 1FMVA 1K04A 1MMAA 4NTAA 5A6AA 4DOZA 2XSEA 3Q7GA 2HS5A 4JKVA 3DZAA 5E2QA 1S05A 3EZHA 4Q7CA 4JCHA 1VYIA 5A6KA 4JTCB 2CDQA 4WABA 2KSFA 1AUEA 2YVKA 2J45A 3K6BA 4MNDA 4CS9C 3KL4A 3K1IA 1T5OA 2A69F 2LFDA 4J7TA 4O6MA 1LIHA 3T6JA 4BJTA 5IY5C 1Q0DA 5JVEA 2YRFA 1Z23A 3RW0A 4J7YA 3R2PA 4I44A 1ZHTA 1ZHZA 4XEFA 2QE9A 2XL4A 1ORYA 3KMIA 1QZXA 4ZLCA 4Z9JA 5CI9A 1UFBA 2KC3A 2KQ9A 2OG2A 1O3UA 4PJMA 4R32A 4YL1A 2YZSA 4CS7A 2DB4A 4BG0A 3K1IC 1OKKD 3CSKA 1ZU5A 2HMZA 2HMQA 2BE5F 2CNWA 3AG2C 3JRTA 3NMIA 3PMRA 4H4KC 4JJFA 4LLEA 4Z9HA 4E7SA 3C63A 3G50A 4IB4A 2A0BA 2YL7A 4PR9A 3PHF2 3EJNA 3R7CA 1PD1A 2WZGA 1WN0A 2A0UA 3GM3A 3IQ5A 3MYIA 3DM5A 5DS5A 3Q6NA 2NG1A 3M4CA 4LDRA 5AC4A 2Y3HA 3S9OA 2ZXPA 4IAQA 4W8KA 5FZTA 1VB5A 2XL6A 3EGDA 3KKBA 4OD4A 4DBQA 1YYJA 5T3WA 2YL3A 4OIPF 3VRCA 2EPOA 4IARA 1BR2A 2DYRC 3L34A 1E83A 4MVSA 3HNIA 1QKRA 1A0BA 1H6GA 3C8GA 5D92A 2TMVP 3S0XA 5DS4A 1BR1A 2FGYA 4MVUA 3W8IA 4YN0B 3AJMA 2YQYA 3FHDA 4KI2A 2Y3DA 1VLTA 2EPNA 2YLGA 1QLEC 2Q9BA 2KNHA 1OCZC 3AQCA 3N2ZB 3OA1A 2WB7A 2MHRA 5DQTA 4YT2A 2LSEA 1ORSC 3C8ZA 4NC3A 3U5SA 1YJGA 3LUTB 4U5HA 3ZQVA 2XLWA 3KPHA 3LS0A 3TQOA 4AE4B 1YAUO 4JTAB 4K0DA 1BR4A 3QZCA 1T6QA 1C02A 2WVQA 4EBKA 1C17M 4XQ1A 2OJQA 5JLIA 4K7BA 4OD5A 3U3BA 4U9DA 1A7EA 3JSZA 4PJLA 1LPEA 2GFHA 2L7AA 5CI8A 3UMKA 2XM4A 3GEEA 1MQVA 2HV7A 4YT4A 3QVZA 3EGXA 4NTFA 1MMNA 4XPXA 2YWAA 3UMIA 3TOLA 1LS4A 2QUPA 4P6IC 1XWJA 3U3FA 4CSAC 5TJ5E 5DLJA 5DVWA 2PP4A 3V5XA 1BZ4A 3E70C 2OJED 2AWYA 2XS8A 1ZHWA 3ZTZA 3DE8A 1D0ZA 1MMGA 2XRHA 3DXJF 3LLIA 3RQEA 2AVKA 5COFA 3T6BA 5L0DA 5L0CA 1Y4CA 2HUJA 2J9VA 4XLNF 4YL3A 2KW3C 5B3SC 3B0VC 1GQAA 2IXPA 3AGUA 2X0CA 2HSQA 4I3MA 4U5GA 2J9UA 4U5CE 1VMAA 3NDBB 1HY5A 1YZAA 2O9XA 3NYJA 5KYXA 1ZZPA 1AEPA 1H9GA 3LESA 2R7OA 3SNHA 5E33A 1Z3IX 3GORA 2PFDA 1AVOB 3UMHA 4AL1A 2KJGA 4DRJB 2Q4FA 5L0FA 2Y39A 3N24A 2A6EF 1SYQA 3F46A 2Z15A 3FOOA 2YHSA 3O55A 2EPMX 3DKAA 2QTVA 5KYYB 4I1MA 3CQZA 4C7OA 1BDJB 3C62A 1RKEB 2HV6A 3CAXA 3IQTA 2HJ3A 1OCCC 3CEXA 5B1AC 3FOPA 3GWNA 2UUHA 1CGOA 3RQGA 2IXMA 3WAQA 4GQHA 1M56C 4MW8A 2IBFA 3U8VA 4LDQA 3US6A 3WG7C 2W4MA 2L6HA 2OOCA 2P0NA 3TD7A 5KYWA 3SXYA 1ST6A 3DE9A 2Y3BA 2EIKC 2IXOA 2R7QA 4MS2A 1G4WR 5F28E 2KK1A 1BBHA 1L7CA 3HLZA 3U2LA 4EBJA 1JPNA 1SZIA 4YL0A 3RQFA 2R7XA 3O6XA 3MLGA 4PK4A 2R7UA 3JT1A 2R7TA 1WTYA 5L3VA 3IQ6A 3M15A 3FMSA 3U9JA 2EINC 2HSBA 4WGYA 3TK0A 4ER9A 2W9YA 5A6JA 5JS5A 1EQ1A 2CCYA 3TJ6A 2MYSA 3ECSA 1JAFA 1TQGA 2Q9CA 4W8PA 5AGFA 4A2NB 1TWGA 1OR2A 5JSLA 3HKKA 2V26A 1YZCA 2VCAA 5FCLA 2XM0A 4QDLA 1V74B 3H2UA 4NQFA 2R03A 4I1OB 1Z6AA 3DJUB 3S29A 2NSFA 4G7HF 4ANJA 2RSEB 2HJMA 2XXAA 4G7OF 5A6BA 3LNMB 3ZC4A 3L8IA 4CS8A 2EPKX 2EIMC 3S27A 3NG1A 4CX9A 5EGYA 5D91A 4X0RA 4DRIB 1FNTc 5T3TA 4O6NA 3M1CB 3ITFA 3I5PA 2J7PD 3AOUA 2EPLX 2P61A 3AGTA 2JD3A 3AG3C 3B29A 3K33A 1R5ID 2LCHA 4MVZA 1T6IA 4LACB 3BRJA 1M2VB 1FMWA 3ASOC 1Y6DA 3FAJA 4HFKB 4C3BA 3W4YA 2YLDA 5KYYA 1U89A 4NCQA 3K1HA 2OCCC 4PFPA 5EK0A 1I4ZA 3QW0A 1LVKA 2VC9A 1MNDA 4O6YA 4H54A 3DD7A 3S28A 3ABMC 1ZU4A 3SZRA 1Q0MA 5BUOA 2XLHA 4RD9A 3L1MA 1Z7Qc 1OW7A 1HW1A 2CNWD 3JCUQ 3JTLO 4CDAA 2G62A 3FDQA 2CGEA 3N0TA 2Y69C 5L0GA 2R7SA 3NMKA 3SEOA 1CGNA 1M57C 3EG9B 3FAPB 2MWQA 3GEHA 2ICWG 3RFYA 1LS1A 3PDMP 1XZPA 4MTGA 2R7VA 3NYLA 2PBEA 1JR8A 4JIOA 3QVYA 2M64A 1D0XA 1SF8A 1TFOB 2DYSC 4BJ1A 4WJ0A 3MX3A 2NPUA 5L3QA 1V54C 3ZDLA 2ZXOA 2AWCA 3PCVA 4JEAA 1NU9C 4MVMA 4D4NA 2VB6A 2YL0A 1G5ZA 2W4BA 1VYKA 5A69A 2ETSA 1E84A 1RJ9B 4BJ5A 1SR2A 1G4US 2ASRA 3GODA 1OXKA 4IRUA 2B0HA 5DQZA 2YEVA 3EH2A 4E0HA 3RF3A 1D1BA 1JMWA 2OEVA 3C8GD 2D4UA 3IEEA 3AG1C 3EH1A 3POVA 1YA9A 2X51A 1NLXA 2CYDA 3T4RA 1LKXA 1RCPA 1RKCA 3GM1A 4G78A 3RKOF 3U8PA 3UGPA 1GGQA 3LS1A 2KYHA 2WVOA 3ATPA 4JTDB 4Q4ZF 5E3CA 4XPYA 4E0IA 2JPUA 3EZIA 3QTHA 2J7PA 2G3VA 1OW6A 2QLAA 4P9TA 5L0IA 2Q3TA 2GWWA 1NBBA 5K0IA 3IPMO 4PFOA 1DOWA 1WATA 4N6CA 2AU5A 5CIVA 1PCXA 1RMVA 2J0WA 4JURI 5A6BD 3NKDA 3JYHA 1PV3A 3B0UX 1M6TA 4A4AA 3T9OA 3Q6MA 4UDVA 3DM9B 4IWBA 5KYUB 1Q0GA 1YA7O 1MMDA 1TWHA 2H7BA 3AQBA 3W2WA 4E17A 4DBRA 3ZSUA 3LEVA 1D0YA 2LFFA 3W2VA 3IHUA 4G0HA 1RKEA 3O39A 2VCCA 4OIOF 1JPJA 2I8BA 3I5QA 4M63A 3WHNA 4FAPB 3GEIA 4C3DA 4DVZA 2IM8A 3LJBA 2LP4A 3RVZA 1TFKB 4E7ZA 2R7WA 2B0JA 2BC5A 3EGDB 2ZD9A 1A7DA 2P6VA 2XS1A 5JP7A 1J8YF 4MVRA 4CDVA 4AK9A 1XZQA 1QQ3A 4WGZA 3O10A 4PJNA 4BEJA 1HE1A 1OW8A 1RXQA 2J9BA 1G8XA 1LE4A 2P7VA 3EPVA 4GYTA 1T01A 4PJJA 4EUKB 2R7RA 4U5BE 3J06A 1EA8A 4BPMA 2HFIA 4OIQF 1E2XA 3EFOB 4CIHA 5KYWB 1U0BB 4Q5SF 3QMKA 1C03A 3JRMO 2E87A 2VCBA 3V7OA 1EKYA 5BQGA 4BJ6A 5F5HA 3SYNA 3DWWA 3K7DA 2ZPAA 4KC9A 1GS9A 4CJOA 2J0XA 1FR0A 1ZHXA 3W8HA 2RD9A 3GWLA 2VASA 4C7OB 4CS9A 1A41A 3SXZA 3EHNA 1ORJA 2JX0A 1E85A 4LDKA 2XLDA 2CW0F 3ZVRA 4YWQA 1NSGB 3G4XA 1TR2A 4MW3A 5B1BC 3QW1A 2ZXRA 4XTKA 3ZTMA 3SP1A 1JOGA 3HNJA 2R9RB 4U9EA 1MNEA 4ULWA 2OKUA 2XL8A 4G7ZF 4XWJA 2FAPB 1T9KA 3EG9A 5KYXB 4J30B 4L6RA 256BA 3DI5A 2IYLD 4KNWA 1V4AA 1KTMA 2H8AA 3MFNA 5HV9A 1LM3B 4O79A 2OQMA 3RIPA 3T6GB 1M2OA 1EI7A 5DS6A 4GEHA 1K05A 5AC5A 5BQHA 2R25A 3UGOA 1KU2A 1O87A 1CPRA 3EHMA 3WODF 1RJ9A 4JC7A 1IW7F 2IXNA 2OU6A 2QNLA 4FESA 3BEHA 1VLSA 3HNKA 1TWAA 3ABKC 4N4WA 1I5NA 4YK5A 4Z9IA 4DVYP 2YL1A 1O5HA 4JVSA 3TOMA 1LE2A 4HFFB 1YYXA 1M2VA 1I4YA 4LERA 2L9JA 5F5FA 4C3EA 4JCZA 4IAOA 4YT5A 3NYMA 1Z63A 4FX5A 4OINF 1OR3A 1TKNA 1YVIA 1R4TA 1YDIA 3C18A 3Q7LA 2BL2A 3RYLA 3ABLC 1Q0FA 3NKEA 5JUAA 2NUPA 1OCOC 1B68A 1J8MF 1VOMA 2G3KA 4JJGA 2HZ8A 2M4EA 2EILC 2J8WA 3A11A 1E86A 1D1AA 1V55C 3H65A 4NTBA 3JSEO 3ZG1A 3ZWIA 3ZQYA 1QPUA 4F4BA 2VH3A 4CBEA 3HJCA 5COMA 4N6HA 2PF4E 4AX2A
chains in the Genus database with same CATH topology
1WATA 3T9OA 2ASRA 4Z9HA 1LIHA 4Z9JA 1VLSA 1VLTA 4H54A 4Z9IA 1JMWA 1WASA 2D4UA 3ATPA 2LIGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WAT A;  3T9O A;  2ASR A;  4Z9H A;  1LIH A;  4Z9J A;  1VLS A;  1VLT A;  4H54 A;  4Z9I A;  1JMW A;  1WAS A;  2D4U A;  3ATP A;  2LIG A; 
#chains in the Genus database with same CATH topology
 4IGG A;  4XPW A;  2QY9 A;  2LQG A;  4XEV A;  1GM5 A;  4DRH B;  3CZ6 A;  2NUT B;  5COG A;  4QI2 A;  1N1C A;  2XLE A;  3NMJ A;  3DAF A;  3HNL A;  1WAS A;  4EWC A;  1OXB A;  1JRA A;  3U0C A;  1ZYR F;  4CDY A;  5KYU A;  3UR3 C;  2UUI A;  5GPG B;  3VM6 A;  3DJN B;  1ZW2 A;  4JE9 A;  3LNR A;  5EHH A;  3C7J A;  3C8G B;  1WOL A;  4K1O A;  3G4Z A;  2GA0 A;  1A7V A;  3JYY A;  3A9C A;  2IOQ A;  2H7V C;  2H7O A;  1NU7 D;  4KNV A;  3VYW A;  3VAY A;  2WZL A;  1HE9 A;  5KYN A;  2Q00 A;  1VTM P;  4AL0 A;  1UG7 A;  3B71 A;  4JW1 A;  1D1C A;  1CGM E;  2WL8 A;  4BJ6 C;  2C04 A;  2WZF A;  4LLC A;  1FFH A;  3KYJ A;  4DXW A;  1K40 A;  1NG1 A;  1LI7 A;  1ZVZ A;  1YAR O;  5B3I A;  3EQL F;  3M79 A;  4JEB A;  5E3A A;  3TJ5 A;  2C03 A;  2A68 F;  1S7Z A;  4D4X A;  1HMO A;  1LI5 A;  2L6G A;  3JZ0 A;  3U2M A;  4CJG A;  3H2V A;  3MBG A;  3S84 A;  2WVN A;  2LK4 A;  1APC A;  3OWT A;  4B6I A;  4O7G A;  3NRH A;  3RVY A;  1L3P A;  4MVQ A;  4N06 A;  5JT4 A;  2V3C C;  2J46 A;  2XLM A;  2YLI A;  2R05 A;  1QSP A;  1SMY F;  3LEO A;  3SXM A;  1W2W A;  1ZW3 A;  2HKV A;  2R02 A;  4FWV A;  2A6H F;  4HE8 D;  2GAQ A;  4BJ5 C;  3S90 A;  1WWP A;  4MTO A;  3U9M A;  5L0J A;  1Q0K A;  2XLO A;  3K66 A;  2LIG A;  4U5F E;  2DGJ A;  1FFT C;  1YLM A;  1OQC A;  4IJJ A;  1VK5 A;  2ZXW C;  3L8J A;  1DOV A;  4OIR F;  5BQI A;  4ULV A;  4XLP F;  1PD0 A;  2Y3G A;  3B9Q A;  3DAG A;  1QVX A;  4XEK A;  2J9W A;  3FXH A;  2D5R B;  1U6H A;  4AE4 A;  4EHP A;  4MVO A;  1CPQ A;  5T1D B;  3EFO A;  4NY3 A;  1NFN A;  2NUT A;  4ONS A;  3EGX B;  3V5Y A;  2AP3 A;  5JRA A;  2FFH A;  3B0P A;  2L81 A;  2PNO A;  2A1D D;  2F22 A;  3ASN C;  3L0I A;  2NUP B;  1Z5Z A;  4BEM J;  3KYI A;  3VF0 A;  2L6F A;  3GM2 A;  1H7I A;  2W45 A;  4RBN A;  3LAY A;  3AG4 C;  3MYF A;  4YT8 A;  1IZM A;  1OKK A;  3DMD A;  4QI0 A;  2YKZ A;  3IQC A;  3X1O A;  1KNY A;  1T6U A;  3F47 A;  4CS8 C;  3FVY A;  3OEO A;  3V5Z A;  1FAP B;  4E18 A;  3KH2 A;  2KGO A;  2GDC A;  3I4U A;  1H9T A;  4MTF A;  2I15 A;  3UNG C;  3GAN A;  1OCR C;  3E9V A;  4KBL A;  4U5E E;  2Q7R A;  4EKW A;  4EBB A;  2NSG A;  4YJW A;  3SXK A;  4MQ9 F;  4DJ9 A;  3TUL A;  1ZHY A;  3HTK C;  4J32 B;  2XLV A;  4JZA A;  2LD6 A;  1F1M A;  4RDA A;  1WGW A;  2DI3 A;  4CSA A;  2XXA B;  3M4B A;  4PAC A;  3RH3 A;  2OEX A;  5HSW A;  4P9F A;  1TWC A;  2PX0 A;  4CIP A;  3ZIB A;  4EIY A;  2EIJ C;  2Q9A A;  4JRZ A;  2P1A A;  2PX3 A;  1NZE A;  3X2Q C;  1NFO A;  1FTS A;  4HEA J;  3LLK A;  4ZLD A;  1HMD A;  1HW2 A;  5L0H A;  4U5D E;  1FMV A;  1K04 A;  1MMA A;  4NTA A;  5A6A A;  4DOZ A;  2XSE A;  3Q7G A;  2HS5 A;  4JKV A;  3DZA A;  5E2Q A;  1S05 A;  3EZH A;  4Q7C A;  4JCH A;  1VYI A;  5A6K A;  4JTC B;  2CDQ A;  4WAB A;  2KSF A;  1AUE A;  2YVK A;  2J45 A;  3K6B A;  4MND A;  4CS9 C;  3KL4 A;  3K1I A;  1T5O A;  2A69 F;  2LFD A;  4J7T A;  4O6M A;  1LIH A;  3T6J A;  4BJT A;  5IY5 C;  1Q0D A;  5JVE A;  2YRF A;  1Z23 A;  3RW0 A;  4J7Y A;  3R2P A;  4I44 A;  1ZHT A;  1ZHZ A;  4XEF A;  2QE9 A;  2XL4 A;  1ORY A;  3KMI A;  1QZX A;  4ZLC A;  4Z9J A;  5CI9 A;  1UFB A;  2KC3 A;  2KQ9 A;  2OG2 A;  1O3U A;  4PJM A;  4R32 A;  4YL1 A;  2YZS A;  4CS7 A;  2DB4 A;  4BG0 A;  3K1I C;  1OKK D;  3CSK A;  1ZU5 A;  2HMZ A;  2HMQ A;  2BE5 F;  2CNW A;  3AG2 C;  3JRT A;  3NMI A;  3PMR A;  4H4K C;  4JJF A;  4LLE A;  4Z9H A;  4E7S A;  3C63 A;  3G50 A;  4IB4 A;  2A0B A;  2YL7 A;  4PR9 A;  3PHF 2;  3EJN A;  3R7C A;  1PD1 A;  2WZG A;  1WN0 A;  2A0U A;  3GM3 A;  3IQ5 A;  3MYI A;  3DM5 A;  5DS5 A;  3Q6N A;  2NG1 A;  3M4C A;  4LDR A;  5AC4 A;  2Y3H A;  3S9O A;  2ZXP A;  4IAQ A;  4W8K A;  5FZT A;  1VB5 A;  2XL6 A;  3EGD A;  3KKB A;  4OD4 A;  4DBQ A;  1YYJ A;  5T3W A;  2YL3 A;  4OIP F;  3VRC A;  2EPO A;  4IAR A;  1BR2 A;  2DYR C;  3L34 A;  1E83 A;  4MVS A;  3HNI A;  1QKR A;  1A0B A;  1H6G A;  3C8G A;  5D92 A;  2TMV P;  3S0X A;  5DS4 A;  1BR1 A;  2FGY A;  4MVU A;  3W8I A;  4YN0 B;  3AJM A;  2YQY A;  3FHD A;  4KI2 A;  2Y3D A;  1VLT A;  2EPN A;  2YLG A;  1QLE C;  2Q9B A;  2KNH A;  1OCZ C;  3AQC A;  3N2Z B;  3OA1 A;  2WB7 A;  2MHR A;  5DQT A;  4YT2 A;  2LSE A;  1ORS C;  3C8Z A;  4NC3 A;  3U5S A;  1YJG A;  3LUT B;  4U5H A;  3ZQV A;  2XLW A;  3KPH A;  3LS0 A;  3TQO A;  4AE4 B;  1YAU O;  4JTA B;  4K0D A;  1BR4 A;  3QZC A;  1T6Q A;  1C02 A;  2WVQ A;  4EBK A;  1C17 M;  4XQ1 A;  2OJQ A;  5JLI A;  4K7B A;  4OD5 A;  3U3B A;  4U9D A;  1A7E A;  3JSZ A;  4PJL A;  1LPE A;  2GFH A;  2L7A A;  5CI8 A;  3UMK A;  2XM4 A;  3GEE A;  1MQV A;  2HV7 A;  4YT4 A;  3QVZ A;  3EGX A;  4NTF A;  1MMN A;  4XPX A;  2YWA A;  3UMI A;  3TOL A;  1LS4 A;  2QUP A;  4P6I C;  1XWJ A;  3U3F A;  4CSA C;  5TJ5 E;  5DLJ A;  5DVW A;  2PP4 A;  3V5X A;  1BZ4 A;  3E70 C;  2OJE D;  2AWY A;  2XS8 A;  1ZHW A;  3ZTZ A;  3DE8 A;  1D0Z A;  1MMG A;  2XRH A;  3DXJ F;  3LLI A;  3RQE A;  2AVK A;  5COF A;  3T6B A;  5L0D A;  5L0C A;  1Y4C A;  2HUJ A;  2J9V A;  4XLN F;  4YL3 A;  2KW3 C;  5B3S C;  3B0V C;  1GQA A;  2IXP A;  3AGU A;  2X0C A;  2HSQ A;  4I3M A;  4U5G A;  2J9U A;  4U5C E;  1VMA A;  3NDB B;  1HY5 A;  1YZA A;  2O9X A;  3NYJ A;  5KYX A;  1ZZP A;  1AEP A;  1H9G A;  3LES A;  2R7O A;  3SNH A;  5E33 A;  1Z3I X;  3GOR A;  2PFD A;  1AVO B;  3UMH A;  4AL1 A;  2KJG A;  4DRJ B;  2Q4F A;  5L0F A;  2Y39 A;  3N24 A;  2A6E F;  1SYQ A;  3F46 A;  2Z15 A;  3FOO A;  2YHS A;  3O55 A;  2EPM X;  3DKA A;  2QTV A;  5KYY B;  4I1M A;  3CQZ A;  4C7O A;  1BDJ B;  3C62 A;  1RKE B;  2HV6 A;  3CAX A;  3IQT A;  2HJ3 A;  1OCC C;  3CEX A;  5B1A C;  3FOP A;  3GWN A;  2UUH A;  1CGO A;  3RQG A;  2IXM A;  3WAQ A;  4GQH A;  1M56 C;  4MW8 A;  2IBF A;  3U8V A;  4LDQ A;  3US6 A;  3WG7 C;  2W4M A;  2L6H A;  2OOC A;  2P0N A;  3TD7 A;  5KYW A;  3SXY A;  1ST6 A;  3DE9 A;  2Y3B A;  2EIK C;  2IXO A;  2R7Q A;  4MS2 A;  1G4W R;  5F28 E;  2KK1 A;  1BBH A;  1L7C A;  3HLZ A;  3U2L A;  4EBJ A;  1JPN A;  1SZI A;  4YL0 A;  3RQF A;  2R7X A;  3O6X A;  3MLG A;  4PK4 A;  2R7U A;  3JT1 A;  2R7T A;  1WTY A;  5L3V A;  3IQ6 A;  3M15 A;  3FMS A;  3U9J A;  2EIN C;  2HSB A;  4WGY A;  3TK0 A;  4ER9 A;  2W9Y A;  5A6J A;  5JS5 A;  1EQ1 A;  2CCY A;  3TJ6 A;  2MYS A;  3ECS A;  1JAF A;  1TQG A;  2Q9C A;  4W8P A;  5AGF A;  4A2N B;  1TWG A;  1OR2 A;  5JSL A;  3HKK A;  2V26 A;  1YZC A;  2VCA A;  5FCL A;  2XM0 A;  4QDL A;  1V74 B;  3H2U A;  4NQF A;  2R03 A;  4I1O B;  1Z6A A;  3DJU B;  3S29 A;  2NSF A;  4G7H F;  4ANJ A;  2RSE B;  2HJM A;  2XXA A;  4G7O F;  5A6B A;  3LNM B;  3ZC4 A;  3L8I A;  4CS8 A;  2EPK X;  2EIM C;  3S27 A;  3NG1 A;  4CX9 A;  5EGY A;  5D91 A;  4X0R A;  4DRI B;  1FNT c;  5T3T A;  4O6N A;  3M1C B;  3ITF A;  3I5P A;  2J7P D;  3AOU A;  2EPL X;  2P61 A;  3AGT A;  2JD3 A;  3AG3 C;  3B29 A;  3K33 A;  1R5I D;  2LCH A;  4MVZ A;  1T6I A;  4LAC B;  3BRJ A;  1M2V B;  1FMW A;  3ASO C;  1Y6D A;  3FAJ A;  4HFK B;  4C3B A;  3W4Y A;  2YLD A;  5KYY A;  1U89 A;  4NCQ A;  3K1H A;  2OCC C;  4PFP A;  5EK0 A;  1I4Z A;  3QW0 A;  1LVK A;  2VC9 A;  1MND A;  4O6Y A;  4H54 A;  3DD7 A;  3S28 A;  3ABM C;  1ZU4 A;  3SZR A;  1Q0M A;  5BUO A;  2XLH A;  4RD9 A;  3L1M A;  1Z7Q c;  1OW7 A;  1HW1 A;  2CNW D;  3JCU Q;  3JTL O;  4CDA A;  2G62 A;  3FDQ A;  2CGE A;  3N0T A;  2Y69 C;  5L0G A;  2R7S A;  3NMK A;  3SEO A;  1CGN A;  1M57 C;  3EG9 B;  3FAP B;  2MWQ A;  3GEH A;  2ICW G;  3RFY A;  1LS1 A;  3PDM P;  1XZP A;  4MTG A;  2R7V A;  3NYL A;  2PBE A;  1JR8 A;  4JIO A;  3QVY A;  2M64 A;  1D0X A;  1SF8 A;  1TFO B;  2DYS C;  4BJ1 A;  4WJ0 A;  3MX3 A;  2NPU A;  5L3Q A;  1V54 C;  3ZDL A;  2ZXO A;  2AWC A;  3PCV A;  4JEA A;  1NU9 C;  4MVM A;  4D4N A;  2VB6 A;  2YL0 A;  1G5Z A;  2W4B A;  1VYK A;  5A69 A;  2ETS A;  1E84 A;  1RJ9 B;  4BJ5 A;  1SR2 A;  1G4U S;  2ASR A;  3GOD A;  1OXK A;  4IRU A;  2B0H A;  5DQZ A;  2YEV A;  3EH2 A;  4E0H A;  3RF3 A;  1D1B A;  1JMW A;  2OEV A;  3C8G D;  2D4U A;  3IEE A;  3AG1 C;  3EH1 A;  3POV A;  1YA9 A;  2X51 A;  1NLX A;  2CYD A;  3T4R A;  1LKX A;  1RCP A;  1RKC A;  3GM1 A;  4G78 A;  3RKO F;  3U8P A;  3UGP A;  1GGQ A;  3LS1 A;  2KYH A;  2WVO A;  3ATP A;  4JTD B;  4Q4Z F;  5E3C A;  4XPY A;  4E0I A;  2JPU A;  3EZI A;  3QTH A;  2J7P A;  2G3V A;  1OW6 A;  2QLA A;  4P9T A;  5L0I A;  2Q3T A;  2GWW A;  1NBB A;  5K0I A;  3IPM O;  4PFO A;  1DOW A;  1WAT A;  4N6C A;  2AU5 A;  5CIV A;  1PCX A;  1RMV A;  2J0W A;  4JUR I;  5A6B D;  3NKD A;  3JYH A;  1PV3 A;  3B0U X;  1M6T A;  4A4A A;  3T9O A;  3Q6M A;  4UDV A;  3DM9 B;  4IWB A;  5KYU B;  1Q0G A;  1YA7 O;  1MMD A;  1TWH A;  2H7B A;  3AQB A;  3W2W A;  4E17 A;  4DBR A;  3ZSU A;  3LEV A;  1D0Y A;  2LFF A;  3W2V A;  3IHU A;  4G0H A;  1RKE A;  3O39 A;  2VCC A;  4OIO F;  1JPJ A;  2I8B A;  3I5Q A;  4M63 A;  3WHN A;  4FAP B;  3GEI A;  4C3D A;  4DVZ A;  2IM8 A;  3LJB A;  2LP4 A;  3RVZ A;  1TFK B;  4E7Z A;  2R7W A;  2B0J A;  2BC5 A;  3EGD B;  2ZD9 A;  1A7D A;  2P6V A;  2XS1 A;  5JP7 A;  1J8Y F;  4MVR A;  4CDV A;  4AK9 A;  1XZQ A;  1QQ3 A;  4WGZ A;  3O10 A;  4PJN A;  4BEJ A;  1HE1 A;  1OW8 A;  1RXQ A;  2J9B A;  1G8X A;  1LE4 A;  2P7V A;  3EPV A;  4GYT A;  1T01 A;  4PJJ A;  4EUK B;  2R7R A;  4U5B E;  3J06 A;  1EA8 A;  4BPM A;  2HFI A;  4OIQ F;  1E2X A;  3EFO B;  4CIH A;  5KYW B;  1U0B B;  4Q5S F;  3QMK A;  1C03 A;  3JRM O;  2E87 A;  2VCB A;  3V7O A;  1EKY A;  5BQG A;  4BJ6 A;  5F5H A;  3SYN A;  3DWW A;  3K7D A;  2ZPA A;  4KC9 A;  1GS9 A;  4CJO A;  2J0X A;  1FR0 A;  1ZHX A;  3W8H A;  2RD9 A;  3GWL A;  2VAS A;  4C7O B;  4CS9 A;  1A41 A;  3SXZ A;  3EHN A;  1ORJ A;  2JX0 A;  1E85 A;  4LDK A;  2XLD A;  2CW0 F;  3ZVR A;  4YWQ A;  1NSG B;  3G4X A;  1TR2 A;  4MW3 A;  5B1B C;  3QW1 A;  2ZXR A;  4XTK A;  3ZTM A;  3SP1 A;  1JOG A;  3HNJ A;  2R9R B;  4U9E A;  1MNE A;  4ULW A;  2OKU A;  2XL8 A;  4G7Z F;  4XWJ A;  2FAP B;  1T9K A;  3EG9 A;  5KYX B;  4J30 B;  4L6R A;  256B A;  3DI5 A;  2IYL D;  4KNW A;  1V4A A;  1KTM A;  2H8A A;  3MFN A;  5HV9 A;  1LM3 B;  4O79 A;  2OQM A;  3RIP A;  3T6G B;  1M2O A;  1EI7 A;  5DS6 A;  4GEH A;  1K05 A;  5AC5 A;  5BQH A;  2R25 A;  3UGO A;  1KU2 A;  1O87 A;  1CPR A;  3EHM A;  3WOD F;  1RJ9 A;  4JC7 A;  1IW7 F;  2IXN A;  2OU6 A;  2QNL A;  4FES A;  3BEH A;  1VLS A;  3HNK A;  1TWA A;  3ABK C;  4N4W A;  1I5N A;  4YK5 A;  4Z9I A;  4DVY P;  2YL1 A;  1O5H A;  4JVS A;  3TOM A;  1LE2 A;  4HFF B;  1YYX A;  1M2V A;  1I4Y A;  4LER A;  2L9J A;  5F5F A;  4C3E A;  4JCZ A;  4IAO A;  4YT5 A;  3NYM A;  1Z63 A;  4FX5 A;  4OIN F;  1OR3 A;  1TKN A;  1YVI A;  1R4T A;  1YDI A;  3C18 A;  3Q7L A;  2BL2 A;  3RYL A;  3ABL C;  1Q0F A;  3NKE A;  5JUA A;  2NUP A;  1OCO C;  1B68 A;  1J8M F;  1VOM A;  2G3K A;  4JJG A;  2HZ8 A;  2M4E A;  2EIL C;  2J8W A;  3A11 A;  1E86 A;  1D1A A;  1V55 C;  3H65 A;  4NTB A;  3JSE O;  3ZG1 A;  3ZWI A;  3ZQY A;  1QPU A;  4F4B A;  2VH3 A;  4CBE A;  3HJC A;  5COM A;  4N6H A;  2PF4 E;  4AX2 A; 
#chains in the Genus database with same CATH homology
 1WAT A;  3T9O A;  2ASR A;  4Z9H A;  1LIH A;  4Z9J A;  1VLS A;  1VLT A;  4H54 A;  4Z9I A;  1JMW A;  1WAS A;  2D4U A;  3ATP A;  2LIG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...