3AGUA

Hemerythrin-like domain of dcrh (semimet-r)
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
133
structure length
133
Chain Sequence
DVLVKWSEDLANLPSIDTQHKRLVDYINDLYRAARRRDMDKAREVFDALKNYAVEHFGYEERLFADYAYPEATRHKEIHRRFVETVLKWEKQLAAGDPEVVMTTLRGLVDWLVNHIMKEDKKYEAYLRERGVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Characteristics of Diiron Site with Large Cavity in Hemerythrin-like Domain of DcrH
rcsb
source organism Desulfovibrio vulgaris
molecule tags Metal binding protein
molecule keywords Hemerythrin-like domain protein DcrH
total genus 58
structure length 133
sequence length 133
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01814 Hemerythrin Hemerythrin HHE cation binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.50 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Hemerythrin-like 3aguA00
2AWYA 2HMQA 3AGTA 1A7EA 4XPXA 1A7DA 1I4YA 2AVKA 2HMZA 2AWCA 2MHRA 1I4ZA 1HMDA 3AGUA 4XQ1A 4XPYA 4XPWA 3WAQA 3WHNA 1HMOA
chains in the Genus database with same CATH superfamily
1HW1A 1WOLA 4QI0A 2XXAA 1A7DA 2MHRA 2QTVA 1U6HA 4RBNA 4YN0B 3EGDA 3TJ5A 1QSPA 2D4UA 4N6CA 1HE1A 1FAPB 1Y4CA 4FWVA 4RD9A 2GDCA 3FOOA 2OU6A 3HLZA 3O6XA 4XPWA 5L0JA 1AUEA 1AEPA 1G4US 2FFHA 2YL3A 1W2WA 2ETSA 3AJMA 4U5DE 3DXJF 2R7WA 1U0BB 3K66A 2P1AA 5FCLA 1A7EA 2PF4E 1LS1A 1UFBA 3K7DA 3SXZA 5DLJA 5JVEA 1QVXA 1D1AA 3TK0A 1BDJB 1QKRA 1YLMA 2LQGA 4G7ZF 1TKNA 2ZXPA 3ASOC 3GANA 4NTAA 1GM5A 2A1DD 4JW1A 1JR8A 1LM3B 2L6GA 3DE9A 3T4RA 1TFOB 3KKBA 3VF0A 1E84A 4UDVA 1VOMA 2VB6A 3L0IA 2R7XA 1GGQA 3R7CA 2EPOA 3C8GD 2IXOA 4QI2A 1NBBA 3M4CA 4KI2A 3SNHA 3EJNA 1B68A 1JPJA 3C8GB 2J0WA 4MVSA 4C3DA 1E83A 4G7OF 1WGWA 1V54C 1Y6DA 1M2OA 4EHPA 3B29A 2XL8A 1NFNA 3U8PA 1BBHA 2Q4FA 3B0PA 5HV9A 1ZHXA 1WWPA 2P6VA 1BR4A 5F28E 1MNDA 3MYIA 3ZC4A 3ZIBA 3G4ZA 1ZHYA 3ZVRA 1NSGB 3EZHA 2C04A 4J32B 4OIRF 4EIYA 5L3VA 3TOLA 3B0VC 1NLXA 2R25A 1G4WR 2YVKA 3HNJA 2HZ8A 3IQ5A 4ULWA 1VLTA 2IBFA 4BJTA 4MVQA 4YWQA 5KYWB 2YWAA 4C7OB 2F22A 2OEVA 4ULVA 3EH1A 3DAGA 2ICWG 2KW3C 2X0CA 3SXMA 2OOCA 4U5GA 3VAYA 2Q9CA 3AG2C 1T01A 4YT8A 1XWJA 2OQMA 1LVKA 1CPRA 1YYXA 2Q00A 3C7JA 1J8MF 3DJNB 1HY5A 2J45A 1S05A 4L6RA 1EI7A 1G8XA 3QZCA 1SYQA 3GORA 1ZHZA 1ORYA 3I5QA 4YK5A 5DS6A 2JD3A 2CNWA 3R2PA 3CQZA 3FOPA 2XRHA 4Q4ZF 1K04A 4ZLCA 1VYKA 1OCCC 3GODA 3ABMC 2NUPB 2R7TA 2RD9A 3CSKA 4XEFA 5KYUA 1MNEA 4MVOA 2DGJA 2NSFA 3QTHA 3EG9B 1RCPA 2J0XA 4CDVA 1MQVA 3L8IA 3DJUB 2M64A 2V3CC 4XWJA 3POVA 3TD7A 3CEXA 4K1OA 3E9VA 3WG7C 2AU5A 3ASNC 4O7GA 3FHDA 2A0UA 1EA8A 1LE2A 1ST6A 1TWAA 5KYYB 4YL1A 3U9JA 2Y69C 3W2WA 2ZPAA 4JTDB 3IQCA 3RW0A 1WN0A 4JEAA 1BZ4A 2P7VA 3HNIA 2HKVA 4P9FA 1J8YF 4GYTA 3TOMA 2G3KA 4M63A 3TJ6A 2JPUA 4JE9A 2XSEA 3T6GB 3G50A 2J8WA 4HEAJ 1F1MA 1YDIA 4RDAA 1LI5A 2IM8A 2LCHA 3S90A 1ZU4A 4QDLA 3FXHA 3RIPA 4OIQF 4N6HA 4E17A 2R7VA 4LDRA 1IZMA 2L7AA 1R4TA 2HV6A 3IPMO 3LS0A 4CSAC 1C02A 5FZTA 4BEMJ 1RJ9A 1Q0KA 2YRFA 1YZAA 5BQHA 5BQIA 3EFOB 2LFDA 2OJQA 2P0NA 4W8KA 4AL0A 2HS5A 3C18A 3S84A 3NG1A 2LK4A 2KK1A 2OG2A 4Q5SF 1RKEA 4O6MA 3DD7A 4FAPB 2HJ3A 4JZAA 4Q7CA 5B1BC 5BQGA 1E86A 1SF8A 5A6JA 4U5FE 3A9CA 2X51A 2NUTA 1U89A 1VK5A 1VYIA 1T6QA 3V5XA 5COMA 2YL0A 2J9VA 4C3EA 3DI5A 4WGYA 3BRJA 4PJMA 3UMKA 2EIMC 3S9OA 3UGPA 1V74B 3LLIA 4P6IC 1KTMA 2HMZA 2WZLA 4CIPA 2G62A 2CGEA 4JC7A 2JX0A 1FMWA 4K7BA 1YAUO 4I1OB 4EWCA 3W2VA 5DVWA 4XPXA 3DE8A 4MTFA 4CDYA 3G4XA 4AK9A 3NYMA 1QZXA 3LLKA 3LUTB 4IAOA 4LLEA 4YL0A 2DYSC 1APCA 1RJ9B 2AVKA 5L0HA 1FR0A 4KNWA 1JMWA 3CAXA 3LNMB 5BUOA 3GM2A 2YHSA 3FVYA 5K0IA 4JJGA 2L6HA 3MYFA 2BC5A 2R7RA 2G3VA 2KYHA 3ZDLA 2KC3A 5CIVA 3ZG1A 5A6BA 4BG0A 4IAQA 2CCYA 4XEVA 5COFA 3TULA 3QVYA 3U0CA 2L81A 3KL4A 1JOGA 5L0CA 3GWLA 3RQGA 3Q7LA 2EPNA 5AGFA 3W4YA 4CS7A 4MVZA 4EBJA 5T1DB 3ECSA 1ZZPA 1ZU5A 3F46A 3JRTA 3GEEA 2IXNA 2GFHA 1QPUA 3PCVA 4DXWA 4PACA 4BJ6A 4PJNA 2XLWA 1VLSA 3EH2A 3K1IA 3GM3A 3LJBA 3NYJA 1JPNA 2EPLX 1OKKA 3KH2A 2H7BA 4NQFA 1FFHA 1ORJA 1S7ZA 1YA7O 2KQ9A 4HFFB 2UUHA 1FTSA 4C7OA 4GQHA 3W8HA 4HFKB 1MMNA 1Q0GA 5JP7A 3RH3A 4IWBA 3HJCA 4YT5A 2J9BA 1I4ZA 2LFFA 4MVUA 3WAQA 4XLPF 3LEOA 5EK0A 2L9JA 2EIJC 2W4BA 3NMJA 4BJ1A 3IHUA 4BPMA 3M1CB 1LPEA 5JLIA 2BE5F 3L1MA 1A41A 2RSEB 4MTGA 3DAFA 3DM5A 2J46A 1G5ZA 2QY9A 4AL1A 3AQBA 1M57C 3HNLA 2CYDA 3BEHA 1D0XA 1KU2A 1TR2A 2WVQA 3NKEA 3TQOA 1K40A 3VRCA 1OR2A 2A6EF 3L8JA 3AOUA 5KYWA 1OCZC 2YLDA 1ZYRF 2LSEA 3UMHA 5JUAA 4CX9A 3ABLC 5L0FA 2H7OA 2OEXA 1H9TA 3JTLO 2YQYA 1FMVA 4MTOA 4H54A 4MW3A 2A6HF 4CDAA 5KYYA 1NZEA 1RKEB 2LD6A 3RFYA 3K1HA 4K0DA 3B9QA 2Q3TA 3I5PA 3WODF 2KNHA 3KPHA 3HNKA 4IJJA 2HSBA 2W9YA 5A6AA 3FDQA 4ANJA 4OIPF 3H65A 5GPGB 4C3BA 4OD5A 3AGTA 1E85A 3OA1A 4P9TA 5KYUB 1TWCA 1OCOC 1E2XA 1YARO 1C17M 2PX3A 3S29A 3U8VA 1SZIA 2NUPA 1OXKA 2VH3A 3NMKA 1O3UA 3RVYA 3U5SA 4YT2A 2Y3GA 4FESA 4G78A 2M4EA 2Z15A 1OW6A 1D1CA 1T6UA 2WL8A 1QLEC 4XQ1A 4AX2A 3PHF2 3EHNA 2ZXWC 4JKVA 1M56C 5E2QA 3SYNA 4U5CE 4KBLA 1PV3A 1WTYA 1D1BA 1YJGA 2L6FA 2PBEA 4NTFA 4E0IA 1K05A 1A7VA 2XLEA 3S0XA 5CI9A 4OIOF 5A6BD 1OQCA 3IQ6A 2O9XA 4BJ5A 1TWHA 4LLCA 1QQ3A 4Z9HA 3N24A 4DBRA 3AG1C 3IEEA 3LS1A 3RF3A 3NDBB 1RKCA 3O55A 3N2ZB 1VMAA 3U9MA 2NPUA 3M4BA 3U2MA 3QW1A 2PX0A 2H7VC 1Q0DA 1UG7A 4O6YA 3EG9A 4LDKA 2FAPB 2A68F 4CJGA 1V4AA 2KGOA 3I4UA 4CJOA 3B71A 3MFNA 1Q0FA 4IARA 3K33A 2YKZA 2WVOA 4J7TA 4F4BA 4PJJA 2I15A 3JSEO 4U9DA 2QLAA 4DVYP 4DBQA 4EBBA 1M2VA 2HMQA 3GEHA 4DRHB 2J9UA 4KC9A 4WJ0A 5E33A 4EKWA 3RKOF 4N06A 2ZXRA 1LI7A 2OKUA 1NFOA 2XL6A 4JTCB 4O79A 4R32A 4XEKA 3ABKC 5L0IA 3EHMA 5DS4A 1FNTc 5JS5A 2LIGA 3JT1A 4LACB 1XZPA 3RYLA 2XLDA 2NUTB 2XM4A 2XLVA 3LNRA 3ZTZA 1OW8A 1Z6AA 4A2NB 3ITFA 5KYXB 2V26A 2XS8A 2YLGA 5JSLA 4XTKA 2R7UA 1SR2A 3VYWA 3ZQYA 3U3FA 1EKYA 2YZSA 1H7IA 3H2UA 4EBKA 3EFOA 1A0BA 3J06A 1LE4A 2R7OA 1TFKB 3V5YA 1D0YA 3B0UX 5D91A 1TWGA 2XXAB 4D4XA 2J7PA 2WZFA 1CGOA 3NYLA 5L0GA 1T9KA 5B1AC 3SP1A 1ZHWA 2EILC 3C8GA 1HMDA 3WHNA 4BEJA 1OXBA 3S28A 1ZW2A 2XLOA 5T3WA 2UUIA 4E7SA 1N1CA 4I3MA 2IYLD 4JTAB 4CBEA 4E18A 5JRAA 2Y3BA 4JCHA 3VM6A 2GWWA 2WVNA 1CGME 1NU7D 1MMDA 2XM0A 3IQTA 1FFTC 2J7PD 3JRMO 2C03A 2MWQA 2XLMA 5DQZA 4JJFA 1ZVZA 2Y39A 4FX5A 4BJ5C 2H8AA 1OW7A 4NTBA 4OINF 2ASRA 1JAFA 3K1IC 4CS9A 4CS9C 4EUKB 1L7CA 5COGA 4N4WA 2IXMA 256BA 4DVZA 2R03A 3H2VA 3JSZA 5KYNA 2Q7RA 4ZLDA 2CDQA 2J9WA 2A0BA 1T5OA 3C62A 1WATA 4W8PA 4YT4A 2EPMX 1D0ZA 1M6TA 2HUJA 2D5RB 3K6BA 4XLNF 3GEIA 3LESA 3EZIA 2IOQA 2YLIA 1RXQA 2W4MA 3N0TA 3EPVA 2ZXOA 4IRUA 3JYYA 3EGDB 2R05A 2EPKX 1Z5ZA 1OKKD 1PCXA 2QNLA 2XLHA 3UMIA 2PFDA 1HW2A 3JZ0A 3ATPA 3RQFA 3SXYA 3PMRA 1VTMP 2AP3A 2EINC 3AQCA 3V7OA 3DWWA 2HV7A 5F5HA 4DRIB 5AC4A 4U5BE 3LEVA 4I1MA 5B3SC 4JVSA 3AGUA 4J30B 3RVZA 4CSAA 1NG1A 4CS8A 2A69F 4YJWA 3OEOA 5D92A 3UNGC 1YZCA 1NU9C 1ORSC 3DM9B 4LDQA 1PD1A 2IXPA 3O39A 2QUPA 2YEVA 1Z7Qc 1YYJA 5DS5A 3ZWIA 3DKAA 2FGYA 3NKDA 4JRZA 3T6BA 2AWYA 3FAPB 3Q6MA 1HE9A 1WASA 1Z3IX 4U5EE 2YL1A 2VCBA 3US6A 3QW0A 4CIHA 1CGNA 3A11A 1BR1A 2B0HA 4ER9A 4IB4A 4KNVA 1JRAA 3C8ZA 4WABA 4G7HF 1H6GA 3LAYA 2HJMA 2NSGA 1I4YA 4MVRA 4NCQA 1ZHTA 4HE8D 1Z63A 4IGGA 2GA0A 3RQEA 2QE9A 4J7YA 2R9RB 3Q6NA 1YVIA 2DYRC 1C03A 4E0HA 4U5HA 5DQTA 3JCUQ 2KJGA 2I8BA 3HTKC 3Q7GA 3HKKA 3E70C 3V5ZA 3KYIA 4YL3A 2GAQA 3S27A 1MMGA 3ZSUA 3F47A 1CPQA 5TJ5E 2R02A 1L3PA 3QMKA 4JURI 3PDMP 4E7ZA 4BJ6C 3GM1A 1LS4A 3FMSA 3JYHA 2KSFA 2PNOA 3ZTMA 4DRJB 3EGXB 4DJ9A 2MYSA 3AG3C 2R7QA 3FAJA 3ZQVA 4G0HA 4JIOA 1O87A 1H9GA 1T6IA 3T6JA 5HSWA 2NG1A 2VCCA 3SEOA 1TQGA 3QVZA 1PD0A 5T3TA 5F5FA 4B6IA 2Y3DA 1YA9A 3W8IA 4I44A 1BR2A 4LERA 4D4NA 4WGZA 2TMVP 5EGYA 5EHHA 5L3QA 3SZRA 4OD4A 4JEBA 3GWNA 4PK4A 2XL4A 5KYXA 1AVOB 5L0DA 1I5NA 1OR3A 1DOVA 2VC9A 2PP4A 3DMDA 4XPYA 4AE4A 1GS9A 1KNYA 4MW8A 5AC5A 2EIKC 4U9EA 2DB4A 3DZAA 1R5ID 2WB7A 3MBGA 3MLGA 1HMOA 3M79A 2Y3HA 3UR3C 1MMAA 1VB5A 1O5HA 4GEHA 4MNDA 5E3CA 1RMVA 4CS8C 2E87A 1LIHA 3T9OA 3KMIA 3MX3A 5E3AA 3U2LA 3AG4C 5B3IA 2W45A 2DI3A 5IY5C 2AWCA 1GQAA 2OCCC 4NY3A 5A69A 2VASA 2OJED 2B0JA 3EGXA 4Z9JA 4MQ9F 4DOZA 1ZW3A 1OCRC 2XS1A 4H4KC 2YL7A 1LKXA 2HFIA 2VCAA 1SMYF 2LP4A 4MVMA 4X0RA 3UGOA 5JT4A 3X2QC 3L34A 3EQLF 3SXKA 3CZ6A 4O6NA 2Q9AA 3O10A 4PR9A 2HSQA 1DOWA 3M15A 4Z9IA 4PJLA 4MS2A 3OWTA 2P61A 3NMIA 3NRHA 2Q9BA 1XZQA 4PFPA 3U3BA 4A4AA 1Q0MA 2ZD9A 5CI8A 2R7SA 3X1OA 1EQ1A 2BL2A 5A6KA 1Z23A 4NC3A 1V55C 1M2VB 2CW0F 3C63A 1IW7F 2CNWD 4JCZA 4PFOA 4ONSA 2WZGA 3KYJA 4AE4B
chains in the Genus database with same CATH topology
2AWYA 2HMQA 3AGTA 1A7EA 4XPXA 1A7DA 1I4YA 2AVKA 2HMZA 2AWCA 2MHRA 1I4ZA 1HMDA 3AGUA 4XQ1A 4XPYA 4XPWA 3WAQA 3WHNA 1HMOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AWY A;  2HMQ A;  3AGT A;  1A7E A;  4XPX A;  1A7D A;  1I4Y A;  2AVK A;  2HMZ A;  2AWC A;  2MHR A;  1I4Z A;  1HMD A;  3AGU A;  4XQ1 A;  4XPY A;  4XPW A;  3WAQ A;  3WHN A;  1HMO A; 
#chains in the Genus database with same CATH topology
 1HW1 A;  1WOL A;  4QI0 A;  2XXA A;  1A7D A;  2MHR A;  2QTV A;  1U6H A;  4RBN A;  4YN0 B;  3EGD A;  3TJ5 A;  1QSP A;  2D4U A;  4N6C A;  1HE1 A;  1FAP B;  1Y4C A;  4FWV A;  4RD9 A;  2GDC A;  3FOO A;  2OU6 A;  3HLZ A;  3O6X A;  4XPW A;  5L0J A;  1AUE A;  1AEP A;  1G4U S;  2FFH A;  2YL3 A;  1W2W A;  2ETS A;  3AJM A;  4U5D E;  3DXJ F;  2R7W A;  1U0B B;  3K66 A;  2P1A A;  5FCL A;  1A7E A;  2PF4 E;  1LS1 A;  1UFB A;  3K7D A;  3SXZ A;  5DLJ A;  5JVE A;  1QVX A;  1D1A A;  3TK0 A;  1BDJ B;  1QKR A;  1YLM A;  2LQG A;  4G7Z F;  1TKN A;  2ZXP A;  3ASO C;  3GAN A;  4NTA A;  1GM5 A;  2A1D D;  4JW1 A;  1JR8 A;  1LM3 B;  2L6G A;  3DE9 A;  3T4R A;  1TFO B;  3KKB A;  3VF0 A;  1E84 A;  4UDV A;  1VOM A;  2VB6 A;  3L0I A;  2R7X A;  1GGQ A;  3R7C A;  2EPO A;  3C8G D;  2IXO A;  4QI2 A;  1NBB A;  3M4C A;  4KI2 A;  3SNH A;  3EJN A;  1B68 A;  1JPJ A;  3C8G B;  2J0W A;  4MVS A;  4C3D A;  1E83 A;  4G7O F;  1WGW A;  1V54 C;  1Y6D A;  1M2O A;  4EHP A;  3B29 A;  2XL8 A;  1NFN A;  3U8P A;  1BBH A;  2Q4F A;  3B0P A;  5HV9 A;  1ZHX A;  1WWP A;  2P6V A;  1BR4 A;  5F28 E;  1MND A;  3MYI A;  3ZC4 A;  3ZIB A;  3G4Z A;  1ZHY A;  3ZVR A;  1NSG B;  3EZH A;  2C04 A;  4J32 B;  4OIR F;  4EIY A;  5L3V A;  3TOL A;  3B0V C;  1NLX A;  2R25 A;  1G4W R;  2YVK A;  3HNJ A;  2HZ8 A;  3IQ5 A;  4ULW A;  1VLT A;  2IBF A;  4BJT A;  4MVQ A;  4YWQ A;  5KYW B;  2YWA A;  4C7O B;  2F22 A;  2OEV A;  4ULV A;  3EH1 A;  3DAG A;  2ICW G;  2KW3 C;  2X0C A;  3SXM A;  2OOC A;  4U5G A;  3VAY A;  2Q9C A;  3AG2 C;  1T01 A;  4YT8 A;  1XWJ A;  2OQM A;  1LVK A;  1CPR A;  1YYX A;  2Q00 A;  3C7J A;  1J8M F;  3DJN B;  1HY5 A;  2J45 A;  1S05 A;  4L6R A;  1EI7 A;  1G8X A;  3QZC A;  1SYQ A;  3GOR A;  1ZHZ A;  1ORY A;  3I5Q A;  4YK5 A;  5DS6 A;  2JD3 A;  2CNW A;  3R2P A;  3CQZ A;  3FOP A;  2XRH A;  4Q4Z F;  1K04 A;  4ZLC A;  1VYK A;  1OCC C;  3GOD A;  3ABM C;  2NUP B;  2R7T A;  2RD9 A;  3CSK A;  4XEF A;  5KYU A;  1MNE A;  4MVO A;  2DGJ A;  2NSF A;  3QTH A;  3EG9 B;  1RCP A;  2J0X A;  4CDV A;  1MQV A;  3L8I A;  3DJU B;  2M64 A;  2V3C C;  4XWJ A;  3POV A;  3TD7 A;  3CEX A;  4K1O A;  3E9V A;  3WG7 C;  2AU5 A;  3ASN C;  4O7G A;  3FHD A;  2A0U A;  1EA8 A;  1LE2 A;  1ST6 A;  1TWA A;  5KYY B;  4YL1 A;  3U9J A;  2Y69 C;  3W2W A;  2ZPA A;  4JTD B;  3IQC A;  3RW0 A;  1WN0 A;  4JEA A;  1BZ4 A;  2P7V A;  3HNI A;  2HKV A;  4P9F A;  1J8Y F;  4GYT A;  3TOM A;  2G3K A;  4M63 A;  3TJ6 A;  2JPU A;  4JE9 A;  2XSE A;  3T6G B;  3G50 A;  2J8W A;  4HEA J;  1F1M A;  1YDI A;  4RDA A;  1LI5 A;  2IM8 A;  2LCH A;  3S90 A;  1ZU4 A;  4QDL A;  3FXH A;  3RIP A;  4OIQ F;  4N6H A;  4E17 A;  2R7V A;  4LDR A;  1IZM A;  2L7A A;  1R4T A;  2HV6 A;  3IPM O;  3LS0 A;  4CSA C;  1C02 A;  5FZT A;  4BEM J;  1RJ9 A;  1Q0K A;  2YRF A;  1YZA A;  5BQH A;  5BQI A;  3EFO B;  2LFD A;  2OJQ A;  2P0N A;  4W8K A;  4AL0 A;  2HS5 A;  3C18 A;  3S84 A;  3NG1 A;  2LK4 A;  2KK1 A;  2OG2 A;  4Q5S F;  1RKE A;  4O6M A;  3DD7 A;  4FAP B;  2HJ3 A;  4JZA A;  4Q7C A;  5B1B C;  5BQG A;  1E86 A;  1SF8 A;  5A6J A;  4U5F E;  3A9C A;  2X51 A;  2NUT A;  1U89 A;  1VK5 A;  1VYI A;  1T6Q A;  3V5X A;  5COM A;  2YL0 A;  2J9V A;  4C3E A;  3DI5 A;  4WGY A;  3BRJ A;  4PJM A;  3UMK A;  2EIM C;  3S9O A;  3UGP A;  1V74 B;  3LLI A;  4P6I C;  1KTM A;  2HMZ A;  2WZL A;  4CIP A;  2G62 A;  2CGE A;  4JC7 A;  2JX0 A;  1FMW A;  4K7B A;  1YAU O;  4I1O B;  4EWC A;  3W2V A;  5DVW A;  4XPX A;  3DE8 A;  4MTF A;  4CDY A;  3G4X A;  4AK9 A;  3NYM A;  1QZX A;  3LLK A;  3LUT B;  4IAO A;  4LLE A;  4YL0 A;  2DYS C;  1APC A;  1RJ9 B;  2AVK A;  5L0H A;  1FR0 A;  4KNW A;  1JMW A;  3CAX A;  3LNM B;  5BUO A;  3GM2 A;  2YHS A;  3FVY A;  5K0I A;  4JJG A;  2L6H A;  3MYF A;  2BC5 A;  2R7R A;  2G3V A;  2KYH A;  3ZDL A;  2KC3 A;  5CIV A;  3ZG1 A;  5A6B A;  4BG0 A;  4IAQ A;  2CCY A;  4XEV A;  5COF A;  3TUL A;  3QVY A;  3U0C A;  2L81 A;  3KL4 A;  1JOG A;  5L0C A;  3GWL A;  3RQG A;  3Q7L A;  2EPN A;  5AGF A;  3W4Y A;  4CS7 A;  4MVZ A;  4EBJ A;  5T1D B;  3ECS A;  1ZZP A;  1ZU5 A;  3F46 A;  3JRT A;  3GEE A;  2IXN A;  2GFH A;  1QPU A;  3PCV A;  4DXW A;  4PAC A;  4BJ6 A;  4PJN A;  2XLW A;  1VLS A;  3EH2 A;  3K1I A;  3GM3 A;  3LJB A;  3NYJ A;  1JPN A;  2EPL X;  1OKK A;  3KH2 A;  2H7B A;  4NQF A;  1FFH A;  1ORJ A;  1S7Z A;  1YA7 O;  2KQ9 A;  4HFF B;  2UUH A;  1FTS A;  4C7O A;  4GQH A;  3W8H A;  4HFK B;  1MMN A;  1Q0G A;  5JP7 A;  3RH3 A;  4IWB A;  3HJC A;  4YT5 A;  2J9B A;  1I4Z A;  2LFF A;  4MVU A;  3WAQ A;  4XLP F;  3LEO A;  5EK0 A;  2L9J A;  2EIJ C;  2W4B A;  3NMJ A;  4BJ1 A;  3IHU A;  4BPM A;  3M1C B;  1LPE A;  5JLI A;  2BE5 F;  3L1M A;  1A41 A;  2RSE B;  4MTG A;  3DAF A;  3DM5 A;  2J46 A;  1G5Z A;  2QY9 A;  4AL1 A;  3AQB A;  1M57 C;  3HNL A;  2CYD A;  3BEH A;  1D0X A;  1KU2 A;  1TR2 A;  2WVQ A;  3NKE A;  3TQO A;  1K40 A;  3VRC A;  1OR2 A;  2A6E F;  3L8J A;  3AOU A;  5KYW A;  1OCZ C;  2YLD A;  1ZYR F;  2LSE A;  3UMH A;  5JUA A;  4CX9 A;  3ABL C;  5L0F A;  2H7O A;  2OEX A;  1H9T A;  3JTL O;  2YQY A;  1FMV A;  4MTO A;  4H54 A;  4MW3 A;  2A6H F;  4CDA A;  5KYY A;  1NZE A;  1RKE B;  2LD6 A;  3RFY A;  3K1H A;  4K0D A;  3B9Q A;  2Q3T A;  3I5P A;  3WOD F;  2KNH A;  3KPH A;  3HNK A;  4IJJ A;  2HSB A;  2W9Y A;  5A6A A;  3FDQ A;  4ANJ A;  4OIP F;  3H65 A;  5GPG B;  4C3B A;  4OD5 A;  3AGT A;  1E85 A;  3OA1 A;  4P9T A;  5KYU B;  1TWC A;  1OCO C;  1E2X A;  1YAR O;  1C17 M;  2PX3 A;  3S29 A;  3U8V A;  1SZI A;  2NUP A;  1OXK A;  2VH3 A;  3NMK A;  1O3U A;  3RVY A;  3U5S A;  4YT2 A;  2Y3G A;  4FES A;  4G78 A;  2M4E A;  2Z15 A;  1OW6 A;  1D1C A;  1T6U A;  2WL8 A;  1QLE C;  4XQ1 A;  4AX2 A;  3PHF 2;  3EHN A;  2ZXW C;  4JKV A;  1M56 C;  5E2Q A;  3SYN A;  4U5C E;  4KBL A;  1PV3 A;  1WTY A;  1D1B A;  1YJG A;  2L6F A;  2PBE A;  4NTF A;  4E0I A;  1K05 A;  1A7V A;  2XLE A;  3S0X A;  5CI9 A;  4OIO F;  5A6B D;  1OQC A;  3IQ6 A;  2O9X A;  4BJ5 A;  1TWH A;  4LLC A;  1QQ3 A;  4Z9H A;  3N24 A;  4DBR A;  3AG1 C;  3IEE A;  3LS1 A;  3RF3 A;  3NDB B;  1RKC A;  3O55 A;  3N2Z B;  1VMA A;  3U9M A;  2NPU A;  3M4B A;  3U2M A;  3QW1 A;  2PX0 A;  2H7V C;  1Q0D A;  1UG7 A;  4O6Y A;  3EG9 A;  4LDK A;  2FAP B;  2A68 F;  4CJG A;  1V4A A;  2KGO A;  3I4U A;  4CJO A;  3B71 A;  3MFN A;  1Q0F A;  4IAR A;  3K33 A;  2YKZ A;  2WVO A;  4J7T A;  4F4B A;  4PJJ A;  2I15 A;  3JSE O;  4U9D A;  2QLA A;  4DVY P;  4DBQ A;  4EBB A;  1M2V A;  2HMQ A;  3GEH A;  4DRH B;  2J9U A;  4KC9 A;  4WJ0 A;  5E33 A;  4EKW A;  3RKO F;  4N06 A;  2ZXR A;  1LI7 A;  2OKU A;  1NFO A;  2XL6 A;  4JTC B;  4O79 A;  4R32 A;  4XEK A;  3ABK C;  5L0I A;  3EHM A;  5DS4 A;  1FNT c;  5JS5 A;  2LIG A;  3JT1 A;  4LAC B;  1XZP A;  3RYL A;  2XLD A;  2NUT B;  2XM4 A;  2XLV A;  3LNR A;  3ZTZ A;  1OW8 A;  1Z6A A;  4A2N B;  3ITF A;  5KYX B;  2V26 A;  2XS8 A;  2YLG A;  5JSL A;  4XTK A;  2R7U A;  1SR2 A;  3VYW A;  3ZQY A;  3U3F A;  1EKY A;  2YZS A;  1H7I A;  3H2U A;  4EBK A;  3EFO A;  1A0B A;  3J06 A;  1LE4 A;  2R7O A;  1TFK B;  3V5Y A;  1D0Y A;  3B0U X;  5D91 A;  1TWG A;  2XXA B;  4D4X A;  2J7P A;  2WZF A;  1CGO A;  3NYL A;  5L0G A;  1T9K A;  5B1A C;  3SP1 A;  1ZHW A;  2EIL C;  3C8G A;  1HMD A;  3WHN A;  4BEJ A;  1OXB A;  3S28 A;  1ZW2 A;  2XLO A;  5T3W A;  2UUI A;  4E7S A;  1N1C A;  4I3M A;  2IYL D;  4JTA B;  4CBE A;  4E18 A;  5JRA A;  2Y3B A;  4JCH A;  3VM6 A;  2GWW A;  2WVN A;  1CGM E;  1NU7 D;  1MMD A;  2XM0 A;  3IQT A;  1FFT C;  2J7P D;  3JRM O;  2C03 A;  2MWQ A;  2XLM A;  5DQZ A;  4JJF A;  1ZVZ A;  2Y39 A;  4FX5 A;  4BJ5 C;  2H8A A;  1OW7 A;  4NTB A;  4OIN F;  2ASR A;  1JAF A;  3K1I C;  4CS9 A;  4CS9 C;  4EUK B;  1L7C A;  5COG A;  4N4W A;  2IXM A;  256B A;  4DVZ A;  2R03 A;  3H2V A;  3JSZ A;  5KYN A;  2Q7R A;  4ZLD A;  2CDQ A;  2J9W A;  2A0B A;  1T5O A;  3C62 A;  1WAT A;  4W8P A;  4YT4 A;  2EPM X;  1D0Z A;  1M6T A;  2HUJ A;  2D5R B;  3K6B A;  4XLN F;  3GEI A;  3LES A;  3EZI A;  2IOQ A;  2YLI A;  1RXQ A;  2W4M A;  3N0T A;  3EPV A;  2ZXO A;  4IRU A;  3JYY A;  3EGD B;  2R05 A;  2EPK X;  1Z5Z A;  1OKK D;  1PCX A;  2QNL A;  2XLH A;  3UMI A;  2PFD A;  1HW2 A;  3JZ0 A;  3ATP A;  3RQF A;  3SXY A;  3PMR A;  1VTM P;  2AP3 A;  2EIN C;  3AQC A;  3V7O A;  3DWW A;  2HV7 A;  5F5H A;  4DRI B;  5AC4 A;  4U5B E;  3LEV A;  4I1M A;  5B3S C;  4JVS A;  3AGU A;  4J30 B;  3RVZ A;  4CSA A;  1NG1 A;  4CS8 A;  2A69 F;  4YJW A;  3OEO A;  5D92 A;  3UNG C;  1YZC A;  1NU9 C;  1ORS C;  3DM9 B;  4LDQ A;  1PD1 A;  2IXP A;  3O39 A;  2QUP A;  2YEV A;  1Z7Q c;  1YYJ A;  5DS5 A;  3ZWI A;  3DKA A;  2FGY A;  3NKD A;  4JRZ A;  3T6B A;  2AWY A;  3FAP B;  3Q6M A;  1HE9 A;  1WAS A;  1Z3I X;  4U5E E;  2YL1 A;  2VCB A;  3US6 A;  3QW0 A;  4CIH A;  1CGN A;  3A11 A;  1BR1 A;  2B0H A;  4ER9 A;  4IB4 A;  4KNV A;  1JRA A;  3C8Z A;  4WAB A;  4G7H F;  1H6G A;  3LAY A;  2HJM A;  2NSG A;  1I4Y A;  4MVR A;  4NCQ A;  1ZHT A;  4HE8 D;  1Z63 A;  4IGG A;  2GA0 A;  3RQE A;  2QE9 A;  4J7Y A;  2R9R B;  3Q6N A;  1YVI A;  2DYR C;  1C03 A;  4E0H A;  4U5H A;  5DQT A;  3JCU Q;  2KJG A;  2I8B A;  3HTK C;  3Q7G A;  3HKK A;  3E70 C;  3V5Z A;  3KYI A;  4YL3 A;  2GAQ A;  3S27 A;  1MMG A;  3ZSU A;  3F47 A;  1CPQ A;  5TJ5 E;  2R02 A;  1L3P A;  3QMK A;  4JUR I;  3PDM P;  4E7Z A;  4BJ6 C;  3GM1 A;  1LS4 A;  3FMS A;  3JYH A;  2KSF A;  2PNO A;  3ZTM A;  4DRJ B;  3EGX B;  4DJ9 A;  2MYS A;  3AG3 C;  2R7Q A;  3FAJ A;  3ZQV A;  4G0H A;  4JIO A;  1O87 A;  1H9G A;  1T6I A;  3T6J A;  5HSW A;  2NG1 A;  2VCC A;  3SEO A;  1TQG A;  3QVZ A;  1PD0 A;  5T3T A;  5F5F A;  4B6I A;  2Y3D A;  1YA9 A;  3W8I A;  4I44 A;  1BR2 A;  4LER A;  4D4N A;  4WGZ A;  2TMV P;  5EGY A;  5EHH A;  5L3Q A;  3SZR A;  4OD4 A;  4JEB A;  3GWN A;  4PK4 A;  2XL4 A;  5KYX A;  1AVO B;  5L0D A;  1I5N A;  1OR3 A;  1DOV A;  2VC9 A;  2PP4 A;  3DMD A;  4XPY A;  4AE4 A;  1GS9 A;  1KNY A;  4MW8 A;  5AC5 A;  2EIK C;  4U9E A;  2DB4 A;  3DZA A;  1R5I D;  2WB7 A;  3MBG A;  3MLG A;  1HMO A;  3M79 A;  2Y3H A;  3UR3 C;  1MMA A;  1VB5 A;  1O5H A;  4GEH A;  4MND A;  5E3C A;  1RMV A;  4CS8 C;  2E87 A;  1LIH A;  3T9O A;  3KMI A;  3MX3 A;  5E3A A;  3U2L A;  3AG4 C;  5B3I A;  2W45 A;  2DI3 A;  5IY5 C;  2AWC A;  1GQA A;  2OCC C;  4NY3 A;  5A69 A;  2VAS A;  2OJE D;  2B0J A;  3EGX A;  4Z9J A;  4MQ9 F;  4DOZ A;  1ZW3 A;  1OCR C;  2XS1 A;  4H4K C;  2YL7 A;  1LKX A;  2HFI A;  2VCA A;  1SMY F;  2LP4 A;  4MVM A;  4X0R A;  3UGO A;  5JT4 A;  3X2Q C;  3L34 A;  3EQL F;  3SXK A;  3CZ6 A;  4O6N A;  2Q9A A;  3O10 A;  4PR9 A;  2HSQ A;  1DOW A;  3M15 A;  4Z9I A;  4PJL A;  4MS2 A;  3OWT A;  2P61 A;  3NMI A;  3NRH A;  2Q9B A;  1XZQ A;  4PFP A;  3U3B A;  4A4A A;  1Q0M A;  2ZD9 A;  5CI8 A;  2R7S A;  3X1O A;  1EQ1 A;  2BL2 A;  5A6K A;  1Z23 A;  4NC3 A;  1V55 C;  1M2V B;  2CW0 F;  3C63 A;  1IW7 F;  2CNW D;  4JCZ A;  4PFO A;  4ONS A;  2WZG A;  3KYJ A;  4AE4 B; 
#chains in the Genus database with same CATH homology
 2AWY A;  2HMQ A;  3AGT A;  1A7E A;  4XPX A;  1A7D A;  1I4Y A;  2AVK A;  2HMZ A;  2AWC A;  2MHR A;  1I4Z A;  1HMD A;  3AGU A;  4XQ1 A;  4XPY A;  4XPW A;  3WAQ A;  3WHN A;  1HMO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...