3AGUA

Hemerythrin-like domain of dcrh (semimet-r)
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
133
structure length
133
Chain Sequence
DVLVKWSEDLANLPSIDTQHKRLVDYINDLYRAARRRDMDKAREVFDALKNYAVEHFGYEERLFADYAYPEATRHKEIHRRFVETVLKWEKQLAAGDPEVVMTTLRGLVDWLVNHIMKEDKKYEAYLRERGVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hemerythrin-like domain protein DcrH
publication title Characteristics of Diiron Site with Large Cavity in Hemerythrin-like Domain of DcrH
rcsb
source organism Desulfovibrio vulgaris
molecule tags Metal binding protein
total genus 58
structure length 133
sequence length 133
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01814 Hemerythrin Hemerythrin HHE cation binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.50 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Hemerythrin-like 3aguA00
2AVKA 4XQ1A 3AGUA 1I4YA 1A7DA 1I4ZA 2HMQA 3AGTA 2MHRA 1A7EA 4XPYA 3WHNA 4XPWA 3WAQA 1HMOA 2HMZA 2AWYA 2AWCA 1HMDA 4XPXA
chains in the Genus database with same CATH superfamily
2IOQA 3K33A 4B6IA 3Q7LA 1HE9A 3SYNA 1WGWA 3C8ZA 1E83A 2EIJC 3DWWA 1QPUA 3FOOA 3JZ0A 4E0IA 2YL1A 1RKCA 3DMDA 5A6BA 5L0CA 1VLSA 3ITFA 5KYXB 2CYDA 3HJCA 1YVIA 3EFOB 3ABMC 3QVZA 4XTKA 1WOLA 3R2PA 4C3BA 4CS9A 1C17M 4OINF 2J8WA 1MNDA 2JX0A 2P7VA 4DRHB 4I3MA 3S9OA 2IXMA 2OCCC 4DBQA 2YZSA 2KGOA 1T01A 1Y4CA 2IXOA 4DOZA 3PHF2 1VB5A 2IXPA 2Y69C 4CSAC 1FFTC 1L3PA 2EPKX 2OU6A 1SZIA 1NU7D 3EHNA 4XEFA 5B1AC 3HNJA 1G5ZA 1YYXA 1VOMA 5A6AA 4N6CA 1ORSC 4BJ5A 4J7YA 1M2VA 1ZU5A 1EQ1A 4C7OB 4EHPA 1E85A 4OD4A 4OIQF 2WZFA 1O5HA 4PJJA 3EGXB 5AC4A 5L0DA 1BDJB 4HEAJ 2L9JA 4IGGA 5KYXA 1WASA 3AG1C 3MFNA 3S84A 2QE9A 1TKNA 3MBGA 4JRZA 3V7OA 1Z5ZA 3CEXA 3EHMA 4KI2A 2PP4A 3TJ6A 3SZRA 2LFFA 2EPOA 2IXNA 4XWJA 2LFDA 2KJGA 3ASNC 4A2NB 1T9KA 3EH1A 1JPNA 1N1CA 2OJED 1JOGA 5IY5C 3I4UA 1HMOA 4U5FE 3NMIA 3MLGA 2AWYA 4LDQA 3ZDLA 1KNYA 2VCCA 3H2UA 4EBKA 5A6BD 1MQVA 3V5ZA 4BG0A 1JPJA 1BBHA 1V4AA 2Q9BA 4EUKB 3EGDA 3L8IA 5COGA 3EPVA 2G3KA 3HNKA 4C7OA 3L34A 1YYJA 5JP7A 1BZ4A 3T6GB 5T3WA 3AG3C 3T6BA 3ZQVA 2ZXRA 3JSEO 5DLJA 3HKKA 2LP4A 3BEHA 2Y3BA 2I15A 3Q6NA 4JEAA 3X1OA 4ANJA 4CDVA 4PFOA 2DB4A 3NRHA 3B0VC 3GEHA 2CW0F 1QSPA 2X51A 3RKOF 4CS8C 1NU9C 2IM8A 2P61A 2VCBA 3LEOA 2J45A 3EQLF 4O79A 3C8GA 3SEOA 2A6EF 3U3BA 5COMA 1VK5A 3US6A 2HZ8A 4YL1A 2QLAA 4DRJB 4R32A 1U0BB 5B3IA 2A1DD 2HKVA 1QKRA 4QI0A 1BR1A 1M6TA 2L6HA 4CSAA 3ZTMA 2LQGA 1R4TA 4JKVA 2WVOA 4XQ1A 4CS7A 2EIMC 3S27A 5DQZA 4JCHA 1CPQA 4ULWA 1D0YA 2EINC 1UG7A 2O9XA 2ZXWC 4U5DE 4M63A 2R05A 4MVUA 1SMYF 4BEJA 2EILC 2CGEA 4O6MA 1MMAA 4MVRA 4MQ9F 4C3DA 3M15A 2XSEA 3HTKC 3B9QA 1ZU4A 3ECSA 1YA7O 1YDIA 3QW0A 2P6VA 2NUTB 2BC5A 3GEIA 3KKBA 2HSQA 5HV9A 3OEOA 1T6QA 1HW2A 1APCA 4LDKA 4U5HA 3ASOC 5L3VA 1HMDA 2F22A 5AC5A 4JTAB 4WJ0A 3C63A 3AQBA 3F47A 3A9CA 3LAYA 2YQYA 3L1MA 4G0HA 4GEHA 4Q7CA 4IJJA 4CJOA 5JRAA 2BL2A 3TJ5A 1YLMA 4J30B 4FX5A 2WVQA 1UFBA 2IBFA 4O7GA 2Q9AA 2R7SA 1GS9A 2XM0A 1HY5A 4HFKB 1IZMA 4PK4A 4YT2A 3U8PA 3VAYA 3C8GD 2V3CC 4EBJA 2R7UA 2D4UA 3UGPA 2XXAA 4Z9JA 3U5SA 3GM1A 3S28A 2L6GA 1D1CA 5DQTA 2LIGA 2PNOA 5E2QA 2R7XA 3AOUA 3DE9A 1A41A 1LS4A 1NG1A 1O3UA 4WABA 2IYLD 4XEVA 3NKEA 2NUTA 1M2VB 2A69F 2AWCA 1YARO 4CS8A 5E3CA 3QZCA 1FMVA 3T9OA 3L8JA 3O10A 2HV7A 1OR2A 3A11A 4MTFA 4P9FA 1NSGB 1PD0A 4G7ZF 1FTSA 4JIOA 4XLPF 3BRJA 3ZTZA 1V55C 4CIPA 3RIPA 3RQFA 2H8AA 4I1OB 5KYUB 3M4BA 3K66A 4MVMA 4BJ1A 2J9UA 2VC9A 2WL8A 2ZXPA 3IQCA 3PCVA 1CPRA 3GEEA 1KU2A 1OR3A 1WATA 4XEKA 3IQ5A 3QVYA 4U9DA 4YT4A 3LLKA 3RW0A 4HFFB 3MYIA 256BA 3W8IA 4IB4A 2A68F 2LK4A 1FNTc 3KYIA 3DJNB 4JJGA 4AK9A 2ZPAA 1PD1A 1Z6AA 2XL6A 4K7BA 5COFA 3RYLA 3EGDB 3DJUB 4BPMA 3ZQYA 4OIOF 3CQZA 1JRAA 3K1IC 4MVQA 4MVOA 3DZAA 1ZYRF 4OD5A 2DYRC 1AEPA 2V26A 1G4WR 5JS5A 1A7DA 2YL7A 3SXKA 3VYWA 1RKEB 5B3SC 5EHHA 4FESA 3JRMO 3RH3A 3FMSA 1D1AA 1PV3A 3HNIA 3ZWIA 4EKWA 4U5BE 2XS8A 5KYUA 4MS2A 3JTLO 5CI8A 3NYMA 4E18A 1TWGA 3VRCA 1OW6A 2KNHA 2JPUA 2G3VA 3VM6A 2KSFA 3UR3C 1E84A 2HJMA 5D92A 3DKAA 4DVYP 3C8GB 3N24A 1VMAA 3HNLA 4MW8A 4U5EE 1XZQA 3N0TA 3TULA 1OW8A 1SF8A 2A6HF 2YLDA 3FVYA 3DM5A 3IEEA 1Q0GA 2PX3A 4HE8D 3EZHA 3PMRA 2XS1A 3CSKA 1T6IA 2R25A 3NKDA 1CGOA 4PFPA 1RKEA 3RQEA 1NLXA 1RXQA 4LLCA 5EGYA 1H9TA 1FFHA 3IHUA 4YWQA 1K04A 4MVZA 5L0HA 2Y3DA 4G7HF 2XL8A 3AGTA 4N06A 1M2OA 2XLMA 4KNWA 2KQ9A 3RVZA 4ZLCA 3I5QA 1JMWA 4J7TA 5GPGB 2Y39A 1OQCA 3GWLA 5JSLA 3E9VA 1U89A 3NMKA 3NDBB 2W4MA 4L6RA 1LM3B 3M1CB 3M4CA 1H6GA 1RJ9A 2HUJA 4ONSA 2KYHA 2FFHA 2YLIA 5KYWB 5L0GA 2XL4A 4E0HA 4IARA 3B71A 3B0PA 3GANA 3NMJA 4JTCB 5B1BC 4EBBA 1OCCC 3LS1A 1SYQA 2HS5A 2NSGA 3SXYA 1WN0A 3B29A 1OCRC 1YA9A 1ZHTA 3GORA 3ABKC 4P6IC 2XLHA 3K1IA 3QMKA 2W45A 2J46A 3U2LA 4MTOA 2EPNA 2YL3A 3LJBA 4NTFA 4PJLA 5A69A 1GGQA 1TFKB 3EJNA 4CDYA 3MYFA 3U8VA 5L3QA 2XXAB 2CDQA 4DVZA 4YT5A 1AUEA 5JUAA 1GM5A 1I5NA 3AJMA 2PBEA 3U9JA 1Z3IX 4XPWA 3T4RA 2Q7RA 3WAQA 4Q5SF 2R7QA 2GFHA 1FAPB 3H2VA 4FAPB 1TWCA 2PF4E 1XZPA 2W4BA 2XLWA 3IQTA 4NCQA 2A0BA 4JE9A 4PR9A 3TD7A 3TOLA 2WVNA 4MVSA 4JW1A 4E17A 3S0XA 2M64A 3NG1A 4W8PA 4OIRF 5KYWA 2H7OA 3LESA 1FMWA 4MNDA 5JVEA 2J9WA 1M57C 2UUHA 2B0HA 2I8BA 2R9RB 3RQGA 4LACB 4DRIB 1BR4A 2H7VC 2L7AA 2UUIA 4QI2A 3ATPA 5AGFA 4KNVA 4PJMA 3RVYA 2R7VA 1FR0A 3JT1A 5BUOA 1Q0MA 3JCUQ 4WGYA 4BJ6C 4NY3A 2Z15A 1R5ID 2ZXOA 4LDRA 3CZ6A 4BEMJ 4XPYA 4MTGA 5A6KA 2XM4A 2OG2A 2E87A 1G8XA 3DAGA 1NFNA 4Z9IA 2R7WA 4RD9A 4JURI 3W2WA 4YK5A 1Z63A 4DXWA 1C03A 2XLDA 4GYTA 4IWBA 2OEVA 1KTMA 3TK0A 3O6XA 4PACA 1MMNA 3PDMP 2VB6A 2HV6A 2WZLA 2J9BA 3JRTA 3Q7GA 2OQMA 3C18A 4OIPF 2NSFA 2C04A 2GA0A 2GDCA 3FAPB 2FGYA 3EH2A 3GWNA 1ZW2A 5L0IA 3ZC4A 3HLZA 4Q4ZF 2EIKC 2QY9A 4RBNA 1LI7A 3IQ6A 2P1AA 1EI7A 1G4US 1XWJA 2KW3C 4YT8A 3S90A 3DAFA 1CGNA 3UNGC 3AG2C 2DYSC 2NPUA 1J8MF 3G4XA 1A7EA 2LCHA 1T6UA 2YLGA 1D0ZA 3E70C 2ZD9A 3H65A 3KPHA 3LNRA 4F4BA 2OEXA 2NUPB 1EA8A 4AE4A 4C3EA 2Q3TA 3CAXA 4CIHA 1BR2A 2NG1A 3OWTA 2ETSA 1YJGA 4N4WA 1WTYA 4UDVA 3LS0A 3AQCA 1OW7A 2HJ3A 1A0BA 1RCPA 3IPMO 1ORJA 1TQGA 1LIHA 4JTDB 1ZHWA 5KYNA 3UGOA 1H7IA 4IRUA 3SXMA 3FOPA 1AVOB 4JC7A 4K0DA 2DGJA 4JZAA 1IW7F 2PFDA 4MW3A 1OCZC 1LPEA 3LUTB 2WB7A 3KYJA 2HSBA 2YHSA 5BQGA 3ZG1A 3LEVA 1YAUO 2Q4FA 1I4ZA 1NFOA 1S7ZA 1L7CA 4KBLA 4E7SA 3UMKA 3FXHA 3K7DA 1D1BA 2EPMX 3FHDA 3ABLC 4H54A 5E33A 5T1DB 2TMVP 3FDQA 1W2WA 2Q9CA 1HW1A 2A0UA 4O6NA 2MWQA 4I1MA 3U9MA 1DOVA 3KL4A 1T5OA 3R7CA 2RD9A 2NUPA 1ZVZA 4JCZA 5F5HA 4BJ6A 3RFYA 1LKXA 5FZTA 3B0UX 1QZXA 2R7RA 2YKZA 2HFIA 1RJ9B 5T3TA 1ORYA 2LSEA 2B0JA 2AU5A 2BE5F 3OA1A 3SP1A 3ZVRA 1LVKA 4AL0A 4NTBA 3V5YA 1K40A 1QLEC 5JT4A 1OKKA 1K05A 1VYIA 3AGUA 4CJGA 3TQOA 1JAFA 3KMIA 5KYYB 2PX0A 3EFOA 1V74B 2GAQA 2M4EA 2GWWA 2MYSA 2WZGA 1O87A 3EG9B 5TJ5E 3W4YA 5BQHA 1Q0KA 4AL1A 2LD6A 2HMQA 3ZSUA 2R7OA 3WODF 5K0IA 3K1HA 2QNLA 2P0NA 2J7PA 5E3AA 2R03A 3W8HA 1A7VA 4YL0A 1TWAA 1ZHXA 5L0JA 1MMDA 2Q00A 3U3FA 2XLVA 2JD3A 3DM9B 5A6JA 2XLEA 2HMZA 2KK1A 1E86A 4H4KC 4W8KA 3JYHA 1Y6DA 1H9GA 4YL3A 4LERA 2H7BA 1MMGA 2Y3GA 4DJ9A 3N2ZB 4FWVA 1HE1A 1WWPA 1J8YF 4NQFA 1M56C 1F1MA 1PCXA 2VCAA 4IAQA 4N6HA 4EWCA 4WGZA 4EIYA 2J9VA 4LLEA 3EGXA 4A4AA 4U5GA 3VF0A 2J0WA 2W9YA 3DD7A 5KYYA 2FAPB 3JYYA 1TWHA 2CNWA 4CDAA 1ZZPA 4AX2A 3EG9A 4CX9A 2VH3A 4GQHA 3Q6MA 3GM2A 3U0CA 1Z23A 1JR8A 1QQ3A 2XRHA 3X2QC 5JLIA 2VASA 3GODA 1E2XA 3QTHA 1RMVA 2YRFA 5D91A 3V5XA 1TFOB 5EK0A 5F5FA 2YWAA 1ZW3A 2R02A 2R7TA 4J32B 2YEVA 1OKKD 2CCYA 4JVSA 2X0CA 4U9EA 4XPXA 4ZLDA 2OOCA 4E7ZA 1SR2A 4G7OF 2QUPA 3SXZA 4CS9C 4X0RA 1Q0DA 2OJQA 3GM3A 4O6YA 2Y3HA 3F46A 3MX3A 4CBEA 5FCLA 1OCOC 3G50A 3NYJA 4D4XA 2L81A 1I4YA 5CIVA 1V54C 3AG4C 1NZEA 4Z9HA 2J7PD 4P9TA 4YJWA 1C02A 4XLNF 5BQIA 1DOWA 1QVXA 4QDLA 3NYLA 5DVWA 1ZHZA 3UMIA 3DXJF 1LE4A 1ST6A 1YZAA 4BJ5C 1LI5A 2G62A 3KH2A 3UMHA 3ZIBA 4AE4B 3G4ZA 3POVA 2QTVA 1ZHYA 4JJFA 5L0FA 2J0XA 3EZIA 1B68A 3M79A 1OXKA 3L0IA 3QW1A 4IAOA 5DS4A 3K6BA 5DS6A 2ASRA 1VTMP 3J06A 3JSZA 3U2MA 2OKUA 2XLOA 3DE8A 2AVKA 4NTAA 3O39A 4NC3A 1OXBA 2CNWD 5HSWA 3LNMB 4JEBA 4KC9A 1D0XA 1LE2A 4K1OA 3TOMA 1VYKA 3I5PA 3FAJA 4RDAA 2L6FA 1EKYA 3O55A 5F28E 2ICWG 2D5RB 1VLTA 1Q0FA 1Z7Qc 4U5CE 3S29A 1CGME 3C7JA 2C03A 1TR2A 1S05A 1U6HA 2YVKA 4PJNA 2MHRA 4DBRA 1MNEA 2RSEB 1NBBA 2EPLX 2YL0A 3C62A 4ULVA 3RF3A 3WHNA 4BJTA 2KC3A 1YZCA 3W2VA 1LS1A 5CI9A 3WG7C 3SNHA 5DS5A 3LLIA 2AP3A 3DI5A 4I44A 4YN0B 4G78A 3T6JA 2DI3A 1GQAA 4ER9A 4D4NA
chains in the Genus database with same CATH topology
2AVKA 4XQ1A 3AGUA 1I4YA 1A7DA 1I4ZA 2HMQA 3AGTA 2MHRA 1A7EA 4XPYA 3WHNA 4XPWA 3WAQA 1HMOA 2HMZA 2AWYA 2AWCA 1HMDA 4XPXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AVK A;  4XQ1 A;  3AGU A;  1I4Y A;  1A7D A;  1I4Z A;  2HMQ A;  3AGT A;  2MHR A;  1A7E A;  4XPY A;  3WHN A;  4XPW A;  3WAQ A;  1HMO A;  2HMZ A;  2AWY A;  2AWC A;  1HMD A;  4XPX A; 
#chains in the Genus database with same CATH topology
 2IOQ A;  3K33 A;  4B6I A;  3Q7L A;  1HE9 A;  3SYN A;  1WGW A;  3C8Z A;  1E83 A;  2EIJ C;  3DWW A;  1QPU A;  3FOO A;  3JZ0 A;  4E0I A;  2YL1 A;  1RKC A;  3DMD A;  5A6B A;  5L0C A;  1VLS A;  3ITF A;  5KYX B;  2CYD A;  3HJC A;  1YVI A;  3EFO B;  3ABM C;  3QVZ A;  4XTK A;  1WOL A;  3R2P A;  4C3B A;  4CS9 A;  1C17 M;  4OIN F;  2J8W A;  1MND A;  2JX0 A;  2P7V A;  4DRH B;  4I3M A;  3S9O A;  2IXM A;  2OCC C;  4DBQ A;  2YZS A;  2KGO A;  1T01 A;  1Y4C A;  2IXO A;  4DOZ A;  3PHF 2;  1VB5 A;  2IXP A;  2Y69 C;  4CSA C;  1FFT C;  1L3P A;  2EPK X;  2OU6 A;  1SZI A;  1NU7 D;  3EHN A;  4XEF A;  5B1A C;  3HNJ A;  1G5Z A;  1YYX A;  1VOM A;  5A6A A;  4N6C A;  1ORS C;  4BJ5 A;  4J7Y A;  1M2V A;  1ZU5 A;  1EQ1 A;  4C7O B;  4EHP A;  1E85 A;  4OD4 A;  4OIQ F;  2WZF A;  1O5H A;  4PJJ A;  3EGX B;  5AC4 A;  5L0D A;  1BDJ B;  4HEA J;  2L9J A;  4IGG A;  5KYX A;  1WAS A;  3AG1 C;  3MFN A;  3S84 A;  2QE9 A;  1TKN A;  3MBG A;  4JRZ A;  3V7O A;  1Z5Z A;  3CEX A;  3EHM A;  4KI2 A;  2PP4 A;  3TJ6 A;  3SZR A;  2LFF A;  2EPO A;  2IXN A;  4XWJ A;  2LFD A;  2KJG A;  3ASN C;  4A2N B;  1T9K A;  3EH1 A;  1JPN A;  1N1C A;  2OJE D;  1JOG A;  5IY5 C;  3I4U A;  1HMO A;  4U5F E;  3NMI A;  3MLG A;  2AWY A;  4LDQ A;  3ZDL A;  1KNY A;  2VCC A;  3H2U A;  4EBK A;  5A6B D;  1MQV A;  3V5Z A;  4BG0 A;  1JPJ A;  1BBH A;  1V4A A;  2Q9B A;  4EUK B;  3EGD A;  3L8I A;  5COG A;  3EPV A;  2G3K A;  3HNK A;  4C7O A;  3L34 A;  1YYJ A;  5JP7 A;  1BZ4 A;  3T6G B;  5T3W A;  3AG3 C;  3T6B A;  3ZQV A;  2ZXR A;  3JSE O;  5DLJ A;  3HKK A;  2LP4 A;  3BEH A;  2Y3B A;  2I15 A;  3Q6N A;  4JEA A;  3X1O A;  4ANJ A;  4CDV A;  4PFO A;  2DB4 A;  3NRH A;  3B0V C;  3GEH A;  2CW0 F;  1QSP A;  2X51 A;  3RKO F;  4CS8 C;  1NU9 C;  2IM8 A;  2P61 A;  2VCB A;  3LEO A;  2J45 A;  3EQL F;  4O79 A;  3C8G A;  3SEO A;  2A6E F;  3U3B A;  5COM A;  1VK5 A;  3US6 A;  2HZ8 A;  4YL1 A;  2QLA A;  4DRJ B;  4R32 A;  1U0B B;  5B3I A;  2A1D D;  2HKV A;  1QKR A;  4QI0 A;  1BR1 A;  1M6T A;  2L6H A;  4CSA A;  3ZTM A;  2LQG A;  1R4T A;  4JKV A;  2WVO A;  4XQ1 A;  4CS7 A;  2EIM C;  3S27 A;  5DQZ A;  4JCH A;  1CPQ A;  4ULW A;  1D0Y A;  2EIN C;  1UG7 A;  2O9X A;  2ZXW C;  4U5D E;  4M63 A;  2R05 A;  4MVU A;  1SMY F;  4BEJ A;  2EIL C;  2CGE A;  4O6M A;  1MMA A;  4MVR A;  4MQ9 F;  4C3D A;  3M15 A;  2XSE A;  3HTK C;  3B9Q A;  1ZU4 A;  3ECS A;  1YA7 O;  1YDI A;  3QW0 A;  2P6V A;  2NUT B;  2BC5 A;  3GEI A;  3KKB A;  2HSQ A;  5HV9 A;  3OEO A;  1T6Q A;  1HW2 A;  1APC A;  4LDK A;  4U5H A;  3ASO C;  5L3V A;  1HMD A;  2F22 A;  5AC5 A;  4JTA B;  4WJ0 A;  3C63 A;  3AQB A;  3F47 A;  3A9C A;  3LAY A;  2YQY A;  3L1M A;  4G0H A;  4GEH A;  4Q7C A;  4IJJ A;  4CJO A;  5JRA A;  2BL2 A;  3TJ5 A;  1YLM A;  4J30 B;  4FX5 A;  2WVQ A;  1UFB A;  2IBF A;  4O7G A;  2Q9A A;  2R7S A;  1GS9 A;  2XM0 A;  1HY5 A;  4HFK B;  1IZM A;  4PK4 A;  4YT2 A;  3U8P A;  3VAY A;  3C8G D;  2V3C C;  4EBJ A;  2R7U A;  2D4U A;  3UGP A;  2XXA A;  4Z9J A;  3U5S A;  3GM1 A;  3S28 A;  2L6G A;  1D1C A;  5DQT A;  2LIG A;  2PNO A;  5E2Q A;  2R7X A;  3AOU A;  3DE9 A;  1A41 A;  1LS4 A;  1NG1 A;  1O3U A;  4WAB A;  2IYL D;  4XEV A;  3NKE A;  2NUT A;  1M2V B;  2A69 F;  2AWC A;  1YAR O;  4CS8 A;  5E3C A;  3QZC A;  1FMV A;  3T9O A;  3L8J A;  3O10 A;  2HV7 A;  1OR2 A;  3A11 A;  4MTF A;  4P9F A;  1NSG B;  1PD0 A;  4G7Z F;  1FTS A;  4JIO A;  4XLP F;  3BRJ A;  3ZTZ A;  1V55 C;  4CIP A;  3RIP A;  3RQF A;  2H8A A;  4I1O B;  5KYU B;  3M4B A;  3K66 A;  4MVM A;  4BJ1 A;  2J9U A;  2VC9 A;  2WL8 A;  2ZXP A;  3IQC A;  3PCV A;  1CPR A;  3GEE A;  1KU2 A;  1OR3 A;  1WAT A;  4XEK A;  3IQ5 A;  3QVY A;  4U9D A;  4YT4 A;  3LLK A;  3RW0 A;  4HFF B;  3MYI A;  256B A;  3W8I A;  4IB4 A;  2A68 F;  2LK4 A;  1FNT c;  3KYI A;  3DJN B;  4JJG A;  4AK9 A;  2ZPA A;  1PD1 A;  1Z6A A;  2XL6 A;  4K7B A;  5COF A;  3RYL A;  3EGD B;  3DJU B;  4BPM A;  3ZQY A;  4OIO F;  3CQZ A;  1JRA A;  3K1I C;  4MVQ A;  4MVO A;  3DZA A;  1ZYR F;  4OD5 A;  2DYR C;  1AEP A;  2V26 A;  1G4W R;  5JS5 A;  1A7D A;  2YL7 A;  3SXK A;  3VYW A;  1RKE B;  5B3S C;  5EHH A;  4FES A;  3JRM O;  3RH3 A;  3FMS A;  1D1A A;  1PV3 A;  3HNI A;  3ZWI A;  4EKW A;  4U5B E;  2XS8 A;  5KYU A;  4MS2 A;  3JTL O;  5CI8 A;  3NYM A;  4E18 A;  1TWG A;  3VRC A;  1OW6 A;  2KNH A;  2JPU A;  2G3V A;  3VM6 A;  2KSF A;  3UR3 C;  1E84 A;  2HJM A;  5D92 A;  3DKA A;  4DVY P;  3C8G B;  3N24 A;  1VMA A;  3HNL A;  4MW8 A;  4U5E E;  1XZQ A;  3N0T A;  3TUL A;  1OW8 A;  1SF8 A;  2A6H F;  2YLD A;  3FVY A;  3DM5 A;  3IEE A;  1Q0G A;  2PX3 A;  4HE8 D;  3EZH A;  3PMR A;  2XS1 A;  3CSK A;  1T6I A;  2R25 A;  3NKD A;  1CGO A;  4PFP A;  1RKE A;  3RQE A;  1NLX A;  1RXQ A;  4LLC A;  5EGY A;  1H9T A;  1FFH A;  3IHU A;  4YWQ A;  1K04 A;  4MVZ A;  5L0H A;  2Y3D A;  4G7H F;  2XL8 A;  3AGT A;  4N06 A;  1M2O A;  2XLM A;  4KNW A;  2KQ9 A;  3RVZ A;  4ZLC A;  3I5Q A;  1JMW A;  4J7T A;  5GPG B;  2Y39 A;  1OQC A;  3GWL A;  5JSL A;  3E9V A;  1U89 A;  3NMK A;  3NDB B;  2W4M A;  4L6R A;  1LM3 B;  3M1C B;  3M4C A;  1H6G A;  1RJ9 A;  2HUJ A;  4ONS A;  2KYH A;  2FFH A;  2YLI A;  5KYW B;  5L0G A;  2XL4 A;  4E0H A;  4IAR A;  3B71 A;  3B0P A;  3GAN A;  3NMJ A;  4JTC B;  5B1B C;  4EBB A;  1OCC C;  3LS1 A;  1SYQ A;  2HS5 A;  2NSG A;  3SXY A;  1WN0 A;  3B29 A;  1OCR C;  1YA9 A;  1ZHT A;  3GOR A;  3ABK C;  4P6I C;  2XLH A;  3K1I A;  3QMK A;  2W45 A;  2J46 A;  3U2L A;  4MTO A;  2EPN A;  2YL3 A;  3LJB A;  4NTF A;  4PJL A;  5A69 A;  1GGQ A;  1TFK B;  3EJN A;  4CDY A;  3MYF A;  3U8V A;  5L3Q A;  2XXA B;  2CDQ A;  4DVZ A;  4YT5 A;  1AUE A;  5JUA A;  1GM5 A;  1I5N A;  3AJM A;  2PBE A;  3U9J A;  1Z3I X;  4XPW A;  3T4R A;  2Q7R A;  3WAQ A;  4Q5S F;  2R7Q A;  2GFH A;  1FAP B;  3H2V A;  4FAP B;  1TWC A;  2PF4 E;  1XZP A;  2W4B A;  2XLW A;  3IQT A;  4NCQ A;  2A0B A;  4JE9 A;  4PR9 A;  3TD7 A;  3TOL A;  2WVN A;  4MVS A;  4JW1 A;  4E17 A;  3S0X A;  2M64 A;  3NG1 A;  4W8P A;  4OIR F;  5KYW A;  2H7O A;  3LES A;  1FMW A;  4MND A;  5JVE A;  2J9W A;  1M57 C;  2UUH A;  2B0H A;  2I8B A;  2R9R B;  3RQG A;  4LAC B;  4DRI B;  1BR4 A;  2H7V C;  2L7A A;  2UUI A;  4QI2 A;  3ATP A;  5AGF A;  4KNV A;  4PJM A;  3RVY A;  2R7V A;  1FR0 A;  3JT1 A;  5BUO A;  1Q0M A;  3JCU Q;  4WGY A;  4BJ6 C;  4NY3 A;  2Z15 A;  1R5I D;  2ZXO A;  4LDR A;  3CZ6 A;  4BEM J;  4XPY A;  4MTG A;  5A6K A;  2XM4 A;  2OG2 A;  2E87 A;  1G8X A;  3DAG A;  1NFN A;  4Z9I A;  2R7W A;  4RD9 A;  4JUR I;  3W2W A;  4YK5 A;  1Z63 A;  4DXW A;  1C03 A;  2XLD A;  4GYT A;  4IWB A;  2OEV A;  1KTM A;  3TK0 A;  3O6X A;  4PAC A;  1MMN A;  3PDM P;  2VB6 A;  2HV6 A;  2WZL A;  2J9B A;  3JRT A;  3Q7G A;  2OQM A;  3C18 A;  4OIP F;  2NSF A;  2C04 A;  2GA0 A;  2GDC A;  3FAP B;  2FGY A;  3EH2 A;  3GWN A;  1ZW2 A;  5L0I A;  3ZC4 A;  3HLZ A;  4Q4Z F;  2EIK C;  2QY9 A;  4RBN A;  1LI7 A;  3IQ6 A;  2P1A A;  1EI7 A;  1G4U S;  1XWJ A;  2KW3 C;  4YT8 A;  3S90 A;  3DAF A;  1CGN A;  3UNG C;  3AG2 C;  2DYS C;  2NPU A;  1J8M F;  3G4X A;  1A7E A;  2LCH A;  1T6U A;  2YLG A;  1D0Z A;  3E70 C;  2ZD9 A;  3H65 A;  3KPH A;  3LNR A;  4F4B A;  2OEX A;  2NUP B;  1EA8 A;  4AE4 A;  4C3E A;  2Q3T A;  3CAX A;  4CIH A;  1BR2 A;  2NG1 A;  3OWT A;  2ETS A;  1YJG A;  4N4W A;  1WTY A;  4UDV A;  3LS0 A;  3AQC A;  1OW7 A;  2HJ3 A;  1A0B A;  1RCP A;  3IPM O;  1ORJ A;  1TQG A;  1LIH A;  4JTD B;  1ZHW A;  5KYN A;  3UGO A;  1H7I A;  4IRU A;  3SXM A;  3FOP A;  1AVO B;  4JC7 A;  4K0D A;  2DGJ A;  4JZA A;  1IW7 F;  2PFD A;  4MW3 A;  1OCZ C;  1LPE A;  3LUT B;  2WB7 A;  3KYJ A;  2HSB A;  2YHS A;  5BQG A;  3ZG1 A;  3LEV A;  1YAU O;  2Q4F A;  1I4Z A;  1NFO A;  1S7Z A;  1L7C A;  4KBL A;  4E7S A;  3UMK A;  3FXH A;  3K7D A;  1D1B A;  2EPM X;  3FHD A;  3ABL C;  4H54 A;  5E33 A;  5T1D B;  2TMV P;  3FDQ A;  1W2W A;  2Q9C A;  1HW1 A;  2A0U A;  4O6N A;  2MWQ A;  4I1M A;  3U9M A;  1DOV A;  3KL4 A;  1T5O A;  3R7C A;  2RD9 A;  2NUP A;  1ZVZ A;  4JCZ A;  5F5H A;  4BJ6 A;  3RFY A;  1LKX A;  5FZT A;  3B0U X;  1QZX A;  2R7R A;  2YKZ A;  2HFI A;  1RJ9 B;  5T3T A;  1ORY A;  2LSE A;  2B0J A;  2AU5 A;  2BE5 F;  3OA1 A;  3SP1 A;  3ZVR A;  1LVK A;  4AL0 A;  4NTB A;  3V5Y A;  1K40 A;  1QLE C;  5JT4 A;  1OKK A;  1K05 A;  1VYI A;  3AGU A;  4CJG A;  3TQO A;  1JAF A;  3KMI A;  5KYY B;  2PX0 A;  3EFO A;  1V74 B;  2GAQ A;  2M4E A;  2GWW A;  2MYS A;  2WZG A;  1O87 A;  3EG9 B;  5TJ5 E;  3W4Y A;  5BQH A;  1Q0K A;  4AL1 A;  2LD6 A;  2HMQ A;  3ZSU A;  2R7O A;  3WOD F;  5K0I A;  3K1H A;  2QNL A;  2P0N A;  2J7P A;  5E3A A;  2R03 A;  3W8H A;  1A7V A;  4YL0 A;  1TWA A;  1ZHX A;  5L0J A;  1MMD A;  2Q00 A;  3U3F A;  2XLV A;  2JD3 A;  3DM9 B;  5A6J A;  2XLE A;  2HMZ A;  2KK1 A;  1E86 A;  4H4K C;  4W8K A;  3JYH A;  1Y6D A;  1H9G A;  4YL3 A;  4LER A;  2H7B A;  1MMG A;  2Y3G A;  4DJ9 A;  3N2Z B;  4FWV A;  1HE1 A;  1WWP A;  1J8Y F;  4NQF A;  1M56 C;  1F1M A;  1PCX A;  2VCA A;  4IAQ A;  4N6H A;  4EWC A;  4WGZ A;  4EIY A;  2J9V A;  4LLE A;  3EGX A;  4A4A A;  4U5G A;  3VF0 A;  2J0W A;  2W9Y A;  3DD7 A;  5KYY A;  2FAP B;  3JYY A;  1TWH A;  2CNW A;  4CDA A;  1ZZP A;  4AX2 A;  3EG9 A;  4CX9 A;  2VH3 A;  4GQH A;  3Q6M A;  3GM2 A;  3U0C A;  1Z23 A;  1JR8 A;  1QQ3 A;  2XRH A;  3X2Q C;  5JLI A;  2VAS A;  3GOD A;  1E2X A;  3QTH A;  1RMV A;  2YRF A;  5D91 A;  3V5X A;  1TFO B;  5EK0 A;  5F5F A;  2YWA A;  1ZW3 A;  2R02 A;  2R7T A;  4J32 B;  2YEV A;  1OKK D;  2CCY A;  4JVS A;  2X0C A;  4U9E A;  4XPX A;  4ZLD A;  2OOC A;  4E7Z A;  1SR2 A;  4G7O F;  2QUP A;  3SXZ A;  4CS9 C;  4X0R A;  1Q0D A;  2OJQ A;  3GM3 A;  4O6Y A;  2Y3H A;  3F46 A;  3MX3 A;  4CBE A;  5FCL A;  1OCO C;  3G50 A;  3NYJ A;  4D4X A;  2L81 A;  1I4Y A;  5CIV A;  1V54 C;  3AG4 C;  1NZE A;  4Z9H A;  2J7P D;  4P9T A;  4YJW A;  1C02 A;  4XLN F;  5BQI A;  1DOW A;  1QVX A;  4QDL A;  3NYL A;  5DVW A;  1ZHZ A;  3UMI A;  3DXJ F;  1LE4 A;  1ST6 A;  1YZA A;  4BJ5 C;  1LI5 A;  2G62 A;  3KH2 A;  3UMH A;  3ZIB A;  4AE4 B;  3G4Z A;  3POV A;  2QTV A;  1ZHY A;  4JJF A;  5L0F A;  2J0X A;  3EZI A;  1B68 A;  3M79 A;  1OXK A;  3L0I A;  3QW1 A;  4IAO A;  5DS4 A;  3K6B A;  5DS6 A;  2ASR A;  1VTM P;  3J06 A;  3JSZ A;  3U2M A;  2OKU A;  2XLO A;  3DE8 A;  2AVK A;  4NTA A;  3O39 A;  4NC3 A;  1OXB A;  2CNW D;  5HSW A;  3LNM B;  4JEB A;  4KC9 A;  1D0X A;  1LE2 A;  4K1O A;  3TOM A;  1VYK A;  3I5P A;  3FAJ A;  4RDA A;  2L6F A;  1EKY A;  3O55 A;  5F28 E;  2ICW G;  2D5R B;  1VLT A;  1Q0F A;  1Z7Q c;  4U5C E;  3S29 A;  1CGM E;  3C7J A;  2C03 A;  1TR2 A;  1S05 A;  1U6H A;  2YVK A;  4PJN A;  2MHR A;  4DBR A;  1MNE A;  2RSE B;  1NBB A;  2EPL X;  2YL0 A;  3C62 A;  4ULV A;  3RF3 A;  3WHN A;  4BJT A;  2KC3 A;  1YZC A;  3W2V A;  1LS1 A;  5CI9 A;  3WG7 C;  3SNH A;  5DS5 A;  3LLI A;  2AP3 A;  3DI5 A;  4I44 A;  4YN0 B;  4G78 A;  3T6J A;  2DI3 A;  1GQA A;  4ER9 A;  4D4N A; 
#chains in the Genus database with same CATH homology
 2AVK A;  4XQ1 A;  3AGU A;  1I4Y A;  1A7D A;  1I4Z A;  2HMQ A;  3AGT A;  2MHR A;  1A7E A;  4XPY A;  3WHN A;  4XPW A;  3WAQ A;  1HMO A;  2HMZ A;  2AWY A;  2AWC A;  1HMD A;  4XPX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...