3AGUA

Hemerythrin-like domain of dcrh (semimet-r)
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
133
structure length
133
Chain Sequence
DVLVKWSEDLANLPSIDTQHKRLVDYINDLYRAARRRDMDKAREVFDALKNYAVEHFGYEERLFADYAYPEATRHKEIHRRFVETVLKWEKQLAAGDPEVVMTTLRGLVDWLVNHIMKEDKKYEAYLRERGVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Hemerythrin-like domain protein DcrH
publication title Characteristics of Diiron Site with Large Cavity in Hemerythrin-like Domain of DcrH
rcsb
source organism Desulfovibrio vulgaris
total genus 58
structure length 133
sequence length 133
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01814 Hemerythrin Hemerythrin HHE cation binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.50 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Hemerythrin-like 3aguA00
3AGTA 2HMQA 3AGUA 1HMDA 1I4ZA 3WAQA 2AWYA 1HMOA 2MHRA 4XPXA 1A7DA 2AVKA 1I4YA 3WHNA 4XQ1A 1A7EA 2HMZA 4XPYA 4XPWA 2AWCA
chains in the Genus database with same CATH superfamily
1C02A 3S9OA 2HSBA 1NSGB 2QNLA 3AGTA 4J30B 4MVRA 1YJGA 2WZFA 5AC4A 3AGUA 1RKEA 3ECSA 1V55C 2QLAA 4P9TA 1TWCA 3FAJA 2KNHA 3RF3A 2Y3DA 2IM8A 4AL0A 3HKKA 3IEEA 2NSGA 2VCAA 3B0PA 1ZHYA 5F28E 3RYLA 1PD1A 4EWCA 4ONSA 3US6A 4C7OA 5DQZA 1QSPA 2FAPB 3AG2C 5JP7A 3T4RA 1K04A 3H2VA 5L0DA 5A6BA 1T6UA 1E2XA 2G3KA 2WVOA 3PDMP 4PJLA 1D1BA 2H8AA 3C7JA 2ICWG 4CX9A 1PD0A 3GEIA 3EG9B 1TKNA 4IGGA 4H54A 3K33A 3QZCA 1CPQA 2PF4E 2VASA 4CJOA 4NTFA 4AE4A 1OKKA 1YYXA 2O9XA 4MVMA 2CDQA 1M6TA 1TFKB 1ZHZA 4KNWA 1T9KA 3X1OA 4DXWA 1T6IA 3E9VA 4LDRA 2HSQA 1BR2A 2Q4FA 4JE9A 3C8GA 5B1BC 4I3MA 1MMDA 3U2LA 2C03A 2HMQA 1VYIA 5T3TA 3B9QA 1ORSC 3DXJF 3BRJA 4QI0A 4N6CA 4YN0B 2ZD9A 3EGDA 2XL6A 3HNIA 3KH2A 2R03A 3DMDA 4IRUA 1ZYRF 3W8HA 2JPUA 3NMIA 4PACA 4J32B 2AU5A 5D91A 1CGNA 3T9OA 2MWQA 2CW0F 1H7IA 1Z23A 3M1CB 4JRZA 1SR2A 1LS1A 256BA 4IWBA 1Y6DA 2PBEA 2R7XA 4IB4A 4K0DA 1YAUO 2V26A 5CIVA 2HV7A 2I8BA 4ZLCA 1U6HA 4J7TA 4C3DA 1RCPA 2B0JA 1LE2A 1J8YF 1YLMA 4KBLA 1D0YA 4MNDA 3JT1A 4O6NA 2OU6A 3ABLC 3PHF2 1H6GA 2QTVA 4D4NA 1QPUA 1K05A 5JVEA 1W2WA 1ZW3A 3HTKC 4ZLDA 2EILC 5BUOA 2DB4A 2CNWD 2DGJA 4WGZA 5JT4A 4MW3A 2BC5A 1OW8A 1KNYA 3C8ZA 1ORJA 3EGXA 3I4UA 3VAYA 3WODF 2MHRA 4CS8A 2ZXWC 1MMGA 1NU7D 3K1IA 4EHPA 5AC5A 2EPMX 3QW0A 2V3CC 4AL1A 1BR1A 3NRHA 2FGYA 2AVKA 3GEHA 4MTFA 1H9GA 4LERA 3R7CA 4C7OB 3NMJA 2H7VC 4DRIB 3MX3A 3EH1A 4FWVA 2QE9A 4NCQA 4NY3A 4RD9A 4HFFB 4JW1A 1FNTc 4N4WA 3LNRA 5DS5A 3DE9A 1YZCA 2NSFA 3EZIA 3U2MA 2YLIA 4JJFA 2L6HA 2H7OA 3TULA 2E87A 4PR9A 2EIKC 4AE4B 4U5FE 2P7VA 3S90A 5AGFA 5DS6A 3EJNA 1L7CA 3W2VA 4G7HF 3DAGA 3NKEA 2EPNA 2L6FA 1TWAA 1RKCA 3C8GB 2UUIA 4WJ0A 5L0GA 3CZ6A 4I1MA 1IW7F 1V54C 4CDAA 3Q7GA 4XPXA 3B29A 3PCVA 3UMKA 2DI3A 4U5DE 5A69A 3EGDB 3ATPA 4CIHA 3EHMA 3FDQA 2PP4A 3M4CA 1E84A 4K1OA 3Q6NA 2W9YA 5EK0A 1O5HA 2XLOA 3VM6A 3CSKA 1SYQA 1SF8A 4IAOA 1Y4CA 4JIOA 1L3PA 1NZEA 1XWJA 2YZSA 2ZPAA 3NYMA 4LACB 4YL1A 2YL3A 3AG1C 1GGQA 3N0TA 3S84A 1LS4A 1VLSA 2YL1A 5KYXB 3EPVA 4AX2A 3B0UX 1D0ZA 3EHNA 2R7RA 3G4ZA 3RQGA 3MBGA 1MMNA 1C17M 2R7QA 3LEVA 2YRFA 4YT4A 2WVQA 1BDJB 5KYYA 1BBHA 1HW2A 1FFTC 1G4WR 2P1AA 4OINF 2CYDA 2XM4A 3V5ZA 3NG1A 2EPKX 3EH2A 4CBEA 2D5RB 1NFNA 2TMVP 1GS9A 1QQ3A 1Z3IX 3NKDA 4H4KC 3PMRA 4XEFA 4PJMA 3B0VC 2LP4A 4NTBA 3KMIA 3LUTB 3EGXB 2C04A 5FZTA 1OCCC 3G4XA 5L3QA 4Z9HA 2W4BA 3HNJA 4KNVA 2J45A 2JX0A 1R4TA 3ABMC 4BEMJ 5T1DB 2LCHA 1XZPA 2XXAA 3RW0A 1Z6AA 1Q0DA 3W4YA 1Z5ZA 2OEVA 2BE5F 4IJJA 4W8PA 2KSFA 3VF0A 1I4ZA 5CI9A 4F4BA 4L6RA 3LESA 2OJQA 3MFNA 4OIRF 1ORYA 2R7VA 1GQAA 2J9UA 3I5QA 1YARO 2LSEA 2A6EF 4WABA 3JZ0A 1WTYA 2F22A 1M56C 2LD6A 2YKZA 3DAFA 3A9CA 5B1AC 1LIHA 1NG1A 2CNWA 4XLPF 1I4YA 1VK5A 3U9JA 5JSLA 4IARA 5HSWA 1EKYA 2DYSC 2LK4A 3SYNA 3IPMO 1C03A 5EGYA 2YVKA 4XPYA 5HV9A 3KYJA 1KTMA 3O6XA 2HKVA 1IZMA 1OR2A 2WB7A 3AG4C 3ASOC 3JCUQ 3O10A 1OCRC 1O87A 1Q0MA 4JTDB 4B6IA 1VTMP 2A68F 4GEHA 4NTAA 1UFBA 2EIMC 2XXAB 3OWTA 3GWLA 3V7OA 1KU2A 4PFPA 4BJ5A 1EI7A 1WN0A 4GQHA 1FMWA 3K1IC 5E33A 4BJ1A 4CS8C 3HNKA 4HEAJ 4GYTA 3VYWA 2Y3HA 4EBJA 3NDBB 5E3AA 1V74B 2P61A 3LLIA 5KYYB 1WOLA 1APCA 1G4US 1ZZPA 3U9MA 2GA0A 3SXMA 4XQ1A 2KW3C 2J9WA 2A6HF 3G50A 2WL8A 4JURI 3GM2A 2XLVA 4BPMA 4XPWA 4YJWA 5T3WA 1R5ID 1F1MA 4EBKA 2KYHA 4PFOA 2NUTB 4Q5SF 2LQGA 4JTCB 1Q0FA 3W2WA 3LAYA 4PJJA 3L0IA 3MYFA 1WGWA 3KKBA 1XZQA 4MVOA 2MYSA 1JPNA 3CEXA 3UNGC 2BL2A 2XL4A 1I5NA 2OJED 5KYWA 4CSAC 2WVNA 2XLDA 3T6BA 4CS9A 2YHSA 3QW1A 2PNOA 3IQCA 2W45A 1U0BB 1MNDA 3CAXA 3JSZA 3ZSUA 4BJ6A 4JEBA 3DD7A 3M79A 1NU9C 4JVSA 4YL3A 1T6QA 3T6GB 3RVYA 4MVUA 1D1CA 3CQZA 3AQCA 2LFFA 4LDQA 2RSEB 3S28A 4ANJA 2B0HA 3SP1A 3TQOA 4C3EA 3UGOA 1FR0A 3S0XA 1JOGA 1MQVA 1AEPA 1TR2A 3DM9B 4Z9JA 4YT5A 1OXBA 3ZWIA 1NFOA 1HMDA 2Z15A 5A6JA 1S7ZA 3RFYA 5BQHA 3LS1A 3WAQA 2YL7A 2WZLA 1B68A 1LPEA 1M2OA 3SEOA 2IXNA 5B3SC 5JLIA 2R7TA 5L0CA 4KC9A 2IXMA 4N6HA 3O39A 4P6IC 1WWPA 2KJGA 1FTSA 2XLWA 1VLTA 3Q6MA 1S05A 5B3IA 2EPLX 1AVOB 1PCXA 2KC3A 3B71A 3GM1A 3QTHA 4PJNA 4DOZA 4FAPB 5JUAA 5L0HA 2OCCC 1JRAA 1SZIA 2A1DD 2ETSA 4XTKA 1CGOA 4E18A 1O3UA 2CGEA 4FX5A 4CIPA 3KL4A 4U9EA 2HJMA 1J8MF 1V4AA 1YZAA 3AQBA 3OA1A 2IBFA 2YLDA 2XL8A 4N06A 1DOWA 1QZXA 2CCYA 2Y3GA 2Y69C 2IYLD 4CJGA 3A11A 1VB5A 2KGOA 2Q00A 3R2PA 2LIGA 5CI8A 1E85A 4HE8D 1HE1A 2A69F 3NMKA 2YQYA 4MW8A 3ZG1A 3GWNA 4LDKA 5KYWB 1A0BA 3GEEA 2OKUA 3OEOA 2HV6A 4DVYP 5L0FA 3N2ZB 4ER9A 2I15A 2X0CA 3HLZA 2NUTA 3TJ6A 2A0UA 4ULWA 4X0RA 2J7PD 2A0BA 1ZVZA 1DOVA 5E3CA 4QDLA 3C62A 4XEVA 1ZHTA 2Q3TA 2YLGA 3TJ5A 2AP3A 4NQFA 2XLHA 2Y3BA 4MVZA 4R32A 1ST6A 1YA7O 2GWWA 3FVYA 4JKVA 1Q0KA 4U9DA 3L34A 4BJ5C 5IY5C 5JRAA 4E7ZA 1A41A 3EZHA 3U8PA 2NUPA 3U3FA 4DBRA 4WGYA 3AJMA 2HS5A 4BEJA 4MS2A 4C3BA 3IQ5A 4MTGA 5DQTA 2P0NA 1MNEA 3LS0A 2Q7RA 3I5PA 3MYIA 2IXPA 3GANA 1YVIA 5DVWA 3N24A 2Q9AA 1LM3B 2HUJA 4DRHB 5BQIA 2ZXRA 1CPRA 3SXYA 2QUPA 3ZQVA 3POVA 3FHDA 1M57C 4XLNF 3S29A 3T6JA 1Z63A 2PX0A 2YL0A 3LLKA 1OW7A 2EINC 2XLMA 3ASNC 3QVYA 4I44A 3WG7C 4BJTA 5EHHA 1OXKA 1QVXA 4JC7A 4CS7A 4MVSA 4J7YA 4DBQA 4OIQF 1LKXA 3RH3A 5DS4A 3LEOA 3C18A 5F5FA 3TD7A 1BZ4A 1LVKA 3AG3C 4JEAA 4U5GA 2J0XA 4U5BE 2P6VA 2UUHA 3JYYA 4CS9C 5L3VA 3U8VA 3JTLO 3NYLA 1OQCA 5A6AA 4G7OF 1N1CA 2Q9BA 2R7WA 1SMYF 3O55A 1QKRA 4YWQA 3ZTZA 2M64A 4BJ6C 1NLXA 2OG2A 3DJUB 2VH3A 2ASRA 1E86A 2Y39A 3SNHA 3WHNA 3ZTMA 1VOMA 3JRTA 1OCZC 1JMWA 2XM0A 3DI5A 3ZQYA 3SZRA 3ZVRA 1T01A 2GFHA 2XSEA 4JTAB 2OQMA 4PK4A 4DJ9A 3FOOA 4E17A 2ZXOA 3TK0A 3DM5A 3HJCA 3U5SA 2VB6A 4EBBA 1LI7A 2J9VA 3DKAA 3DE8A 3GORA 5GPGB 4Q4ZF 2EPOA 3K6BA 3S27A 1M2VB 1FMVA 1ZW2A 3EFOA 5KYUA 3RKOF 1T5OA 2R7UA 5COFA 4QI2A 1YA9A 2PX3A 4AK9A 1RXQA 3QMKA 3ZIBA 1FFHA 1JPJA 1ZU5A 3EQLF 3DWWA 1WATA 3HNLA 1AUEA 2NUPB 3IHUA 2DYRC 4G78A 4Q7CA 1RJ9A 3RVZA 4E0IA 4EKWA 2HJ3A 4LLEA 1YDIA 2L9JA 4RBNA 1EQ1A 1NBBA 3TOMA 4E0HA 5E2QA 2IOQA 3JYHA 2X51A 3L8IA 1LI5A 3KYIA 1UG7A 2XRHA 3F47A 5D92A 1A7EA 3W8IA 2WZGA 4Z9IA 4YT2A 4IAQA 1K40A 2YEVA 1G5ZA 3GM3A 3JRMO 4E7SA 1JAFA 2NPUA 1H9TA 4DRJB 3GODA 4P9FA 4UDVA 1EA8A 3C63A 3K1HA 1OR3A 2J7PA 5BQGA 4U5HA 2IXOA 1TWGA 5JS5A 5A6BD 2J46A 3X2QC 3F46A 4W8KA 1D0XA 4JCHA 3SXZA 3IQTA 4YT8A 1RKEB 3VRCA 3RQEA 2VC9A 4OD4A 1HY5A 1OKKD 3M4BA 3U0CA 4OIOF 1YYJA 2G3VA 3L8JA 3MLGA 1A7DA 2RD9A 2VCBA 2YWAA 4CDYA 4FESA 1Z7Qc 4BG0A 4MVQA 1ZHWA 3C8GD 4YK5A 1D1AA 3K66A 2R05A 2ZXPA 2J9BA 5KYXA 4MQ9F 2L6GA 3UMHA 3NYJA 4I1OB 1VMAA 1G8XA 4OIPF 1HW1A 1A7VA 1WASA 1MMAA 1TWHA 4XWJA 1BR4A 3UMIA 4K7BA 4O79A 2XLEA 3M15A 2G62A 3UR3C 4DVZA 1RMVA 5DLJA 3E70C 3V5YA 2FFHA 4G7ZF 3IQ6A 3FMSA 4A4AA 3LNMB 1QLEC 3FAPB 3H2UA 3KPHA 3ZC4A 3UGPA 2PFDA 4CSAA 4NC3A 1JR8A 1HMOA 3EG9A 3JSEO 1LE4A 3H65A 2L7AA 3DZAA 2EIJC 4MTOA 5K0IA 3U3BA 2HFIA 1TQGA 3Q7LA 2J8WA 3EFOB 4RDAA 1HE9A 5KYUB 3SXKA 2KQ9A 5F5HA 2R7OA 2NG1A 4EIYA 2OOCA 5TJ5E 1Q0GA 2KK1A 2J0WA 3ABKC 1U89A 2XS1A 1OCOC 2HMZA 4LLCA 1CGME 3FOPA 3ITFA 1RJ9B 2D4UA 4KI2A 1M2VA 2W4MA 2AWCA 4JJGA 2R25A 3AOUA 2OEXA 3QVZA 3V5XA 2R9RB 4CDVA 2M4EA 2Q9CA 5FCLA 1VYKA 3K7DA 3BEHA 3RIPA 3ZDLA 5L0JA 4JCZA 5A6KA 4U5EE 3J06A 4O6YA 2GDCA 5COGA 3L1MA 3RQFA 3TOLA 4U5CE 4EUKB 1FAPB 2AWYA 2R7SA 4OD5A 2HZ8A 5KYNA 2L81A 4JZAA 4HFKB 1ZHXA 4D4XA 1GM5A 2VCCA 1OW6A 2GAQA 4M63A 1ZU4A 4G0HA 2XS8A 2QY9A 4ULVA 2R02A 4XEKA 3DJNB 4YL0A 3FXHA 1E83A 2LFDA 4O6MA 5L0IA 2H7BA 4O7GA 1PV3A 3LJBA 2JD3A 4A2NB 5COMA 1TFOB
chains in the Genus database with same CATH topology
3AGTA 2HMQA 3AGUA 1HMDA 1I4ZA 3WAQA 2AWYA 1HMOA 2MHRA 4XPXA 1A7DA 2AVKA 1I4YA 3WHNA 4XQ1A 1A7EA 2HMZA 4XPYA 4XPWA 2AWCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AGT A;  2HMQ A;  3AGU A;  1HMD A;  1I4Z A;  3WAQ A;  2AWY A;  1HMO A;  2MHR A;  4XPX A;  1A7D A;  2AVK A;  1I4Y A;  3WHN A;  4XQ1 A;  1A7E A;  2HMZ A;  4XPY A;  4XPW A;  2AWC A; 
#chains in the Genus database with same CATH topology
 1C02 A;  3S9O A;  2HSB A;  1NSG B;  2QNL A;  3AGT A;  4J30 B;  4MVR A;  1YJG A;  2WZF A;  5AC4 A;  3AGU A;  1RKE A;  3ECS A;  1V55 C;  2QLA A;  4P9T A;  1TWC A;  3FAJ A;  2KNH A;  3RF3 A;  2Y3D A;  2IM8 A;  4AL0 A;  3HKK A;  3IEE A;  2NSG A;  2VCA A;  3B0P A;  1ZHY A;  5F28 E;  3RYL A;  1PD1 A;  4EWC A;  4ONS A;  3US6 A;  4C7O A;  5DQZ A;  1QSP A;  2FAP B;  3AG2 C;  5JP7 A;  3T4R A;  1K04 A;  3H2V A;  5L0D A;  5A6B A;  1T6U A;  1E2X A;  2G3K A;  2WVO A;  3PDM P;  4PJL A;  1D1B A;  2H8A A;  3C7J A;  2ICW G;  4CX9 A;  1PD0 A;  3GEI A;  3EG9 B;  1TKN A;  4IGG A;  4H54 A;  3K33 A;  3QZC A;  1CPQ A;  2PF4 E;  2VAS A;  4CJO A;  4NTF A;  4AE4 A;  1OKK A;  1YYX A;  2O9X A;  4MVM A;  2CDQ A;  1M6T A;  1TFK B;  1ZHZ A;  4KNW A;  1T9K A;  3X1O A;  4DXW A;  1T6I A;  3E9V A;  4LDR A;  2HSQ A;  1BR2 A;  2Q4F A;  4JE9 A;  3C8G A;  5B1B C;  4I3M A;  1MMD A;  3U2L A;  2C03 A;  2HMQ A;  1VYI A;  5T3T A;  3B9Q A;  1ORS C;  3DXJ F;  3BRJ A;  4QI0 A;  4N6C A;  4YN0 B;  2ZD9 A;  3EGD A;  2XL6 A;  3HNI A;  3KH2 A;  2R03 A;  3DMD A;  4IRU A;  1ZYR F;  3W8H A;  2JPU A;  3NMI A;  4PAC A;  4J32 B;  2AU5 A;  5D91 A;  1CGN A;  3T9O A;  2MWQ A;  2CW0 F;  1H7I A;  1Z23 A;  3M1C B;  4JRZ A;  1SR2 A;  1LS1 A;  256B A;  4IWB A;  1Y6D A;  2PBE A;  2R7X A;  4IB4 A;  4K0D A;  1YAU O;  2V26 A;  5CIV A;  2HV7 A;  2I8B A;  4ZLC A;  1U6H A;  4J7T A;  4C3D A;  1RCP A;  2B0J A;  1LE2 A;  1J8Y F;  1YLM A;  4KBL A;  1D0Y A;  4MND A;  3JT1 A;  4O6N A;  2OU6 A;  3ABL C;  3PHF 2;  1H6G A;  2QTV A;  4D4N A;  1QPU A;  1K05 A;  5JVE A;  1W2W A;  1ZW3 A;  3HTK C;  4ZLD A;  2EIL C;  5BUO A;  2DB4 A;  2CNW D;  2DGJ A;  4WGZ A;  5JT4 A;  4MW3 A;  2BC5 A;  1OW8 A;  1KNY A;  3C8Z A;  1ORJ A;  3EGX A;  3I4U A;  3VAY A;  3WOD F;  2MHR A;  4CS8 A;  2ZXW C;  1MMG A;  1NU7 D;  3K1I A;  4EHP A;  5AC5 A;  2EPM X;  3QW0 A;  2V3C C;  4AL1 A;  1BR1 A;  3NRH A;  2FGY A;  2AVK A;  3GEH A;  4MTF A;  1H9G A;  4LER A;  3R7C A;  4C7O B;  3NMJ A;  2H7V C;  4DRI B;  3MX3 A;  3EH1 A;  4FWV A;  2QE9 A;  4NCQ A;  4NY3 A;  4RD9 A;  4HFF B;  4JW1 A;  1FNT c;  4N4W A;  3LNR A;  5DS5 A;  3DE9 A;  1YZC A;  2NSF A;  3EZI A;  3U2M A;  2YLI A;  4JJF A;  2L6H A;  2H7O A;  3TUL A;  2E87 A;  4PR9 A;  2EIK C;  4AE4 B;  4U5F E;  2P7V A;  3S90 A;  5AGF A;  5DS6 A;  3EJN A;  1L7C A;  3W2V A;  4G7H F;  3DAG A;  3NKE A;  2EPN A;  2L6F A;  1TWA A;  1RKC A;  3C8G B;  2UUI A;  4WJ0 A;  5L0G A;  3CZ6 A;  4I1M A;  1IW7 F;  1V54 C;  4CDA A;  3Q7G A;  4XPX A;  3B29 A;  3PCV A;  3UMK A;  2DI3 A;  4U5D E;  5A69 A;  3EGD B;  3ATP A;  4CIH A;  3EHM A;  3FDQ A;  2PP4 A;  3M4C A;  1E84 A;  4K1O A;  3Q6N A;  2W9Y A;  5EK0 A;  1O5H A;  2XLO A;  3VM6 A;  3CSK A;  1SYQ A;  1SF8 A;  4IAO A;  1Y4C A;  4JIO A;  1L3P A;  1NZE A;  1XWJ A;  2YZS A;  2ZPA A;  3NYM A;  4LAC B;  4YL1 A;  2YL3 A;  3AG1 C;  1GGQ A;  3N0T A;  3S84 A;  1LS4 A;  1VLS A;  2YL1 A;  5KYX B;  3EPV A;  4AX2 A;  3B0U X;  1D0Z A;  3EHN A;  2R7R A;  3G4Z A;  3RQG A;  3MBG A;  1MMN A;  1C17 M;  2R7Q A;  3LEV A;  2YRF A;  4YT4 A;  2WVQ A;  1BDJ B;  5KYY A;  1BBH A;  1HW2 A;  1FFT C;  1G4W R;  2P1A A;  4OIN F;  2CYD A;  2XM4 A;  3V5Z A;  3NG1 A;  2EPK X;  3EH2 A;  4CBE A;  2D5R B;  1NFN A;  2TMV P;  1GS9 A;  1QQ3 A;  1Z3I X;  3NKD A;  4H4K C;  3PMR A;  4XEF A;  4PJM A;  3B0V C;  2LP4 A;  4NTB A;  3KMI A;  3LUT B;  3EGX B;  2C04 A;  5FZT A;  1OCC C;  3G4X A;  5L3Q A;  4Z9H A;  2W4B A;  3HNJ A;  4KNV A;  2J45 A;  2JX0 A;  1R4T A;  3ABM C;  4BEM J;  5T1D B;  2LCH A;  1XZP A;  2XXA A;  3RW0 A;  1Z6A A;  1Q0D A;  3W4Y A;  1Z5Z A;  2OEV A;  2BE5 F;  4IJJ A;  4W8P A;  2KSF A;  3VF0 A;  1I4Z A;  5CI9 A;  4F4B A;  4L6R A;  3LES A;  2OJQ A;  3MFN A;  4OIR F;  1ORY A;  2R7V A;  1GQA A;  2J9U A;  3I5Q A;  1YAR O;  2LSE A;  2A6E F;  4WAB A;  3JZ0 A;  1WTY A;  2F22 A;  1M56 C;  2LD6 A;  2YKZ A;  3DAF A;  3A9C A;  5B1A C;  1LIH A;  1NG1 A;  2CNW A;  4XLP F;  1I4Y A;  1VK5 A;  3U9J A;  5JSL A;  4IAR A;  5HSW A;  1EKY A;  2DYS C;  2LK4 A;  3SYN A;  3IPM O;  1C03 A;  5EGY A;  2YVK A;  4XPY A;  5HV9 A;  3KYJ A;  1KTM A;  3O6X A;  2HKV A;  1IZM A;  1OR2 A;  2WB7 A;  3AG4 C;  3ASO C;  3JCU Q;  3O10 A;  1OCR C;  1O87 A;  1Q0M A;  4JTD B;  4B6I A;  1VTM P;  2A68 F;  4GEH A;  4NTA A;  1UFB A;  2EIM C;  2XXA B;  3OWT A;  3GWL A;  3V7O A;  1KU2 A;  4PFP A;  4BJ5 A;  1EI7 A;  1WN0 A;  4GQH A;  1FMW A;  3K1I C;  5E33 A;  4BJ1 A;  4CS8 C;  3HNK A;  4HEA J;  4GYT A;  3VYW A;  2Y3H A;  4EBJ A;  3NDB B;  5E3A A;  1V74 B;  2P61 A;  3LLI A;  5KYY B;  1WOL A;  1APC A;  1G4U S;  1ZZP A;  3U9M A;  2GA0 A;  3SXM A;  4XQ1 A;  2KW3 C;  2J9W A;  2A6H F;  3G50 A;  2WL8 A;  4JUR I;  3GM2 A;  2XLV A;  4BPM A;  4XPW A;  4YJW A;  5T3W A;  1R5I D;  1F1M A;  4EBK A;  2KYH A;  4PFO A;  2NUT B;  4Q5S F;  2LQG A;  4JTC B;  1Q0F A;  3W2W A;  3LAY A;  4PJJ A;  3L0I A;  3MYF A;  1WGW A;  3KKB A;  1XZQ A;  4MVO A;  2MYS A;  1JPN A;  3CEX A;  3UNG C;  2BL2 A;  2XL4 A;  1I5N A;  2OJE D;  5KYW A;  4CSA C;  2WVN A;  2XLD A;  3T6B A;  4CS9 A;  2YHS A;  3QW1 A;  2PNO A;  3IQC A;  2W45 A;  1U0B B;  1MND A;  3CAX A;  3JSZ A;  3ZSU A;  4BJ6 A;  4JEB A;  3DD7 A;  3M79 A;  1NU9 C;  4JVS A;  4YL3 A;  1T6Q A;  3T6G B;  3RVY A;  4MVU A;  1D1C A;  3CQZ A;  3AQC A;  2LFF A;  4LDQ A;  2RSE B;  3S28 A;  4ANJ A;  2B0H A;  3SP1 A;  3TQO A;  4C3E A;  3UGO A;  1FR0 A;  3S0X A;  1JOG A;  1MQV A;  1AEP A;  1TR2 A;  3DM9 B;  4Z9J A;  4YT5 A;  1OXB A;  3ZWI A;  1NFO A;  1HMD A;  2Z15 A;  5A6J A;  1S7Z A;  3RFY A;  5BQH A;  3LS1 A;  3WAQ A;  2YL7 A;  2WZL A;  1B68 A;  1LPE A;  1M2O A;  3SEO A;  2IXN A;  5B3S C;  5JLI A;  2R7T A;  5L0C A;  4KC9 A;  2IXM A;  4N6H A;  3O39 A;  4P6I C;  1WWP A;  2KJG A;  1FTS A;  2XLW A;  1VLT A;  3Q6M A;  1S05 A;  5B3I A;  2EPL X;  1AVO B;  1PCX A;  2KC3 A;  3B71 A;  3GM1 A;  3QTH A;  4PJN A;  4DOZ A;  4FAP B;  5JUA A;  5L0H A;  2OCC C;  1JRA A;  1SZI A;  2A1D D;  2ETS A;  4XTK A;  1CGO A;  4E18 A;  1O3U A;  2CGE A;  4FX5 A;  4CIP A;  3KL4 A;  4U9E A;  2HJM A;  1J8M F;  1V4A A;  1YZA A;  3AQB A;  3OA1 A;  2IBF A;  2YLD A;  2XL8 A;  4N06 A;  1DOW A;  1QZX A;  2CCY A;  2Y3G A;  2Y69 C;  2IYL D;  4CJG A;  3A11 A;  1VB5 A;  2KGO A;  2Q00 A;  3R2P A;  2LIG A;  5CI8 A;  1E85 A;  4HE8 D;  1HE1 A;  2A69 F;  3NMK A;  2YQY A;  4MW8 A;  3ZG1 A;  3GWN A;  4LDK A;  5KYW B;  1A0B A;  3GEE A;  2OKU A;  3OEO A;  2HV6 A;  4DVY P;  5L0F A;  3N2Z B;  4ER9 A;  2I15 A;  2X0C A;  3HLZ A;  2NUT A;  3TJ6 A;  2A0U A;  4ULW A;  4X0R A;  2J7P D;  2A0B A;  1ZVZ A;  1DOV A;  5E3C A;  4QDL A;  3C62 A;  4XEV A;  1ZHT A;  2Q3T A;  2YLG A;  3TJ5 A;  2AP3 A;  4NQF A;  2XLH A;  2Y3B A;  4MVZ A;  4R32 A;  1ST6 A;  1YA7 O;  2GWW A;  3FVY A;  4JKV A;  1Q0K A;  4U9D A;  3L34 A;  4BJ5 C;  5IY5 C;  5JRA A;  4E7Z A;  1A41 A;  3EZH A;  3U8P A;  2NUP A;  3U3F A;  4DBR A;  4WGY A;  3AJM A;  2HS5 A;  4BEJ A;  4MS2 A;  4C3B A;  3IQ5 A;  4MTG A;  5DQT A;  2P0N A;  1MNE A;  3LS0 A;  2Q7R A;  3I5P A;  3MYI A;  2IXP A;  3GAN A;  1YVI A;  5DVW A;  3N24 A;  2Q9A A;  1LM3 B;  2HUJ A;  4DRH B;  5BQI A;  2ZXR A;  1CPR A;  3SXY A;  2QUP A;  3ZQV A;  3POV A;  3FHD A;  1M57 C;  4XLN F;  3S29 A;  3T6J A;  1Z63 A;  2PX0 A;  2YL0 A;  3LLK A;  1OW7 A;  2EIN C;  2XLM A;  3ASN C;  3QVY A;  4I44 A;  3WG7 C;  4BJT A;  5EHH A;  1OXK A;  1QVX A;  4JC7 A;  4CS7 A;  4MVS A;  4J7Y A;  4DBQ A;  4OIQ F;  1LKX A;  3RH3 A;  5DS4 A;  3LEO A;  3C18 A;  5F5F A;  3TD7 A;  1BZ4 A;  1LVK A;  3AG3 C;  4JEA A;  4U5G A;  2J0X A;  4U5B E;  2P6V A;  2UUH A;  3JYY A;  4CS9 C;  5L3V A;  3U8V A;  3JTL O;  3NYL A;  1OQC A;  5A6A A;  4G7O F;  1N1C A;  2Q9B A;  2R7W A;  1SMY F;  3O55 A;  1QKR A;  4YWQ A;  3ZTZ A;  2M64 A;  4BJ6 C;  1NLX A;  2OG2 A;  3DJU B;  2VH3 A;  2ASR A;  1E86 A;  2Y39 A;  3SNH A;  3WHN A;  3ZTM A;  1VOM A;  3JRT A;  1OCZ C;  1JMW A;  2XM0 A;  3DI5 A;  3ZQY A;  3SZR A;  3ZVR A;  1T01 A;  2GFH A;  2XSE A;  4JTA B;  2OQM A;  4PK4 A;  4DJ9 A;  3FOO A;  4E17 A;  2ZXO A;  3TK0 A;  3DM5 A;  3HJC A;  3U5S A;  2VB6 A;  4EBB A;  1LI7 A;  2J9V A;  3DKA A;  3DE8 A;  3GOR A;  5GPG B;  4Q4Z F;  2EPO A;  3K6B A;  3S27 A;  1M2V B;  1FMV A;  1ZW2 A;  3EFO A;  5KYU A;  3RKO F;  1T5O A;  2R7U A;  5COF A;  4QI2 A;  1YA9 A;  2PX3 A;  4AK9 A;  1RXQ A;  3QMK A;  3ZIB A;  1FFH A;  1JPJ A;  1ZU5 A;  3EQL F;  3DWW A;  1WAT A;  3HNL A;  1AUE A;  2NUP B;  3IHU A;  2DYR C;  4G78 A;  4Q7C A;  1RJ9 A;  3RVZ A;  4E0I A;  4EKW A;  2HJ3 A;  4LLE A;  1YDI A;  2L9J A;  4RBN A;  1EQ1 A;  1NBB A;  3TOM A;  4E0H A;  5E2Q A;  2IOQ A;  3JYH A;  2X51 A;  3L8I A;  1LI5 A;  3KYI A;  1UG7 A;  2XRH A;  3F47 A;  5D92 A;  1A7E A;  3W8I A;  2WZG A;  4Z9I A;  4YT2 A;  4IAQ A;  1K40 A;  2YEV A;  1G5Z A;  3GM3 A;  3JRM O;  4E7S A;  1JAF A;  2NPU A;  1H9T A;  4DRJ B;  3GOD A;  4P9F A;  4UDV A;  1EA8 A;  3C63 A;  3K1H A;  1OR3 A;  2J7P A;  5BQG A;  4U5H A;  2IXO A;  1TWG A;  5JS5 A;  5A6B D;  2J46 A;  3X2Q C;  3F46 A;  4W8K A;  1D0X A;  4JCH A;  3SXZ A;  3IQT A;  4YT8 A;  1RKE B;  3VRC A;  3RQE A;  2VC9 A;  4OD4 A;  1HY5 A;  1OKK D;  3M4B A;  3U0C A;  4OIO F;  1YYJ A;  2G3V A;  3L8J A;  3MLG A;  1A7D A;  2RD9 A;  2VCB A;  2YWA A;  4CDY A;  4FES A;  1Z7Q c;  4BG0 A;  4MVQ A;  1ZHW A;  3C8G D;  4YK5 A;  1D1A A;  3K66 A;  2R05 A;  2ZXP A;  2J9B A;  5KYX A;  4MQ9 F;  2L6G A;  3UMH A;  3NYJ A;  4I1O B;  1VMA A;  1G8X A;  4OIP F;  1HW1 A;  1A7V A;  1WAS A;  1MMA A;  1TWH A;  4XWJ A;  1BR4 A;  3UMI A;  4K7B A;  4O79 A;  2XLE A;  3M15 A;  2G62 A;  3UR3 C;  4DVZ A;  1RMV A;  5DLJ A;  3E70 C;  3V5Y A;  2FFH A;  4G7Z F;  3IQ6 A;  3FMS A;  4A4A A;  3LNM B;  1QLE C;  3FAP B;  3H2U A;  3KPH A;  3ZC4 A;  3UGP A;  2PFD A;  4CSA A;  4NC3 A;  1JR8 A;  1HMO A;  3EG9 A;  3JSE O;  1LE4 A;  3H65 A;  2L7A A;  3DZA A;  2EIJ C;  4MTO A;  5K0I A;  3U3B A;  2HFI A;  1TQG A;  3Q7L A;  2J8W A;  3EFO B;  4RDA A;  1HE9 A;  5KYU B;  3SXK A;  2KQ9 A;  5F5H A;  2R7O A;  2NG1 A;  4EIY A;  2OOC A;  5TJ5 E;  1Q0G A;  2KK1 A;  2J0W A;  3ABK C;  1U89 A;  2XS1 A;  1OCO C;  2HMZ A;  4LLC A;  1CGM E;  3FOP A;  3ITF A;  1RJ9 B;  2D4U A;  4KI2 A;  1M2V A;  2W4M A;  2AWC A;  4JJG A;  2R25 A;  3AOU A;  2OEX A;  3QVZ A;  3V5X A;  2R9R B;  4CDV A;  2M4E A;  2Q9C A;  5FCL A;  1VYK A;  3K7D A;  3BEH A;  3RIP A;  3ZDL A;  5L0J A;  4JCZ A;  5A6K A;  4U5E E;  3J06 A;  4O6Y A;  2GDC A;  5COG A;  3L1M A;  3RQF A;  3TOL A;  4U5C E;  4EUK B;  1FAP B;  2AWY A;  2R7S A;  4OD5 A;  2HZ8 A;  5KYN A;  2L81 A;  4JZA A;  4HFK B;  1ZHX A;  4D4X A;  1GM5 A;  2VCC A;  1OW6 A;  2GAQ A;  4M63 A;  1ZU4 A;  4G0H A;  2XS8 A;  2QY9 A;  4ULV A;  2R02 A;  4XEK A;  3DJN B;  4YL0 A;  3FXH A;  1E83 A;  2LFD A;  4O6M A;  5L0I A;  2H7B A;  4O7G A;  1PV3 A;  3LJB A;  2JD3 A;  4A2N B;  5COM A;  1TFO B; 
#chains in the Genus database with same CATH homology
 3AGT A;  2HMQ A;  3AGU A;  1HMD A;  1I4Z A;  3WAQ A;  2AWY A;  1HMO A;  2MHR A;  4XPX A;  1A7D A;  2AVK A;  1I4Y A;  3WHN A;  4XQ1 A;  1A7E A;  2HMZ A;  4XPY A;  4XPW A;  2AWC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...