3AGUA

Hemerythrin-like domain of dcrh (semimet-r)
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
133
structure length
133
Chain Sequence
DVLVKWSEDLANLPSIDTQHKRLVDYINDLYRAARRRDMDKAREVFDALKNYAVEHFGYEERLFADYAYPEATRHKEIHRRFVETVLKWEKQLAAGDPEVVMTTLRGLVDWLVNHIMKEDKKYEAYLRERGVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hemerythrin-like domain protein DcrH
publication title Characteristics of Diiron Site with Large Cavity in Hemerythrin-like Domain of DcrH
rcsb
source organism Desulfovibrio vulgaris
molecule tags Metal binding protein
total genus 58
structure length 133
sequence length 133
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01814 Hemerythrin Hemerythrin HHE cation binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.50 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Hemerythrin-like 3aguA00
4XQ1A 2AWYA 3AGTA 2HMZA 2HMQA 1I4YA 3WHNA 2AWCA 3WAQA 1HMOA 1A7EA 1A7DA 2MHRA 1HMDA 4XPYA 1I4ZA 3AGUA 2AVKA 4XPWA 4XPXA
chains in the Genus database with same CATH superfamily
1ST6A 5L0DA 1KU2A 4CSAA 3B9QA 1BDJB 3JRMO 3HNLA 1ZU5A 4BEMJ 2YZSA 4A2NB 3U2LA 1R4TA 2FGYA 3RQGA 3U9JA 1E84A 5EGYA 5KYNA 4KNWA 2XS1A 3CZ6A 3L1MA 3DM9B 2R7VA 1UG7A 3C8GD 3M79A 5KYXA 4QI2A 5JS5A 1OCRC 1DOVA 1YYXA 1TFKB 3NYMA 4J30B 4JJFA 4JZAA 3RYLA 4D4NA 4EIYA 3ASNC 3EPVA 2EIKC 4J7TA 4LDQA 3NMKA 5DLJA 1OW7A 1TR2A 1VLTA 3AQBA 1CGNA 2WZGA 1N1CA 4KNVA 4RD9A 5KYUA 4PK4A 3SEOA 4EKWA 4LLEA 1BZ4A 3FOPA 1Q0MA 2QY9A 3IQ5A 3U3BA 4CS9A 2XM0A 2Z15A 2AVKA 2A69F 2OG2A 4XPWA 2YL0A 4M63A 3W2VA 4AE4B 3JSEO 1Z63A 1MMDA 1ZW2A 4E0HA 1QVXA 4LDRA 1TQGA 2LSEA 2XS8A 3MFNA 5D91A 3ZQYA 2I8BA 1AEPA 1VLSA 2WZLA 4N6HA 4U5BE 1OR3A 5B3SC 4PJJA 3ZTMA 3M15A 2EPNA 1M2VB 3QMKA 2CGEA 5E2QA 2L81A 3JSZA 1RCPA 1VMAA 3PMRA 4LDKA 1ORYA 3MX3A 2BE5F 1YLMA 4IRUA 3SZRA 2HJ3A 3LESA 3RFYA 4DXWA 3DAFA 2XLWA 4ULWA 4W8PA 1Q0FA 4F4BA 4D4XA 3UMIA 1NLXA 3KH2A 3NYLA 5L3QA 4NC3A 4NTAA 4AE4A 3GORA 2YKZA 2TMVP 4DRHB 3K1IC 1PD1A 3S27A 3ABMC 4XQ1A 1T6UA 3QVYA 4CS8A 1OXBA 1GS9A 1WGWA 2A6EF 2KGOA 2YHSA 3C18A 3DJUB 4RBNA 3WHNA 1M2VA 1XWJA 5CI8A 3RH3A 2LFDA 3BRJA 3PHF2 3EH1A 2QUPA 2R25A 4MVSA 2VCAA 2EPLX 2KK1A 2WVOA 1VOMA 2MHRA 2OJQA 3H65A 4WJ0A 3ZSUA 3LJBA 2A0UA 2FFHA 2LFFA 3E9VA 4UDVA 3I4UA 3C63A 3DD7A 3SYNA 3FAJA 3LEOA 1WWPA 2Q9AA 4MW8A 3UR3C 4DVZA 5KYWB 5L0FA 3EZHA 1G5ZA 1OCOC 3US6A 1YVIA 2XLMA 3A9CA 5K0IA 1ZHYA 3QZCA 4EHPA 3OA1A 5A6KA 2A0BA 1QQ3A 2KC3A 2NUTB 2ZXWC 2Q7RA 1T6QA 2I15A 2OKUA 3AG4C 2R7UA 1ZHTA 2XSEA 1I5NA 3U5SA 4ANJA 1TFOB 3QW0A 3RF3A 1A7EA 1V4AA 3W4YA 4FESA 2J45A 5D92A 4U5FE 3R7CA 2J9VA 3I5PA 1OW6A 1I4ZA 3N24A 1M2OA 4U9EA 5COMA 5KYWA 4B6IA 1LVKA 1Z3IX 4J32B 2J9UA 3M4CA 5FZTA 3MYIA 1GM5A 1ZYRF 1KNYA 4AL0A 2KYHA 2OOCA 1ZZPA 1NBBA 2J7PD 2YEVA 5L0IA 3F47A 2NUTA 4PACA 3U0CA 5BQIA 3GEIA 3K66A 4JRZA 4DBQA 4OIOF 1EKYA 5CI9A 2GA0A 1LIHA 1D0ZA 1HY5A 3AQCA 3JRTA 3KPHA 4HEAJ 4JTDB 1D0YA 2VCBA 4P6IC 2EIJC 1SYQA 4C3DA 4IAOA 5E3CA 1A0BA 4CS7A 3O39A 5A6AA 1D0XA 1EI7A 5E3AA 1MNEA 2R7TA 1HW1A 4I3MA 3S28A 3TULA 1HE9A 1Q0DA 3HNKA 2YWAA 1SR2A 4R32A 5DQZA 2ZD9A 4U5DE 4Q4ZF 3PDMP 1JRAA 4MVUA 2Q9CA 3SXMA 1ORJA 2J46A 2LIGA 3LEVA 3B29A 2D4UA 3G50A 3MYFA 5AGFA 5FCLA 3S0XA 1BR1A 3IQTA 3R2PA 5TJ5E 3C62A 4JEBA 3S29A 3F46A 1FTSA 3DMDA 4JIOA 2F22A 3AJMA 1GGQA 4HFFB 2WB7A 4I1OB 2KSFA 4OD5A 3V5ZA 256BA 3K7DA 2L6HA 3W8HA 4DOZA 5L3VA 3NKEA 4IWBA 1JR8A 5JRAA 3AG2C 2R9RB 1FAPB 1GQAA 3M1CB 2H7BA 1LKXA 5IY5C 1V55C 3IQCA 1QKRA 4YT5A 1OQCA 3OEOA 3ASOC 1YARO 4O7GA 1LPEA 2E87A 3W8IA 2W9YA 3AGTA 2HV6A 4JKVA 3U8PA 2KNHA 2P1AA 3N2ZB 2DI3A 1OXKA 1C03A 1TWAA 2KW3C 2PP4A 2R03A 2PX0A 3TJ6A 1APCA 2BC5A 2EILC 2W4BA 4YWQA 2WVNA 3IPMO 1MMAA 4K1OA 2EINC 4KI2A 3POVA 3KKBA 4JURI 4JCZA 5L0HA 3HKKA 3S90A 3G4XA 3NYJA 1VB5A 4JC7A 2EPMX 3IQ6A 3DI5A 2DYRC 4MVOA 3L34A 1YAUO 2C04A 1OKKA 3LAYA 3ZC4A 2OEVA 4C7OB 4Q5SF 1VYIA 2HV7A 2L6GA 1OW8A 1T9KA 2ZXRA 4MNDA 3ABKC 4YN0B 1FMVA 3RQFA 2PBEA 2R7SA 4NTFA 2CW0F 2X0CA 1VTMP 4ZLDA 3HLZA 3VF0A 4NTBA 4YT4A 1T6IA 2VASA 1C17M 1MNDA 2P7VA 2P0NA 1FFTC 2PF4E 3G4ZA 3Q6NA 4FWVA 4WGZA 5HV9A 1L7CA 1MMNA 4CDVA 5T3WA 1WOLA 1LE2A 3E70C 4CDYA 2QLAA 3HNJA 2MWQA 4CDAA 2RD9A 1HMDA 2W4MA 1LI5A 2MYSA 2GDCA 3NRHA 4G78A 1ORSC 1NFOA 2B0JA 2WL8A 4K0DA 1F1MA 2PX3A 4MVRA 4C7OA 3TD7A 1NG1A 3K6BA 4E0IA 5CIVA 5A6BD 3ECSA 3SP1A 4X0RA 5DS5A 3ITFA 2R7WA 3C8ZA 1QPUA 5AC4A 1Y6DA 2J9WA 3UMKA 2OEXA 1CGOA 1ZW3A 2CNWA 3FMSA 3O55A 4I1MA 2XLVA 4U5HA 5DVWA 5AC5A 1CPQA 1WTYA 2JPUA 4QDLA 1EQ1A 4XEKA 3QW1A 1YDIA 2NSGA 3ZTZA 3DJNB 4IJJA 4C3EA 3ZWIA 3CQZA 3UMHA 4CBEA 1M6TA 3ZG1A 1O5HA 5JT4A 3ABLC 2J9BA 2PNOA 1VYKA 1SF8A 2XM4A 4YJWA 5T3TA 3CAXA 2L7AA 1LI7A 1L3PA 3DM5A 3VRCA 2DGJA 3M4BA 4XLNF 1UFBA 2P6VA 3VYWA 1JMWA 4GYTA 4CSAC 4PFOA 5F5FA 4JEAA 3K1HA 4U5EE 3RVYA 4DRIB 1J8MF 1J8YF 1EA8A 3GM2A 4G7HF 3GEHA 1IZMA 4XTKA 4A4AA 2Q3TA 5A69A 4CIHA 4LACB 2P61A 2UUHA 3NMJA 4LERA 5EK0A 1S05A 3H2UA 4MS2A 1NU7D 3UGOA 2DB4A 2LCHA 5COFA 5L0JA 1YZAA 3UNGC 5DS4A 2HMQA 3V7OA 1BR2A 1TWGA 4EUKB 4BJ5A 2O9XA 3ZVRA 3EH2A 1O87A 4ER9A 1LS4A 2YRFA 2H7OA 1OR2A 2Y3DA 4CS9C 2R05A 4E7ZA 2OQMA 3JTLO 2ASRA 3AOUA 3LNRA 3Q7LA 2YLDA 4BJ6A 2GAQA 3DXJF 2LQGA 4O6NA 3FXHA 3B71A 4BG0A 1CGME 1JPJA 4XWJA 3RVZA 3SXKA 1SMYF 1V54C 2RSEB 3C8GB 3JYHA 4JVSA 3TJ5A 3FOOA 3WG7C 4IGGA 5BQGA 4EBBA 3LUTB 4XPXA 2NPUA 2V26A 2HSBA 2Y3GA 1LE4A 1RKCA 1ZU4A 1NU9C 1A41A 1YJGA 1YA9A 4O6MA 1HMOA 2A6HF 1FR0A 2WVQA 4YT2A 4I44A 2NG1A 5JLIA 2YQYA 5JVEA 2YL1A 3JZ0A 1BR4A 2LK4A 3W2WA 5B3IA 4CS8C 1XZPA 1NSGB 1K05A 3C8GA 3DAGA 4MQ9F 4MVMA 3EGXB 1LS1A 4MTOA 4NQFA 3TOLA 3LLKA 1JAFA 1R5ID 2XLOA 3HTKC 2R7RA 1XZQA 3AG1C 2M64A 4GEHA 1PV3A 2Q9BA 3LS1A 4G7OF 4AL1A 2XLHA 2A68F 4U5CE 2GWWA 1C02A 3DE9A 3LLIA 1QZXA 4JTAB 1MQVA 4AX2A 3DZAA 5L0CA 2HZ8A 3HNIA 3U8VA 2HMZA 2G3VA 1I4YA 2ZPAA 3IHUA 1FFHA 5COGA 3GM1A 1KTMA 3U3FA 2UUIA 4BEJA 4EBJA 3EQLF 1Z7Qc 3EHMA 3A11A 4YL3A 1S7ZA 5JSLA 1AVOB 5GPGB 3K1IA 3EGXA 4XPYA 1G8XA 2G62A 1V74B 1LM3B 2NSFA 3O6XA 3U9MA 5EHHA 1ZHWA 3EJNA 4JTCB 2A1DD 4XLPF 3AGUA 4WGYA 4HE8D 2DYSC 4N4WA 1PD0A 1TKNA 2IXOA 5KYYB 2HUJA 1RKEB 1HW2A 4RDAA 3H2VA 4GQHA 3Q6MA 3SXYA 4DVYP 3U2MA 4YT8A 2YLIA 2GFHA 2HSQA 3T6GB 3LNMB 3C7JA 3ZIBA 2VH3A 1AUEA 3UGPA 3MLGA 2IM8A 1MMGA 3RIPA 3HJCA 3QVZA 5HSWA 3DWWA 2IXMA 3KMIA 3GANA 1T01A 3CEXA 3GEEA 3GODA 2BL2A 4MVZA 4KC9A 4N06A 2XL6A 2L6FA 4EBKA 3VAYA 5KYYA 1Q0GA 4CX9A 3ATPA 4ULVA 4OINF 1RKEA 2IXNA 4OIRF 3JYYA 4OIQF 4CIPA 2LD6A 4G0HA 5B1BC 1K04A 4HFKB 4ONSA 4W8KA 4DBRA 3B0VC 3RQEA 2JX0A 3EG9B 3SNHA 1VK5A 1D1CA 3DKAA 3V5XA 4P9FA 3ZDLA 2VB6A 2Q4FA 2KQ9A 3J06A 1RJ9B 4Z9IA 4OD4A 1W2WA 4H54A 5E33A 4CJGA 3TK0A 1U89A 2VC9A 3O10A 1QLEC 2QE9A 3WAQA 4BJ1A 1H6GA 1OCCC 3DE8A 2Y69C 3KYIA 2B0HA 2D5RB 5F28E 4MW3A 2J8WA 3K33A 1OKKD 4NCQA 5T1DB 3KYJA 3QTHA 2CCYA 1JPNA 3RW0A 1WATA 3L8IA 4AK9A 4O6YA 2PFDA 2ICWG 5JP7A 1T5OA 4J7YA 3L0IA 2HFIA 2YL7A 3EG9A 3B0UX 3EFOB 1M57C 1K40A 1Q0KA 3T6JA 4QI0A 2XXAB 1RJ9A 3OWTA 2QTVA 4G7ZF 1RXQA 2FAPB 2OCCC 4WABA 2J7PA 2R7XA 2X51A 3GWLA 4BJTA 3GWNA 4PJLA 4U5GA 2Y3HA 3GM3A 4JE9A 4PFPA 2R02A 4CJOA 4OIPF 3V5YA 4MTFA 4YL1A 4MVQA 1O3UA 2R7OA 3ZQVA 3JT1A 4Z9JA 1NFNA 1BBHA 4PR9A 2EIMC 1PCXA 1Z23A 2HJMA 3EHNA 1G4US 1SZIA 3N0TA 1JOGA 1Y4CA 5B1AC 2Q00A 4DJ9A 5BQHA 3FDQA 1CPRA 3I5QA 3KL4A 3EFOA 2CNWD 1RMVA 1E83A 2ZXPA 2XXAA 2M4EA 3FVYA 5L0GA 2NUPB 3T6BA 3NG1A 4PJNA 4XEVA 4ZLCA 5F5HA 2R7QA 1FNTc 1A7VA 4O79A 4E17A 1ZHZA 1E2XA 2YVKA 3T4RA 1U6HA 2OU6A 1D1AA 1QSPA 1B68A 2HS5A 3CSKA 3IEEA 2W45A 2HKVA 1NZEA 1U0BB 1TWCA 3RKOF 3WODF 2OJED 2CYDA 2C03A 4DRJB 2AU5A 1TWHA 2AWCA 3PCVA 3X2QC 3S84A 4P9TA 4BPMA 2YL3A 4L6RA 2IBFA 4E18A 5JUAA 2LP4A 1A7DA 2ZXOA 2CDQA 2QNLA 2EPOA 4YL0A 3T9OA 1DOWA 2J0XA 2G3KA 2H7VC 3NDBB 3NKDA 1FMWA 2AP3A 2NUPA 2XLDA 3LS0A 3Q7GA 3L8JA 3S9OA 2L9JA 4LLCA 2V3CC 1E85A 1H7IA 2EPKX 3AG3C 3EGDB 3VM6A 1OCZC 4JW1A 1YA7O 3JCUQ 4K7BA 3MBGA 4KBLA 4PJMA 4IARA 5BUOA 3BEHA 1IW7F 2AWYA 4XEFA 4U9DA 2ETSA 1M56C 4FX5A 2IOQA 4H4KC 1H9TA 3B0PA 4MTGA 1YZCA 1Z6AA 3EZIA 1G4WR 2J0WA 2VCCA 2Y3BA 3X1OA 4FAPB 5DS6A 2JD3A 1Z5ZA 1HE1A 4Q7CA 4C3BA 2Y39A 4YK5A 1D1BA 1E86A 2H8AA 2YLGA 3TOMA 5A6JA 2IXPA 2KJGA 1YYJA 4Z9HA 2XRHA 2XL4A 5KYXB 1ZHXA 2IYLD 4JCHA 1WN0A 2WZFA 1H9GA 4E7SA 3FAPB 3EGDA 4BJ5C 4IB4A 4IAQA 3SXZA 4JJGA 5DQTA 2XL8A 4EWCA 3TQOA 1ZVZA 2XLEA 5A6BA 5KYUB 4NY3A 4N6CA 3NMIA 4BJ6C 1WASA 3FHDA
chains in the Genus database with same CATH topology
4XQ1A 2AWYA 3AGTA 2HMZA 2HMQA 1I4YA 3WHNA 2AWCA 3WAQA 1HMOA 1A7EA 1A7DA 2MHRA 1HMDA 4XPYA 1I4ZA 3AGUA 2AVKA 4XPWA 4XPXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XQ1 A;  2AWY A;  3AGT A;  2HMZ A;  2HMQ A;  1I4Y A;  3WHN A;  2AWC A;  3WAQ A;  1HMO A;  1A7E A;  1A7D A;  2MHR A;  1HMD A;  4XPY A;  1I4Z A;  3AGU A;  2AVK A;  4XPW A;  4XPX A; 
#chains in the Genus database with same CATH topology
 1ST6 A;  5L0D A;  1KU2 A;  4CSA A;  3B9Q A;  1BDJ B;  3JRM O;  3HNL A;  1ZU5 A;  4BEM J;  2YZS A;  4A2N B;  3U2L A;  1R4T A;  2FGY A;  3RQG A;  3U9J A;  1E84 A;  5EGY A;  5KYN A;  4KNW A;  2XS1 A;  3CZ6 A;  3L1M A;  3DM9 B;  2R7V A;  1UG7 A;  3C8G D;  3M79 A;  5KYX A;  4QI2 A;  5JS5 A;  1OCR C;  1DOV A;  1YYX A;  1TFK B;  3NYM A;  4J30 B;  4JJF A;  4JZA A;  3RYL A;  4D4N A;  4EIY A;  3ASN C;  3EPV A;  2EIK C;  4J7T A;  4LDQ A;  3NMK A;  5DLJ A;  1OW7 A;  1TR2 A;  1VLT A;  3AQB A;  1CGN A;  2WZG A;  1N1C A;  4KNV A;  4RD9 A;  5KYU A;  4PK4 A;  3SEO A;  4EKW A;  4LLE A;  1BZ4 A;  3FOP A;  1Q0M A;  2QY9 A;  3IQ5 A;  3U3B A;  4CS9 A;  2XM0 A;  2Z15 A;  2AVK A;  2A69 F;  2OG2 A;  4XPW A;  2YL0 A;  4M63 A;  3W2V A;  4AE4 B;  3JSE O;  1Z63 A;  1MMD A;  1ZW2 A;  4E0H A;  1QVX A;  4LDR A;  1TQG A;  2LSE A;  2XS8 A;  3MFN A;  5D91 A;  3ZQY A;  2I8B A;  1AEP A;  1VLS A;  2WZL A;  4N6H A;  4U5B E;  1OR3 A;  5B3S C;  4PJJ A;  3ZTM A;  3M15 A;  2EPN A;  1M2V B;  3QMK A;  2CGE A;  5E2Q A;  2L81 A;  3JSZ A;  1RCP A;  1VMA A;  3PMR A;  4LDK A;  1ORY A;  3MX3 A;  2BE5 F;  1YLM A;  4IRU A;  3SZR A;  2HJ3 A;  3LES A;  3RFY A;  4DXW A;  3DAF A;  2XLW A;  4ULW A;  4W8P A;  1Q0F A;  4F4B A;  4D4X A;  3UMI A;  1NLX A;  3KH2 A;  3NYL A;  5L3Q A;  4NC3 A;  4NTA A;  4AE4 A;  3GOR A;  2YKZ A;  2TMV P;  4DRH B;  3K1I C;  1PD1 A;  3S27 A;  3ABM C;  4XQ1 A;  1T6U A;  3QVY A;  4CS8 A;  1OXB A;  1GS9 A;  1WGW A;  2A6E F;  2KGO A;  2YHS A;  3C18 A;  3DJU B;  4RBN A;  3WHN A;  1M2V A;  1XWJ A;  5CI8 A;  3RH3 A;  2LFD A;  3BRJ A;  3PHF 2;  3EH1 A;  2QUP A;  2R25 A;  4MVS A;  2VCA A;  2EPL X;  2KK1 A;  2WVO A;  1VOM A;  2MHR A;  2OJQ A;  3H65 A;  4WJ0 A;  3ZSU A;  3LJB A;  2A0U A;  2FFH A;  2LFF A;  3E9V A;  4UDV A;  3I4U A;  3C63 A;  3DD7 A;  3SYN A;  3FAJ A;  3LEO A;  1WWP A;  2Q9A A;  4MW8 A;  3UR3 C;  4DVZ A;  5KYW B;  5L0F A;  3EZH A;  1G5Z A;  1OCO C;  3US6 A;  1YVI A;  2XLM A;  3A9C A;  5K0I A;  1ZHY A;  3QZC A;  4EHP A;  3OA1 A;  5A6K A;  2A0B A;  1QQ3 A;  2KC3 A;  2NUT B;  2ZXW C;  2Q7R A;  1T6Q A;  2I15 A;  2OKU A;  3AG4 C;  2R7U A;  1ZHT A;  2XSE A;  1I5N A;  3U5S A;  4ANJ A;  1TFO B;  3QW0 A;  3RF3 A;  1A7E A;  1V4A A;  3W4Y A;  4FES A;  2J45 A;  5D92 A;  4U5F E;  3R7C A;  2J9V A;  3I5P A;  1OW6 A;  1I4Z A;  3N24 A;  1M2O A;  4U9E A;  5COM A;  5KYW A;  4B6I A;  1LVK A;  1Z3I X;  4J32 B;  2J9U A;  3M4C A;  5FZT A;  3MYI A;  1GM5 A;  1ZYR F;  1KNY A;  4AL0 A;  2KYH A;  2OOC A;  1ZZP A;  1NBB A;  2J7P D;  2YEV A;  5L0I A;  3F47 A;  2NUT A;  4PAC A;  3U0C A;  5BQI A;  3GEI A;  3K66 A;  4JRZ A;  4DBQ A;  4OIO F;  1EKY A;  5CI9 A;  2GA0 A;  1LIH A;  1D0Z A;  1HY5 A;  3AQC A;  3JRT A;  3KPH A;  4HEA J;  4JTD B;  1D0Y A;  2VCB A;  4P6I C;  2EIJ C;  1SYQ A;  4C3D A;  4IAO A;  5E3C A;  1A0B A;  4CS7 A;  3O39 A;  5A6A A;  1D0X A;  1EI7 A;  5E3A A;  1MNE A;  2R7T A;  1HW1 A;  4I3M A;  3S28 A;  3TUL A;  1HE9 A;  1Q0D A;  3HNK A;  2YWA A;  1SR2 A;  4R32 A;  5DQZ A;  2ZD9 A;  4U5D E;  4Q4Z F;  3PDM P;  1JRA A;  4MVU A;  2Q9C A;  3SXM A;  1ORJ A;  2J46 A;  2LIG A;  3LEV A;  3B29 A;  2D4U A;  3G50 A;  3MYF A;  5AGF A;  5FCL A;  3S0X A;  1BR1 A;  3IQT A;  3R2P A;  5TJ5 E;  3C62 A;  4JEB A;  3S29 A;  3F46 A;  1FTS A;  3DMD A;  4JIO A;  2F22 A;  3AJM A;  1GGQ A;  4HFF B;  2WB7 A;  4I1O B;  2KSF A;  4OD5 A;  3V5Z A;  256B A;  3K7D A;  2L6H A;  3W8H A;  4DOZ A;  5L3V A;  3NKE A;  4IWB A;  1JR8 A;  5JRA A;  3AG2 C;  2R9R B;  1FAP B;  1GQA A;  3M1C B;  2H7B A;  1LKX A;  5IY5 C;  1V55 C;  3IQC A;  1QKR A;  4YT5 A;  1OQC A;  3OEO A;  3ASO C;  1YAR O;  4O7G A;  1LPE A;  2E87 A;  3W8I A;  2W9Y A;  3AGT A;  2HV6 A;  4JKV A;  3U8P A;  2KNH A;  2P1A A;  3N2Z B;  2DI3 A;  1OXK A;  1C03 A;  1TWA A;  2KW3 C;  2PP4 A;  2R03 A;  2PX0 A;  3TJ6 A;  1APC A;  2BC5 A;  2EIL C;  2W4B A;  4YWQ A;  2WVN A;  3IPM O;  1MMA A;  4K1O A;  2EIN C;  4KI2 A;  3POV A;  3KKB A;  4JUR I;  4JCZ A;  5L0H A;  3HKK A;  3S90 A;  3G4X A;  3NYJ A;  1VB5 A;  4JC7 A;  2EPM X;  3IQ6 A;  3DI5 A;  2DYR C;  4MVO A;  3L34 A;  1YAU O;  2C04 A;  1OKK A;  3LAY A;  3ZC4 A;  2OEV A;  4C7O B;  4Q5S F;  1VYI A;  2HV7 A;  2L6G A;  1OW8 A;  1T9K A;  2ZXR A;  4MND A;  3ABK C;  4YN0 B;  1FMV A;  3RQF A;  2PBE A;  2R7S A;  4NTF A;  2CW0 F;  2X0C A;  1VTM P;  4ZLD A;  3HLZ A;  3VF0 A;  4NTB A;  4YT4 A;  1T6I A;  2VAS A;  1C17 M;  1MND A;  2P7V A;  2P0N A;  1FFT C;  2PF4 E;  3G4Z A;  3Q6N A;  4FWV A;  4WGZ A;  5HV9 A;  1L7C A;  1MMN A;  4CDV A;  5T3W A;  1WOL A;  1LE2 A;  3E70 C;  4CDY A;  2QLA A;  3HNJ A;  2MWQ A;  4CDA A;  2RD9 A;  1HMD A;  2W4M A;  1LI5 A;  2MYS A;  2GDC A;  3NRH A;  4G78 A;  1ORS C;  1NFO A;  2B0J A;  2WL8 A;  4K0D A;  1F1M A;  2PX3 A;  4MVR A;  4C7O A;  3TD7 A;  1NG1 A;  3K6B A;  4E0I A;  5CIV A;  5A6B D;  3ECS A;  3SP1 A;  4X0R A;  5DS5 A;  3ITF A;  2R7W A;  3C8Z A;  1QPU A;  5AC4 A;  1Y6D A;  2J9W A;  3UMK A;  2OEX A;  1CGO A;  1ZW3 A;  2CNW A;  3FMS A;  3O55 A;  4I1M A;  2XLV A;  4U5H A;  5DVW A;  5AC5 A;  1CPQ A;  1WTY A;  2JPU A;  4QDL A;  1EQ1 A;  4XEK A;  3QW1 A;  1YDI A;  2NSG A;  3ZTZ A;  3DJN B;  4IJJ A;  4C3E A;  3ZWI A;  3CQZ A;  3UMH A;  4CBE A;  1M6T A;  3ZG1 A;  1O5H A;  5JT4 A;  3ABL C;  2J9B A;  2PNO A;  1VYK A;  1SF8 A;  2XM4 A;  4YJW A;  5T3T A;  3CAX A;  2L7A A;  1LI7 A;  1L3P A;  3DM5 A;  3VRC A;  2DGJ A;  3M4B A;  4XLN F;  1UFB A;  2P6V A;  3VYW A;  1JMW A;  4GYT A;  4CSA C;  4PFO A;  5F5F A;  4JEA A;  3K1H A;  4U5E E;  3RVY A;  4DRI B;  1J8M F;  1J8Y F;  1EA8 A;  3GM2 A;  4G7H F;  3GEH A;  1IZM A;  4XTK A;  4A4A A;  2Q3T A;  5A69 A;  4CIH A;  4LAC B;  2P61 A;  2UUH A;  3NMJ A;  4LER A;  5EK0 A;  1S05 A;  3H2U A;  4MS2 A;  1NU7 D;  3UGO A;  2DB4 A;  2LCH A;  5COF A;  5L0J A;  1YZA A;  3UNG C;  5DS4 A;  2HMQ A;  3V7O A;  1BR2 A;  1TWG A;  4EUK B;  4BJ5 A;  2O9X A;  3ZVR A;  3EH2 A;  1O87 A;  4ER9 A;  1LS4 A;  2YRF A;  2H7O A;  1OR2 A;  2Y3D A;  4CS9 C;  2R05 A;  4E7Z A;  2OQM A;  3JTL O;  2ASR A;  3AOU A;  3LNR A;  3Q7L A;  2YLD A;  4BJ6 A;  2GAQ A;  3DXJ F;  2LQG A;  4O6N A;  3FXH A;  3B71 A;  4BG0 A;  1CGM E;  1JPJ A;  4XWJ A;  3RVZ A;  3SXK A;  1SMY F;  1V54 C;  2RSE B;  3C8G B;  3JYH A;  4JVS A;  3TJ5 A;  3FOO A;  3WG7 C;  4IGG A;  5BQG A;  4EBB A;  3LUT B;  4XPX A;  2NPU A;  2V26 A;  2HSB A;  2Y3G A;  1LE4 A;  1RKC A;  1ZU4 A;  1NU9 C;  1A41 A;  1YJG A;  1YA9 A;  4O6M A;  1HMO A;  2A6H F;  1FR0 A;  2WVQ A;  4YT2 A;  4I44 A;  2NG1 A;  5JLI A;  2YQY A;  5JVE A;  2YL1 A;  3JZ0 A;  1BR4 A;  2LK4 A;  3W2W A;  5B3I A;  4CS8 C;  1XZP A;  1NSG B;  1K05 A;  3C8G A;  3DAG A;  4MQ9 F;  4MVM A;  3EGX B;  1LS1 A;  4MTO A;  4NQF A;  3TOL A;  3LLK A;  1JAF A;  1R5I D;  2XLO A;  3HTK C;  2R7R A;  1XZQ A;  3AG1 C;  2M64 A;  4GEH A;  1PV3 A;  2Q9B A;  3LS1 A;  4G7O F;  4AL1 A;  2XLH A;  2A68 F;  4U5C E;  2GWW A;  1C02 A;  3DE9 A;  3LLI A;  1QZX A;  4JTA B;  1MQV A;  4AX2 A;  3DZA A;  5L0C A;  2HZ8 A;  3HNI A;  3U8V A;  2HMZ A;  2G3V A;  1I4Y A;  2ZPA A;  3IHU A;  1FFH A;  5COG A;  3GM1 A;  1KTM A;  3U3F A;  2UUI A;  4BEJ A;  4EBJ A;  3EQL F;  1Z7Q c;  3EHM A;  3A11 A;  4YL3 A;  1S7Z A;  5JSL A;  1AVO B;  5GPG B;  3K1I A;  3EGX A;  4XPY A;  1G8X A;  2G62 A;  1V74 B;  1LM3 B;  2NSF A;  3O6X A;  3U9M A;  5EHH A;  1ZHW A;  3EJN A;  4JTC B;  2A1D D;  4XLP F;  3AGU A;  4WGY A;  4HE8 D;  2DYS C;  4N4W A;  1PD0 A;  1TKN A;  2IXO A;  5KYY B;  2HUJ A;  1RKE B;  1HW2 A;  4RDA A;  3H2V A;  4GQH A;  3Q6M A;  3SXY A;  4DVY P;  3U2M A;  4YT8 A;  2YLI A;  2GFH A;  2HSQ A;  3T6G B;  3LNM B;  3C7J A;  3ZIB A;  2VH3 A;  1AUE A;  3UGP A;  3MLG A;  2IM8 A;  1MMG A;  3RIP A;  3HJC A;  3QVZ A;  5HSW A;  3DWW A;  2IXM A;  3KMI A;  3GAN A;  1T01 A;  3CEX A;  3GEE A;  3GOD A;  2BL2 A;  4MVZ A;  4KC9 A;  4N06 A;  2XL6 A;  2L6F A;  4EBK A;  3VAY A;  5KYY A;  1Q0G A;  4CX9 A;  3ATP A;  4ULV A;  4OIN F;  1RKE A;  2IXN A;  4OIR F;  3JYY A;  4OIQ F;  4CIP A;  2LD6 A;  4G0H A;  5B1B C;  1K04 A;  4HFK B;  4ONS A;  4W8K A;  4DBR A;  3B0V C;  3RQE A;  2JX0 A;  3EG9 B;  3SNH A;  1VK5 A;  1D1C A;  3DKA A;  3V5X A;  4P9F A;  3ZDL A;  2VB6 A;  2Q4F A;  2KQ9 A;  3J06 A;  1RJ9 B;  4Z9I A;  4OD4 A;  1W2W A;  4H54 A;  5E33 A;  4CJG A;  3TK0 A;  1U89 A;  2VC9 A;  3O10 A;  1QLE C;  2QE9 A;  3WAQ A;  4BJ1 A;  1H6G A;  1OCC C;  3DE8 A;  2Y69 C;  3KYI A;  2B0H A;  2D5R B;  5F28 E;  4MW3 A;  2J8W A;  3K33 A;  1OKK D;  4NCQ A;  5T1D B;  3KYJ A;  3QTH A;  2CCY A;  1JPN A;  3RW0 A;  1WAT A;  3L8I A;  4AK9 A;  4O6Y A;  2PFD A;  2ICW G;  5JP7 A;  1T5O A;  4J7Y A;  3L0I A;  2HFI A;  2YL7 A;  3EG9 A;  3B0U X;  3EFO B;  1M57 C;  1K40 A;  1Q0K A;  3T6J A;  4QI0 A;  2XXA B;  1RJ9 A;  3OWT A;  2QTV A;  4G7Z F;  1RXQ A;  2FAP B;  2OCC C;  4WAB A;  2J7P A;  2R7X A;  2X51 A;  3GWL A;  4BJT A;  3GWN A;  4PJL A;  4U5G A;  2Y3H A;  3GM3 A;  4JE9 A;  4PFP A;  2R02 A;  4CJO A;  4OIP F;  3V5Y A;  4MTF A;  4YL1 A;  4MVQ A;  1O3U A;  2R7O A;  3ZQV A;  3JT1 A;  4Z9J A;  1NFN A;  1BBH A;  4PR9 A;  2EIM C;  1PCX A;  1Z23 A;  2HJM A;  3EHN A;  1G4U S;  1SZI A;  3N0T A;  1JOG A;  1Y4C A;  5B1A C;  2Q00 A;  4DJ9 A;  5BQH A;  3FDQ A;  1CPR A;  3I5Q A;  3KL4 A;  3EFO A;  2CNW D;  1RMV A;  1E83 A;  2ZXP A;  2XXA A;  2M4E A;  3FVY A;  5L0G A;  2NUP B;  3T6B A;  3NG1 A;  4PJN A;  4XEV A;  4ZLC A;  5F5H A;  2R7Q A;  1FNT c;  1A7V A;  4O79 A;  4E17 A;  1ZHZ A;  1E2X A;  2YVK A;  3T4R A;  1U6H A;  2OU6 A;  1D1A A;  1QSP A;  1B68 A;  2HS5 A;  3CSK A;  3IEE A;  2W45 A;  2HKV A;  1NZE A;  1U0B B;  1TWC A;  3RKO F;  3WOD F;  2OJE D;  2CYD A;  2C03 A;  4DRJ B;  2AU5 A;  1TWH A;  2AWC A;  3PCV A;  3X2Q C;  3S84 A;  4P9T A;  4BPM A;  2YL3 A;  4L6R A;  2IBF A;  4E18 A;  5JUA A;  2LP4 A;  1A7D A;  2ZXO A;  2CDQ A;  2QNL A;  2EPO A;  4YL0 A;  3T9O A;  1DOW A;  2J0X A;  2G3K A;  2H7V C;  3NDB B;  3NKD A;  1FMW A;  2AP3 A;  2NUP A;  2XLD A;  3LS0 A;  3Q7G A;  3L8J A;  3S9O A;  2L9J A;  4LLC A;  2V3C C;  1E85 A;  1H7I A;  2EPK X;  3AG3 C;  3EGD B;  3VM6 A;  1OCZ C;  4JW1 A;  1YA7 O;  3JCU Q;  4K7B A;  3MBG A;  4KBL A;  4PJM A;  4IAR A;  5BUO A;  3BEH A;  1IW7 F;  2AWY A;  4XEF A;  4U9D A;  2ETS A;  1M56 C;  4FX5 A;  2IOQ A;  4H4K C;  1H9T A;  3B0P A;  4MTG A;  1YZC A;  1Z6A A;  3EZI A;  1G4W R;  2J0W A;  2VCC A;  2Y3B A;  3X1O A;  4FAP B;  5DS6 A;  2JD3 A;  1Z5Z A;  1HE1 A;  4Q7C A;  4C3B A;  2Y39 A;  4YK5 A;  1D1B A;  1E86 A;  2H8A A;  2YLG A;  3TOM A;  5A6J A;  2IXP A;  2KJG A;  1YYJ A;  4Z9H A;  2XRH A;  2XL4 A;  5KYX B;  1ZHX A;  2IYL D;  4JCH A;  1WN0 A;  2WZF A;  1H9G A;  4E7S A;  3FAP B;  3EGD A;  4BJ5 C;  4IB4 A;  4IAQ A;  3SXZ A;  4JJG A;  5DQT A;  2XL8 A;  4EWC A;  3TQO A;  1ZVZ A;  2XLE A;  5A6B A;  5KYU B;  4NY3 A;  4N6C A;  3NMI A;  4BJ6 C;  1WAS A;  3FHD A; 
#chains in the Genus database with same CATH homology
 4XQ1 A;  2AWY A;  3AGT A;  2HMZ A;  2HMQ A;  1I4Y A;  3WHN A;  2AWC A;  3WAQ A;  1HMO A;  1A7E A;  1A7D A;  2MHR A;  1HMD A;  4XPY A;  1I4Z A;  3AGU A;  2AVK A;  4XPW A;  4XPX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...