1CGNA

Cytochrome c'
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
125
structure length
125
Chain Sequence
EFAKPEDAVKYRQSALTLMASHFGRMAPVVKGQAPYDAAQIKANVEVLKTLTALPWAAFGAGTEGGDARPEIWSDAAGFKQKQQAFQDNIVKLSAAADAGDLDKLRAAFGDVGASCKACHDSYRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOCHROME C
publication title Three-dimensional structure of cytochrome c' from two Alcaligenes species and the implications for four-helix bundle structures.
pubmed doi rcsb
source organism Achromobacter xylosoxidans
molecule tags Electron transport (cytochrome)
total genus 48
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 1995-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01322 Cytochrom_C_2 Cytochrome C'
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 1cgnA00
256BA 3NMKA 4CX9A 3ZWIA 4JEAA 3C63A 4IAQA 2XLWA 3M4BA 4CIPA 4JE9A 2YKZA 1CPRA 3TOLA 4ER9A 3M15A 3NMIA 2YL0A 2J9BA 4IARA 1NBBA 5AGFA 3ZQVA 2XLHA 3FOPA 3VRCA 1YYXA 2QLAA 3HNJA 2BC5A 1APCA 1E85A 3ZQYA 3QW1A 3HNLA 2XLDA 2XLVA 5JS5A 4EIYA 4U9DA 1CGNA 3M4CA 4WGZA 4ULVA 4U9EA 3L1MA 4JEBA 2XL6A 4D4NA 2YLDA 4N4WA 2XLOA 4WGYA 1S05A 2XM0A 4CDYA 3C62A 3QW0A 5JP7A 3IQ6A 3ZTZA 4CDVA 5JLIA 3TOMA 3U8PA 2YLGA 3M79A 5B3IA 3IQ5A 4JKVA 2XL8A 3QVZA 5JUAA 5JRAA 2YL1A 5JVEA 2CCYA 1M6TA 1LM3B 4L6RA 2XLMA 5JT4A 1E84A 2YLIA 1RCPA 2J8WA 4CJGA 1JAFA 4NC3A 1YYJA 3HNIA 1E86A 4IB4A 4D4XA 5JSLA 2YL3A 1E83A 1QPUA 4CJOA 4CDAA 1GQAA 1QQ3A 2YL7A 1MQVA 3QVYA 1CGOA 4N6HA 1YZAA 1YZCA 1CPQA 3ZTMA 2XM4A 3NMJA 3FOOA 3HNKA 3DE9A 3DE8A 2XLEA 1A7VA 1EKYA 1BBHA
chains in the Genus database with same CATH superfamily
1U89A 3RF3A 1VMAA 3WG7C 1MMGA 3K7DA 2W45A 1D0ZA 1IZMA 3WODF 2XL4A 2HV7A 4U5BE 3WAQA 1WASA 1QVXA 3O10A 1T6UA 1FMVA 4MTOA 2HZ8A 4JEAA 3EFOB 2A0UA 4HEAJ 5KYYA 2KQ9A 3EZIA 5BQHA 1QKRA 1VYIA 1I4YA 1SYQA 1ZW2A 2P6VA 2YKZA 2PX0A 2OCCC 3U2MA 3C8ZA 4JURI 1TFOB 1MMAA 2J9UA 3M15A 1AVOB 1Q0KA 4MW3A 1QLEC 1RKCA 2J9BA 3DJUB 5E3CA 2KW3C 5DLJA 3IQCA 3FOPA 4X0RA 3VRCA 2OJQA 4WJ0A 5A6JA 1RJ9A 1YYXA 5BQIA 2D5RB 2QLAA 5CI9A 3S29A 1APCA 5F5HA 1Z63A 4PJJA 2V26A 2XSEA 2VCAA 3AGUA 1FAPB 1R5ID 1OCRC 3AOUA 3IEEA 5DVWA 4MW8A 3V7OA 3DM9B 4YWQA 5HSWA 2ZXPA 1MNEA 2VCCA 3CAXA 3NYJA 2PBEA 5L0CA 1HW1A 2PNOA 4N6CA 2R7QA 1MMNA 4JVSA 4IGGA 3W2WA 4U9DA 3NG1A 2P7VA 4PACA 1T01A 5B1AC 3EGDB 3LUTB 4LERA 3N2ZB 4Z9HA 3MLGA 4NCQA 1ZHZA 1O87A 1LPEA 2OKUA 1Y4CA 2AU5A 4N4WA 2QNLA 3DAFA 5L0FA 1YARO 2XLOA 3LESA 1OQCA 4QI2A 4WGYA 2IYLD 1M57C 3I5QA 4HFFB 4DRHB 1HW2A 1SR2A 1TWGA 3GWNA 4C3EA 3Q7LA 4NTFA 3Q7GA 4PFOA 4BJ6A 2XM0A 3C62A 4ULWA 1WTYA 4EKWA 1Z5ZA 5T3WA 3LS0A 3NDBB 1OCCC 3J06A 2W9YA 5F28E 4E18A 4HFKB 3T6GB 2Y39A 5A69A 1I5NA 3U8PA 3R7CA 3EGXB 4J32B 2RD9A 1Y6DA 3SP1A 3TQOA 2Y3DA 1JR8A 4G78A 1Q0DA 3SEOA 4IJJA 3QVZA 4J7YA 5JUAA 1A41A 4CS8C 1WOLA 3BRJA 5TJ5E 4KNWA 4OIOF 3AG3C 4MVRA 2A68F 2KSFA 2KK1A 3I4UA 4MVZA 3EG9A 4RBNA 3B71A 2XLMA 2Q9BA 2Y69C 4YL3A 5L0GA 5A6BD 1E84A 3ABKC 4P9FA 4CJGA 1G4WR 3EH2A 1JAFA 1V54C 3OA1A 3EZHA 3O55A 2NPUA 2J9WA 3C8GA 1BDJB 4F4BA 2JPUA 2P0NA 2IOQA 4JC7A 4U5EE 3T9OA 3AG1C 1QPUA 3NRHA 4I1OB 2NSGA 3VAYA 2EPKX 4MTFA 1FFTC 4CDAA 3L8IA 4MVUA 4YT8A 1OR3A 2YL7A 4NTBA 3FDQA 3AG4C 4G7ZF 2P1AA 2P61A 1NG1A 3LAYA 4N6HA 4OIRF 5L0IA 4YJWA 3W8HA 1EI7A 1CPQA 3SNHA 1FR0A 2XS8A 1MNDA 5EK0A 1Q0GA 3NMJA 3ZVRA 1YLMA 3HNKA 4C7OA 3ZG1A 3IHUA 4PFPA 1WATA 2VCBA 5DS5A 3SXKA 2R7TA 3ZC4A 2H8AA 2PF4E 2H7VC 2GA0A 4U5HA 1VYKA 2XRHA 1HE9A 1SZIA 2IM8A 3L34A 3S0XA 3JZ0A 4J30B 3PDMP 3S27A 4H4KC 1O5HA 1OXBA 2E87A 2R7UA 1ZHTA 3K33A 1JPJA 1LE4A 4CX9A 3S28A 2X51A 1FNTc 4IAQA 1WWPA 1ZW3A 3UMKA 2DYSC 1OCOC 1A7DA 3M4BA 2LSEA 4ER9A 2PFDA 4YT5A 1LS1A 1NFOA 2Y3HA 5B3SC 3V5ZA 1RKEA 3K66A 4I1MA 3NYMA 3NMIA 1G5ZA 3POVA 4CSAA 2KGOA 4ZLDA 1V4AA 4JW1A 2A1DD 2R03A 4CS9C 1D0XA 1HE1A 2YZSA 5AGFA 1LKXA 2KJGA 3DI5A 4PK4A 5E2QA 1B68A 2A6EF 4FWVA 1A0BA 5KYXA 4YL1A 3JCUQ 2Q3TA 1LIHA 2DGJA 2IXNA 3GODA 3LLKA 3QW1A 1D1AA 1K40A 3S84A 3U0CA 2EPNA 2J7PD 2XLVA 3F46A 4PR9A 2UUIA 4U5DE 4AE4B 3K1IA 2JD3A 1TWHA 1OW8A 3A11A 3C7JA 2FFHA 3IQTA 5FCLA 3M4CA 2LQGA 1V55C 1K05A 3MBGA 2HSQA 3O6XA 4U9EA 1ZHXA 2AWCA 2VB6A 3L1MA 3PCVA 2R7OA 3FMSA 2VASA 2I8BA 2YLDA 3SYNA 3KYIA 4I3MA 4XLNF 3TD7A 3WHNA 4DOZA 4KI2A 3EFOA 3ITFA 1D1BA 2LFFA 2YHSA 3ECSA 3NKDA 3JSEO 2LFDA 2ETSA 2RSEB 3DXJF 3EHMA 3PHF2 1VOMA 4DRJB 2ZXRA 1WN0A 3ZTZA 3JRTA 2PX3A 2H7BA 2OU6A 1QSPA 2EINC 2A0BA 2GDCA 1TFKB 3JYYA 1QZXA 5DQTA 3LS1A 1OR2A 1PD1A 3RQEA 3TOMA 1KU2A 3KMIA 4WABA 3U3FA 4BJ1A 4MVQA 1HMDA 4AL1A 3T6JA 2CNWA 3E70C 1RXQA 5EHHA 3SZRA 5L0HA 5B3IA 4C3BA 2WZGA 2GFHA 2J9VA 4MVMA 4E7ZA 3RVZA 4JIOA 1RMVA 1CGME 4JJGA 5E33A 1LVKA 5HV9A 2PP4A 3AGTA 3EQLF 5JVEA 1DOVA 1F1MA 2MHRA 3DJNB 4BJ5C 4BPMA 4EWCA 1OKKA 1LM3B 4L6RA 1YA7O 3TJ5A 4NTAA 1NFNA 2A6HF 4YL0A 5EGYA 1G8XA 4YT2A 1T5OA 5COFA 4NC3A 2NUPA 2TMVP 1EQ1A 4OIPF 2R9RB 4D4XA 4EBKA 2R7SA 4BEMJ 4KBLA 2YL3A 4CJOA 4Q4ZF 4W8KA 1U0BB 1GQAA 2WB7A 1TQGA 2R05A 2QUPA 3AG2C 3GM1A 2CDQA 1YZAA 3R2PA 2XXAB 4Z9JA 4DVYP 2OEVA 3EHNA 2L6GA 2WVOA 4GEHA 4NY3A 2Q00A 3UNGC 3RW0A 1GGQA 1IW7F 1EA8A 3FOOA 1JMWA 2XLEA 1A7VA 1TR2A 1ZU4A 3H2UA 3HJCA 3C18A 3DAGA 3X2QC 2R25A 3EGXA 1T6IA 1YDIA 4GQHA 3W8IA 2G3VA 4O6MA 1M56C 2R7VA 1TWAA 1ORSC 3NMKA 3LLIA 3KL4A 3GANA 4ONSA 1UFBA 4LDRA 1C03A 5T1DB 3AQBA 1K04A 1VK5A 3NYLA 3U9JA 3ZWIA 4BG0A 4CBEA 2R7XA 1VTMP 4DRIB 3QTHA 3CEXA 4JE9A 4CIPA 4XLPF 1E2XA 1HMOA 4CS8A 3ZIBA 1ST6A 1DOWA 4W8PA 1NLXA 3E9VA 1VLTA 4NQFA 4O7GA 3N0TA 2QE9A 3OEOA 4EUKB 3SXZA 1YJGA 3LNRA 4K1OA 2YVKA 4JCHA 2R7RA 2ICWG 2MWQA 1NBBA 2ZXWC 3FAPB 3EJNA 4XPYA 3ZQVA 3F47A 4PJMA 5DS6A 2Z15A 3KH2A 5KYUB 2HMQA 3VF0A 3C8GD 2FAPB 4U5CE 5COMA 3CQZA 1OW6A 2L7AA 3HNJA 1E85A 2J45A 3UGPA 2Y3BA 4FAPB 3ZQYA 3DZAA 4EHPA 4E17A 2XLDA 1PD0A 2XS1A 4E7SA 3N24A 1H7IA 5DS4A 1L7CA 1VB5A 3T4RA 3GEHA 3CSKA 4C7OB 3G4ZA 2O9XA 1JOGA 1EKYA 2A69F 4EIYA 4MQ9F 4G7HF 1OCZC 2G3KA 4J7TA 1M2VB 4WGZA 4ULVA 1N1CA 1U6HA 1NSGB 1A7EA 3FAJA 1NU9C 3W2VA 4JEBA 3IPMO 4O79A 2AP3A 2HKVA 2XL6A 5CI8A 3VYWA 4D4NA 2L9JA 2WZFA 2L6FA 3FXHA 4IRUA 1TKNA 1OXKA 1M2OA 4JRZA 5T3TA 1PV3A 3M1CB 2BL2A 1BR2A 5K0IA 3QW0A 2WZLA 2Q4FA 2J0XA 1MMDA 1TWCA 1H9GA 1ZHWA 2L81A 2NUTB 1FMWA 3IQ6A 3Q6MA 4MNDA 4Q7CA 5L3VA 5KYWB 2HJMA 5IY5C 3UMHA 1H9TA 4RDAA 2WVNA 2DB4A 2WL8A 2YLGA 4CS9A 3S90A 3M79A 2GAQA 3U8VA 2OJED 2ZXOA 3IQ5A 1AUEA 4QDLA 2QY9A 1T6QA 4KNVA 2XL8A 4P6IC 3U2LA 4MTGA 1BR4A 3V5XA 4DJ9A 1FTSA 1C02A 4A4AA 4OD4A 1YVIA 4FESA 1ORJA 5KYYB 3EPVA 3UMIA 1NZEA 4MS2A 3S9OA 4AE4A 2HS5A 2J46A 3B0VC 4IWBA 4PJLA 4Z9IA 5E3AA 2CCYA 3H65A 2C03A 2YQYA 1M6TA 2AVKA 5JT4A 4M63A 2EPMX 2YLIA 1RCPA 2KC3A 3KYJA 3U3BA 1VLSA 1E86A 1NU7D 2G62A 1XZQA 1C17M 1RJ9B 4OIQF 2DI3A 2NG1A 4OINF 2YEVA 1QQ3A 5COGA 2DYRC 2IXMA 3HTKC 4YK5A 1MQVA 2B0JA 3B9QA 3AQCA 4CS7A 4XEVA 2W4MA 3KPHA 4LLCA 4N06A 1YZCA 2Q7RA 2LK4A 1ORYA 2VH3A 2J0WA 4PJNA 4UDVA 2OG2A 3I5PA 3LNMB 3ZTMA 2EIKC 1D1CA 2B0HA 2EILC 3BEHA 5A6KA 2EPLX 2MYSA 4DXWA 3DE9A 4K0DA 3DE8A 3DKAA 1Z6AA 4XEFA 3X1OA 1BBHA 2F22A 2EPOA 3V5YA 1AEPA 4XEKA 3W4YA 1LS4A 2M64A 4JJFA 3SXYA 2CGEA 3GEIA 3MFNA 1Z7Qc 2CNWD 256BA 2KNHA 2IBFA 3FHDA 3LEVA 3EGDA 4O6YA 1XWJA 3ATPA 3RVYA 1JRAA 1ZYRF 4BJ6C 3RIPA 1S7ZA 4Q5SF 4G0HA 3C63A 3DD7A 4LDQA 2XLWA 1V74B 2OQMA 4HE8D 4BJTA 1KTMA 3DWWA 1CPRA 2HV6A 3GM2A 3ASOC 3JTLO 3TOLA 4B6IA 3NKEA 5AC4A 2UUHA 5D92A 2NUPB 1XZPA 1OKKD 3ABLC 5L0JA 4JZAA 2WVQA 3DMDA 3B0UX 1G4US 4AK9A 3GEEA 2YL0A 4GYTA 4AX2A 4IARA 3MX3A 3G50A 4H54A 4FX5A 3A9CA 2XLHA 4P9TA 2LD6A 4XTKA 3GM3A 1YA9A 2JX0A 4IAOA 1YAUO 2D4UA 3JRMO 1GS9A 2BC5A 5L0DA 4LLEA 2I15A 3RQGA 2YRFA 3HNLA 1GM5A 5FZTA 2LIGA 4JTAB 5L3QA 2YWAA 2GWWA 2EIJC 2KYHA 3AJMA 1Q0MA 2L6HA 3RFYA 2AWYA 3RH3A 2XXAA 5JS5A 1UG7A 1ZHYA 4QI0A 3CZ6A 5GPGB 3TULA 4AL0A 2HJ3A 1L3PA 4JTCB 2M4EA 3EG9B 2H7OA 5A6BA 1CGNA 2BE5F 5BUOA 4ZLCA 3FVYA 3B29A 3MYFA 1ZU5A 3PMRA 3K6BA 1T9KA 4ANJA 1BZ4A 4E0IA 3C8GB 4DVZA 2VC9A 2CW0F 4XQ1A 3VM6A 1OW7A 1R4TA 4YT4A 3T6BA 4KC9A 5AC5A 1BR1A 3GWLA 5BQGA 1LI5A 3HLZA 3U5SA 2Q9AA 3HKKA 1S05A 1HY5A 2HSBA 4U5FE 2HMZA 4XPXA 4CDYA 2EIMC 5B1BC 5CIVA 5JP7A 2V3CC 2R7WA 2HFIA 4JTDB 2Y3GA 4G7OF 1SF8A 1H6GA 3JSZA 3L8JA 3DM5A 4R32A 2HUJA 4CDVA 5JLIA 3JT1A 5DQZA 4DBRA 4CIHA 2FGYA 2LP4A 3LEOA 1SMYF 4YN0B 3EH1A 5KYUA 3L0IA 3RKOF 2QTVA 2X0CA 4MVOA 4LACB 3US6A 3TJ6A 5F5FA 2R02A 3RYLA 1KNYA 3G4XA 4EBJA 5KYNA 4I44A 4XPWA 1LI7A 4JKVA 3OWTA 3RQFA 3K1HA 2IXOA 3UR3C 3Q6NA 1Z23A 1Z3IX 4E0HA 4C3DA 1FFHA 5JRAA 3ABMC 1ZVZA 3MYIA 3ZDLA 2YL1A 1Q0FA 4U5GA 4OD5A 2ZPAA 4XWJA 1WGWA 3SXMA 2IXPA 1I4ZA 4CSAC 2W4BA 3H2VA 3GORA 1RKEB 3QZCA 1M2VA 3ZSUA 3B0PA 2J8WA 1J8YF 1O3UA 4BEJA 1YYJA 3HNIA 4O6NA 4IB4A 2ASRA 4DBQA 3U9MA 5KYXB 5JSLA 1E83A 2LCHA 1JPNA 2CYDA 2Q9CA 4A2NB 3ASNC 2C04A 4LDKA 2OEXA 4MVSA 2ZD9A 3QVYA 1CGOA 1PCXA 3K1IC 1J8MF 3JYHA 3UGOA 1D0YA 2J7PA 3QMKA 2OOCA 3O39A 4EBBA 2NSFA 2NUTA 5KYWA 1W2WA 2XM4A 3TK0A 1ZZPA 4RD9A 5D91A 4BJ5A 3KKBA 4JCZA 4K7BA 5A6AA 3LJBA 1LE2A
chains in the Genus database with same CATH topology
256BA 3NMKA 4CX9A 3ZWIA 4JEAA 3C63A 4IAQA 2XLWA 3M4BA 4CIPA 4JE9A 2YKZA 1CPRA 3TOLA 4ER9A 3M15A 3NMIA 2YL0A 2J9BA 4IARA 1NBBA 5AGFA 3ZQVA 2XLHA 3FOPA 3VRCA 1YYXA 2QLAA 3HNJA 2BC5A 1APCA 1E85A 3ZQYA 3QW1A 3HNLA 2XLDA 2XLVA 5JS5A 4EIYA 4U9DA 1CGNA 3M4CA 4WGZA 4ULVA 4U9EA 3L1MA 4JEBA 2XL6A 4D4NA 2YLDA 4N4WA 2XLOA 4WGYA 1S05A 2XM0A 4CDYA 3C62A 3QW0A 5JP7A 3IQ6A 3ZTZA 4CDVA 5JLIA 3TOMA 3U8PA 2YLGA 3M79A 5B3IA 3IQ5A 4JKVA 2XL8A 3QVZA 5JUAA 5JRAA 2YL1A 5JVEA 2CCYA 1M6TA 1LM3B 4L6RA 2XLMA 5JT4A 1E84A 2YLIA 1RCPA 2J8WA 4CJGA 1JAFA 4NC3A 1YYJA 3HNIA 1E86A 4IB4A 4D4XA 5JSLA 2YL3A 1E83A 1QPUA 4CJOA 4CDAA 1GQAA 1QQ3A 2YL7A 1MQVA 3QVYA 1CGOA 4N6HA 1YZAA 1YZCA 1CPQA 3ZTMA 2XM4A 3NMJA 3FOOA 3HNKA 3DE9A 3DE8A 2XLEA 1A7VA 1EKYA 1BBHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 256B A;  3NMK A;  4CX9 A;  3ZWI A;  4JEA A;  3C63 A;  4IAQ A;  2XLW A;  3M4B A;  4CIP A;  4JE9 A;  2YKZ A;  1CPR A;  3TOL A;  4ER9 A;  3M15 A;  3NMI A;  2YL0 A;  2J9B A;  4IAR A;  1NBB A;  5AGF A;  3ZQV A;  2XLH A;  3FOP A;  3VRC A;  1YYX A;  2QLA A;  3HNJ A;  2BC5 A;  1APC A;  1E85 A;  3ZQY A;  3QW1 A;  3HNL A;  2XLD A;  2XLV A;  5JS5 A;  4EIY A;  4U9D A;  1CGN A;  3M4C A;  4WGZ A;  4ULV A;  4U9E A;  3L1M A;  4JEB A;  2XL6 A;  4D4N A;  2YLD A;  4N4W A;  2XLO A;  4WGY A;  1S05 A;  2XM0 A;  4CDY A;  3C62 A;  3QW0 A;  5JP7 A;  3IQ6 A;  3ZTZ A;  4CDV A;  5JLI A;  3TOM A;  3U8P A;  2YLG A;  3M79 A;  5B3I A;  3IQ5 A;  4JKV A;  2XL8 A;  3QVZ A;  5JUA A;  5JRA A;  2YL1 A;  5JVE A;  2CCY A;  1M6T A;  1LM3 B;  4L6R A;  2XLM A;  5JT4 A;  1E84 A;  2YLI A;  1RCP A;  2J8W A;  4CJG A;  1JAF A;  4NC3 A;  1YYJ A;  3HNI A;  1E86 A;  4IB4 A;  4D4X A;  5JSL A;  2YL3 A;  1E83 A;  1QPU A;  4CJO A;  4CDA A;  1GQA A;  1QQ3 A;  2YL7 A;  1MQV A;  3QVY A;  1CGO A;  4N6H A;  1YZA A;  1YZC A;  1CPQ A;  3ZTM A;  2XM4 A;  3NMJ A;  3FOO A;  3HNK A;  3DE9 A;  3DE8 A;  2XLE A;  1A7V A;  1EKY A;  1BBH A; 
#chains in the Genus database with same CATH topology
 1U89 A;  3RF3 A;  1VMA A;  3WG7 C;  1MMG A;  3K7D A;  2W45 A;  1D0Z A;  1IZM A;  3WOD F;  2XL4 A;  2HV7 A;  4U5B E;  3WAQ A;  1WAS A;  1QVX A;  3O10 A;  1T6U A;  1FMV A;  4MTO A;  2HZ8 A;  4JEA A;  3EFO B;  2A0U A;  4HEA J;  5KYY A;  2KQ9 A;  3EZI A;  5BQH A;  1QKR A;  1VYI A;  1I4Y A;  1SYQ A;  1ZW2 A;  2P6V A;  2YKZ A;  2PX0 A;  2OCC C;  3U2M A;  3C8Z A;  4JUR I;  1TFO B;  1MMA A;  2J9U A;  3M15 A;  1AVO B;  1Q0K A;  4MW3 A;  1QLE C;  1RKC A;  2J9B A;  3DJU B;  5E3C A;  2KW3 C;  5DLJ A;  3IQC A;  3FOP A;  4X0R A;  3VRC A;  2OJQ A;  4WJ0 A;  5A6J A;  1RJ9 A;  1YYX A;  5BQI A;  2D5R B;  2QLA A;  5CI9 A;  3S29 A;  1APC A;  5F5H A;  1Z63 A;  4PJJ A;  2V26 A;  2XSE A;  2VCA A;  3AGU A;  1FAP B;  1R5I D;  1OCR C;  3AOU A;  3IEE A;  5DVW A;  4MW8 A;  3V7O A;  3DM9 B;  4YWQ A;  5HSW A;  2ZXP A;  1MNE A;  2VCC A;  3CAX A;  3NYJ A;  2PBE A;  5L0C A;  1HW1 A;  2PNO A;  4N6C A;  2R7Q A;  1MMN A;  4JVS A;  4IGG A;  3W2W A;  4U9D A;  3NG1 A;  2P7V A;  4PAC A;  1T01 A;  5B1A C;  3EGD B;  3LUT B;  4LER A;  3N2Z B;  4Z9H A;  3MLG A;  4NCQ A;  1ZHZ A;  1O87 A;  1LPE A;  2OKU A;  1Y4C A;  2AU5 A;  4N4W A;  2QNL A;  3DAF A;  5L0F A;  1YAR O;  2XLO A;  3LES A;  1OQC A;  4QI2 A;  4WGY A;  2IYL D;  1M57 C;  3I5Q A;  4HFF B;  4DRH B;  1HW2 A;  1SR2 A;  1TWG A;  3GWN A;  4C3E A;  3Q7L A;  4NTF A;  3Q7G A;  4PFO A;  4BJ6 A;  2XM0 A;  3C62 A;  4ULW A;  1WTY A;  4EKW A;  1Z5Z A;  5T3W A;  3LS0 A;  3NDB B;  1OCC C;  3J06 A;  2W9Y A;  5F28 E;  4E18 A;  4HFK B;  3T6G B;  2Y39 A;  5A69 A;  1I5N A;  3U8P A;  3R7C A;  3EGX B;  4J32 B;  2RD9 A;  1Y6D A;  3SP1 A;  3TQO A;  2Y3D A;  1JR8 A;  4G78 A;  1Q0D A;  3SEO A;  4IJJ A;  3QVZ A;  4J7Y A;  5JUA A;  1A41 A;  4CS8 C;  1WOL A;  3BRJ A;  5TJ5 E;  4KNW A;  4OIO F;  3AG3 C;  4MVR A;  2A68 F;  2KSF A;  2KK1 A;  3I4U A;  4MVZ A;  3EG9 A;  4RBN A;  3B71 A;  2XLM A;  2Q9B A;  2Y69 C;  4YL3 A;  5L0G A;  5A6B D;  1E84 A;  3ABK C;  4P9F A;  4CJG A;  1G4W R;  3EH2 A;  1JAF A;  1V54 C;  3OA1 A;  3EZH A;  3O55 A;  2NPU A;  2J9W A;  3C8G A;  1BDJ B;  4F4B A;  2JPU A;  2P0N A;  2IOQ A;  4JC7 A;  4U5E E;  3T9O A;  3AG1 C;  1QPU A;  3NRH A;  4I1O B;  2NSG A;  3VAY A;  2EPK X;  4MTF A;  1FFT C;  4CDA A;  3L8I A;  4MVU A;  4YT8 A;  1OR3 A;  2YL7 A;  4NTB A;  3FDQ A;  3AG4 C;  4G7Z F;  2P1A A;  2P61 A;  1NG1 A;  3LAY A;  4N6H A;  4OIR F;  5L0I A;  4YJW A;  3W8H A;  1EI7 A;  1CPQ A;  3SNH A;  1FR0 A;  2XS8 A;  1MND A;  5EK0 A;  1Q0G A;  3NMJ A;  3ZVR A;  1YLM A;  3HNK A;  4C7O A;  3ZG1 A;  3IHU A;  4PFP A;  1WAT A;  2VCB A;  5DS5 A;  3SXK A;  2R7T A;  3ZC4 A;  2H8A A;  2PF4 E;  2H7V C;  2GA0 A;  4U5H A;  1VYK A;  2XRH A;  1HE9 A;  1SZI A;  2IM8 A;  3L34 A;  3S0X A;  3JZ0 A;  4J30 B;  3PDM P;  3S27 A;  4H4K C;  1O5H A;  1OXB A;  2E87 A;  2R7U A;  1ZHT A;  3K33 A;  1JPJ A;  1LE4 A;  4CX9 A;  3S28 A;  2X51 A;  1FNT c;  4IAQ A;  1WWP A;  1ZW3 A;  3UMK A;  2DYS C;  1OCO C;  1A7D A;  3M4B A;  2LSE A;  4ER9 A;  2PFD A;  4YT5 A;  1LS1 A;  1NFO A;  2Y3H A;  5B3S C;  3V5Z A;  1RKE A;  3K66 A;  4I1M A;  3NYM A;  3NMI A;  1G5Z A;  3POV A;  4CSA A;  2KGO A;  4ZLD A;  1V4A A;  4JW1 A;  2A1D D;  2R03 A;  4CS9 C;  1D0X A;  1HE1 A;  2YZS A;  5AGF A;  1LKX A;  2KJG A;  3DI5 A;  4PK4 A;  5E2Q A;  1B68 A;  2A6E F;  4FWV A;  1A0B A;  5KYX A;  4YL1 A;  3JCU Q;  2Q3T A;  1LIH A;  2DGJ A;  2IXN A;  3GOD A;  3LLK A;  3QW1 A;  1D1A A;  1K40 A;  3S84 A;  3U0C A;  2EPN A;  2J7P D;  2XLV A;  3F46 A;  4PR9 A;  2UUI A;  4U5D E;  4AE4 B;  3K1I A;  2JD3 A;  1TWH A;  1OW8 A;  3A11 A;  3C7J A;  2FFH A;  3IQT A;  5FCL A;  3M4C A;  2LQG A;  1V55 C;  1K05 A;  3MBG A;  2HSQ A;  3O6X A;  4U9E A;  1ZHX A;  2AWC A;  2VB6 A;  3L1M A;  3PCV A;  2R7O A;  3FMS A;  2VAS A;  2I8B A;  2YLD A;  3SYN A;  3KYI A;  4I3M A;  4XLN F;  3TD7 A;  3WHN A;  4DOZ A;  4KI2 A;  3EFO A;  3ITF A;  1D1B A;  2LFF A;  2YHS A;  3ECS A;  3NKD A;  3JSE O;  2LFD A;  2ETS A;  2RSE B;  3DXJ F;  3EHM A;  3PHF 2;  1VOM A;  4DRJ B;  2ZXR A;  1WN0 A;  3ZTZ A;  3JRT A;  2PX3 A;  2H7B A;  2OU6 A;  1QSP A;  2EIN C;  2A0B A;  2GDC A;  1TFK B;  3JYY A;  1QZX A;  5DQT A;  3LS1 A;  1OR2 A;  1PD1 A;  3RQE A;  3TOM A;  1KU2 A;  3KMI A;  4WAB A;  3U3F A;  4BJ1 A;  4MVQ A;  1HMD A;  4AL1 A;  3T6J A;  2CNW A;  3E70 C;  1RXQ A;  5EHH A;  3SZR A;  5L0H A;  5B3I A;  4C3B A;  2WZG A;  2GFH A;  2J9V A;  4MVM A;  4E7Z A;  3RVZ A;  4JIO A;  1RMV A;  1CGM E;  4JJG A;  5E33 A;  1LVK A;  5HV9 A;  2PP4 A;  3AGT A;  3EQL F;  5JVE A;  1DOV A;  1F1M A;  2MHR A;  3DJN B;  4BJ5 C;  4BPM A;  4EWC A;  1OKK A;  1LM3 B;  4L6R A;  1YA7 O;  3TJ5 A;  4NTA A;  1NFN A;  2A6H F;  4YL0 A;  5EGY A;  1G8X A;  4YT2 A;  1T5O A;  5COF A;  4NC3 A;  2NUP A;  2TMV P;  1EQ1 A;  4OIP F;  2R9R B;  4D4X A;  4EBK A;  2R7S A;  4BEM J;  4KBL A;  2YL3 A;  4CJO A;  4Q4Z F;  4W8K A;  1U0B B;  1GQA A;  2WB7 A;  1TQG A;  2R05 A;  2QUP A;  3AG2 C;  3GM1 A;  2CDQ A;  1YZA A;  3R2P A;  2XXA B;  4Z9J A;  4DVY P;  2OEV A;  3EHN A;  2L6G A;  2WVO A;  4GEH A;  4NY3 A;  2Q00 A;  3UNG C;  3RW0 A;  1GGQ A;  1IW7 F;  1EA8 A;  3FOO A;  1JMW A;  2XLE A;  1A7V A;  1TR2 A;  1ZU4 A;  3H2U A;  3HJC A;  3C18 A;  3DAG A;  3X2Q C;  2R25 A;  3EGX A;  1T6I A;  1YDI A;  4GQH A;  3W8I A;  2G3V A;  4O6M A;  1M56 C;  2R7V A;  1TWA A;  1ORS C;  3NMK A;  3LLI A;  3KL4 A;  3GAN A;  4ONS A;  1UFB A;  4LDR A;  1C03 A;  5T1D B;  3AQB A;  1K04 A;  1VK5 A;  3NYL A;  3U9J A;  3ZWI A;  4BG0 A;  4CBE A;  2R7X A;  1VTM P;  4DRI B;  3QTH A;  3CEX A;  4JE9 A;  4CIP A;  4XLP F;  1E2X A;  1HMO A;  4CS8 A;  3ZIB A;  1ST6 A;  1DOW A;  4W8P A;  1NLX A;  3E9V A;  1VLT A;  4NQF A;  4O7G A;  3N0T A;  2QE9 A;  3OEO A;  4EUK B;  3SXZ A;  1YJG A;  3LNR A;  4K1O A;  2YVK A;  4JCH A;  2R7R A;  2ICW G;  2MWQ A;  1NBB A;  2ZXW C;  3FAP B;  3EJN A;  4XPY A;  3ZQV A;  3F47 A;  4PJM A;  5DS6 A;  2Z15 A;  3KH2 A;  5KYU B;  2HMQ A;  3VF0 A;  3C8G D;  2FAP B;  4U5C E;  5COM A;  3CQZ A;  1OW6 A;  2L7A A;  3HNJ A;  1E85 A;  2J45 A;  3UGP A;  2Y3B A;  4FAP B;  3ZQY A;  3DZA A;  4EHP A;  4E17 A;  2XLD A;  1PD0 A;  2XS1 A;  4E7S A;  3N24 A;  1H7I A;  5DS4 A;  1L7C A;  1VB5 A;  3T4R A;  3GEH A;  3CSK A;  4C7O B;  3G4Z A;  2O9X A;  1JOG A;  1EKY A;  2A69 F;  4EIY A;  4MQ9 F;  4G7H F;  1OCZ C;  2G3K A;  4J7T A;  1M2V B;  4WGZ A;  4ULV A;  1N1C A;  1U6H A;  1NSG B;  1A7E A;  3FAJ A;  1NU9 C;  3W2V A;  4JEB A;  3IPM O;  4O79 A;  2AP3 A;  2HKV A;  2XL6 A;  5CI8 A;  3VYW A;  4D4N A;  2L9J A;  2WZF A;  2L6F A;  3FXH A;  4IRU A;  1TKN A;  1OXK A;  1M2O A;  4JRZ A;  5T3T A;  1PV3 A;  3M1C B;  2BL2 A;  1BR2 A;  5K0I A;  3QW0 A;  2WZL A;  2Q4F A;  2J0X A;  1MMD A;  1TWC A;  1H9G A;  1ZHW A;  2L81 A;  2NUT B;  1FMW A;  3IQ6 A;  3Q6M A;  4MND A;  4Q7C A;  5L3V A;  5KYW B;  2HJM A;  5IY5 C;  3UMH A;  1H9T A;  4RDA A;  2WVN A;  2DB4 A;  2WL8 A;  2YLG A;  4CS9 A;  3S90 A;  3M79 A;  2GAQ A;  3U8V A;  2OJE D;  2ZXO A;  3IQ5 A;  1AUE A;  4QDL A;  2QY9 A;  1T6Q A;  4KNV A;  2XL8 A;  4P6I C;  3U2L A;  4MTG A;  1BR4 A;  3V5X A;  4DJ9 A;  1FTS A;  1C02 A;  4A4A A;  4OD4 A;  1YVI A;  4FES A;  1ORJ A;  5KYY B;  3EPV A;  3UMI A;  1NZE A;  4MS2 A;  3S9O A;  4AE4 A;  2HS5 A;  2J46 A;  3B0V C;  4IWB A;  4PJL A;  4Z9I A;  5E3A A;  2CCY A;  3H65 A;  2C03 A;  2YQY A;  1M6T A;  2AVK A;  5JT4 A;  4M63 A;  2EPM X;  2YLI A;  1RCP A;  2KC3 A;  3KYJ A;  3U3B A;  1VLS A;  1E86 A;  1NU7 D;  2G62 A;  1XZQ A;  1C17 M;  1RJ9 B;  4OIQ F;  2DI3 A;  2NG1 A;  4OIN F;  2YEV A;  1QQ3 A;  5COG A;  2DYR C;  2IXM A;  3HTK C;  4YK5 A;  1MQV A;  2B0J A;  3B9Q A;  3AQC A;  4CS7 A;  4XEV A;  2W4M A;  3KPH A;  4LLC A;  4N06 A;  1YZC A;  2Q7R A;  2LK4 A;  1ORY A;  2VH3 A;  2J0W A;  4PJN A;  4UDV A;  2OG2 A;  3I5P A;  3LNM B;  3ZTM A;  2EIK C;  1D1C A;  2B0H A;  2EIL C;  3BEH A;  5A6K A;  2EPL X;  2MYS A;  4DXW A;  3DE9 A;  4K0D A;  3DE8 A;  3DKA A;  1Z6A A;  4XEF A;  3X1O A;  1BBH A;  2F22 A;  2EPO A;  3V5Y A;  1AEP A;  4XEK A;  3W4Y A;  1LS4 A;  2M64 A;  4JJF A;  3SXY A;  2CGE A;  3GEI A;  3MFN A;  1Z7Q c;  2CNW D;  256B A;  2KNH A;  2IBF A;  3FHD A;  3LEV A;  3EGD A;  4O6Y A;  1XWJ A;  3ATP A;  3RVY A;  1JRA A;  1ZYR F;  4BJ6 C;  3RIP A;  1S7Z A;  4Q5S F;  4G0H A;  3C63 A;  3DD7 A;  4LDQ A;  2XLW A;  1V74 B;  2OQM A;  4HE8 D;  4BJT A;  1KTM A;  3DWW A;  1CPR A;  2HV6 A;  3GM2 A;  3ASO C;  3JTL O;  3TOL A;  4B6I A;  3NKE A;  5AC4 A;  2UUH A;  5D92 A;  2NUP B;  1XZP A;  1OKK D;  3ABL C;  5L0J A;  4JZA A;  2WVQ A;  3DMD A;  3B0U X;  1G4U S;  4AK9 A;  3GEE A;  2YL0 A;  4GYT A;  4AX2 A;  4IAR A;  3MX3 A;  3G50 A;  4H54 A;  4FX5 A;  3A9C A;  2XLH A;  4P9T A;  2LD6 A;  4XTK A;  3GM3 A;  1YA9 A;  2JX0 A;  4IAO A;  1YAU O;  2D4U A;  3JRM O;  1GS9 A;  2BC5 A;  5L0D A;  4LLE A;  2I15 A;  3RQG A;  2YRF A;  3HNL A;  1GM5 A;  5FZT A;  2LIG A;  4JTA B;  5L3Q A;  2YWA A;  2GWW A;  2EIJ C;  2KYH A;  3AJM A;  1Q0M A;  2L6H A;  3RFY A;  2AWY A;  3RH3 A;  2XXA A;  5JS5 A;  1UG7 A;  1ZHY A;  4QI0 A;  3CZ6 A;  5GPG B;  3TUL A;  4AL0 A;  2HJ3 A;  1L3P A;  4JTC B;  2M4E A;  3EG9 B;  2H7O A;  5A6B A;  1CGN A;  2BE5 F;  5BUO A;  4ZLC A;  3FVY A;  3B29 A;  3MYF A;  1ZU5 A;  3PMR A;  3K6B A;  1T9K A;  4ANJ A;  1BZ4 A;  4E0I A;  3C8G B;  4DVZ A;  2VC9 A;  2CW0 F;  4XQ1 A;  3VM6 A;  1OW7 A;  1R4T A;  4YT4 A;  3T6B A;  4KC9 A;  5AC5 A;  1BR1 A;  3GWL A;  5BQG A;  1LI5 A;  3HLZ A;  3U5S A;  2Q9A A;  3HKK A;  1S05 A;  1HY5 A;  2HSB A;  4U5F E;  2HMZ A;  4XPX A;  4CDY A;  2EIM C;  5B1B C;  5CIV A;  5JP7 A;  2V3C C;  2R7W A;  2HFI A;  4JTD B;  2Y3G A;  4G7O F;  1SF8 A;  1H6G A;  3JSZ A;  3L8J A;  3DM5 A;  4R32 A;  2HUJ A;  4CDV A;  5JLI A;  3JT1 A;  5DQZ A;  4DBR A;  4CIH A;  2FGY A;  2LP4 A;  3LEO A;  1SMY F;  4YN0 B;  3EH1 A;  5KYU A;  3L0I A;  3RKO F;  2QTV A;  2X0C A;  4MVO A;  4LAC B;  3US6 A;  3TJ6 A;  5F5F A;  2R02 A;  3RYL A;  1KNY A;  3G4X A;  4EBJ A;  5KYN A;  4I44 A;  4XPW A;  1LI7 A;  4JKV A;  3OWT A;  3RQF A;  3K1H A;  2IXO A;  3UR3 C;  3Q6N A;  1Z23 A;  1Z3I X;  4E0H A;  4C3D A;  1FFH A;  5JRA A;  3ABM C;  1ZVZ A;  3MYI A;  3ZDL A;  2YL1 A;  1Q0F A;  4U5G A;  4OD5 A;  2ZPA A;  4XWJ A;  1WGW A;  3SXM A;  2IXP A;  1I4Z A;  4CSA C;  2W4B A;  3H2V A;  3GOR A;  1RKE B;  3QZC A;  1M2V A;  3ZSU A;  3B0P A;  2J8W A;  1J8Y F;  1O3U A;  4BEJ A;  1YYJ A;  3HNI A;  4O6N A;  4IB4 A;  2ASR A;  4DBQ A;  3U9M A;  5KYX B;  5JSL A;  1E83 A;  2LCH A;  1JPN A;  2CYD A;  2Q9C A;  4A2N B;  3ASN C;  2C04 A;  4LDK A;  2OEX A;  4MVS A;  2ZD9 A;  3QVY A;  1CGO A;  1PCX A;  3K1I C;  1J8M F;  3JYH A;  3UGO A;  1D0Y A;  2J7P A;  3QMK A;  2OOC A;  3O39 A;  4EBB A;  2NSF A;  2NUT A;  5KYW A;  1W2W A;  2XM4 A;  3TK0 A;  1ZZP A;  4RD9 A;  5D91 A;  4BJ5 A;  3KKB A;  4JCZ A;  4K7B A;  5A6A A;  3LJB A;  1LE2 A; 
#chains in the Genus database with same CATH homology
 256B A;  3NMK A;  4CX9 A;  3ZWI A;  4JEA A;  3C63 A;  4IAQ A;  2XLW A;  3M4B A;  4CIP A;  4JE9 A;  2YKZ A;  1CPR A;  3TOL A;  4ER9 A;  3M15 A;  3NMI A;  2YL0 A;  2J9B A;  4IAR A;  1NBB A;  5AGF A;  3ZQV A;  2XLH A;  3FOP A;  3VRC A;  1YYX A;  2QLA A;  3HNJ A;  2BC5 A;  1APC A;  1E85 A;  3ZQY A;  3QW1 A;  3HNL A;  2XLD A;  2XLV A;  5JS5 A;  4EIY A;  4U9D A;  1CGN A;  3M4C A;  4WGZ A;  4ULV A;  4U9E A;  3L1M A;  4JEB A;  2XL6 A;  4D4N A;  2YLD A;  4N4W A;  2XLO A;  4WGY A;  1S05 A;  2XM0 A;  4CDY A;  3C62 A;  3QW0 A;  5JP7 A;  3IQ6 A;  3ZTZ A;  4CDV A;  5JLI A;  3TOM A;  3U8P A;  2YLG A;  3M79 A;  5B3I A;  3IQ5 A;  4JKV A;  2XL8 A;  3QVZ A;  5JUA A;  5JRA A;  2YL1 A;  5JVE A;  2CCY A;  1M6T A;  1LM3 B;  4L6R A;  2XLM A;  5JT4 A;  1E84 A;  2YLI A;  1RCP A;  2J8W A;  4CJG A;  1JAF A;  4NC3 A;  1YYJ A;  3HNI A;  1E86 A;  4IB4 A;  4D4X A;  5JSL A;  2YL3 A;  1E83 A;  1QPU A;  4CJO A;  4CDA A;  1GQA A;  1QQ3 A;  2YL7 A;  1MQV A;  3QVY A;  1CGO A;  4N6H A;  1YZA A;  1YZC A;  1CPQ A;  3ZTM A;  2XM4 A;  3NMJ A;  3FOO A;  3HNK A;  3DE9 A;  3DE8 A;  2XLE A;  1A7V A;  1EKY A;  1BBH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...