1CGNA

Cytochrome c'
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
125
structure length
125
Chain Sequence
EFAKPEDAVKYRQSALTLMASHFGRMAPVVKGQAPYDAAQIKANVEVLKTLTALPWAAFGAGTEGGDARPEIWSDAAGFKQKQQAFQDNIVKLSAAADAGDLDKLRAAFGDVGASCKACHDSYRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Three-dimensional structure of cytochrome c' from two Alcaligenes species and the implications for four-helix bundle structures.
pubmed doi rcsb
source organism Achromobacter xylosoxidans
molecule tags Electron transport (cytochrome)
molecule keywords CYTOCHROME C
total genus 48
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 1995-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01322 Cytochrom_C_2 Cytochrome C'
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 1cgnA00
2YKZA 3TOMA 4CX9A 2XLMA 4N4WA 3NMKA 3U8PA 4D4XA 4U9EA 2XLOA 4CDVA 2J8WA 3M4CA 1RCPA 4L6RA 3DE8A 2YL7A 5JP7A 3ZQVA 3M79A 3VRCA 3C63A 3IQ5A 5AGFA 5JVEA 3ZWIA 1GQAA 3HNKA 1NBBA 1E84A 4ULVA 2XM4A 2BC5A 2YLIA 1CGOA 3QVYA 1YYJA 4D4NA 3QW0A 1CPQA 1APCA 4NC3A 1LM3B 3HNIA 1A7VA 3C62A 2XLEA 1CGNA 3HNLA 2J9BA 4EIYA 2XM0A 1EKYA 256BA 5B3IA 2XLHA 5JLIA 2XL8A 1QQ3A 5JRAA 4JEAA 1S05A 4CJOA 2YL3A 5JSLA 4CDYA 3FOPA 3TOLA 2YLGA 1BBHA 1QPUA 1E83A 4CDAA 1E85A 2XL6A 4JKVA 2YLDA 1MQVA 1YZCA 3NMJA 2XLDA 3M15A 2CCYA 5JUAA 4IARA 3L1MA 4WGZA 1E86A 1CPRA 1JAFA 4WGYA 3DE9A 4N6HA 2XLWA 2QLAA 4JE9A 3IQ6A 3ZQYA 4ER9A 3FOOA 3HNJA 4CIPA 4JEBA 2YL1A 3QVZA 3QW1A 5JS5A 4IB4A 2XLVA 3M4BA 4IAQA 3NMIA 3ZTMA 1YYXA 2YL0A 4CJGA 5JT4A 4U9DA 1YZAA 1M6TA 3ZTZA
chains in the Genus database with same CATH superfamily
3AG3C 2YQYA 2J45A 5A6JA 3ABLC 3AJMA 1Q0FA 2EPMX 1RMVA 3EQLF 4N4WA 1D1CA 1V54C 1NG1A 1JRAA 2AWYA 1ORSC 5K0IA 4CDVA 1C17M 3JCUQ 1S7ZA 4NQFA 4XEVA 1H7IA 2I8BA 2R7TA 1T5OA 2P0NA 3SYNA 4JTDB 2R7UA 3EHMA 3K1HA 3M79A 3VRCA 4W8PA 3CSKA 4NTAA 4MVZA 5COMA 5EGYA 2YEVA 1ZZPA 4DBQA 1OXKA 2Q9BA 5FZTA 3HNKA 2Y3BA 3RVYA 1LI7A 1FAPB 4DXWA 1WTYA 2AWCA 2UUHA 3DAFA 2Y39A 1WGWA 3C8GB 4DBRA 4KI2A 1KTMA 2H8AA 3G4XA 3CZ6A 4QDLA 5BQGA 1YYJA 1ZU4A 3ZIBA 4OINF 4BG0A 2G3VA 4D4NA 4F4BA 4JC7A 5IY5C 3E70C 1C03A 1UG7A 1RKEA 3LJBA 2CNWD 4G7ZF 1BR1A 2EPKX 2VH3A 1XZQA 5A6BD 3EG9B 2BL2A 4Z9HA 1JR8A 1RKEB 3RW0A 1SF8A 3SP1A 4DJ9A 4FESA 3RH3A 2XSEA 3DM9B 4Q5SF 4EIYA 3IHUA 1PV3A 2BE5F 3ECSA 4CS8C 1YA7O 1K40A 1EKYA 3W8IA 2D4UA 1TWHA 5F5FA 1TKNA 4A2NB 1WWPA 2W45A 2R03A 4QI0A 3U5SA 4KBLA 1G4US 3UMIA 3GWNA 1TWGA 2E87A 4LERA 1DOVA 1VK5A 2ZD9A 5DLJA 1QQ3A 1VLTA 3LEVA 4P6IC 3TJ6A 3EH2A 4JCZA 4O7GA 5AC4A 5DS4A 3K6BA 2ETSA 4ANJA 4EUKB 1ZHXA 2HMZA 2LIGA 1Q0MA 5JSLA 4FAPB 2CNWA 3FAPB 1V55C 2HSQA 3SXKA 3ZDLA 1T6QA 1MNEA 4PACA 1TFOB 4J7TA 2W4BA 3RIPA 2UUIA 1MQVA 3A11A 3IPMO 4PJNA 3S84A 3W2WA 4GYTA 4XTKA 3DM5A 4C7OB 1DOWA 2NSFA 4JTCB 3M15A 2FGYA 2YRFA 3C7JA 4PR9A 5L0JA 3SNHA 2WZFA 4M63A 3VAYA 2DYSC 5GPGB 5A6BA 1NLXA 4WGZA 1E86A 3N24A 5A6KA 3NDBB 4O6NA 1QLEC 2P1AA 1W2WA 4B6IA 4LLEA 3EJNA 1FMWA 1ZW2A 2IXNA 2NSGA 3IEEA 1NU9C 3NKEA 4PJMA 3DE9A 1J8MF 4WGYA 3U8VA 1QSPA 4MVOA 3DI5A 4IAOA 4U5CE 3OEOA 4JJFA 3KYJA 1VOMA 1AEPA 4LDKA 3UMKA 3HNJA 3UR3C 1TR2A 3HLZA 1KU2A 3EH1A 3AG4C 2KQ9A 2QTVA 5E3AA 2HMQA 2WVQA 4U5BE 4MQ9F 4U5EE 4MVUA 3GEEA 2CGEA 1D0ZA 1OQCA 2LFFA 4IAQA 2A1DD 1RJ9A 1B68A 3GM3A 5KYYB 2HJ3A 2ICWG 4EHPA 2OCCC 4CJGA 2G3KA 1KNYA 1RJ9B 5JT4A 1YZAA 1FTSA 3LS0A 3CEXA 2Q7RA 4MW8A 1T6UA 3U9MA 2ZXRA 2R7OA 3T9OA 2WVNA 4K7BA 3EFOA 4C3DA 4CS8A 5KYWB 1NFNA 3KPHA 3Q7LA 2J7PD 4MVSA 2J0WA 5BQIA 1SZIA 4EBJA 4G7OF 2DGJA 4X0RA 3FAJA 2A6EF 4JW1A 1OR2A 4EBKA 1I4ZA 3M4CA 4J32B 4NTBA 2X0CA 2J46A 4P9FA 4E7SA 3EZIA 3RKOF 4N6CA 4OIRF 3GORA 2HUJA 4IWBA 5JP7A 5D91A 1Y6DA 3ZQVA 2ZPAA 2IXMA 3ITFA 4PFOA 1A7DA 3LNRA 2XXAA 3W4YA 4E18A 1MMGA 4MTOA 3MX3A 1FR0A 3UGOA 3S28A 1T9KA 5FCLA 3I5PA 3ZWIA 2G62A 2R25A 3O6XA 2NG1A 1E84A 3SXMA 4H54A 2A0BA 4BEMJ 1K04A 3UGPA 4IJJA 1BDJB 4JTAB 1Z23A 2KC3A 4C3EA 1YA9A 2A0UA 5CIVA 4LLCA 3B0VC 1C02A 3LNMB 4BJ5A 4H4KC 3B0PA 3EFOB 4MTGA 1A7VA 2R05A 3C62A 3W2VA 5KYWA 2ZXWC 5DQTA 4ONSA 1MMNA 2WZGA 1BR4A 1OXBA 1AUEA 2J9BA 1YDIA 2MWQA 2PX3A 2XM0A 1YLMA 4XEFA 1JMWA 1QZXA 4DOZA 1YARO 2B0JA 3H2VA 5DS5A 3I4UA 1WASA 2AU5A 2LQGA 3S27A 3DKAA 4PK4A 5B3IA 5KYYA 4Q4ZF 1Y4CA 4BEJA 5JLIA 4JJGA 1H6GA 3GM1A 1LVKA 1YAUO 4LDQA 3GEIA 2LP4A 1SMYF 1M2OA 3GWLA 2GFHA 5JRAA 1Z7Qc 2R7XA 4JEAA 5CI9A 1S05A 2OOCA 3X2QC 2Q3TA 1VYIA 5A6AA 2HJMA 1G4WR 3EG9A 1VTMP 4MVRA 3A9CA 1ST6A 4LDRA 1OW6A 2Y3GA 5L0HA 1RKCA 1Z5ZA 3QTHA 1E85A 4HE8D 4CIHA 3EHNA 3WHNA 1OCRC 4JKVA 1AVOB 2ZXOA 1FFHA 3KH2A 4MNDA 5A69A 2HKVA 4JCHA 4BJ6A 1Z3IX 2VB6A 2XLDA 2OJQA 5JUAA 4Z9IA 1O87A 4IARA 3L1MA 4JIOA 2VCBA 2Q00A 1FFTC 3RFYA 5DVWA 3LLKA 3NG1A 3POVA 3SXZA 4XWJA 2LCHA 1VMAA 3NRHA 3B29A 3N2ZB 4HFFB 2IYLD 3QMKA 4JE9A 5AC5A 3SEOA 3LEOA 3T6BA 2A6HF 2J0XA 1OW8A 2JX0A 2OU6A 3G4ZA 3KMIA 4MVMA 3V7OA 1Q0GA 3KYIA 1IZMA 1M56C 3C8GD 3IQTA 2V26A 3EZHA 4JEBA 4YN0B 2PF4E 3J06A 3QVZA 3NYJA 1GS9A 4OD4A 3WODF 5B3SC 2HSBA 1A7EA 2L6GA 4IB4A 3DWWA 3DJUB 1XWJA 2XLVA 4P9TA 3RF3A 3ZTMA 2TMVP 1VLSA 4IRUA 2L6HA 4JVSA 4XLNF 2FFHA 5E3CA 1TWAA 2NUTA 4AK9A 1LS4A 4XPYA 1MMDA 4YJWA 1OR3A 3TQOA 5L0IA 1M6TA 3ABMC 5F28E 4BJ1A 4OIQF 3ZTZA 4C7OA 3JSEO 4O79A 3C8ZA 3ASOC 2C04A 4I1OB 1N1CA 3EGDB 4I3MA 3K7DA 1V4AA 2OJED 2V3CC 1NFOA 1M2VA 2W9YA 4CX9A 4CS7A 4C3BA 3NMKA 3JT1A 4MTFA 3U8PA 2D5RB 1VB5A 1XZPA 2CDQA 4U9EA 4AL0A 4D4XA 2XLOA 4GQHA 4K0DA 2VC9A 3C8GA 3PMRA 3TD7A 3ZSUA 1HY5A 5CI8A 5COGA 1RCPA 4L6RA 3O10A 3DE8A 1U6HA 2KSFA 3DMDA 3CQZA 4NTFA 3VM6A 1H9TA 2A69F 2YZSA 3C63A 3IQ5A 3K1IC 3DZAA 1GM5A 1HMOA 5AGFA 4J7YA 2VASA 2H7VC 1I5NA 2GA0A 3B71A 4E7ZA 1NBBA 2P6VA 4I1MA 3AOUA 4ULVA 1ZHYA 2Q9AA 4KC9A 2FAPB 3TK0A 3L0IA 3NKDA 2YLIA 1CGOA 3QVYA 1ZW3A 1TQGA 3FVYA 5BQHA 2PBEA 2WZLA 3ASNC 2O9XA 1WATA 2C03A 1M2VB 3QW0A 3NYMA 1A0BA 3AQCA 1APCA 4NC3A 1LM3B 3AGUA 3MBGA 2R7SA 3C18A 2L7AA 5DS6A 2LFDA 1LPEA 2ASRA 1K05A 3B9QA 3HNLA 4DRJB 4ZLCA 4OIPF 4K1OA 1ORYA 4XQ1A 3W8HA 2LSEA 3O39A 4JURI 2X51A 4AX2A 2KNHA 2F22A 2YVKA 1WOLA 2WL8A 3AGTA 3LESA 3I5QA 2YHSA 3WAQA 2XLHA 2IXOA 3T6JA 1LIHA 5COFA 3T6GB 2W4MA 4WJ0A 5KYNA 3KL4A 5KYUA 2P7VA 3ZVRA 2NPUA 1ZYRF 3LAYA 1UFBA 4AE4B 1HW1A 3AG1C 2AVKA 2KJGA 4DVZA 2LK4A 2HFIA 2YL3A 1SYQA 3V5ZA 4O6MA 2AP3A 1RXQA 4CDYA 2R7VA 5L3QA 4R32A 3TOLA 2DYRC 2YLGA 4O6YA 4CBEA 1BBHA 1QPUA 3L8JA 3OA1A 5B1BC 3U2MA 2H7OA 2XL6A 3M1CB 1WN0A 3FMSA 2XL4A 2R02A 1H9GA 1A41A 4G78A 5T3WA 2OEXA 3SZRA 4LACB 4XPWA 2R7RA 1YZCA 3NMJA 3EGXA 4YT8A 1O5HA 1TWCA 1T6IA 1CPRA 1MMAA 4DRIB 2HZ8A 4KNWA 2PX0A 3V5YA 1CGME 4PJJA 2RSEB 3U0CA 5F5HA 3N0TA 3PHF2 3U3BA 1QVXA 2XLWA 4HFKB 4XEKA 2L9JA 3TULA 4A4AA 4U5HA 4NY3A 3ZQYA 4N06A 2RD9A 1LI5A 3TJ5A 4ER9A 1G5ZA 2EINC 3FOOA 4BJ5C 2L6FA 2EPNA 2YL1A 1NZEA 2CW0F 3QZCA 2IM8A 1G8XA 1ZHWA 2P61A 3LUTB 4PJLA 3RVZA 2PFDA 5BUOA 2DB4A 1D0XA 3QW1A 3L34A 1L7CA 3FXHA 3KKBA 1FNTc 4MVQA 1NSGB 2EIJC 1ZU5A 3M4BA 3NMIA 4BPMA 1YYXA 2GWWA 1L3PA 1OCZC 1OCOC 3FHDA 4YT2A 4RBNA 3ATPA 4ZLDA 1IW7F 4YK5A 4U9DA 4G7HF 4HEAJ 1D0YA 4I44A 5L3VA 2OQMA 1ZHZA 1ZVZA 4YL1A 4YT5A 2XS8A 2YKZA 4NCQA 3ZC4A 5L0GA 2R7WA 4AL1A 1E2XA 1FMVA 4OIOF 3TOMA 2HV7A 2XLMA 3MLGA 4Q7CA 1F1MA 2KW3C 2JPUA 4U5FE 4XLPF 2KGOA 4CSAC 2NUPA 3K33A 3AG2C 3DAGA 4IGGA 2J9WA 4J30B 5B1AC 5L0DA 1PD0A 2J8WA 2HV6A 3OWTA 4EBBA 2VCAA 3X1OA 4EWCA 3JYHA 2NUPB 2Y69C 3Q6MA 2HS5A 1LS1A 3LS1A 2EIKC 2YL7A 1Q0KA 1GGQA 5E33A 5TJ5E 3RYLA 3ZG1A 3RQGA 3U9JA 1T01A 3RQFA 3LLIA 5HSWA 1U89A 3IQCA 1J8YF 3JZ0A 4XPXA 2DI3A 3U3FA 2QY9A 2MHRA 5EHHA 2EPLX 2MYSA 5JVEA 3HKKA 3PCVA 1LE4A 1GQAA 1OCCC 3Q7GA 4MS2A 2OG2A 3K1IA 2YWAA 3GM2A 4FX5A 2XM4A 2BC5A 2QUPA 4G0HA 3HJCA 3WG7C 2B0HA 2EIMC 3S90A 1Z63A 2J9UA 3V5XA 3DXJF 1HE1A 4W8KA 4DVYP 5L0CA 3S29A 1CPQA 2WB7A 4JZAA 2ZXPA 3JYYA 3HNIA 4MW3A 2XLEA 5KYXA 1CGNA 2KK1A 4AE4A 3F46A 4U5DE 4JRZA 2QNLA 4KNVA 1OKKD 2IOQA 4UDVA 1JPNA 3BRJA 2GDCA 3T4RA 4OD5A 1R5ID 256BA 5D92A 5L0FA 3B0UX 3VYWA 1HMDA 3NYLA 4CS9A 5T1DB 5HV9A 4YWQA 4QI2A 2EPOA 2PP4A 3GANA 4ULWA 1M57C 1PCXA 4CS9C 1D1AA 1MNDA 2WVOA 2XL8A 4EKWA 2IBFA 2VCCA 4RD9A 1V74B 1ZHTA 4BJ6C 2J9VA 1NU7D 1JPJA 3SXYA 1YVIA 2Q9CA 1HE9A 3Q6NA 3MFNA 3G50A 4CJOA 3R2PA 3FOPA 4CSAA 3BEHA 1ORJA 3UNGC 4U5GA 1QKRA 3JRMO 1E83A 4CDAA 4YL0A 3R7CA 1EI7A 2KYHA 2LD6A 1HW2A 3ABKC 5KYXB 2YLDA 1TFKB 1Z6AA 3H65A 3UMHA 1SR2A 1O3UA 2R9RB 3EGXB 4E0IA 4GEHA 3S0XA 4PFPA 2CCYA 3E9VA 2QE9A 1VYKA 2Y3HA 2L81A 3VF0A 3JTLO 3HTKC 5KYUB 3GEHA 1D1BA 3GODA 3RQEA 1BZ4A 3L8IA 1JAFA 2OKUA 4N6HA 4RDAA 1JOGA 1OKKA 2H7BA 3EPVA 1EA8A 5EK0A 2QLAA 1Q0DA 3MYIA 2A68F 3IQ6A 2R7QA 2NUTB 5DQZA 3H2UA 3US6A 2GAQA 1R4TA 2OEVA 4WABA 3S9OA 1U0BB 2Z15A 2PNOA 4FWVA 3O55A 3K66A 2I15A 4CIPA 3FDQA 3MYFA 2J7PA 2XS1A 3JRTA 4YT4A 3EGDA 5T3TA 3DJNB 3PDMP 1PD1A 4Z9JA 5JS5A 2XRHA 4BJTA 1LKXA 4DRHB 1LE2A 2EILC 2M4EA 2Q4FA 3F47A 3DD7A 2IXPA 3JSZA 2CYDA 3AQBA 1I4YA 1OW7A 1BR2A 2Y3DA 2YL0A 2XXAB 4E17A 1EQ1A 1YJGA 3CAXA 4E0HA 5E2QA 4YL3A 2M64A 3U2LA 2JD3A
chains in the Genus database with same CATH topology
2YKZA 3TOMA 4CX9A 2XLMA 4N4WA 3NMKA 3U8PA 4D4XA 4U9EA 2XLOA 4CDVA 2J8WA 3M4CA 1RCPA 4L6RA 3DE8A 2YL7A 5JP7A 3ZQVA 3M79A 3VRCA 3C63A 3IQ5A 5AGFA 5JVEA 3ZWIA 1GQAA 3HNKA 1NBBA 1E84A 4ULVA 2XM4A 2BC5A 2YLIA 1CGOA 3QVYA 1YYJA 4D4NA 3QW0A 1CPQA 1APCA 4NC3A 1LM3B 3HNIA 1A7VA 3C62A 2XLEA 1CGNA 3HNLA 2J9BA 4EIYA 2XM0A 1EKYA 256BA 5B3IA 2XLHA 5JLIA 2XL8A 1QQ3A 5JRAA 4JEAA 1S05A 4CJOA 2YL3A 5JSLA 4CDYA 3FOPA 3TOLA 2YLGA 1BBHA 1QPUA 1E83A 4CDAA 1E85A 2XL6A 4JKVA 2YLDA 1MQVA 1YZCA 3NMJA 2XLDA 3M15A 2CCYA 5JUAA 4IARA 3L1MA 4WGZA 1E86A 1CPRA 1JAFA 4WGYA 3DE9A 4N6HA 2XLWA 2QLAA 4JE9A 3IQ6A 3ZQYA 4ER9A 3FOOA 3HNJA 4CIPA 4JEBA 2YL1A 3QVZA 3QW1A 5JS5A 4IB4A 2XLVA 3M4BA 4IAQA 3NMIA 3ZTMA 1YYXA 2YL0A 4CJGA 5JT4A 4U9DA 1YZAA 1M6TA 3ZTZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YKZ A;  3TOM A;  4CX9 A;  2XLM A;  4N4W A;  3NMK A;  3U8P A;  4D4X A;  4U9E A;  2XLO A;  4CDV A;  2J8W A;  3M4C A;  1RCP A;  4L6R A;  3DE8 A;  2YL7 A;  5JP7 A;  3ZQV A;  3M79 A;  3VRC A;  3C63 A;  3IQ5 A;  5AGF A;  5JVE A;  3ZWI A;  1GQA A;  3HNK A;  1NBB A;  1E84 A;  4ULV A;  2XM4 A;  2BC5 A;  2YLI A;  1CGO A;  3QVY A;  1YYJ A;  4D4N A;  3QW0 A;  1CPQ A;  1APC A;  4NC3 A;  1LM3 B;  3HNI A;  1A7V A;  3C62 A;  2XLE A;  1CGN A;  3HNL A;  2J9B A;  4EIY A;  2XM0 A;  1EKY A;  256B A;  5B3I A;  2XLH A;  5JLI A;  2XL8 A;  1QQ3 A;  5JRA A;  4JEA A;  1S05 A;  4CJO A;  2YL3 A;  5JSL A;  4CDY A;  3FOP A;  3TOL A;  2YLG A;  1BBH A;  1QPU A;  1E83 A;  4CDA A;  1E85 A;  2XL6 A;  4JKV A;  2YLD A;  1MQV A;  1YZC A;  3NMJ A;  2XLD A;  3M15 A;  2CCY A;  5JUA A;  4IAR A;  3L1M A;  4WGZ A;  1E86 A;  1CPR A;  1JAF A;  4WGY A;  3DE9 A;  4N6H A;  2XLW A;  2QLA A;  4JE9 A;  3IQ6 A;  3ZQY A;  4ER9 A;  3FOO A;  3HNJ A;  4CIP A;  4JEB A;  2YL1 A;  3QVZ A;  3QW1 A;  5JS5 A;  4IB4 A;  2XLV A;  3M4B A;  4IAQ A;  3NMI A;  3ZTM A;  1YYX A;  2YL0 A;  4CJG A;  5JT4 A;  4U9D A;  1YZA A;  1M6T A;  3ZTZ A; 
#chains in the Genus database with same CATH topology
 3AG3 C;  2YQY A;  2J45 A;  5A6J A;  3ABL C;  3AJM A;  1Q0F A;  2EPM X;  1RMV A;  3EQL F;  4N4W A;  1D1C A;  1V54 C;  1NG1 A;  1JRA A;  2AWY A;  1ORS C;  5K0I A;  4CDV A;  1C17 M;  3JCU Q;  1S7Z A;  4NQF A;  4XEV A;  1H7I A;  2I8B A;  2R7T A;  1T5O A;  2P0N A;  3SYN A;  4JTD B;  2R7U A;  3EHM A;  3K1H A;  3M79 A;  3VRC A;  4W8P A;  3CSK A;  4NTA A;  4MVZ A;  5COM A;  5EGY A;  2YEV A;  1ZZP A;  4DBQ A;  1OXK A;  2Q9B A;  5FZT A;  3HNK A;  2Y3B A;  3RVY A;  1LI7 A;  1FAP B;  4DXW A;  1WTY A;  2AWC A;  2UUH A;  3DAF A;  2Y39 A;  1WGW A;  3C8G B;  4DBR A;  4KI2 A;  1KTM A;  2H8A A;  3G4X A;  3CZ6 A;  4QDL A;  5BQG A;  1YYJ A;  1ZU4 A;  3ZIB A;  4OIN F;  4BG0 A;  2G3V A;  4D4N A;  4F4B A;  4JC7 A;  5IY5 C;  3E70 C;  1C03 A;  1UG7 A;  1RKE A;  3LJB A;  2CNW D;  4G7Z F;  1BR1 A;  2EPK X;  2VH3 A;  1XZQ A;  5A6B D;  3EG9 B;  2BL2 A;  4Z9H A;  1JR8 A;  1RKE B;  3RW0 A;  1SF8 A;  3SP1 A;  4DJ9 A;  4FES A;  3RH3 A;  2XSE A;  3DM9 B;  4Q5S F;  4EIY A;  3IHU A;  1PV3 A;  2BE5 F;  3ECS A;  4CS8 C;  1YA7 O;  1K40 A;  1EKY A;  3W8I A;  2D4U A;  1TWH A;  5F5F A;  1TKN A;  4A2N B;  1WWP A;  2W45 A;  2R03 A;  4QI0 A;  3U5S A;  4KBL A;  1G4U S;  3UMI A;  3GWN A;  1TWG A;  2E87 A;  4LER A;  1DOV A;  1VK5 A;  2ZD9 A;  5DLJ A;  1QQ3 A;  1VLT A;  3LEV A;  4P6I C;  3TJ6 A;  3EH2 A;  4JCZ A;  4O7G A;  5AC4 A;  5DS4 A;  3K6B A;  2ETS A;  4ANJ A;  4EUK B;  1ZHX A;  2HMZ A;  2LIG A;  1Q0M A;  5JSL A;  4FAP B;  2CNW A;  3FAP B;  1V55 C;  2HSQ A;  3SXK A;  3ZDL A;  1T6Q A;  1MNE A;  4PAC A;  1TFO B;  4J7T A;  2W4B A;  3RIP A;  2UUI A;  1MQV A;  3A11 A;  3IPM O;  4PJN A;  3S84 A;  3W2W A;  4GYT A;  4XTK A;  3DM5 A;  4C7O B;  1DOW A;  2NSF A;  4JTC B;  3M15 A;  2FGY A;  2YRF A;  3C7J A;  4PR9 A;  5L0J A;  3SNH A;  2WZF A;  4M63 A;  3VAY A;  2DYS C;  5GPG B;  5A6B A;  1NLX A;  4WGZ A;  1E86 A;  3N24 A;  5A6K A;  3NDB B;  4O6N A;  1QLE C;  2P1A A;  1W2W A;  4B6I A;  4LLE A;  3EJN A;  1FMW A;  1ZW2 A;  2IXN A;  2NSG A;  3IEE A;  1NU9 C;  3NKE A;  4PJM A;  3DE9 A;  1J8M F;  4WGY A;  3U8V A;  1QSP A;  4MVO A;  3DI5 A;  4IAO A;  4U5C E;  3OEO A;  4JJF A;  3KYJ A;  1VOM A;  1AEP A;  4LDK A;  3UMK A;  3HNJ A;  3UR3 C;  1TR2 A;  3HLZ A;  1KU2 A;  3EH1 A;  3AG4 C;  2KQ9 A;  2QTV A;  5E3A A;  2HMQ A;  2WVQ A;  4U5B E;  4MQ9 F;  4U5E E;  4MVU A;  3GEE A;  2CGE A;  1D0Z A;  1OQC A;  2LFF A;  4IAQ A;  2A1D D;  1RJ9 A;  1B68 A;  3GM3 A;  5KYY B;  2HJ3 A;  2ICW G;  4EHP A;  2OCC C;  4CJG A;  2G3K A;  1KNY A;  1RJ9 B;  5JT4 A;  1YZA A;  1FTS A;  3LS0 A;  3CEX A;  2Q7R A;  4MW8 A;  1T6U A;  3U9M A;  2ZXR A;  2R7O A;  3T9O A;  2WVN A;  4K7B A;  3EFO A;  4C3D A;  4CS8 A;  5KYW B;  1NFN A;  3KPH A;  3Q7L A;  2J7P D;  4MVS A;  2J0W A;  5BQI A;  1SZI A;  4EBJ A;  4G7O F;  2DGJ A;  4X0R A;  3FAJ A;  2A6E F;  4JW1 A;  1OR2 A;  4EBK A;  1I4Z A;  3M4C A;  4J32 B;  4NTB A;  2X0C A;  2J46 A;  4P9F A;  4E7S A;  3EZI A;  3RKO F;  4N6C A;  4OIR F;  3GOR A;  2HUJ A;  4IWB A;  5JP7 A;  5D91 A;  1Y6D A;  3ZQV A;  2ZPA A;  2IXM A;  3ITF A;  4PFO A;  1A7D A;  3LNR A;  2XXA A;  3W4Y A;  4E18 A;  1MMG A;  4MTO A;  3MX3 A;  1FR0 A;  3UGO A;  3S28 A;  1T9K A;  5FCL A;  3I5P A;  3ZWI A;  2G62 A;  2R25 A;  3O6X A;  2NG1 A;  1E84 A;  3SXM A;  4H54 A;  2A0B A;  4BEM J;  1K04 A;  3UGP A;  4IJJ A;  1BDJ B;  4JTA B;  1Z23 A;  2KC3 A;  4C3E A;  1YA9 A;  2A0U A;  5CIV A;  4LLC A;  3B0V C;  1C02 A;  3LNM B;  4BJ5 A;  4H4K C;  3B0P A;  3EFO B;  4MTG A;  1A7V A;  2R05 A;  3C62 A;  3W2V A;  5KYW A;  2ZXW C;  5DQT A;  4ONS A;  1MMN A;  2WZG A;  1BR4 A;  1OXB A;  1AUE A;  2J9B A;  1YDI A;  2MWQ A;  2PX3 A;  2XM0 A;  1YLM A;  4XEF A;  1JMW A;  1QZX A;  4DOZ A;  1YAR O;  2B0J A;  3H2V A;  5DS5 A;  3I4U A;  1WAS A;  2AU5 A;  2LQG A;  3S27 A;  3DKA A;  4PK4 A;  5B3I A;  5KYY A;  4Q4Z F;  1Y4C A;  4BEJ A;  5JLI A;  4JJG A;  1H6G A;  3GM1 A;  1LVK A;  1YAU O;  4LDQ A;  3GEI A;  2LP4 A;  1SMY F;  1M2O A;  3GWL A;  2GFH A;  5JRA A;  1Z7Q c;  2R7X A;  4JEA A;  5CI9 A;  1S05 A;  2OOC A;  3X2Q C;  2Q3T A;  1VYI A;  5A6A A;  2HJM A;  1G4W R;  3EG9 A;  1VTM P;  4MVR A;  3A9C A;  1ST6 A;  4LDR A;  1OW6 A;  2Y3G A;  5L0H A;  1RKC A;  1Z5Z A;  3QTH A;  1E85 A;  4HE8 D;  4CIH A;  3EHN A;  3WHN A;  1OCR C;  4JKV A;  1AVO B;  2ZXO A;  1FFH A;  3KH2 A;  4MND A;  5A69 A;  2HKV A;  4JCH A;  4BJ6 A;  1Z3I X;  2VB6 A;  2XLD A;  2OJQ A;  5JUA A;  4Z9I A;  1O87 A;  4IAR A;  3L1M A;  4JIO A;  2VCB A;  2Q00 A;  1FFT C;  3RFY A;  5DVW A;  3LLK A;  3NG1 A;  3POV A;  3SXZ A;  4XWJ A;  2LCH A;  1VMA A;  3NRH A;  3B29 A;  3N2Z B;  4HFF B;  2IYL D;  3QMK A;  4JE9 A;  5AC5 A;  3SEO A;  3LEO A;  3T6B A;  2A6H F;  2J0X A;  1OW8 A;  2JX0 A;  2OU6 A;  3G4Z A;  3KMI A;  4MVM A;  3V7O A;  1Q0G A;  3KYI A;  1IZM A;  1M56 C;  3C8G D;  3IQT A;  2V26 A;  3EZH A;  4JEB A;  4YN0 B;  2PF4 E;  3J06 A;  3QVZ A;  3NYJ A;  1GS9 A;  4OD4 A;  3WOD F;  5B3S C;  2HSB A;  1A7E A;  2L6G A;  4IB4 A;  3DWW A;  3DJU B;  1XWJ A;  2XLV A;  4P9T A;  3RF3 A;  3ZTM A;  2TMV P;  1VLS A;  4IRU A;  2L6H A;  4JVS A;  4XLN F;  2FFH A;  5E3C A;  1TWA A;  2NUT A;  4AK9 A;  1LS4 A;  4XPY A;  1MMD A;  4YJW A;  1OR3 A;  3TQO A;  5L0I A;  1M6T A;  3ABM C;  5F28 E;  4BJ1 A;  4OIQ F;  3ZTZ A;  4C7O A;  3JSE O;  4O79 A;  3C8Z A;  3ASO C;  2C04 A;  4I1O B;  1N1C A;  3EGD B;  4I3M A;  3K7D A;  1V4A A;  2OJE D;  2V3C C;  1NFO A;  1M2V A;  2W9Y A;  4CX9 A;  4CS7 A;  4C3B A;  3NMK A;  3JT1 A;  4MTF A;  3U8P A;  2D5R B;  1VB5 A;  1XZP A;  2CDQ A;  4U9E A;  4AL0 A;  4D4X A;  2XLO A;  4GQH A;  4K0D A;  2VC9 A;  3C8G A;  3PMR A;  3TD7 A;  3ZSU A;  1HY5 A;  5CI8 A;  5COG A;  1RCP A;  4L6R A;  3O10 A;  3DE8 A;  1U6H A;  2KSF A;  3DMD A;  3CQZ A;  4NTF A;  3VM6 A;  1H9T A;  2A69 F;  2YZS A;  3C63 A;  3IQ5 A;  3K1I C;  3DZA A;  1GM5 A;  1HMO A;  5AGF A;  4J7Y A;  2VAS A;  2H7V C;  1I5N A;  2GA0 A;  3B71 A;  4E7Z A;  1NBB A;  2P6V A;  4I1M A;  3AOU A;  4ULV A;  1ZHY A;  2Q9A A;  4KC9 A;  2FAP B;  3TK0 A;  3L0I A;  3NKD A;  2YLI A;  1CGO A;  3QVY A;  1ZW3 A;  1TQG A;  3FVY A;  5BQH A;  2PBE A;  2WZL A;  3ASN C;  2O9X A;  1WAT A;  2C03 A;  1M2V B;  3QW0 A;  3NYM A;  1A0B A;  3AQC A;  1APC A;  4NC3 A;  1LM3 B;  3AGU A;  3MBG A;  2R7S A;  3C18 A;  2L7A A;  5DS6 A;  2LFD A;  1LPE A;  2ASR A;  1K05 A;  3B9Q A;  3HNL A;  4DRJ B;  4ZLC A;  4OIP F;  4K1O A;  1ORY A;  4XQ1 A;  3W8H A;  2LSE A;  3O39 A;  4JUR I;  2X51 A;  4AX2 A;  2KNH A;  2F22 A;  2YVK A;  1WOL A;  2WL8 A;  3AGT A;  3LES A;  3I5Q A;  2YHS A;  3WAQ A;  2XLH A;  2IXO A;  3T6J A;  1LIH A;  5COF A;  3T6G B;  2W4M A;  4WJ0 A;  5KYN A;  3KL4 A;  5KYU A;  2P7V A;  3ZVR A;  2NPU A;  1ZYR F;  3LAY A;  1UFB A;  4AE4 B;  1HW1 A;  3AG1 C;  2AVK A;  2KJG A;  4DVZ A;  2LK4 A;  2HFI A;  2YL3 A;  1SYQ A;  3V5Z A;  4O6M A;  2AP3 A;  1RXQ A;  4CDY A;  2R7V A;  5L3Q A;  4R32 A;  3TOL A;  2DYR C;  2YLG A;  4O6Y A;  4CBE A;  1BBH A;  1QPU A;  3L8J A;  3OA1 A;  5B1B C;  3U2M A;  2H7O A;  2XL6 A;  3M1C B;  1WN0 A;  3FMS A;  2XL4 A;  2R02 A;  1H9G A;  1A41 A;  4G78 A;  5T3W A;  2OEX A;  3SZR A;  4LAC B;  4XPW A;  2R7R A;  1YZC A;  3NMJ A;  3EGX A;  4YT8 A;  1O5H A;  1TWC A;  1T6I A;  1CPR A;  1MMA A;  4DRI B;  2HZ8 A;  4KNW A;  2PX0 A;  3V5Y A;  1CGM E;  4PJJ A;  2RSE B;  3U0C A;  5F5H A;  3N0T A;  3PHF 2;  3U3B A;  1QVX A;  2XLW A;  4HFK B;  4XEK A;  2L9J A;  3TUL A;  4A4A A;  4U5H A;  4NY3 A;  3ZQY A;  4N06 A;  2RD9 A;  1LI5 A;  3TJ5 A;  4ER9 A;  1G5Z A;  2EIN C;  3FOO A;  4BJ5 C;  2L6F A;  2EPN A;  2YL1 A;  1NZE A;  2CW0 F;  3QZC A;  2IM8 A;  1G8X A;  1ZHW A;  2P61 A;  3LUT B;  4PJL A;  3RVZ A;  2PFD A;  5BUO A;  2DB4 A;  1D0X A;  3QW1 A;  3L34 A;  1L7C A;  3FXH A;  3KKB A;  1FNT c;  4MVQ A;  1NSG B;  2EIJ C;  1ZU5 A;  3M4B A;  3NMI A;  4BPM A;  1YYX A;  2GWW A;  1L3P A;  1OCZ C;  1OCO C;  3FHD A;  4YT2 A;  4RBN A;  3ATP A;  4ZLD A;  1IW7 F;  4YK5 A;  4U9D A;  4G7H F;  4HEA J;  1D0Y A;  4I44 A;  5L3V A;  2OQM A;  1ZHZ A;  1ZVZ A;  4YL1 A;  4YT5 A;  2XS8 A;  2YKZ A;  4NCQ A;  3ZC4 A;  5L0G A;  2R7W A;  4AL1 A;  1E2X A;  1FMV A;  4OIO F;  3TOM A;  2HV7 A;  2XLM A;  3MLG A;  4Q7C A;  1F1M A;  2KW3 C;  2JPU A;  4U5F E;  4XLP F;  2KGO A;  4CSA C;  2NUP A;  3K33 A;  3AG2 C;  3DAG A;  4IGG A;  2J9W A;  4J30 B;  5B1A C;  5L0D A;  1PD0 A;  2J8W A;  2HV6 A;  3OWT A;  4EBB A;  2VCA A;  3X1O A;  4EWC A;  3JYH A;  2NUP B;  2Y69 C;  3Q6M A;  2HS5 A;  1LS1 A;  3LS1 A;  2EIK C;  2YL7 A;  1Q0K A;  1GGQ A;  5E33 A;  5TJ5 E;  3RYL A;  3ZG1 A;  3RQG A;  3U9J A;  1T01 A;  3RQF A;  3LLI A;  5HSW A;  1U89 A;  3IQC A;  1J8Y F;  3JZ0 A;  4XPX A;  2DI3 A;  3U3F A;  2QY9 A;  2MHR A;  5EHH A;  2EPL X;  2MYS A;  5JVE A;  3HKK A;  3PCV A;  1LE4 A;  1GQA A;  1OCC C;  3Q7G A;  4MS2 A;  2OG2 A;  3K1I A;  2YWA A;  3GM2 A;  4FX5 A;  2XM4 A;  2BC5 A;  2QUP A;  4G0H A;  3HJC A;  3WG7 C;  2B0H A;  2EIM C;  3S90 A;  1Z63 A;  2J9U A;  3V5X A;  3DXJ F;  1HE1 A;  4W8K A;  4DVY P;  5L0C A;  3S29 A;  1CPQ A;  2WB7 A;  4JZA A;  2ZXP A;  3JYY A;  3HNI A;  4MW3 A;  2XLE A;  5KYX A;  1CGN A;  2KK1 A;  4AE4 A;  3F46 A;  4U5D E;  4JRZ A;  2QNL A;  4KNV A;  1OKK D;  2IOQ A;  4UDV A;  1JPN A;  3BRJ A;  2GDC A;  3T4R A;  4OD5 A;  1R5I D;  256B A;  5D92 A;  5L0F A;  3B0U X;  3VYW A;  1HMD A;  3NYL A;  4CS9 A;  5T1D B;  5HV9 A;  4YWQ A;  4QI2 A;  2EPO A;  2PP4 A;  3GAN A;  4ULW A;  1M57 C;  1PCX A;  4CS9 C;  1D1A A;  1MND A;  2WVO A;  2XL8 A;  4EKW A;  2IBF A;  2VCC A;  4RD9 A;  1V74 B;  1ZHT A;  4BJ6 C;  2J9V A;  1NU7 D;  1JPJ A;  3SXY A;  1YVI A;  2Q9C A;  1HE9 A;  3Q6N A;  3MFN A;  3G50 A;  4CJO A;  3R2P A;  3FOP A;  4CSA A;  3BEH A;  1ORJ A;  3UNG C;  4U5G A;  1QKR A;  3JRM O;  1E83 A;  4CDA A;  4YL0 A;  3R7C A;  1EI7 A;  2KYH A;  2LD6 A;  1HW2 A;  3ABK C;  5KYX B;  2YLD A;  1TFK B;  1Z6A A;  3H65 A;  3UMH A;  1SR2 A;  1O3U A;  2R9R B;  3EGX B;  4E0I A;  4GEH A;  3S0X A;  4PFP A;  2CCY A;  3E9V A;  2QE9 A;  1VYK A;  2Y3H A;  2L81 A;  3VF0 A;  3JTL O;  3HTK C;  5KYU B;  3GEH A;  1D1B A;  3GOD A;  3RQE A;  1BZ4 A;  3L8I A;  1JAF A;  2OKU A;  4N6H A;  4RDA A;  1JOG A;  1OKK A;  2H7B A;  3EPV A;  1EA8 A;  5EK0 A;  2QLA A;  1Q0D A;  3MYI A;  2A68 F;  3IQ6 A;  2R7Q A;  2NUT B;  5DQZ A;  3H2U A;  3US6 A;  2GAQ A;  1R4T A;  2OEV A;  4WAB A;  3S9O A;  1U0B B;  2Z15 A;  2PNO A;  4FWV A;  3O55 A;  3K66 A;  2I15 A;  4CIP A;  3FDQ A;  3MYF A;  2J7P A;  2XS1 A;  3JRT A;  4YT4 A;  3EGD A;  5T3T A;  3DJN B;  3PDM P;  1PD1 A;  4Z9J A;  5JS5 A;  2XRH A;  4BJT A;  1LKX A;  4DRH B;  1LE2 A;  2EIL C;  2M4E A;  2Q4F A;  3F47 A;  3DD7 A;  2IXP A;  3JSZ A;  2CYD A;  3AQB A;  1I4Y A;  1OW7 A;  1BR2 A;  2Y3D A;  2YL0 A;  2XXA B;  4E17 A;  1EQ1 A;  1YJG A;  3CAX A;  4E0H A;  5E2Q A;  4YL3 A;  2M64 A;  3U2L A;  2JD3 A; 
#chains in the Genus database with same CATH homology
 2YKZ A;  3TOM A;  4CX9 A;  2XLM A;  4N4W A;  3NMK A;  3U8P A;  4D4X A;  4U9E A;  2XLO A;  4CDV A;  2J8W A;  3M4C A;  1RCP A;  4L6R A;  3DE8 A;  2YL7 A;  5JP7 A;  3ZQV A;  3M79 A;  3VRC A;  3C63 A;  3IQ5 A;  5AGF A;  5JVE A;  3ZWI A;  1GQA A;  3HNK A;  1NBB A;  1E84 A;  4ULV A;  2XM4 A;  2BC5 A;  2YLI A;  1CGO A;  3QVY A;  1YYJ A;  4D4N A;  3QW0 A;  1CPQ A;  1APC A;  4NC3 A;  1LM3 B;  3HNI A;  1A7V A;  3C62 A;  2XLE A;  1CGN A;  3HNL A;  2J9B A;  4EIY A;  2XM0 A;  1EKY A;  256B A;  5B3I A;  2XLH A;  5JLI A;  2XL8 A;  1QQ3 A;  5JRA A;  4JEA A;  1S05 A;  4CJO A;  2YL3 A;  5JSL A;  4CDY A;  3FOP A;  3TOL A;  2YLG A;  1BBH A;  1QPU A;  1E83 A;  4CDA A;  1E85 A;  2XL6 A;  4JKV A;  2YLD A;  1MQV A;  1YZC A;  3NMJ A;  2XLD A;  3M15 A;  2CCY A;  5JUA A;  4IAR A;  3L1M A;  4WGZ A;  1E86 A;  1CPR A;  1JAF A;  4WGY A;  3DE9 A;  4N6H A;  2XLW A;  2QLA A;  4JE9 A;  3IQ6 A;  3ZQY A;  4ER9 A;  3FOO A;  3HNJ A;  4CIP A;  4JEB A;  2YL1 A;  3QVZ A;  3QW1 A;  5JS5 A;  4IB4 A;  2XLV A;  3M4B A;  4IAQ A;  3NMI A;  3ZTM A;  1YYX A;  2YL0 A;  4CJG A;  5JT4 A;  4U9D A;  1YZA A;  1M6T A;  3ZTZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...