1CGNA

Cytochrome c'
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
125
structure length
125
Chain Sequence
EFAKPEDAVKYRQSALTLMASHFGRMAPVVKGQAPYDAAQIKANVEVLKTLTALPWAAFGAGTEGGDARPEIWSDAAGFKQKQQAFQDNIVKLSAAADAGDLDKLRAAFGDVGASCKACHDSYRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport (cytochrome)
molecule keywords CYTOCHROME C
publication title Three-dimensional structure of cytochrome c' from two Alcaligenes species and the implications for four-helix bundle structures.
pubmed doi rcsb
source organism Achromobacter xylosoxidans
total genus 48
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 1995-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01322 Cytochrom_C_2 Cytochrome C'
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 1cgnA00
1QQ3A 3NMKA 4D4NA 4CJOA 2J9BA 1CGOA 4CX9A 4ER9A 1A7VA 4WGYA 1CPRA 2XM4A 4U9EA 1EKYA 3IQ5A 4CDYA 2YL1A 3M15A 4JEAA 2BC5A 2YL3A 2XLMA 3ZTZA 1APCA 3HNKA 2YKZA 3TOLA 5JUAA 2XM0A 4D4XA 2XLEA 3L1MA 4CDAA 3NMIA 256BA 2XLOA 2YL7A 4JKVA 4ULVA 3ZTMA 3HNIA 5JLIA 3NMJA 1MQVA 2XL6A 4N4WA 5JSLA 3HNJA 1BBHA 4IARA 3C62A 3TOMA 2YLGA 1LM3B 3ZQVA 3ZQYA 4WGZA 1YZCA 1NBBA 5JS5A 5JP7A 2QLAA 1M6TA 1E84A 3FOPA 4NC3A 4CDVA 1E83A 1QPUA 3M4CA 2XL8A 4CJGA 4U9DA 2XLVA 3IQ6A 3M4BA 3HNLA 2XLHA 3M79A 3FOOA 1YZAA 1E86A 4L6RA 5B3IA 4EIYA 5AGFA 5JRAA 4JEBA 3QW0A 4IAQA 5JT4A 3QVYA 4IB4A 2J8WA 5JVEA 1CPQA 2XLDA 1CGNA 3DE8A 3ZWIA 4CIPA 1GQAA 3QVZA 4N6HA 1E85A 2CCYA 2XLWA 3DE9A 3QW1A 1S05A 1YYJA 4JE9A 3VRCA 3C63A 2YLIA 1YYXA 2YLDA 3U8PA 1RCPA 1JAFA 2YL0A
chains in the Genus database with same CATH superfamily
1QQ3A 1GS9A 1LVKA 4U5CE 3CQZA 3NMKA 4DRIB 3N24A 3ZSUA 5KYXA 2LCHA 4MTOA 4CX9A 1TFKB 1OCCC 2LD6A 1A7VA 3L34A 3I5PA 3FXHA 1H6GA 1MMNA 2OQMA 4U9EA 1EKYA 2AP3A 4NQFA 1G5ZA 3C8GA 4IRUA 2VCCA 3HTKC 2GFHA 1FTSA 2W45A 2HUJA 3IQ5A 3GORA 3L8JA 4YL0A 3W8IA 1J8MF 3KYIA 1YJGA 2Y3HA 4JEAA 3VAYA 3IQCA 2R7SA 3HJCA 1NSGB 4E0HA 1I5NA 1Y4CA 3F47A 1A7EA 3HNKA 4KBLA 4U5EE 3AG4C 3B0PA 1NZEA 3TOLA 3W2WA 4D4XA 5EK0A 4J7TA 3UMKA 4G7OF 2KK1A 3K7DA 4NCQA 3CAXA 1EA8A 1LI5A 1RKEB 256BA 2HZ8A 5D92A 4IAOA 1C03A 3JYYA 4KC9A 3S0XA 3M1CB 3QTHA 3ZTMA 3AG1C 3O55A 3RVYA 3OWTA 2XL4A 4PR9A 2R7XA 4JVSA 4HFKB 3NKEA 4N6CA 3TJ6A 3A9CA 3IEEA 3TQOA 1FNTc 2B0JA 1ZW2A 3LEOA 4MS2A 4OIPF 2EIKC 3GEIA 3RFYA 4JCHA 2OU6A 3LJBA 5JSLA 4U5FE 2A69F 3JSEO 4DOZA 2LIGA 2JPUA 4IARA 4O6YA 1NU7D 3ITFA 1D1BA 4MVSA 1N1CA 4YN0B 2L9JA 3T6JA 5FCLA 1HW2A 1TWGA 4MVMA 1WWPA 4JCZA 4WGZA 2R02A 3SYNA 1NBBA 1Q0GA 4CSAA 4O6MA 2HKVA 4W8PA 1ST6A 3EG9B 3HLZA 4PJNA 1G8XA 4CIHA 3G4XA 3Q7GA 3V5YA 4CDVA 1HY5A 3WAQA 3VYWA 1E83A 2ICWG 3M4CA 4U5BE 4E17A 1M57C 1OCRC 5KYXB 4J7YA 4CJGA 3W4YA 4HFFB 1LKXA 2PBEA 3B9QA 3IQ6A 4IGGA 4DBQA 2D5RB 3GM1A 2YEVA 3JRTA 3JTLO 1LIHA 4MTGA 2UUIA 4GQHA 2IYLD 3EJNA 1VLSA 2LFFA 5A6KA 5B3SC 3K1IC 2IXMA 4JTDB 3J06A 3C8GB 1BR1A 4O6NA 4JURI 3DZAA 4EBKA 5CI9A 1YZAA 3UGPA 4CS8C 2R05A 5JRAA 5AGFA 3ZC4A 2PFDA 1H7IA 1VOMA 4JTAB 2OEVA 3DAFA 3QW0A 1GM5A 1O5HA 2A0UA 2Q9AA 5JT4A 4EUKB 1OXBA 4PFPA 1A41A 3QVYA 4IB4A 4W8KA 2I8BA 5KYWA 3Q6NA 3LNMB 1LPEA 3I4UA 3K66A 2R7VA 4JC7A 1OR2A 4ZLCA 4BJ6A 2OG2A 3U0CA 3NRHA 3L0IA 1BR4A 4F4BA 2RSEB 1F1MA 3DAGA 1SZIA 1CGNA 3ABLC 3DJNB 1DOWA 3MX3A 3CZ6A 3AG3C 2MHRA 3GEEA 3GM2A 4GEHA 5KYUA 4OD4A 1TWHA 5F5HA 2Q7RA 3U9MA 5A6BA 1YA9A 3E9VA 1ZYRF 3MYIA 4PJJA 3G4ZA 4MW8A 1EQ1A 2OEXA 3JYHA 5L0JA 1MNEA 3FDQA 2CCYA 3DE9A 5BQHA 3B71A 3U2LA 5COGA 3T9OA 1ZU4A 2P61A 1LE4A 1A7DA 2J9VA 3R7CA 3GODA 3JT1A 3RQGA 1HE9A 2YLIA 1YYXA 1RJ9A 1V55C 2VCAA 2GWWA 2WVNA 2OCCC 1ZVZA 4BJ1A 1C02A 5COFA 3W2VA 1VYIA 1JOGA 2AWCA 3KPHA 3MBGA 2WZFA 2X51A 3KKBA 3MYFA 4OINF 2DI3A 2G62A 3X2QC 1WN0A 2YZSA 3FAJA 3LS0A 2MWQA 4CJOA 1VK5A 4EBBA 2W4BA 2KQ9A 1TWCA 3GWLA 4ER9A 5L3QA 4WGYA 1L3PA 3EHMA 4JJGA 3KMIA 3PMRA 3LAYA 3S28A 2KGOA 1PD0A 3US6A 2M4EA 2J9WA 2FGYA 4G7HF 3F46A 1I4ZA 4P6IC 2EPLX 3H2VA 2YL1A 4CDYA 4C3BA 1ORSC 2KYHA 3NYMA 4B6IA 2BC5A 1U0BB 2YL3A 2XLMA 3ZTZA 1APCA 3T4RA 2WZLA 1ORJA 2XM0A 1WTYA 3KYJA 4XEVA 4H4KC 3S29A 5DS5A 2XLEA 2L6FA 3NMIA 3BEHA 4G0HA 2XS1A 2YL7A 1D1CA 5KYWB 3PCVA 2ZPAA 2P1AA 2HSBA 2YHSA 2F22A 2NSFA 3U3BA 3GANA 2W9YA 2L81A 4PJLA 3LLIA 3T6GB 4DBRA 4P9FA 4N06A 4RD9A 4DVYP 1WGWA 2IXPA 2NUPA 2XL6A 4N4WA 5KYUB 2L7AA 4NTFA 2YQYA 3K33A 2LSEA 4DVZA 5A6BD 3S84A 2NUTA 4XPWA 5KYYB 3CSKA 2L6GA 3MLGA 4QDLA 3MFNA 3DXJF 4K7BA 2J46A 4E7SA 1RXQA 4CS7A 3U3FA 1G4WR 4O7GA 2B0HA 5L0GA 2YLGA 4JZAA 4Q5SF 5F5FA 1IW7F 3RYLA 4EBJA 4BJ5A 3G50A 3O10A 4EKWA 5JS5A 1JPJA 1OKKA 3POVA 3DJUB 4AL0A 1KTMA 2QLAA 3AGTA 1RJ9B 4J30B 5DQZA 2JD3A 2YVKA 3V5XA 3OEOA 3B0VC 1ORYA 1LS4A 3ZG1A 2WVOA 1VLTA 2IBFA 1AEPA 2VC9A 3C8ZA 3ZIBA 2XSEA 3FMSA 4OIOF 1A0BA 2HV7A 1QSPA 1B68A 1D0ZA 1WATA 3JZ0A 4CBEA 2GDCA 1Z5ZA 3AGUA 4G78A 1BR2A 5KYNA 2V26A 3LNRA 2TMVP 2GAQA 4MNDA 3FOOA 1E86A 1RKCA 1YVIA 3SZRA 1AVOB 3WHNA 4EWCA 4WJ0A 1YARO 1VB5A 2OJED 3RW0A 3LS1A 4C7OA 2DYSC 3ZVRA 3LEVA 4J32B 3C18A 2IM8A 1FMWA 1JMWA 4QI0A 2PP4A 4YT2A 1KU2A 1Z6AA 3AQCA 4C3EA 2QNLA 4U5GA 4KNWA 3U5SA 4LERA 1ZHZA 2XLDA 3EGDA 3ZWIA 1L7CA 3LESA 4CIPA 1QLEC 1AUEA 1T6IA 2NUPB 3U9JA 1M56C 1OXKA 4N6HA 3VM6A 5E3CA 3UMHA 3V5ZA 2NUTB 4ANJA 2AVKA 2G3VA 3K1HA 2A0BA 1Z63A 2HJMA 1D0YA 4X0RA 5EGYA 4OD5A 2HV6A 2J7PA 1JRAA 2KW3C 1C17M 2QY9A 5DQTA 4ONSA 5BUOA 5IY5C 3V7OA 4Q4ZF 5COMA 3EFOA 4XPYA 5B1AC 3RH3A 1FR0A 4KNVA 1MMAA 3NYJA 1ZZPA 2YLDA 2Q9BA 1JAFA 1OKKD 2NG1A 3A11A 3LLKA 4E7ZA 5A6AA 4A2NB 2KSFA 2MYSA 1PD1A 2EIJC 2CW0F 3KH2A 1Q0FA 4YT4A 2DB4A 5HSWA 4E18A 4U5DE 1NLXA 4Z9IA 4CS9A 2O9XA 4CSAC 2FFHA 1CPRA 4XLNF 2XM4A 1VTMP 1QVXA 3DM5A 4P9TA 1MMDA 2HFIA 1OCZC 2P7VA 3NG1A 4HEAJ 4BEMJ 3U2MA 1SMYF 1V54C 2HSQA 2ZXOA 4XPXA 3SXZA 1JR8A 1ZU5A 4FX5A 4PACA 2YKZA 3IHUA 4WABA 4DRHB 5L0FA 3Q6MA 4C7OB 1VMAA 2ZD9A 4YL1A 1NFOA 5EHHA 2PX3A 1SR2A 5E33A 2J9UA 1R5ID 3ECSA 1HW1A 3HNIA 2RD9A 4LLCA 4JTCB 3B0UX 5JLIA 1ZHTA 2I15A 2HMZA 3CEXA 3SEOA 3NMJA 3IPMO 4FWVA 3EGDB 3SXYA 1MQVA 2WVQA 2Q3TA 2Q9CA 4FAPB 3NYLA 2XXAA 3X1OA 1PCXA 3VF0A 4BJ6C 1BBHA 2CGEA 4UDVA 2NSGA 4KI2A 4ZLDA 1OW7A 2CYDA 3C62A 1T5OA 4H54A 2LFDA 4AX2A 4Z9HA 1HMDA 4I44A 1LI7A 1Z23A 2J7PD 4MW3A 1YZCA 4LDKA 3R2PA 4MVZA 3SP1A 2Y69C 2JX0A 3EFOB 3FVYA 5DVWA 1M6TA 3EH2A 2LQGA 1LE2A 2LP4A 3FOPA 4NC3A 2H7VC 1E2XA 2PF4E 5T3TA 1KNYA 1ZHYA 1QPUA 2EPKX 2WB7A 1MNDA 1TFOB 2IOQA 4O79A 2V3CC 4U9DA 3SXKA 1XWJA 3PDMP 2KC3A 2H7OA 2PX0A 2BE5F 5DS6A 3NKDA 5L0CA 3B29A 2XRHA 4XEKA 1VYKA 1OCOC 2XLHA 3ATPA 1JPNA 1M2OA 5CIVA 1PV3A 4YL3A 4A4AA 5BQIA 1K04A 2ZXPA 3NDBB 2ZXRA 1Q0KA 1YDIA 2R7WA 5B1BC 1OW8A 1OQCA 3QZCA 4IAQA 1LS1A 3TULA 3SXMA 1HE1A 1T6QA 2QUPA 2VH3A 2WL8A 3Q7LA 2R7TA 2H8AA 3E70C 1CGME 3FAPB 2CNWD 1CPQA 2WZGA 2Y39A 3RQEA 3QMKA 4MTFA 5A69A 2Q00A 2R25A 4YK5A 2ETSA 1Q0DA 4RBNA 2A6EF 3DE8A 3EPVA 2DYRC 1QKRA 1MMGA 3QVZA 3RKOF 3OA1A 2C03A 1UFBA 3JCUQ 2DGJA 3O6XA 2XXAB 1WOLA 2XS8A 3AJMA 4IWBA 1OW6A 3AG2C 3EH1A 1O3UA 4JIOA 2J0XA 1YYJA 4JE9A 1IZMA 2BL2A 5FZTA 3C63A 3VRCA 4K1OA 1K05A 3RVZA 2HMQA 4I1MA 3EGXA 5GPGB 3H2UA 1M2VA 2EIMC 1Q0MA 2J45A 2Q4FA 1RCPA 1Z3IX 2R7QA 3H65A 3I5QA 3K6BA 2YL0A 3U8PA 3WG7C 1H9TA 2PNOA 3EQLF 3K1IA 2QTVA 5AC5A 1NFNA 1R4TA 4I3MA 1EI7A 2EPNA 5T1DB 1YLMA 4XEFA 1Z7Qc 2VB6A 4D4NA 4BJ5C 1U89A 1ZHXA 2J9BA 1CGOA 3LUTB 4NTAA 4CS8A 2YWAA 3IQTA 3DD7A 2A68F 4LLEA 3UMIA 2HS5A 2OOCA 4YWQA 1TQGA 1O87A 5TJ5E 2KJGA 5DLJA 1I4YA 2Y3DA 4AL1A 5F28E 5A6JA 3S9OA 1SYQA 3M15A 4BJTA 4M63A 4FESA 2VASA 4PK4A 5JUAA 4GYTA 4JJFA 3JRMO 4Q7CA 3L1MA 4CDAA 4IJJA 4DXWA 2XLOA 3RF3A 2YRFA 2J0WA 1TKNA 4JKVA 4MVQA 1FFTC 1YA7O 4XWJA 3GM3A 3JSZA 4ULVA 5BQGA 3TK0A 4E0IA 3ZDLA 2Y3BA 5L0IA 3PHF2 4OIQF 4BG0A 2ZXWC 5E3AA 3UR3C 4AE4A 3EZIA 2G3KA 2H7BA 3GWNA 3GEHA 3S90A 4LDRA 3ASNC 4AK9A 5AC4A 2IXNA 1H9GA 1QZXA 3DI5A 1K40A 3FHDA 3HNJA 2R7OA 3O39A 4LDQA 5CI8A 3C8GD 4MQ9F 2LK4A 4BEJA 3TOMA 2EPMX 2A6HF 1T9KA 2R7UA 1LM3B 3ZQVA 4QI2A 3ZQYA 1G4US 5HV9A 1V74B 4BPMA 4NTBA 1Y6DA 2OKUA 2OJQA 2CDQA 1W2WA 1WASA 2AWYA 2M64A 2UUHA 3HKKA 3EGXB 3L8IA 4I1OB 4R32A 5JP7A 3UNGC 1M2VB 2CNWA 3DM9B 5K0IA 1E84A 5L3VA 1D1AA 1YAUO 3WODF 1ZW3A 3ABMC 2XL8A 1HMOA 5T3WA 1U6HA 2A1DD 1NU9C 3ASOC 2XLVA 4PFOA 2P0NA 2C04A 3EZHA 4NY3A 3AOUA 3DWWA 2VCBA 3RQFA 5KYYA 2R03A 5E2QA 4DRJB 2D4UA 2ASRA 4MVUA 1FFHA 1ZHWA 4YJWA 3M4BA 3HNLA 5DS4A 3N2ZB 4Z9JA 3M79A 1BDJB 3T6BA 4LACB 1SF8A 2GA0A 4U5HA 4CS9C 3C7JA 1J8YF 4L6RA 5B3IA 2EPOA 4ULWA 4EIYA 1TWAA 4JEBA 1S7ZA 1V4AA 2X0CA 4PJMA 3UGOA 4YT8A 1XZPA 3AQBA 1RKEA 2Z15A 1FMVA 1XZQA 2EINC 3TD7A 2R7RA 4JW1A 4OIRF 1UG7A 2J8WA 1FAPB 3RIPA 4XTKA 5JVEA 1BZ4A 1RMVA 2QE9A 1NG1A 4K0DA 4YT5A 4HE8D 5L0HA 3EHNA 2IXOA 1GGQA 3DKAA 1OR3A 2AU5A 5D91A 1GQAA 2EILC 2E87A 4AE4B 1T6UA 1TR2A 2L6HA 2HJ3A 3BRJA 3TJ5A 4DJ9A 4EHPA 2Y3GA 4XQ1A 2KNHA 4JRZA 1E85A 2W4MA 2NPUA 2XLWA 4MVRA 3QW1A 1S05A 2R9RB 2P6VA 5L0DA 4XLPF 4MVOA 3U8VA 3W8HA 4C3DA 1DOVA 3EG9A 3DMDA 3ABKC 3S27A 3SNHA 2FAPB 3KL4A 1T01A 4RDAA 1D0XA 3N0TA 4G7ZF
chains in the Genus database with same CATH topology
1QQ3A 3NMKA 4D4NA 4CJOA 2J9BA 1CGOA 4CX9A 4ER9A 1A7VA 4WGYA 1CPRA 2XM4A 4U9EA 1EKYA 3IQ5A 4CDYA 2YL1A 3M15A 4JEAA 2BC5A 2YL3A 2XLMA 3ZTZA 1APCA 3HNKA 2YKZA 3TOLA 5JUAA 2XM0A 4D4XA 2XLEA 3L1MA 4CDAA 3NMIA 256BA 2XLOA 2YL7A 4JKVA 4ULVA 3ZTMA 3HNIA 5JLIA 3NMJA 1MQVA 2XL6A 4N4WA 5JSLA 3HNJA 1BBHA 4IARA 3C62A 3TOMA 2YLGA 1LM3B 3ZQVA 3ZQYA 4WGZA 1YZCA 1NBBA 5JS5A 5JP7A 2QLAA 1M6TA 1E84A 3FOPA 4NC3A 4CDVA 1E83A 1QPUA 3M4CA 2XL8A 4CJGA 4U9DA 2XLVA 3IQ6A 3M4BA 3HNLA 2XLHA 3M79A 3FOOA 1YZAA 1E86A 4L6RA 5B3IA 4EIYA 5AGFA 5JRAA 4JEBA 3QW0A 4IAQA 5JT4A 3QVYA 4IB4A 2J8WA 5JVEA 1CPQA 2XLDA 1CGNA 3DE8A 3ZWIA 4CIPA 1GQAA 3QVZA 4N6HA 1E85A 2CCYA 2XLWA 3DE9A 3QW1A 1S05A 1YYJA 4JE9A 3VRCA 3C63A 2YLIA 1YYXA 2YLDA 3U8PA 1RCPA 1JAFA 2YL0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QQ3 A;  3NMK A;  4D4N A;  4CJO A;  2J9B A;  1CGO A;  4CX9 A;  4ER9 A;  1A7V A;  4WGY A;  1CPR A;  2XM4 A;  4U9E A;  1EKY A;  3IQ5 A;  4CDY A;  2YL1 A;  3M15 A;  4JEA A;  2BC5 A;  2YL3 A;  2XLM A;  3ZTZ A;  1APC A;  3HNK A;  2YKZ A;  3TOL A;  5JUA A;  2XM0 A;  4D4X A;  2XLE A;  3L1M A;  4CDA A;  3NMI A;  256B A;  2XLO A;  2YL7 A;  4JKV A;  4ULV A;  3ZTM A;  3HNI A;  5JLI A;  3NMJ A;  1MQV A;  2XL6 A;  4N4W A;  5JSL A;  3HNJ A;  1BBH A;  4IAR A;  3C62 A;  3TOM A;  2YLG A;  1LM3 B;  3ZQV A;  3ZQY A;  4WGZ A;  1YZC A;  1NBB A;  5JS5 A;  5JP7 A;  2QLA A;  1M6T A;  1E84 A;  3FOP A;  4NC3 A;  4CDV A;  1E83 A;  1QPU A;  3M4C A;  2XL8 A;  4CJG A;  4U9D A;  2XLV A;  3IQ6 A;  3M4B A;  3HNL A;  2XLH A;  3M79 A;  3FOO A;  1YZA A;  1E86 A;  4L6R A;  5B3I A;  4EIY A;  5AGF A;  5JRA A;  4JEB A;  3QW0 A;  4IAQ A;  5JT4 A;  3QVY A;  4IB4 A;  2J8W A;  5JVE A;  1CPQ A;  2XLD A;  1CGN A;  3DE8 A;  3ZWI A;  4CIP A;  1GQA A;  3QVZ A;  4N6H A;  1E85 A;  2CCY A;  2XLW A;  3DE9 A;  3QW1 A;  1S05 A;  1YYJ A;  4JE9 A;  3VRC A;  3C63 A;  2YLI A;  1YYX A;  2YLD A;  3U8P A;  1RCP A;  1JAF A;  2YL0 A; 
#chains in the Genus database with same CATH topology
 1QQ3 A;  1GS9 A;  1LVK A;  4U5C E;  3CQZ A;  3NMK A;  4DRI B;  3N24 A;  3ZSU A;  5KYX A;  2LCH A;  4MTO A;  4CX9 A;  1TFK B;  1OCC C;  2LD6 A;  1A7V A;  3L34 A;  3I5P A;  3FXH A;  1H6G A;  1MMN A;  2OQM A;  4U9E A;  1EKY A;  2AP3 A;  4NQF A;  1G5Z A;  3C8G A;  4IRU A;  2VCC A;  3HTK C;  2GFH A;  1FTS A;  2W45 A;  2HUJ A;  3IQ5 A;  3GOR A;  3L8J A;  4YL0 A;  3W8I A;  1J8M F;  3KYI A;  1YJG A;  2Y3H A;  4JEA A;  3VAY A;  3IQC A;  2R7S A;  3HJC A;  1NSG B;  4E0H A;  1I5N A;  1Y4C A;  3F47 A;  1A7E A;  3HNK A;  4KBL A;  4U5E E;  3AG4 C;  3B0P A;  1NZE A;  3TOL A;  3W2W A;  4D4X A;  5EK0 A;  4J7T A;  3UMK A;  4G7O F;  2KK1 A;  3K7D A;  4NCQ A;  3CAX A;  1EA8 A;  1LI5 A;  1RKE B;  256B A;  2HZ8 A;  5D92 A;  4IAO A;  1C03 A;  3JYY A;  4KC9 A;  3S0X A;  3M1C B;  3QTH A;  3ZTM A;  3AG1 C;  3O55 A;  3RVY A;  3OWT A;  2XL4 A;  4PR9 A;  2R7X A;  4JVS A;  4HFK B;  3NKE A;  4N6C A;  3TJ6 A;  3A9C A;  3IEE A;  3TQO A;  1FNT c;  2B0J A;  1ZW2 A;  3LEO A;  4MS2 A;  4OIP F;  2EIK C;  3GEI A;  3RFY A;  4JCH A;  2OU6 A;  3LJB A;  5JSL A;  4U5F E;  2A69 F;  3JSE O;  4DOZ A;  2LIG A;  2JPU A;  4IAR A;  4O6Y A;  1NU7 D;  3ITF A;  1D1B A;  4MVS A;  1N1C A;  4YN0 B;  2L9J A;  3T6J A;  5FCL A;  1HW2 A;  1TWG A;  4MVM A;  1WWP A;  4JCZ A;  4WGZ A;  2R02 A;  3SYN A;  1NBB A;  1Q0G A;  4CSA A;  4O6M A;  2HKV A;  4W8P A;  1ST6 A;  3EG9 B;  3HLZ A;  4PJN A;  1G8X A;  4CIH A;  3G4X A;  3Q7G A;  3V5Y A;  4CDV A;  1HY5 A;  3WAQ A;  3VYW A;  1E83 A;  2ICW G;  3M4C A;  4U5B E;  4E17 A;  1M57 C;  1OCR C;  5KYX B;  4J7Y A;  4CJG A;  3W4Y A;  4HFF B;  1LKX A;  2PBE A;  3B9Q A;  3IQ6 A;  4IGG A;  4DBQ A;  2D5R B;  3GM1 A;  2YEV A;  3JRT A;  3JTL O;  1LIH A;  4MTG A;  2UUI A;  4GQH A;  2IYL D;  3EJN A;  1VLS A;  2LFF A;  5A6K A;  5B3S C;  3K1I C;  2IXM A;  4JTD B;  3J06 A;  3C8G B;  1BR1 A;  4O6N A;  4JUR I;  3DZA A;  4EBK A;  5CI9 A;  1YZA A;  3UGP A;  4CS8 C;  2R05 A;  5JRA A;  5AGF A;  3ZC4 A;  2PFD A;  1H7I A;  1VOM A;  4JTA B;  2OEV A;  3DAF A;  3QW0 A;  1GM5 A;  1O5H A;  2A0U A;  2Q9A A;  5JT4 A;  4EUK B;  1OXB A;  4PFP A;  1A41 A;  3QVY A;  4IB4 A;  4W8K A;  2I8B A;  5KYW A;  3Q6N A;  3LNM B;  1LPE A;  3I4U A;  3K66 A;  2R7V A;  4JC7 A;  1OR2 A;  4ZLC A;  4BJ6 A;  2OG2 A;  3U0C A;  3NRH A;  3L0I A;  1BR4 A;  4F4B A;  2RSE B;  1F1M A;  3DAG A;  1SZI A;  1CGN A;  3ABL C;  3DJN B;  1DOW A;  3MX3 A;  3CZ6 A;  3AG3 C;  2MHR A;  3GEE A;  3GM2 A;  4GEH A;  5KYU A;  4OD4 A;  1TWH A;  5F5H A;  2Q7R A;  3U9M A;  5A6B A;  1YA9 A;  3E9V A;  1ZYR F;  3MYI A;  4PJJ A;  3G4Z A;  4MW8 A;  1EQ1 A;  2OEX A;  3JYH A;  5L0J A;  1MNE A;  3FDQ A;  2CCY A;  3DE9 A;  5BQH A;  3B71 A;  3U2L A;  5COG A;  3T9O A;  1ZU4 A;  2P61 A;  1LE4 A;  1A7D A;  2J9V A;  3R7C A;  3GOD A;  3JT1 A;  3RQG A;  1HE9 A;  2YLI A;  1YYX A;  1RJ9 A;  1V55 C;  2VCA A;  2GWW A;  2WVN A;  2OCC C;  1ZVZ A;  4BJ1 A;  1C02 A;  5COF A;  3W2V A;  1VYI A;  1JOG A;  2AWC A;  3KPH A;  3MBG A;  2WZF A;  2X51 A;  3KKB A;  3MYF A;  4OIN F;  2DI3 A;  2G62 A;  3X2Q C;  1WN0 A;  2YZS A;  3FAJ A;  3LS0 A;  2MWQ A;  4CJO A;  1VK5 A;  4EBB A;  2W4B A;  2KQ9 A;  1TWC A;  3GWL A;  4ER9 A;  5L3Q A;  4WGY A;  1L3P A;  3EHM A;  4JJG A;  3KMI A;  3PMR A;  3LAY A;  3S28 A;  2KGO A;  1PD0 A;  3US6 A;  2M4E A;  2J9W A;  2FGY A;  4G7H F;  3F46 A;  1I4Z A;  4P6I C;  2EPL X;  3H2V A;  2YL1 A;  4CDY A;  4C3B A;  1ORS C;  2KYH A;  3NYM A;  4B6I A;  2BC5 A;  1U0B B;  2YL3 A;  2XLM A;  3ZTZ A;  1APC A;  3T4R A;  2WZL A;  1ORJ A;  2XM0 A;  1WTY A;  3KYJ A;  4XEV A;  4H4K C;  3S29 A;  5DS5 A;  2XLE A;  2L6F A;  3NMI A;  3BEH A;  4G0H A;  2XS1 A;  2YL7 A;  1D1C A;  5KYW B;  3PCV A;  2ZPA A;  2P1A A;  2HSB A;  2YHS A;  2F22 A;  2NSF A;  3U3B A;  3GAN A;  2W9Y A;  2L81 A;  4PJL A;  3LLI A;  3T6G B;  4DBR A;  4P9F A;  4N06 A;  4RD9 A;  4DVY P;  1WGW A;  2IXP A;  2NUP A;  2XL6 A;  4N4W A;  5KYU B;  2L7A A;  4NTF A;  2YQY A;  3K33 A;  2LSE A;  4DVZ A;  5A6B D;  3S84 A;  2NUT A;  4XPW A;  5KYY B;  3CSK A;  2L6G A;  3MLG A;  4QDL A;  3MFN A;  3DXJ F;  4K7B A;  2J46 A;  4E7S A;  1RXQ A;  4CS7 A;  3U3F A;  1G4W R;  4O7G A;  2B0H A;  5L0G A;  2YLG A;  4JZA A;  4Q5S F;  5F5F A;  1IW7 F;  3RYL A;  4EBJ A;  4BJ5 A;  3G50 A;  3O10 A;  4EKW A;  5JS5 A;  1JPJ A;  1OKK A;  3POV A;  3DJU B;  4AL0 A;  1KTM A;  2QLA A;  3AGT A;  1RJ9 B;  4J30 B;  5DQZ A;  2JD3 A;  2YVK A;  3V5X A;  3OEO A;  3B0V C;  1ORY A;  1LS4 A;  3ZG1 A;  2WVO A;  1VLT A;  2IBF A;  1AEP A;  2VC9 A;  3C8Z A;  3ZIB A;  2XSE A;  3FMS A;  4OIO F;  1A0B A;  2HV7 A;  1QSP A;  1B68 A;  1D0Z A;  1WAT A;  3JZ0 A;  4CBE A;  2GDC A;  1Z5Z A;  3AGU A;  4G78 A;  1BR2 A;  5KYN A;  2V26 A;  3LNR A;  2TMV P;  2GAQ A;  4MND A;  3FOO A;  1E86 A;  1RKC A;  1YVI A;  3SZR A;  1AVO B;  3WHN A;  4EWC A;  4WJ0 A;  1YAR O;  1VB5 A;  2OJE D;  3RW0 A;  3LS1 A;  4C7O A;  2DYS C;  3ZVR A;  3LEV A;  4J32 B;  3C18 A;  2IM8 A;  1FMW A;  1JMW A;  4QI0 A;  2PP4 A;  4YT2 A;  1KU2 A;  1Z6A A;  3AQC A;  4C3E A;  2QNL A;  4U5G A;  4KNW A;  3U5S A;  4LER A;  1ZHZ A;  2XLD A;  3EGD A;  3ZWI A;  1L7C A;  3LES A;  4CIP A;  1QLE C;  1AUE A;  1T6I A;  2NUP B;  3U9J A;  1M56 C;  1OXK A;  4N6H A;  3VM6 A;  5E3C A;  3UMH A;  3V5Z A;  2NUT B;  4ANJ A;  2AVK A;  2G3V A;  3K1H A;  2A0B A;  1Z63 A;  2HJM A;  1D0Y A;  4X0R A;  5EGY A;  4OD5 A;  2HV6 A;  2J7P A;  1JRA A;  2KW3 C;  1C17 M;  2QY9 A;  5DQT A;  4ONS A;  5BUO A;  5IY5 C;  3V7O A;  4Q4Z F;  5COM A;  3EFO A;  4XPY A;  5B1A C;  3RH3 A;  1FR0 A;  4KNV A;  1MMA A;  3NYJ A;  1ZZP A;  2YLD A;  2Q9B A;  1JAF A;  1OKK D;  2NG1 A;  3A11 A;  3LLK A;  4E7Z A;  5A6A A;  4A2N B;  2KSF A;  2MYS A;  1PD1 A;  2EIJ C;  2CW0 F;  3KH2 A;  1Q0F A;  4YT4 A;  2DB4 A;  5HSW A;  4E18 A;  4U5D E;  1NLX A;  4Z9I A;  4CS9 A;  2O9X A;  4CSA C;  2FFH A;  1CPR A;  4XLN F;  2XM4 A;  1VTM P;  1QVX A;  3DM5 A;  4P9T A;  1MMD A;  2HFI A;  1OCZ C;  2P7V A;  3NG1 A;  4HEA J;  4BEM J;  3U2M A;  1SMY F;  1V54 C;  2HSQ A;  2ZXO A;  4XPX A;  3SXZ A;  1JR8 A;  1ZU5 A;  4FX5 A;  4PAC A;  2YKZ A;  3IHU A;  4WAB A;  4DRH B;  5L0F A;  3Q6M A;  4C7O B;  1VMA A;  2ZD9 A;  4YL1 A;  1NFO A;  5EHH A;  2PX3 A;  1SR2 A;  5E33 A;  2J9U A;  1R5I D;  3ECS A;  1HW1 A;  3HNI A;  2RD9 A;  4LLC A;  4JTC B;  3B0U X;  5JLI A;  1ZHT A;  2I15 A;  2HMZ A;  3CEX A;  3SEO A;  3NMJ A;  3IPM O;  4FWV A;  3EGD B;  3SXY A;  1MQV A;  2WVQ A;  2Q3T A;  2Q9C A;  4FAP B;  3NYL A;  2XXA A;  3X1O A;  1PCX A;  3VF0 A;  4BJ6 C;  1BBH A;  2CGE A;  4UDV A;  2NSG A;  4KI2 A;  4ZLD A;  1OW7 A;  2CYD A;  3C62 A;  1T5O A;  4H54 A;  2LFD A;  4AX2 A;  4Z9H A;  1HMD A;  4I44 A;  1LI7 A;  1Z23 A;  2J7P D;  4MW3 A;  1YZC A;  4LDK A;  3R2P A;  4MVZ A;  3SP1 A;  2Y69 C;  2JX0 A;  3EFO B;  3FVY A;  5DVW A;  1M6T A;  3EH2 A;  2LQG A;  1LE2 A;  2LP4 A;  3FOP A;  4NC3 A;  2H7V C;  1E2X A;  2PF4 E;  5T3T A;  1KNY A;  1ZHY A;  1QPU A;  2EPK X;  2WB7 A;  1MND A;  1TFO B;  2IOQ A;  4O79 A;  2V3C C;  4U9D A;  3SXK A;  1XWJ A;  3PDM P;  2KC3 A;  2H7O A;  2PX0 A;  2BE5 F;  5DS6 A;  3NKD A;  5L0C A;  3B29 A;  2XRH A;  4XEK A;  1VYK A;  1OCO C;  2XLH A;  3ATP A;  1JPN A;  1M2O A;  5CIV A;  1PV3 A;  4YL3 A;  4A4A A;  5BQI A;  1K04 A;  2ZXP A;  3NDB B;  2ZXR A;  1Q0K A;  1YDI A;  2R7W A;  5B1B C;  1OW8 A;  1OQC A;  3QZC A;  4IAQ A;  1LS1 A;  3TUL A;  3SXM A;  1HE1 A;  1T6Q A;  2QUP A;  2VH3 A;  2WL8 A;  3Q7L A;  2R7T A;  2H8A A;  3E70 C;  1CGM E;  3FAP B;  2CNW D;  1CPQ A;  2WZG A;  2Y39 A;  3RQE A;  3QMK A;  4MTF A;  5A69 A;  2Q00 A;  2R25 A;  4YK5 A;  2ETS A;  1Q0D A;  4RBN A;  2A6E F;  3DE8 A;  3EPV A;  2DYR C;  1QKR A;  1MMG A;  3QVZ A;  3RKO F;  3OA1 A;  2C03 A;  1UFB A;  3JCU Q;  2DGJ A;  3O6X A;  2XXA B;  1WOL A;  2XS8 A;  3AJM A;  4IWB A;  1OW6 A;  3AG2 C;  3EH1 A;  1O3U A;  4JIO A;  2J0X A;  1YYJ A;  4JE9 A;  1IZM A;  2BL2 A;  5FZT A;  3C63 A;  3VRC A;  4K1O A;  1K05 A;  3RVZ A;  2HMQ A;  4I1M A;  3EGX A;  5GPG B;  3H2U A;  1M2V A;  2EIM C;  1Q0M A;  2J45 A;  2Q4F A;  1RCP A;  1Z3I X;  2R7Q A;  3H65 A;  3I5Q A;  3K6B A;  2YL0 A;  3U8P A;  3WG7 C;  1H9T A;  2PNO A;  3EQL F;  3K1I A;  2QTV A;  5AC5 A;  1NFN A;  1R4T A;  4I3M A;  1EI7 A;  2EPN A;  5T1D B;  1YLM A;  4XEF A;  1Z7Q c;  2VB6 A;  4D4N A;  4BJ5 C;  1U89 A;  1ZHX A;  2J9B A;  1CGO A;  3LUT B;  4NTA A;  4CS8 A;  2YWA A;  3IQT A;  3DD7 A;  2A68 F;  4LLE A;  3UMI A;  2HS5 A;  2OOC A;  4YWQ A;  1TQG A;  1O87 A;  5TJ5 E;  2KJG A;  5DLJ A;  1I4Y A;  2Y3D A;  4AL1 A;  5F28 E;  5A6J A;  3S9O A;  1SYQ A;  3M15 A;  4BJT A;  4M63 A;  4FES A;  2VAS A;  4PK4 A;  5JUA A;  4GYT A;  4JJF A;  3JRM O;  4Q7C A;  3L1M A;  4CDA A;  4IJJ A;  4DXW A;  2XLO A;  3RF3 A;  2YRF A;  2J0W A;  1TKN A;  4JKV A;  4MVQ A;  1FFT C;  1YA7 O;  4XWJ A;  3GM3 A;  3JSZ A;  4ULV A;  5BQG A;  3TK0 A;  4E0I A;  3ZDL A;  2Y3B A;  5L0I A;  3PHF 2;  4OIQ F;  4BG0 A;  2ZXW C;  5E3A A;  3UR3 C;  4AE4 A;  3EZI A;  2G3K A;  2H7B A;  3GWN A;  3GEH A;  3S90 A;  4LDR A;  3ASN C;  4AK9 A;  5AC4 A;  2IXN A;  1H9G A;  1QZX A;  3DI5 A;  1K40 A;  3FHD A;  3HNJ A;  2R7O A;  3O39 A;  4LDQ A;  5CI8 A;  3C8G D;  4MQ9 F;  2LK4 A;  4BEJ A;  3TOM A;  2EPM X;  2A6H F;  1T9K A;  2R7U A;  1LM3 B;  3ZQV A;  4QI2 A;  3ZQY A;  1G4U S;  5HV9 A;  1V74 B;  4BPM A;  4NTB A;  1Y6D A;  2OKU A;  2OJQ A;  2CDQ A;  1W2W A;  1WAS A;  2AWY A;  2M64 A;  2UUH A;  3HKK A;  3EGX B;  3L8I A;  4I1O B;  4R32 A;  5JP7 A;  3UNG C;  1M2V B;  2CNW A;  3DM9 B;  5K0I A;  1E84 A;  5L3V A;  1D1A A;  1YAU O;  3WOD F;  1ZW3 A;  3ABM C;  2XL8 A;  1HMO A;  5T3W A;  1U6H A;  2A1D D;  1NU9 C;  3ASO C;  2XLV A;  4PFO A;  2P0N A;  2C04 A;  3EZH A;  4NY3 A;  3AOU A;  3DWW A;  2VCB A;  3RQF A;  5KYY A;  2R03 A;  5E2Q A;  4DRJ B;  2D4U A;  2ASR A;  4MVU A;  1FFH A;  1ZHW A;  4YJW A;  3M4B A;  3HNL A;  5DS4 A;  3N2Z B;  4Z9J A;  3M79 A;  1BDJ B;  3T6B A;  4LAC B;  1SF8 A;  2GA0 A;  4U5H A;  4CS9 C;  3C7J A;  1J8Y F;  4L6R A;  5B3I A;  2EPO A;  4ULW A;  4EIY A;  1TWA A;  4JEB A;  1S7Z A;  1V4A A;  2X0C A;  4PJM A;  3UGO A;  4YT8 A;  1XZP A;  3AQB A;  1RKE A;  2Z15 A;  1FMV A;  1XZQ A;  2EIN C;  3TD7 A;  2R7R A;  4JW1 A;  4OIR F;  1UG7 A;  2J8W A;  1FAP B;  3RIP A;  4XTK A;  5JVE A;  1BZ4 A;  1RMV A;  2QE9 A;  1NG1 A;  4K0D A;  4YT5 A;  4HE8 D;  5L0H A;  3EHN A;  2IXO A;  1GGQ A;  3DKA A;  1OR3 A;  2AU5 A;  5D91 A;  1GQA A;  2EIL C;  2E87 A;  4AE4 B;  1T6U A;  1TR2 A;  2L6H A;  2HJ3 A;  3BRJ A;  3TJ5 A;  4DJ9 A;  4EHP A;  2Y3G A;  4XQ1 A;  2KNH A;  4JRZ A;  1E85 A;  2W4M A;  2NPU A;  2XLW A;  4MVR A;  3QW1 A;  1S05 A;  2R9R B;  2P6V A;  5L0D A;  4XLP F;  4MVO A;  3U8V A;  3W8H A;  4C3D A;  1DOV A;  3EG9 A;  3DMD A;  3ABK C;  3S27 A;  3SNH A;  2FAP B;  3KL4 A;  1T01 A;  4RDA A;  1D0X A;  3N0T A;  4G7Z F; 
#chains in the Genus database with same CATH homology
 1QQ3 A;  3NMK A;  4D4N A;  4CJO A;  2J9B A;  1CGO A;  4CX9 A;  4ER9 A;  1A7V A;  4WGY A;  1CPR A;  2XM4 A;  4U9E A;  1EKY A;  3IQ5 A;  4CDY A;  2YL1 A;  3M15 A;  4JEA A;  2BC5 A;  2YL3 A;  2XLM A;  3ZTZ A;  1APC A;  3HNK A;  2YKZ A;  3TOL A;  5JUA A;  2XM0 A;  4D4X A;  2XLE A;  3L1M A;  4CDA A;  3NMI A;  256B A;  2XLO A;  2YL7 A;  4JKV A;  4ULV A;  3ZTM A;  3HNI A;  5JLI A;  3NMJ A;  1MQV A;  2XL6 A;  4N4W A;  5JSL A;  3HNJ A;  1BBH A;  4IAR A;  3C62 A;  3TOM A;  2YLG A;  1LM3 B;  3ZQV A;  3ZQY A;  4WGZ A;  1YZC A;  1NBB A;  5JS5 A;  5JP7 A;  2QLA A;  1M6T A;  1E84 A;  3FOP A;  4NC3 A;  4CDV A;  1E83 A;  1QPU A;  3M4C A;  2XL8 A;  4CJG A;  4U9D A;  2XLV A;  3IQ6 A;  3M4B A;  3HNL A;  2XLH A;  3M79 A;  3FOO A;  1YZA A;  1E86 A;  4L6R A;  5B3I A;  4EIY A;  5AGF A;  5JRA A;  4JEB A;  3QW0 A;  4IAQ A;  5JT4 A;  3QVY A;  4IB4 A;  2J8W A;  5JVE A;  1CPQ A;  2XLD A;  1CGN A;  3DE8 A;  3ZWI A;  4CIP A;  1GQA A;  3QVZ A;  4N6H A;  1E85 A;  2CCY A;  2XLW A;  3DE9 A;  3QW1 A;  1S05 A;  1YYJ A;  4JE9 A;  3VRC A;  3C63 A;  2YLI A;  1YYX A;  2YLD A;  3U8P A;  1RCP A;  1JAF A;  2YL0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...