3U2LA

Crystal structure of human alr mutant c142s.
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
115
structure length
115
Chain Sequence
FREDCPPDREELGRHSWAVLHTLAAYYPDLPTPEQQQDMAQFIHLFSKFYPSEECAEDLRKRLARNHPDTRTRAAFTQWLCHLHNEVNRKLGKPDFDCSKVDERWRDGWKDGSCD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FAD-linked sulfhydryl oxidase ALR
publication title An electron-transfer path through an extended disulfide relay system: the case of the redox protein ALR.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Flavoprotein
total genus 42
structure length 115
sequence length 115
ec nomenclature ec 1.8.3.2: Thiol oxidase.
pdb deposition date 2011-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04777 Evr1_Alr Erv1 / Alr family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.310 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) ERV/ALR sulfhydryl oxidase domain 3u2lA00
3U5SA 3R7CA 3W4YA 3O55A 1OQCA 1JR8A 1JRAA 4E0IA 3LLIA 3TD7A 4LDKA 3GWNA 3MBGA 3U2MA 3LLKA 4E0HA 3GWLA 2HJ3A 3TK0A 3U2LA
chains in the Genus database with same CATH superfamily
2I8BA 1K40A 3O6XA 4EUKB 2OEXA 1CGNA 4OIRF 3C8GA 2HV7A 3KH2A 4F4BA 2QE9A 1ORJA 4U5HA 3LLIA 3NMIA 5COMA 5L0JA 4FESA 1NFNA 2WVNA 4EIYA 3UR3C 1ZHYA 2Q9BA 1K05A 2NUPA 3U2MA 4PK4A 3CEXA 1A7EA 2LFFA 2J0WA 2YZSA 4AX2A 3T4RA 3HLZA 1ORYA 3IPMO 5COGA 3HNIA 1I4ZA 1YYJA 3KYIA 4IARA 2A0UA 4YN0B 2MHRA 4EWCA 3EZIA 2HJ3A 2L7AA 2LQGA 3DAFA 1LIHA 2HZ8A 3F46A 4GYTA 4N6HA 4CDYA 4CIHA 3T6JA 3WHNA 4E18A 5BQHA 2H7BA 2XLOA 3LS0A 1EA8A 1ZHZA 2DB4A 3EFOB 4MVUA 4XPWA 3DI5A 1C02A 1PV3A 3E70C 4CJOA 3ECSA 3FXHA 1NBBA 2AVKA 1MQVA 2J9BA 1APCA 3MYFA 1BR1A 4LERA 1G4US 4QI0A 5E3CA 3SEOA 2R7SA 2ZXWC 2PX3A 2VCCA 3B29A 3AOUA 1OW6A 2R7WA 3SP1A 4BPMA 4MQ9F 1EI7A 1V4AA 1HMOA 4Z9HA 1WWPA 2YL3A 4XEVA 1C17M 3RIPA 3TJ6A 2H8AA 5L0HA 1M57C 3X2QC 4DVZA 5AC4A 3CQZA 3V5XA 5EK0A 4EBBA 1ZYRF 3K6BA 2R7UA 1JOGA 3SYNA 3BEHA 2PF4E 1O87A 3E9VA 2R7VA 4IB4A 3NMKA 3IQ5A 2VCAA 2FAPB 4CSAA 3EJNA 1NZEA 2HSBA 3NRHA 3QZCA 5L0CA 4LLEA 4MVOA 5F5FA 1J8YF 4PJLA 3S28A 3TJ5A 3JZ0A 1JR8A 1TR2A 3QW0A 4CX9A 1I4YA 2YKZA 2ZXPA 3LNMB 4PFOA 4OD5A 4YT4A 4XQ1A 3Q6NA 2BC5A 2LK4A 1RKCA 2EPLX 2KJGA 2PX0A 4IWBA 4U5GA 2NPUA 4NTAA 4KI2A 2L6FA 1LVKA 1ZHTA 3ITFA 1XZQA 4ULWA 4JCZA 3DXJF 1LS1A 1M2VB 2QUPA 3HTKC 4K7BA 3PDMP 1EKYA 5FZTA 1SZIA 4J7TA 3ZC4A 3PHF2 4CSAC 2UUIA 4YL3A 1D1CA 4YL1A 1QPUA 1A41A 1YLMA 2EPKX 3DJUB 3EH2A 3V7OA 2J45A 3PMRA 3L8JA 2R7QA 1OCCC 1M2OA 2WVQA 3EGDB 4ZLCA 5B1AC 2J7PD 2EPNA 3RVYA 3LS1A 1E84A 2Q4FA 3C8GD 2M4EA 4ONSA 2CW0F 1JPJA 4P9TA 1F1MA 2A6EF 3O55A 2A69F 1JMWA 2LD6A 4G78A 2XM0A 3VAYA 2CCYA 1MMAA 1RCPA 3ZG1A 4MW3A 2IYLD 3ZVRA 2KGOA 2EIKC 1T5OA 1AUEA 2F22A 4ULVA 3W2VA 4U9EA 1E83A 1A7DA 2VASA 3L34A 5BQGA 2MWQA 1TWAA 5T3TA 4MVQA 4MW8A 2XLHA 3A11A 1O5HA 2ZPAA 3NMJA 1CPRA 4C7OB 1OCRC 3OA1A 1HY5A 3H2VA 3FAJA 4JRZA 1MMNA 3RVZA 2Q9AA 3GM2A 2WZFA 3K66A 4Q5SF 2H7VC 3O39A 3S0XA 1BDJB 4P6IC 1OR3A 2HMQA 3K1HA 1Z6AA 4UDVA 5K0IA 2IM8A 3AG4C 3TULA 3KYJA 3M4BA 1NLXA 1CGOA 2NSFA 1E86A 4PJNA 4W8KA 3FOOA 3T6GB 3IQCA 1R4TA 4Q7CA 2V3CC 3AGTA 4JEAA 2A0BA 1HW2A 1YZAA 3G50A 3MLGA 4JTCB 5EGYA 5L3VA 3QTHA 1A7VA 3DWWA 3U9JA 1EQ1A 1YZCA 2L6HA 3PCVA 5L0FA 5DS4A 3C8GB 4D4NA 2HKVA 2YL0A 3ZTZA 4CS7A 4WABA 2HJMA 2H7OA 3T9OA 2W4BA 4EHPA 2NUPB 1D1BA 3JYYA 1Q0KA 3LUTB 2R7OA 3QVZA 4U5EE 3UMKA 3LJBA 3U3FA 1FMVA 1NU9C 5L3QA 1WOLA 3AQCA 3IHUA 5HSWA 2EILC 3U5SA 3R7CA 1O3UA 3S84A 1QSPA 2J7PA 2R7RA 3S27A 1ZZPA 3LEOA 2QTVA 3RKOF 2YLDA 1I5NA 1NG1A 1TQGA 1VB5A 2XM4A 3H65A 2TMVP 2UUHA 5DVWA 1KTMA 4J30B 3IQ6A 3MBGA 2CNWD 1LE2A 4KNVA 5B3SC 5F28E 4C3EA 2VH3A 1RXQA 2A1DD 2Z15A 4U5FE 1RJ9A 1ZHXA 5E2QA 2OU6A 1AEPA 4M63A 5B1BC 5T1DB 2HV6A 2YWAA 2XLMA 3L8IA 4Z9JA 3KMIA 3LEVA 1WASA 3JRMO 4LACB 2IXMA 3AG1C 4L6RA 3GM1A 3U2LA 2J46A 4G7HF 1WATA 3S29A 2E87A 3ZSUA 4JKVA 4H54A 4KC9A 4OIQF 2JX0A 3B0VC 1U0BB 1A0BA 3ABKC 4MTFA 1Y4CA 256BA 3OWTA 3WAQA 4YT8A 2PP4A 1T01A 3FHDA 2VB6A 2EIJC 4DBRA 3FDQA 4JCHA 4E7SA 3NKEA 2XL4A 2LCHA 4XEKA 1YDIA 5D91A 3JTLO 3VRCA 1QKRA 4JC7A 1YA9A 4E7ZA 5B3IA 5KYXA 2CYDA 2KNHA 4R32A 4RD9A 2QNLA 1WN0A 3EHMA 1TWCA 4JE9A 4JTDB 5AC5A 2DGJA 3DM9B 1G8XA 3JYHA 4G0HA 4KNWA 4HFKB 1D0YA 5A6KA 3LLKA 1UFBA 3FOPA 2VCBA 1YAUO 1VK5A 4MTOA 2EIMC 4HFFB 3F47A 3EG9B 2Q00A 3RW0A 4CDAA 4AK9A 3FVYA 4MTGA 1BZ4A 4Z9IA 3U3BA 3ZIBA 2KQ9A 1GQAA 4EBKA 3ZWIA 4G7OF 3Q7GA 3JSZA 3AG2C 4N4WA 3U9MA 3T6BA 4E17A 1LI7A 2YQYA 4A4AA 4DRJB 3AQBA 5KYWA 1LS4A 2FGYA 1YYXA 2XSEA 3I5QA 3V5YA 4DRIB 1ST6A 2IXPA 4B6IA 4ER9A 3NYMA 1FMWA 5AGFA 2OG2A 1ZU4A 2AU5A 3GANA 1OW7A 4O6MA 3EG9A 2YL1A 1WTYA 2RD9A 3Q6MA 3J06A 4JTAB 2XS1A 4K1OA 2CNWA 4CDVA 5HV9A 4E0HA 4NC3A 4CS8A 5A69A 4RBNA 2BL2A 3G4ZA 1HE9A 4OIOF 3QW1A 3SXMA 3TOMA 2EPMX 2MYSA 2IBFA 2XRHA 2YLGA 3RF3A 3KPHA 1RKEA 3Q7LA 4PJJA 2AWYA 4H4KC 4XPYA 1AVOB 1ZU5A 3KKBA 3C8ZA 1VOMA 1E2XA 1ZW3A 3M79A 4W8PA 4E0IA 2AWCA 2R7TA 3VF0A 2LFDA 1B68A 3HNKA 4LLCA 5L0GA 3V5ZA 4XEFA 3M15A 2Q9CA 3H2UA 4BJ1A 4CS8C 3NDBB 1LM3B 4I3MA 3DM5A 1M6TA 1L7CA 1UG7A 5CI9A 4U9DA 2OCCC 3EQLF 4BEJA 4I44A 3SZRA 1IW7F 2BE5F 5E33A 2OQMA 2LP4A 3GEEA 4O6NA 4CBEA 1L3PA 4DRHB 4EKWA 2B0HA 2QY9A 5FCLA 3US6A 2GA0A 5A6JA 3GWLA 1VYKA 1YVIA 2LSEA 3C63A 2RSEB 3ABMC 3TK0A 4FAPB 2G3KA 4PFPA 5KYUB 4DBQA 2CDQA 2GAQA 1ZHWA 2WB7A 2ZXRA 3AGUA 1FFTC 2G3VA 3ASNC 1SR2A 3EH1A 3IEEA 2Q7RA 1YJGA 2PFDA 4YJWA 4PJMA 1W2WA 3UNGC 2R7XA 1OKKA 1Z7Qc 2P7VA 2WZLA 4RDAA 5JLIA 1OQCA 1Z63A 3FMSA 3HKKA 4CS9A 2XXAA 2P0NA 4U5BE 3K33A 3DMDA 1M56C 2Y3HA 5GPGB 2P6VA 3BRJA 5L0DA 2L9JA 3G4XA 3CSKA 1H9GA 1SYQA 3GODA 2ZXOA 2WL8A 2R9RB 4BG0A 3ZQVA 5KYUA 1D1AA 4FWVA 2XLEA 3KL4A 3K1IA 5JT4A 1N1CA 1HW1A 1LE4A 2KK1A 3RH3A 4AL1A 4HE8D 4OIPF 3JSEO 3EGXA 2C04A 3IQTA 1ZW2A 1Q0FA 4YL0A 4DXWA 3EZHA 1Z23A 3SXZA 3DAGA 4JW1A 1WGWA 3W8HA 5IY5C 2J9UA 4CS9C 5JVEA 1VLTA 2DI3A 1RJ9B 2YHSA 3CAXA 2L81A 4MVZA 3QVYA 3UMIA 3X1OA 5DLJA 3DE9A 4BJ5A 4XWJA 2YL7A 2J0XA 1QZXA 3M4CA 5DQZA 1G4WR 1JRAA 2OEVA 2Y39A 4PACA 5L0IA 1TFKB 2JPUA 4IAOA 2D5RB 3K1IC 3C7JA 1XZPA 5JSLA 1H6GA 4NTFA 4DOZA 4J7YA 2Y3BA 3L1MA 1MMGA 3L0IA 4AE4A 3C62A 4JVSA 1H9TA 1ZVZA 3I5PA 2P1AA 1BR4A 2DYSC 1OCOC 2IXNA 2XL8A 2NUTA 3AJMA 1Z5ZA 2J9WA 5F5HA 5KYXB 1NU7D 2YRFA 4LDQA 5TJ5E 4BJ5C 3JT1A 1IZMA 4IRUA 4CJGA 1LKXA 2C03A 1DOWA 3C18A 4O6YA 3B9QA 4A2NB 1GS9A 1Q0MA 1NFOA 3A9CA 4BEMJ 2Y3GA 2HSQA 1Y6DA 3TQOA 1QVXA 2PNOA 1Q0GA 4IAQA 3POVA 2L6GA 3GM3A 2HFIA 3DE8A 5BQIA 4C3BA 5COFA 4N6CA 5KYWB 1OCZC 1YA7O 2ZD9A 4MVRA 5JUAA 4YT5A 1DOVA 1T9KA 3UGOA 3R2PA 1CPQA 2D4UA 3SXKA 1VYIA 1PD1A 3ABLC 1K04A 2X0CA 3WG7C 2KC3A 1MNDA 5DQTA 1OKKD 2EPOA 2YEVA 3B0UX 4D4XA 4I1OB 3LESA 4Q4ZF 4XLNF 5KYYB 4MNDA 3O10A 3JCUQ 3RQFA 3ASOC 2NSGA 3TOLA 1U6HA 3HNLA 4NTBA 1RKEB 3NYJA 1JPNA 4WJ0A 2XLVA 2R02A 3DD7A 3NG1A 4WGZA 1J8MF 3ZDLA 1FFHA 1MMDA 1QQ3A 1VMAA 2CGEA 2QLAA 3EFOA 2W45A 1KU2A 2GFHA 1JAFA 2FFHA 3RYLA 5KYYA 3W2WA 5DS6A 4HEAJ 5A6BA 3OEOA 3GEIA 5KYNA 2R03A 5E3AA 4JEBA 1H7IA 4NQFA 3MFNA 5CIVA 3CZ6A 1E85A 1GGQA 3RQEA 2KSFA 4C3DA 2PBEA 2HS5A 4FX5A 3W4YA 4JJGA 4QI2A 1S05A 2WVOA 4QDLA 4IGGA 5JS5A 4OD4A 5CI8A 1NSGB 3N0TA 2GWWA 3SNHA 4YK5A 5JP7A 2DYRC 1R5ID 1Z3IX 1YARO 2VC9A 4G7ZF 3MYIA 4YWQA 1V55C 3U8PA 3DJNB 5BUOA 4J32B 3MX3A 4DJ9A 2XXAB 1HE1A 1T6QA 3JRTA 2P61A 3NKDA 3EPVA 4IJJA 1U89A 4MS2A 2YLIA 2YVKA 1QLEC 2LIGA 2V26A 2ICWG 3B71A 3UMHA 1KNYA 4GEHA 3U0CA 2OJED 2XLWA 3EHNA 3GORA 1D0ZA 2IOQA 3SXYA 1LPEA 4PR9A 2X51A 2I15A 3EGXB 3GEHA 1T6UA 1M2VA 3DKAA 2Q3TA 3K7DA 4MVSA 3FAPB 2B0JA 1XWJA 1OR2A 2OKUA 4MVMA 4O7GA 5T3WA 4JJFA 3TD7A 1GM5A 4LDKA 2KYHA 3N24A 5A6AA 1FR0A 2J8WA 4JURI 3GWNA 1C03A 1PD0A 3RFYA 2M64A 1VTMP 1RMVA 1Q0DA 3W8IA 1ORSC 4N06A 2W9YA 2R05A 2WZGA 2OJQA 3VM6A 2W4MA 3S9OA 3EGDA 1OW8A 4LDRA 3LAYA 3HJCA 1LI5A 1OXKA 2GDCA 1SF8A 3HNJA 3N2ZB 2O9XA 4XPXA 4X0RA 3ZTMA 2XS8A 1PCXA 4XTKA 2IXOA 5DS5A 1D0XA 2G62A 3S90A 3VYWA 2A6HF 4U5CE 4YT2A 3UGPA 4ZLDA 4BJTA 1FTSA 4BJ6A 2ETSA 4AE4B 1TWGA 2R25A 4OINF 4P9FA 1FNTc 3B0PA 2NUTB 4NY3A 2XL6A 4NCQA 1TWHA 2HUJA 1OXBA 1G5ZA 2A68F 1MNEA 4C7OA 4I1MA 2KW3C 1CGME 3AG3C 1SMYF 2NG1A 4WGYA 4ANJA 1TKNA 1BR2A 4O79A 3NYLA 2XLDA 2Y3DA 1T6IA 2ASRA 4DVYP 3WODF 2AP3A 4EBJA 1TFOB 4AL0A 2HMZA 1BBHA 3LNRA 3M1CB 5D92A 4K0DA 1S7ZA 3ZQYA 4BJ6C 5A6BD 3I4UA 5EHHA 2J9VA 4JIOA 4XLPF 3DZAA 2JD3A 3QMKA 1FAPB 1VLSA 4JZAA 3RQGA 1V74B 4KBLA 3U8VA 4CIPA 4U5DE 5JRAA 3ATPA 1V54C 2Y69C 1HMDA 4GQHA 2OOCA 2EINC
chains in the Genus database with same CATH topology
3U5SA 3R7CA 3W4YA 3O55A 1OQCA 1JR8A 1JRAA 4E0IA 3LLIA 3TD7A 4LDKA 3GWNA 3MBGA 3U2MA 3LLKA 4E0HA 3GWLA 2HJ3A 3TK0A 3U2LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U5S A;  3R7C A;  3W4Y A;  3O55 A;  1OQC A;  1JR8 A;  1JRA A;  4E0I A;  3LLI A;  3TD7 A;  4LDK A;  3GWN A;  3MBG A;  3U2M A;  3LLK A;  4E0H A;  3GWL A;  2HJ3 A;  3TK0 A;  3U2L A; 
#chains in the Genus database with same CATH topology
 2I8B A;  1K40 A;  3O6X A;  4EUK B;  2OEX A;  1CGN A;  4OIR F;  3C8G A;  2HV7 A;  3KH2 A;  4F4B A;  2QE9 A;  1ORJ A;  4U5H A;  3LLI A;  3NMI A;  5COM A;  5L0J A;  4FES A;  1NFN A;  2WVN A;  4EIY A;  3UR3 C;  1ZHY A;  2Q9B A;  1K05 A;  2NUP A;  3U2M A;  4PK4 A;  3CEX A;  1A7E A;  2LFF A;  2J0W A;  2YZS A;  4AX2 A;  3T4R A;  3HLZ A;  1ORY A;  3IPM O;  5COG A;  3HNI A;  1I4Z A;  1YYJ A;  3KYI A;  4IAR A;  2A0U A;  4YN0 B;  2MHR A;  4EWC A;  3EZI A;  2HJ3 A;  2L7A A;  2LQG A;  3DAF A;  1LIH A;  2HZ8 A;  3F46 A;  4GYT A;  4N6H A;  4CDY A;  4CIH A;  3T6J A;  3WHN A;  4E18 A;  5BQH A;  2H7B A;  2XLO A;  3LS0 A;  1EA8 A;  1ZHZ A;  2DB4 A;  3EFO B;  4MVU A;  4XPW A;  3DI5 A;  1C02 A;  1PV3 A;  3E70 C;  4CJO A;  3ECS A;  3FXH A;  1NBB A;  2AVK A;  1MQV A;  2J9B A;  1APC A;  3MYF A;  1BR1 A;  4LER A;  1G4U S;  4QI0 A;  5E3C A;  3SEO A;  2R7S A;  2ZXW C;  2PX3 A;  2VCC A;  3B29 A;  3AOU A;  1OW6 A;  2R7W A;  3SP1 A;  4BPM A;  4MQ9 F;  1EI7 A;  1V4A A;  1HMO A;  4Z9H A;  1WWP A;  2YL3 A;  4XEV A;  1C17 M;  3RIP A;  3TJ6 A;  2H8A A;  5L0H A;  1M57 C;  3X2Q C;  4DVZ A;  5AC4 A;  3CQZ A;  3V5X A;  5EK0 A;  4EBB A;  1ZYR F;  3K6B A;  2R7U A;  1JOG A;  3SYN A;  3BEH A;  2PF4 E;  1O87 A;  3E9V A;  2R7V A;  4IB4 A;  3NMK A;  3IQ5 A;  2VCA A;  2FAP B;  4CSA A;  3EJN A;  1NZE A;  2HSB A;  3NRH A;  3QZC A;  5L0C A;  4LLE A;  4MVO A;  5F5F A;  1J8Y F;  4PJL A;  3S28 A;  3TJ5 A;  3JZ0 A;  1JR8 A;  1TR2 A;  3QW0 A;  4CX9 A;  1I4Y A;  2YKZ A;  2ZXP A;  3LNM B;  4PFO A;  4OD5 A;  4YT4 A;  4XQ1 A;  3Q6N A;  2BC5 A;  2LK4 A;  1RKC A;  2EPL X;  2KJG A;  2PX0 A;  4IWB A;  4U5G A;  2NPU A;  4NTA A;  4KI2 A;  2L6F A;  1LVK A;  1ZHT A;  3ITF A;  1XZQ A;  4ULW A;  4JCZ A;  3DXJ F;  1LS1 A;  1M2V B;  2QUP A;  3HTK C;  4K7B A;  3PDM P;  1EKY A;  5FZT A;  1SZI A;  4J7T A;  3ZC4 A;  3PHF 2;  4CSA C;  2UUI A;  4YL3 A;  1D1C A;  4YL1 A;  1QPU A;  1A41 A;  1YLM A;  2EPK X;  3DJU B;  3EH2 A;  3V7O A;  2J45 A;  3PMR A;  3L8J A;  2R7Q A;  1OCC C;  1M2O A;  2WVQ A;  3EGD B;  4ZLC A;  5B1A C;  2J7P D;  2EPN A;  3RVY A;  3LS1 A;  1E84 A;  2Q4F A;  3C8G D;  2M4E A;  4ONS A;  2CW0 F;  1JPJ A;  4P9T A;  1F1M A;  2A6E F;  3O55 A;  2A69 F;  1JMW A;  2LD6 A;  4G78 A;  2XM0 A;  3VAY A;  2CCY A;  1MMA A;  1RCP A;  3ZG1 A;  4MW3 A;  2IYL D;  3ZVR A;  2KGO A;  2EIK C;  1T5O A;  1AUE A;  2F22 A;  4ULV A;  3W2V A;  4U9E A;  1E83 A;  1A7D A;  2VAS A;  3L34 A;  5BQG A;  2MWQ A;  1TWA A;  5T3T A;  4MVQ A;  4MW8 A;  2XLH A;  3A11 A;  1O5H A;  2ZPA A;  3NMJ A;  1CPR A;  4C7O B;  1OCR C;  3OA1 A;  1HY5 A;  3H2V A;  3FAJ A;  4JRZ A;  1MMN A;  3RVZ A;  2Q9A A;  3GM2 A;  2WZF A;  3K66 A;  4Q5S F;  2H7V C;  3O39 A;  3S0X A;  1BDJ B;  4P6I C;  1OR3 A;  2HMQ A;  3K1H A;  1Z6A A;  4UDV A;  5K0I A;  2IM8 A;  3AG4 C;  3TUL A;  3KYJ A;  3M4B A;  1NLX A;  1CGO A;  2NSF A;  1E86 A;  4PJN A;  4W8K A;  3FOO A;  3T6G B;  3IQC A;  1R4T A;  4Q7C A;  2V3C C;  3AGT A;  4JEA A;  2A0B A;  1HW2 A;  1YZA A;  3G50 A;  3MLG A;  4JTC B;  5EGY A;  5L3V A;  3QTH A;  1A7V A;  3DWW A;  3U9J A;  1EQ1 A;  1YZC A;  2L6H A;  3PCV A;  5L0F A;  5DS4 A;  3C8G B;  4D4N A;  2HKV A;  2YL0 A;  3ZTZ A;  4CS7 A;  4WAB A;  2HJM A;  2H7O A;  3T9O A;  2W4B A;  4EHP A;  2NUP B;  1D1B A;  3JYY A;  1Q0K A;  3LUT B;  2R7O A;  3QVZ A;  4U5E E;  3UMK A;  3LJB A;  3U3F A;  1FMV A;  1NU9 C;  5L3Q A;  1WOL A;  3AQC A;  3IHU A;  5HSW A;  2EIL C;  3U5S A;  3R7C A;  1O3U A;  3S84 A;  1QSP A;  2J7P A;  2R7R A;  3S27 A;  1ZZP A;  3LEO A;  2QTV A;  3RKO F;  2YLD A;  1I5N A;  1NG1 A;  1TQG A;  1VB5 A;  2XM4 A;  3H65 A;  2TMV P;  2UUH A;  5DVW A;  1KTM A;  4J30 B;  3IQ6 A;  3MBG A;  2CNW D;  1LE2 A;  4KNV A;  5B3S C;  5F28 E;  4C3E A;  2VH3 A;  1RXQ A;  2A1D D;  2Z15 A;  4U5F E;  1RJ9 A;  1ZHX A;  5E2Q A;  2OU6 A;  1AEP A;  4M63 A;  5B1B C;  5T1D B;  2HV6 A;  2YWA A;  2XLM A;  3L8I A;  4Z9J A;  3KMI A;  3LEV A;  1WAS A;  3JRM O;  4LAC B;  2IXM A;  3AG1 C;  4L6R A;  3GM1 A;  3U2L A;  2J46 A;  4G7H F;  1WAT A;  3S29 A;  2E87 A;  3ZSU A;  4JKV A;  4H54 A;  4KC9 A;  4OIQ F;  2JX0 A;  3B0V C;  1U0B B;  1A0B A;  3ABK C;  4MTF A;  1Y4C A;  256B A;  3OWT A;  3WAQ A;  4YT8 A;  2PP4 A;  1T01 A;  3FHD A;  2VB6 A;  2EIJ C;  4DBR A;  3FDQ A;  4JCH A;  4E7S A;  3NKE A;  2XL4 A;  2LCH A;  4XEK A;  1YDI A;  5D91 A;  3JTL O;  3VRC A;  1QKR A;  4JC7 A;  1YA9 A;  4E7Z A;  5B3I A;  5KYX A;  2CYD A;  2KNH A;  4R32 A;  4RD9 A;  2QNL A;  1WN0 A;  3EHM A;  1TWC A;  4JE9 A;  4JTD B;  5AC5 A;  2DGJ A;  3DM9 B;  1G8X A;  3JYH A;  4G0H A;  4KNW A;  4HFK B;  1D0Y A;  5A6K A;  3LLK A;  1UFB A;  3FOP A;  2VCB A;  1YAU O;  1VK5 A;  4MTO A;  2EIM C;  4HFF B;  3F47 A;  3EG9 B;  2Q00 A;  3RW0 A;  4CDA A;  4AK9 A;  3FVY A;  4MTG A;  1BZ4 A;  4Z9I A;  3U3B A;  3ZIB A;  2KQ9 A;  1GQA A;  4EBK A;  3ZWI A;  4G7O F;  3Q7G A;  3JSZ A;  3AG2 C;  4N4W A;  3U9M A;  3T6B A;  4E17 A;  1LI7 A;  2YQY A;  4A4A A;  4DRJ B;  3AQB A;  5KYW A;  1LS4 A;  2FGY A;  1YYX A;  2XSE A;  3I5Q A;  3V5Y A;  4DRI B;  1ST6 A;  2IXP A;  4B6I A;  4ER9 A;  3NYM A;  1FMW A;  5AGF A;  2OG2 A;  1ZU4 A;  2AU5 A;  3GAN A;  1OW7 A;  4O6M A;  3EG9 A;  2YL1 A;  1WTY A;  2RD9 A;  3Q6M A;  3J06 A;  4JTA B;  2XS1 A;  4K1O A;  2CNW A;  4CDV A;  5HV9 A;  4E0H A;  4NC3 A;  4CS8 A;  5A69 A;  4RBN A;  2BL2 A;  3G4Z A;  1HE9 A;  4OIO F;  3QW1 A;  3SXM A;  3TOM A;  2EPM X;  2MYS A;  2IBF A;  2XRH A;  2YLG A;  3RF3 A;  3KPH A;  1RKE A;  3Q7L A;  4PJJ A;  2AWY A;  4H4K C;  4XPY A;  1AVO B;  1ZU5 A;  3KKB A;  3C8Z A;  1VOM A;  1E2X A;  1ZW3 A;  3M79 A;  4W8P A;  4E0I A;  2AWC A;  2R7T A;  3VF0 A;  2LFD A;  1B68 A;  3HNK A;  4LLC A;  5L0G A;  3V5Z A;  4XEF A;  3M15 A;  2Q9C A;  3H2U A;  4BJ1 A;  4CS8 C;  3NDB B;  1LM3 B;  4I3M A;  3DM5 A;  1M6T A;  1L7C A;  1UG7 A;  5CI9 A;  4U9D A;  2OCC C;  3EQL F;  4BEJ A;  4I44 A;  3SZR A;  1IW7 F;  2BE5 F;  5E33 A;  2OQM A;  2LP4 A;  3GEE A;  4O6N A;  4CBE A;  1L3P A;  4DRH B;  4EKW A;  2B0H A;  2QY9 A;  5FCL A;  3US6 A;  2GA0 A;  5A6J A;  3GWL A;  1VYK A;  1YVI A;  2LSE A;  3C63 A;  2RSE B;  3ABM C;  3TK0 A;  4FAP B;  2G3K A;  4PFP A;  5KYU B;  4DBQ A;  2CDQ A;  2GAQ A;  1ZHW A;  2WB7 A;  2ZXR A;  3AGU A;  1FFT C;  2G3V A;  3ASN C;  1SR2 A;  3EH1 A;  3IEE A;  2Q7R A;  1YJG A;  2PFD A;  4YJW A;  4PJM A;  1W2W A;  3UNG C;  2R7X A;  1OKK A;  1Z7Q c;  2P7V A;  2WZL A;  4RDA A;  5JLI A;  1OQC A;  1Z63 A;  3FMS A;  3HKK A;  4CS9 A;  2XXA A;  2P0N A;  4U5B E;  3K33 A;  3DMD A;  1M56 C;  2Y3H A;  5GPG B;  2P6V A;  3BRJ A;  5L0D A;  2L9J A;  3G4X A;  3CSK A;  1H9G A;  1SYQ A;  3GOD A;  2ZXO A;  2WL8 A;  2R9R B;  4BG0 A;  3ZQV A;  5KYU A;  1D1A A;  4FWV A;  2XLE A;  3KL4 A;  3K1I A;  5JT4 A;  1N1C A;  1HW1 A;  1LE4 A;  2KK1 A;  3RH3 A;  4AL1 A;  4HE8 D;  4OIP F;  3JSE O;  3EGX A;  2C04 A;  3IQT A;  1ZW2 A;  1Q0F A;  4YL0 A;  4DXW A;  3EZH A;  1Z23 A;  3SXZ A;  3DAG A;  4JW1 A;  1WGW A;  3W8H A;  5IY5 C;  2J9U A;  4CS9 C;  5JVE A;  1VLT A;  2DI3 A;  1RJ9 B;  2YHS A;  3CAX A;  2L81 A;  4MVZ A;  3QVY A;  3UMI A;  3X1O A;  5DLJ A;  3DE9 A;  4BJ5 A;  4XWJ A;  2YL7 A;  2J0X A;  1QZX A;  3M4C A;  5DQZ A;  1G4W R;  1JRA A;  2OEV A;  2Y39 A;  4PAC A;  5L0I A;  1TFK B;  2JPU A;  4IAO A;  2D5R B;  3K1I C;  3C7J A;  1XZP A;  5JSL A;  1H6G A;  4NTF A;  4DOZ A;  4J7Y A;  2Y3B A;  3L1M A;  1MMG A;  3L0I A;  4AE4 A;  3C62 A;  4JVS A;  1H9T A;  1ZVZ A;  3I5P A;  2P1A A;  1BR4 A;  2DYS C;  1OCO C;  2IXN A;  2XL8 A;  2NUT A;  3AJM A;  1Z5Z A;  2J9W A;  5F5H A;  5KYX B;  1NU7 D;  2YRF A;  4LDQ A;  5TJ5 E;  4BJ5 C;  3JT1 A;  1IZM A;  4IRU A;  4CJG A;  1LKX A;  2C03 A;  1DOW A;  3C18 A;  4O6Y A;  3B9Q A;  4A2N B;  1GS9 A;  1Q0M A;  1NFO A;  3A9C A;  4BEM J;  2Y3G A;  2HSQ A;  1Y6D A;  3TQO A;  1QVX A;  2PNO A;  1Q0G A;  4IAQ A;  3POV A;  2L6G A;  3GM3 A;  2HFI A;  3DE8 A;  5BQI A;  4C3B A;  5COF A;  4N6C A;  5KYW B;  1OCZ C;  1YA7 O;  2ZD9 A;  4MVR A;  5JUA A;  4YT5 A;  1DOV A;  1T9K A;  3UGO A;  3R2P A;  1CPQ A;  2D4U A;  3SXK A;  1VYI A;  1PD1 A;  3ABL C;  1K04 A;  2X0C A;  3WG7 C;  2KC3 A;  1MND A;  5DQT A;  1OKK D;  2EPO A;  2YEV A;  3B0U X;  4D4X A;  4I1O B;  3LES A;  4Q4Z F;  4XLN F;  5KYY B;  4MND A;  3O10 A;  3JCU Q;  3RQF A;  3ASO C;  2NSG A;  3TOL A;  1U6H A;  3HNL A;  4NTB A;  1RKE B;  3NYJ A;  1JPN A;  4WJ0 A;  2XLV A;  2R02 A;  3DD7 A;  3NG1 A;  4WGZ A;  1J8M F;  3ZDL A;  1FFH A;  1MMD A;  1QQ3 A;  1VMA A;  2CGE A;  2QLA A;  3EFO A;  2W45 A;  1KU2 A;  2GFH A;  1JAF A;  2FFH A;  3RYL A;  5KYY A;  3W2W A;  5DS6 A;  4HEA J;  5A6B A;  3OEO A;  3GEI A;  5KYN A;  2R03 A;  5E3A A;  4JEB A;  1H7I A;  4NQF A;  3MFN A;  5CIV A;  3CZ6 A;  1E85 A;  1GGQ A;  3RQE A;  2KSF A;  4C3D A;  2PBE A;  2HS5 A;  4FX5 A;  3W4Y A;  4JJG A;  4QI2 A;  1S05 A;  2WVO A;  4QDL A;  4IGG A;  5JS5 A;  4OD4 A;  5CI8 A;  1NSG B;  3N0T A;  2GWW A;  3SNH A;  4YK5 A;  5JP7 A;  2DYR C;  1R5I D;  1Z3I X;  1YAR O;  2VC9 A;  4G7Z F;  3MYI A;  4YWQ A;  1V55 C;  3U8P A;  3DJN B;  5BUO A;  4J32 B;  3MX3 A;  4DJ9 A;  2XXA B;  1HE1 A;  1T6Q A;  3JRT A;  2P61 A;  3NKD A;  3EPV A;  4IJJ A;  1U89 A;  4MS2 A;  2YLI A;  2YVK A;  1QLE C;  2LIG A;  2V26 A;  2ICW G;  3B71 A;  3UMH A;  1KNY A;  4GEH A;  3U0C A;  2OJE D;  2XLW A;  3EHN A;  3GOR A;  1D0Z A;  2IOQ A;  3SXY A;  1LPE A;  4PR9 A;  2X51 A;  2I15 A;  3EGX B;  3GEH A;  1T6U A;  1M2V A;  3DKA A;  2Q3T A;  3K7D A;  4MVS A;  3FAP B;  2B0J A;  1XWJ A;  1OR2 A;  2OKU A;  4MVM A;  4O7G A;  5T3W A;  4JJF A;  3TD7 A;  1GM5 A;  4LDK A;  2KYH A;  3N24 A;  5A6A A;  1FR0 A;  2J8W A;  4JUR I;  3GWN A;  1C03 A;  1PD0 A;  3RFY A;  2M64 A;  1VTM P;  1RMV A;  1Q0D A;  3W8I A;  1ORS C;  4N06 A;  2W9Y A;  2R05 A;  2WZG A;  2OJQ A;  3VM6 A;  2W4M A;  3S9O A;  3EGD A;  1OW8 A;  4LDR A;  3LAY A;  3HJC A;  1LI5 A;  1OXK A;  2GDC A;  1SF8 A;  3HNJ A;  3N2Z B;  2O9X A;  4XPX A;  4X0R A;  3ZTM A;  2XS8 A;  1PCX A;  4XTK A;  2IXO A;  5DS5 A;  1D0X A;  2G62 A;  3S90 A;  3VYW A;  2A6H F;  4U5C E;  4YT2 A;  3UGP A;  4ZLD A;  4BJT A;  1FTS A;  4BJ6 A;  2ETS A;  4AE4 B;  1TWG A;  2R25 A;  4OIN F;  4P9F A;  1FNT c;  3B0P A;  2NUT B;  4NY3 A;  2XL6 A;  4NCQ A;  1TWH A;  2HUJ A;  1OXB A;  1G5Z A;  2A68 F;  1MNE A;  4C7O A;  4I1M A;  2KW3 C;  1CGM E;  3AG3 C;  1SMY F;  2NG1 A;  4WGY A;  4ANJ A;  1TKN A;  1BR2 A;  4O79 A;  3NYL A;  2XLD A;  2Y3D A;  1T6I A;  2ASR A;  4DVY P;  3WOD F;  2AP3 A;  4EBJ A;  1TFO B;  4AL0 A;  2HMZ A;  1BBH A;  3LNR A;  3M1C B;  5D92 A;  4K0D A;  1S7Z A;  3ZQY A;  4BJ6 C;  5A6B D;  3I4U A;  5EHH A;  2J9V A;  4JIO A;  4XLP F;  3DZA A;  2JD3 A;  3QMK A;  1FAP B;  1VLS A;  4JZA A;  3RQG A;  1V74 B;  4KBL A;  3U8V A;  4CIP A;  4U5D E;  5JRA A;  3ATP A;  1V54 C;  2Y69 C;  1HMD A;  4GQH A;  2OOC A;  2EIN C; 
#chains in the Genus database with same CATH homology
 3U5S A;  3R7C A;  3W4Y A;  3O55 A;  1OQC A;  1JR8 A;  1JRA A;  4E0I A;  3LLI A;  3TD7 A;  4LDK A;  3GWN A;  3MBG A;  3U2M A;  3LLK A;  4E0H A;  3GWL A;  2HJ3 A;  3TK0 A;  3U2L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...