3U2LA

Crystal structure of human alr mutant c142s.
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
115
structure length
115
Chain Sequence
FREDCPPDREELGRHSWAVLHTLAAYYPDLPTPEQQQDMAQFIHLFSKFYPSEECAEDLRKRLARNHPDTRTRAAFTQWLCHLHNEVNRKLGKPDFDCSKVDERWRDGWKDGSCD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An electron-transfer path through an extended disulfide relay system: the case of the redox protein ALR.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Flavoprotein
molecule keywords FAD-linked sulfhydryl oxidase ALR
total genus 42
structure length 115
sequence length 115
ec nomenclature ec 1.8.3.2: Thiol oxidase.
pdb deposition date 2011-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04777 Evr1_Alr Erv1 / Alr family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.310 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) ERV/ALR sulfhydryl oxidase domain 3u2lA00
4E0IA 1OQCA 2HJ3A 3O55A 1JRAA 4LDKA 3U2LA 4E0HA 3TD7A 3MBGA 3LLIA 3W4YA 3U2MA 3TK0A 3R7CA 3U5SA 1JR8A 3GWNA 3GWLA 3LLKA
chains in the Genus database with same CATH superfamily
4WJ0A 3V5ZA 2AU5A 1A7EA 1ST6A 1MMAA 5DLJA 1JOGA 4MVOA 4XPXA 2NUPA 4CIHA 2QLAA 3JSEO 2XL8A 4DVYP 3T6JA 3SYNA 2XSEA 4C3DA 1SYQA 4N06A 3S90A 1ZHTA 2J9BA 4LERA 3DWWA 2JPUA 3KYJA 1CGOA 2XM0A 2DYSC 2Q00A 3AJMA 4B6IA 4D4XA 3L34A 3ZG1A 4EBJA 3RH3A 3IQ5A 2XLHA 1WGWA 1EI7A 1M2VA 2HV6A 3EGDB 4JW1A 3A9CA 4U5EE 3T4RA 1DOVA 1BBHA 1V54C 4NC3A 5D91A 4JTAB 3DAGA 1K40A 2XS8A 2RSEB 2WL8A 2A0UA 4AX2A 2NUTA 2VASA 2IBFA 2YWAA 2ETSA 2YL0A 2V3CC 4O6MA 1QLEC 2XL4A 1RJ9A 2J46A 2PP4A 4G78A 2ZPAA 3AG3C 4LDKA 4RBNA 3DD7A 4GQHA 2WZFA 3KH2A 4Z9IA 2CYDA 3SXMA 3ZQYA 3ZVRA 4YL0A 1HE1A 1ZHXA 1ZW2A 1B68A 2Q9BA 5KYUA 3U9MA 5B3SC 3W2WA 3EGXA 3M79A 3LEVA 3WHNA 1CPRA 2JD3A 3SP1A 1NU9C 2PX0A 2B0JA 1BDJB 3NYMA 3ZC4A 1VYKA 3EQLF 3ZTMA 4DBQA 2LFFA 5FZTA 4H4KC 3ZIBA 3NKDA 2WZGA 4EHPA 2UUHA 4CSAA 2R25A 1WOLA 2E87A 2MYSA 3EG9B 3FMSA 4O6NA 2C04A 3CAXA 4PFOA 4BJ6A 3H65A 5EHHA 1EKYA 1FTSA 3ZQVA 4EUKB 4OIQF 4MS2A 1D1CA 3S29A 4KI2A 2FFHA 2OEVA 3G4ZA 2Y69C 3JCUQ 4MVUA 4PJNA 1VOMA 1Q0KA 2EPLX 4L6RA 3LLIA 5E3AA 2VB6A 1GS9A 2QTVA 4W8PA 1D1AA 4CS9A 1LE4A 2BC5A 2LFDA 3DM9B 3FAJA 3TJ5A 1XZPA 1H6GA 4YJWA 4GEHA 5COFA 3NG1A 4JIOA 4CBEA 1NBBA 1Y6DA 2L9JA 4HE8D 1RMVA 3RVYA 1FMVA 3GORA 4CS8A 4E7ZA 3MBGA 4DRIB 1VK5A 2G62A 1LI7A 2XXAB 3B0VC 2KJGA 2QE9A 3EZIA 3HLZA 3JSZA 1OCRC 3UMHA 4N6HA 4PFPA 1T9KA 2PNOA 2V26A 1YYJA 2KK1A 3DI5A 3SXYA 4NY3A 2H7VC 1WATA 2R02A 4LDQA 3B0PA 2CNWA 1JPJA 4O79A 5D92A 3S0XA 2A0BA 2OJQA 1Z63A 1VMAA 5BQHA 1OW7A 3AOUA 1YARO 2EINC 1O87A 2AVKA 1OXKA 4NTAA 5A6JA 4IB4A 4NTBA 4UDVA 3UR3C 2Q7RA 2VC9A 3AG4C 2AWYA 4HFKB 1K05A 3IQTA 2J0XA 1MMDA 2Y3DA 3LNRA 2Y39A 4MVQA 1M57C 2WB7A 1T6UA 1FFHA 2WZLA 1K04A 2EIJC 5KYUB 3EHNA 4H54A 5KYYA 1AEPA 3ECSA 1M2VB 3RW0A 1O3UA 2FGYA 2JX0A 3O6XA 4JRZA 4MVMA 4P9FA 4IJJA 3M4BA 1OR2A 2W4BA 2NSFA 2XLEA 2YVKA 4XEFA 4DBRA 2Q9CA 5KYXA 1FNTc 2XM4A 1T6IA 2XRHA 2G3KA 1TWGA 2ZXWC 3ABMC 1Z7Qc 3RF3A 4EBBA 5KYNA 2OOCA 4BJTA 4O7GA 1HY5A 3JYHA 2P0NA 4MVRA 4FESA 3TULA 3JTLO 1LI5A 4CX9A 5KYWB 4QI2A 4JKVA 2HS5A 2QNLA 3FVYA 1OCZC 4AK9A 1E83A 1RKEB 2EPNA 4FWVA 1Z6AA 3PHF2 1SZIA 2KQ9A 3Q6MA 4JJGA 4U5DE 3SEOA 5AC4A 2HMZA 2XLVA 3AGTA 2J9VA 4U5BE 5COMA 4ZLCA 3GEEA 5BUOA 4IGGA 3I5QA 5L0FA 3AG1C 2NUPB 4U5FE 3TD7A 4EKWA 5A6KA 4WABA 1MMGA 5CI9A 3EZHA 3NYLA 1IW7F 4BG0A 4LDRA 3W4YA 1MNEA 3MYIA 3H2UA 3U2MA 4CDVA 3MFNA 5B1AC 2QUPA 3ATPA 1XWJA 4BJ1A 2QY9A 5JSLA 1VB5A 4YL3A 3S27A 3DXJF 1Z23A 4CJOA 1RKCA 1RXQA 3MLGA 3OWTA 2XLDA 4LACB 1M2OA 4LLEA 3ZTZA 5L0JA 3U0CA 2IXPA 2PFDA 3C8ZA 3WODF 3UGOA 2GAQA 1UFBA 1ZZPA 2NUTB 1TWAA 3L0IA 3K33A 2EPMX 3IEEA 3A11A 2HSBA 2X51A 3ITFA 4OIPF 3DM5A 4KC9A 4BPMA 3QTHA 3KMIA 4HFFB 5AGFA 3C8GB 3RQGA 1BZ4A 1QPUA 2A1DD 4K7BA 4OINF 3LNMB 3T6BA 3NMKA 5DS4A 3NKEA 4XPYA 3C63A 3O10A 2M64A 1I4YA 1TFOB 2LD6A 5COGA 4NTFA 1HW1A 1M6TA 1OW6A 3FDQA 3LS1A 1FAPB 1H9GA 4O6YA 1WTYA 3VRCA 2WVOA 1VYIA 1RJ9B 3BRJA 3DZAA 3GWLA 4Z9HA 4IRUA 2L6FA 4GYTA 4JCZA 4XQ1A 4NCQA 2AP3A 4JTDB 1JR8A 3F46A 3QVYA 3FOPA 1G8XA 3EGXB 1E2XA 5AC5A 1XZQA 2OKUA 1N1CA 4JEBA 4BEMJ 3UGPA 3EPVA 2X0CA 4IARA 3E9VA 2OG2A 1TFKB 1KTMA 1A41A 3SNHA 3SXKA 2OCCC 3AQBA 3C18A 3RYLA 1ZU4A 1Q0GA 3EJNA 4AL0A 4YT2A 4J30B 5DS6A 5A6BA 4A4AA 2YKZA 3FXHA 4ONSA 2XXAA 4MTOA 3J06A 1KNYA 3H2VA 256BA 4DRJB 2VH3A 3HNJA 1OR3A 2HSQA 4P9TA 3G4XA 3K7DA 1AUEA 1JPNA 3U8PA 1ZVZA 3JRTA 1RCPA 3L1MA 2EILC 3ABLC 4PK4A 5JP7A 3TK0A 2R7SA 3GANA 3I5PA 1NU7D 2ZXPA 3T6GB 2J0WA 4E7SA 2HJMA 3ZDLA 1Q0DA 2VCBA 5JRAA 2KYHA 3EH2A 4Q4ZF 1HW2A 2IM8A 4LLCA 1VTMP 4JE9A 1EQ1A 1YVIA 4I1OB 3RFYA 3G50A 3V5YA 1OQCA 4BJ6C 1D0XA 5BQGA 4CSAC 4MQ9F 4OD5A 4R32A 3U3BA 1ZW3A 2ZXRA 1C17M 2HUJA 3KPHA 4DXWA 2Y3HA 5CIVA 4XWJA 5L0IA 3ZWIA 4JCHA 2LIGA 2XLOA 1BR1A 2L81A 1Z3IX 4FX5A 4AE4B 2ZXOA 3B29A 3C62A 3QVZA 3SZRA 1WWPA 2YEVA 1ZHWA 3S9OA 3KKBA 1YAUO 3JYYA 3RVZA 1D1BA 1TQGA 2R7WA 2R05A 1C03A 1T6QA 2J45A 3R7CA 3DKAA 2G3VA 3GWNA 5E3CA 3QW1A 4IWBA 4A2NB 5FCLA 3U9JA 3DJUB 3LESA 1Y4CA 4E17A 3N24A 2YLDA 3VYWA 1YZCA 3ZSUA 2LQGA 2DB4A 2LCHA 4CS8C 1YZAA 2EIKC 3C7JA 1Q0FA 1JRAA 3Q6NA 3Q7GA 4XPWA 1ZHYA 1BR2A 4G0HA 2ZD9A 1TWCA 4U5GA 3DMDA 3FHDA 5IY5C 3C8GD 2W4MA 3U5SA 4G7HF 1ZU5A 1WN0A 3K6BA 4E0IA 2F22A 2HJ3A 5B1BC 5T3TA 1JAFA 4EBKA 2YZSA 3ASNC 1KU2A 3US6A 5L3QA 5DS5A 1LM3B 1NG1A 3M15A 1MNDA 4ANJA 2XL6A 5F28E 3BEHA 2HV7A 2KW3C 4YT8A 3WAQA 1F1MA 4WGZA 4I44A 3KL4A 4F4BA 2BL2A 3B9QA 1LPEA 3IQCA 4MW8A 2IOQA 4AL1A 4BEJA 4FAPB 3QW0A 1H9TA 2B0HA 2OEXA 3VAYA 2HFIA 1A7VA 1QZXA 2XLMA 2DI3A 1L3PA 1H7IA 4W8KA 3SXZA 1ZHZA 4JTCB 4E0HA 4J32B 4MVZA 1WASA 1YLMA 5T3WA 3EH1A 2R9RB 3AG2C 4MNDA 4YWQA 2KSFA 5K0IA 1CGME 1EA8A 3E70C 3JRMO 3MX3A 4YK5A 4CJGA 2IXNA 3EFOA 4CS7A 2Q9AA 4HEAJ 4C7OA 2J9UA 2OJED 4Z9JA 3GODA 2YLGA 3T9OA 2AWCA 3C8GA 4C7OB 3X1OA 2LK4A 3LAYA 3HNLA 1OCCC 3GM3A 2L6HA 3FOOA 2H7OA 5E33A 3U8VA 3KYIA 4JZAA 2R7XA 3FAPB 4XTKA 2CW0F 1IZMA 3NMIA 1T01A 5T1DB 1ORJA 4D4NA 5L0DA 2IXMA 3V7OA 4OIOF 1LE2A 1PV3A 1YA7O 2I8BA 2RD9A 2R7QA 2WVQA 1YA9A 5A69A 1FMWA 5CI8A 1E84A 3V5XA 2A6HF 1NFOA 3K1HA 1APCA 4J7YA 4U5HA 3TQOA 3VM6A 5EK0A 4CDAA 4CS9C 3ABKC 2R7TA 1I4ZA 2KC3A 3B71A 4I3MA 4MTGA 4E18A 1SR2A 4OD4A 5GPGB 3CZ6A 1YDIA 4ULVA 3DE8A 5E2QA 3CEXA 2NPUA 1J8YF 4IAQA 4U9EA 5DQZA 5JVEA 1CGNA 5HSWA 1V74B 3HTKC 4PJJA 1V55C 1T5OA 4X0RA 1V4AA 5L0GA 2IYLD 4I1MA 2EIMC 1DOWA 1QVXA 2KGOA 4DJ9A 3PDMP 3AQCA 2ICWG 1HMOA 1OXBA 2YRFA 3K1IA 1C02A 1G5ZA 3W2VA 2YL3A 3NMJA 2R03A 1JMWA 2DGJA 2YHSA 3DE9A 3PMRA 2Y3GA 4JVSA 3OEOA 4OIRF 1S05A 2CGEA 4BJ5A 1W2WA 4XLPF 3EFOB 5L0CA 3NRHA 4JURI 3NDBB 1YYXA 1YJGA 2W9YA 1QSPA 3K66A 3M4CA 5BQIA 3IQ6A 3RQEA 4M63A 4KBLA 1J8MF 4KNWA 3HNKA 3EG9A 2DYRC 3LUTB 2WVNA 4CDYA 3F47A 1BR4A 4DRHB 4JC7A 1RKEA 5EGYA 1VLSA 2P6VA 1NLXA 2L6GA 2ASRA 4YT5A 2R7VA 2EPKX 2IXOA 2GDCA 2J7PA 2XS1A 3LEOA 4JJFA 2TMVP 5B3IA 5JS5A 3NYJA 4Q7CA 4MTFA 3JZ0A 3S84A 2PF4E 2KNHA 3GEHA 3L8IA 3M1CB 3TJ6A 5DVWA 3UMKA 1Q0MA 4K0DA 1SMYF 2HKVA 1TR2A 4P6IC 2LSEA 2R7RA 3B0UX 2H8AA 1G4US 2J8WA 2YLIA 1NSGB 4ER9A 1U89A 3RKOF 1M56C 1E86A 2UUIA 1UG7A 2W45A 3HKKA 1NFNA 2A69F 1PCXA 3POVA 1ORYA 2VCAA 2P1AA 2NSGA 3GM1A 3HNIA 2MHRA 3QZCA 3O55A 3TOMA 1D0ZA 2P7VA 2EPOA 3X2QC 4IAOA 1OKKA 3GEIA 4PACA 2H7BA 4PR9A 4G7ZF 2HMQA 3L8JA 1D0YA 3N0TA 2CCYA 2YL7A 1OW8A 4EWCA 2HZ8A 4EIYA 1NZEA 1MMNA 1PD1A 3WG7C 5L0HA 4CIPA 4XLNF 2R7OA 2GFHA 3W8IA 3CSKA 5JT4A 1L7CA 1LKXA 4MW3A 3OA1A 2OU6A 5A6BD 1GM5A 3O39A 5JUAA 2D5RB 1QKRA 3U2LA 4PJLA 2FAPB 3DAFA 3IPMO 5KYYB 2GWWA 4JEAA 4PJMA 2GA0A 1FFTC 1QQ3A 3LLKA 1A7DA 2D4UA 2VCCA 3HJCA 1E85A 1GQAA 1SF8A 2J7PD 2Q3TA 4C3BA 2CDQA 1O5HA 3RIPA 1OCOC 3LJBA 5F5FA 1MQVA 2BE5F 4RD9A 4DVZA 3R2PA 4KNVA 4N6CA 3GM2A 2Q4FA 2A68F 1HE9A 3LS0A 4QI0A 2Y3BA 3JT1A 5A6AA 5L3VA 4YL1A 1G4WR 1VLTA 2P61A 3EHMA 3N2ZB 2XLWA 3U3FA 2Z15A 4G7OF 1R4TA 1ZYRF 4DOZA 1TKNA 1CPQA 2YQYA 4YN0B 1S7ZA 4NQFA 2PX3A 1A0BA 1LS4A 1ORSC 2LP4A 2M4EA 3CQZA 2MWQA 3I4UA 3Q7LA 4U9DA 4ULWA 5JLIA 1OKKD 2A6EF 1GGQA 2J9WA 5HV9A 1LVKA 3DJNB 4MVSA 3ASOC 3IHUA 1Z5ZA 2I15A 4U5CE 4K1OA 1U0BB 1R5ID 5KYXB 2R7UA 1LS1A 3AGUA 4J7TA 2O9XA 4XEVA 1TWHA 2L7AA 1I5NA 2YL1A 4RDAA 3RQFA 4QDLA 4AE4A 4YT4A 1HMDA 4Q5SF 4N4WA 5TJ5E 3TOLA 4BJ5C 5KYWA 2NG1A 3QMKA 1AVOB 3UMIA 1U6HA 1PD0A 3MYFA 3W8HA 4ZLDA 1FR0A 3S28A 4C3EA 5DQTA 4XEKA 2OQMA 3K1IC 5F5HA 3EGDA 2C03A 2CNWD 3VF0A 1LIHA 3PCVA 2PBEA 3UNGC 4WGYA
chains in the Genus database with same CATH topology
4E0IA 1OQCA 2HJ3A 3O55A 1JRAA 4LDKA 3U2LA 4E0HA 3TD7A 3MBGA 3LLIA 3W4YA 3U2MA 3TK0A 3R7CA 3U5SA 1JR8A 3GWNA 3GWLA 3LLKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4E0I A;  1OQC A;  2HJ3 A;  3O55 A;  1JRA A;  4LDK A;  3U2L A;  4E0H A;  3TD7 A;  3MBG A;  3LLI A;  3W4Y A;  3U2M A;  3TK0 A;  3R7C A;  3U5S A;  1JR8 A;  3GWN A;  3GWL A;  3LLK A; 
#chains in the Genus database with same CATH topology
 4WJ0 A;  3V5Z A;  2AU5 A;  1A7E A;  1ST6 A;  1MMA A;  5DLJ A;  1JOG A;  4MVO A;  4XPX A;  2NUP A;  4CIH A;  2QLA A;  3JSE O;  2XL8 A;  4DVY P;  3T6J A;  3SYN A;  2XSE A;  4C3D A;  1SYQ A;  4N06 A;  3S90 A;  1ZHT A;  2J9B A;  4LER A;  3DWW A;  2JPU A;  3KYJ A;  1CGO A;  2XM0 A;  2DYS C;  2Q00 A;  3AJM A;  4B6I A;  4D4X A;  3L34 A;  3ZG1 A;  4EBJ A;  3RH3 A;  3IQ5 A;  2XLH A;  1WGW A;  1EI7 A;  1M2V A;  2HV6 A;  3EGD B;  4JW1 A;  3A9C A;  4U5E E;  3T4R A;  1DOV A;  1BBH A;  1V54 C;  4NC3 A;  5D91 A;  4JTA B;  3DAG A;  1K40 A;  2XS8 A;  2RSE B;  2WL8 A;  2A0U A;  4AX2 A;  2NUT A;  2VAS A;  2IBF A;  2YWA A;  2ETS A;  2YL0 A;  2V3C C;  4O6M A;  1QLE C;  2XL4 A;  1RJ9 A;  2J46 A;  2PP4 A;  4G78 A;  2ZPA A;  3AG3 C;  4LDK A;  4RBN A;  3DD7 A;  4GQH A;  2WZF A;  3KH2 A;  4Z9I A;  2CYD A;  3SXM A;  3ZQY A;  3ZVR A;  4YL0 A;  1HE1 A;  1ZHX A;  1ZW2 A;  1B68 A;  2Q9B A;  5KYU A;  3U9M A;  5B3S C;  3W2W A;  3EGX A;  3M79 A;  3LEV A;  3WHN A;  1CPR A;  2JD3 A;  3SP1 A;  1NU9 C;  2PX0 A;  2B0J A;  1BDJ B;  3NYM A;  3ZC4 A;  1VYK A;  3EQL F;  3ZTM A;  4DBQ A;  2LFF A;  5FZT A;  4H4K C;  3ZIB A;  3NKD A;  2WZG A;  4EHP A;  2UUH A;  4CSA A;  2R25 A;  1WOL A;  2E87 A;  2MYS A;  3EG9 B;  3FMS A;  4O6N A;  2C04 A;  3CAX A;  4PFO A;  4BJ6 A;  3H65 A;  5EHH A;  1EKY A;  1FTS A;  3ZQV A;  4EUK B;  4OIQ F;  4MS2 A;  1D1C A;  3S29 A;  4KI2 A;  2FFH A;  2OEV A;  3G4Z A;  2Y69 C;  3JCU Q;  4MVU A;  4PJN A;  1VOM A;  1Q0K A;  2EPL X;  4L6R A;  3LLI A;  5E3A A;  2VB6 A;  1GS9 A;  2QTV A;  4W8P A;  1D1A A;  4CS9 A;  1LE4 A;  2BC5 A;  2LFD A;  3DM9 B;  3FAJ A;  3TJ5 A;  1XZP A;  1H6G A;  4YJW A;  4GEH A;  5COF A;  3NG1 A;  4JIO A;  4CBE A;  1NBB A;  1Y6D A;  2L9J A;  4HE8 D;  1RMV A;  3RVY A;  1FMV A;  3GOR A;  4CS8 A;  4E7Z A;  3MBG A;  4DRI B;  1VK5 A;  2G62 A;  1LI7 A;  2XXA B;  3B0V C;  2KJG A;  2QE9 A;  3EZI A;  3HLZ A;  3JSZ A;  1OCR C;  3UMH A;  4N6H A;  4PFP A;  1T9K A;  2PNO A;  2V26 A;  1YYJ A;  2KK1 A;  3DI5 A;  3SXY A;  4NY3 A;  2H7V C;  1WAT A;  2R02 A;  4LDQ A;  3B0P A;  2CNW A;  1JPJ A;  4O79 A;  5D92 A;  3S0X A;  2A0B A;  2OJQ A;  1Z63 A;  1VMA A;  5BQH A;  1OW7 A;  3AOU A;  1YAR O;  2EIN C;  1O87 A;  2AVK A;  1OXK A;  4NTA A;  5A6J A;  4IB4 A;  4NTB A;  4UDV A;  3UR3 C;  2Q7R A;  2VC9 A;  3AG4 C;  2AWY A;  4HFK B;  1K05 A;  3IQT A;  2J0X A;  1MMD A;  2Y3D A;  3LNR A;  2Y39 A;  4MVQ A;  1M57 C;  2WB7 A;  1T6U A;  1FFH A;  2WZL A;  1K04 A;  2EIJ C;  5KYU B;  3EHN A;  4H54 A;  5KYY A;  1AEP A;  3ECS A;  1M2V B;  3RW0 A;  1O3U A;  2FGY A;  2JX0 A;  3O6X A;  4JRZ A;  4MVM A;  4P9F A;  4IJJ A;  3M4B A;  1OR2 A;  2W4B A;  2NSF A;  2XLE A;  2YVK A;  4XEF A;  4DBR A;  2Q9C A;  5KYX A;  1FNT c;  2XM4 A;  1T6I A;  2XRH A;  2G3K A;  1TWG A;  2ZXW C;  3ABM C;  1Z7Q c;  3RF3 A;  4EBB A;  5KYN A;  2OOC A;  4BJT A;  4O7G A;  1HY5 A;  3JYH A;  2P0N A;  4MVR A;  4FES A;  3TUL A;  3JTL O;  1LI5 A;  4CX9 A;  5KYW B;  4QI2 A;  4JKV A;  2HS5 A;  2QNL A;  3FVY A;  1OCZ C;  4AK9 A;  1E83 A;  1RKE B;  2EPN A;  4FWV A;  1Z6A A;  3PHF 2;  1SZI A;  2KQ9 A;  3Q6M A;  4JJG A;  4U5D E;  3SEO A;  5AC4 A;  2HMZ A;  2XLV A;  3AGT A;  2J9V A;  4U5B E;  5COM A;  4ZLC A;  3GEE A;  5BUO A;  4IGG A;  3I5Q A;  5L0F A;  3AG1 C;  2NUP B;  4U5F E;  3TD7 A;  4EKW A;  5A6K A;  4WAB A;  1MMG A;  5CI9 A;  3EZH A;  3NYL A;  1IW7 F;  4BG0 A;  4LDR A;  3W4Y A;  1MNE A;  3MYI A;  3H2U A;  3U2M A;  4CDV A;  3MFN A;  5B1A C;  2QUP A;  3ATP A;  1XWJ A;  4BJ1 A;  2QY9 A;  5JSL A;  1VB5 A;  4YL3 A;  3S27 A;  3DXJ F;  1Z23 A;  4CJO A;  1RKC A;  1RXQ A;  3MLG A;  3OWT A;  2XLD A;  4LAC B;  1M2O A;  4LLE A;  3ZTZ A;  5L0J A;  3U0C A;  2IXP A;  2PFD A;  3C8Z A;  3WOD F;  3UGO A;  2GAQ A;  1UFB A;  1ZZP A;  2NUT B;  1TWA A;  3L0I A;  3K33 A;  2EPM X;  3IEE A;  3A11 A;  2HSB A;  2X51 A;  3ITF A;  4OIP F;  3DM5 A;  4KC9 A;  4BPM A;  3QTH A;  3KMI A;  4HFF B;  5AGF A;  3C8G B;  3RQG A;  1BZ4 A;  1QPU A;  2A1D D;  4K7B A;  4OIN F;  3LNM B;  3T6B A;  3NMK A;  5DS4 A;  3NKE A;  4XPY A;  3C63 A;  3O10 A;  2M64 A;  1I4Y A;  1TFO B;  2LD6 A;  5COG A;  4NTF A;  1HW1 A;  1M6T A;  1OW6 A;  3FDQ A;  3LS1 A;  1FAP B;  1H9G A;  4O6Y A;  1WTY A;  3VRC A;  2WVO A;  1VYI A;  1RJ9 B;  3BRJ A;  3DZA A;  3GWL A;  4Z9H A;  4IRU A;  2L6F A;  4GYT A;  4JCZ A;  4XQ1 A;  4NCQ A;  2AP3 A;  4JTD B;  1JR8 A;  3F46 A;  3QVY A;  3FOP A;  1G8X A;  3EGX B;  1E2X A;  5AC5 A;  1XZQ A;  2OKU A;  1N1C A;  4JEB A;  4BEM J;  3UGP A;  3EPV A;  2X0C A;  4IAR A;  3E9V A;  2OG2 A;  1TFK B;  1KTM A;  1A41 A;  3SNH A;  3SXK A;  2OCC C;  3AQB A;  3C18 A;  3RYL A;  1ZU4 A;  1Q0G A;  3EJN A;  4AL0 A;  4YT2 A;  4J30 B;  5DS6 A;  5A6B A;  4A4A A;  2YKZ A;  3FXH A;  4ONS A;  2XXA A;  4MTO A;  3J06 A;  1KNY A;  3H2V A;  256B A;  4DRJ B;  2VH3 A;  3HNJ A;  1OR3 A;  2HSQ A;  4P9T A;  3G4X A;  3K7D A;  1AUE A;  1JPN A;  3U8P A;  1ZVZ A;  3JRT A;  1RCP A;  3L1M A;  2EIL C;  3ABL C;  4PK4 A;  5JP7 A;  3TK0 A;  2R7S A;  3GAN A;  3I5P A;  1NU7 D;  2ZXP A;  3T6G B;  2J0W A;  4E7S A;  2HJM A;  3ZDL A;  1Q0D A;  2VCB A;  5JRA A;  2KYH A;  3EH2 A;  4Q4Z F;  1HW2 A;  2IM8 A;  4LLC A;  1VTM P;  4JE9 A;  1EQ1 A;  1YVI A;  4I1O B;  3RFY A;  3G50 A;  3V5Y A;  1OQC A;  4BJ6 C;  1D0X A;  5BQG A;  4CSA C;  4MQ9 F;  4OD5 A;  4R32 A;  3U3B A;  1ZW3 A;  2ZXR A;  1C17 M;  2HUJ A;  3KPH A;  4DXW A;  2Y3H A;  5CIV A;  4XWJ A;  5L0I A;  3ZWI A;  4JCH A;  2LIG A;  2XLO A;  1BR1 A;  2L81 A;  1Z3I X;  4FX5 A;  4AE4 B;  2ZXO A;  3B29 A;  3C62 A;  3QVZ A;  3SZR A;  1WWP A;  2YEV A;  1ZHW A;  3S9O A;  3KKB A;  1YAU O;  3JYY A;  3RVZ A;  1D1B A;  1TQG A;  2R7W A;  2R05 A;  1C03 A;  1T6Q A;  2J45 A;  3R7C A;  3DKA A;  2G3V A;  3GWN A;  5E3C A;  3QW1 A;  4IWB A;  4A2N B;  5FCL A;  3U9J A;  3DJU B;  3LES A;  1Y4C A;  4E17 A;  3N24 A;  2YLD A;  3VYW A;  1YZC A;  3ZSU A;  2LQG A;  2DB4 A;  2LCH A;  4CS8 C;  1YZA A;  2EIK C;  3C7J A;  1Q0F A;  1JRA A;  3Q6N A;  3Q7G A;  4XPW A;  1ZHY A;  1BR2 A;  4G0H A;  2ZD9 A;  1TWC A;  4U5G A;  3DMD A;  3FHD A;  5IY5 C;  3C8G D;  2W4M A;  3U5S A;  4G7H F;  1ZU5 A;  1WN0 A;  3K6B A;  4E0I A;  2F22 A;  2HJ3 A;  5B1B C;  5T3T A;  1JAF A;  4EBK A;  2YZS A;  3ASN C;  1KU2 A;  3US6 A;  5L3Q A;  5DS5 A;  1LM3 B;  1NG1 A;  3M15 A;  1MND A;  4ANJ A;  2XL6 A;  5F28 E;  3BEH A;  2HV7 A;  2KW3 C;  4YT8 A;  3WAQ A;  1F1M A;  4WGZ A;  4I44 A;  3KL4 A;  4F4B A;  2BL2 A;  3B9Q A;  1LPE A;  3IQC A;  4MW8 A;  2IOQ A;  4AL1 A;  4BEJ A;  4FAP B;  3QW0 A;  1H9T A;  2B0H A;  2OEX A;  3VAY A;  2HFI A;  1A7V A;  1QZX A;  2XLM A;  2DI3 A;  1L3P A;  1H7I A;  4W8K A;  3SXZ A;  1ZHZ A;  4JTC B;  4E0H A;  4J32 B;  4MVZ A;  1WAS A;  1YLM A;  5T3W A;  3EH1 A;  2R9R B;  3AG2 C;  4MND A;  4YWQ A;  2KSF A;  5K0I A;  1CGM E;  1EA8 A;  3E70 C;  3JRM O;  3MX3 A;  4YK5 A;  4CJG A;  2IXN A;  3EFO A;  4CS7 A;  2Q9A A;  4HEA J;  4C7O A;  2J9U A;  2OJE D;  4Z9J A;  3GOD A;  2YLG A;  3T9O A;  2AWC A;  3C8G A;  4C7O B;  3X1O A;  2LK4 A;  3LAY A;  3HNL A;  1OCC C;  3GM3 A;  2L6H A;  3FOO A;  2H7O A;  5E33 A;  3U8V A;  3KYI A;  4JZA A;  2R7X A;  3FAP B;  4XTK A;  2CW0 F;  1IZM A;  3NMI A;  1T01 A;  5T1D B;  1ORJ A;  4D4N A;  5L0D A;  2IXM A;  3V7O A;  4OIO F;  1LE2 A;  1PV3 A;  1YA7 O;  2I8B A;  2RD9 A;  2R7Q A;  2WVQ A;  1YA9 A;  5A69 A;  1FMW A;  5CI8 A;  1E84 A;  3V5X A;  2A6H F;  1NFO A;  3K1H A;  1APC A;  4J7Y A;  4U5H A;  3TQO A;  3VM6 A;  5EK0 A;  4CDA A;  4CS9 C;  3ABK C;  2R7T A;  1I4Z A;  2KC3 A;  3B71 A;  4I3M A;  4MTG A;  4E18 A;  1SR2 A;  4OD4 A;  5GPG B;  3CZ6 A;  1YDI A;  4ULV A;  3DE8 A;  5E2Q A;  3CEX A;  2NPU A;  1J8Y F;  4IAQ A;  4U9E A;  5DQZ A;  5JVE A;  1CGN A;  5HSW A;  1V74 B;  3HTK C;  4PJJ A;  1V55 C;  1T5O A;  4X0R A;  1V4A A;  5L0G A;  2IYL D;  4I1M A;  2EIM C;  1DOW A;  1QVX A;  2KGO A;  4DJ9 A;  3PDM P;  3AQC A;  2ICW G;  1HMO A;  1OXB A;  2YRF A;  3K1I A;  1C02 A;  1G5Z A;  3W2V A;  2YL3 A;  3NMJ A;  2R03 A;  1JMW A;  2DGJ A;  2YHS A;  3DE9 A;  3PMR A;  2Y3G A;  4JVS A;  3OEO A;  4OIR F;  1S05 A;  2CGE A;  4BJ5 A;  1W2W A;  4XLP F;  3EFO B;  5L0C A;  3NRH A;  4JUR I;  3NDB B;  1YYX A;  1YJG A;  2W9Y A;  1QSP A;  3K66 A;  3M4C A;  5BQI A;  3IQ6 A;  3RQE A;  4M63 A;  4KBL A;  1J8M F;  4KNW A;  3HNK A;  3EG9 A;  2DYR C;  3LUT B;  2WVN A;  4CDY A;  3F47 A;  1BR4 A;  4DRH B;  4JC7 A;  1RKE A;  5EGY A;  1VLS A;  2P6V A;  1NLX A;  2L6G A;  2ASR A;  4YT5 A;  2R7V A;  2EPK X;  2IXO A;  2GDC A;  2J7P A;  2XS1 A;  3LEO A;  4JJF A;  2TMV P;  5B3I A;  5JS5 A;  3NYJ A;  4Q7C A;  4MTF A;  3JZ0 A;  3S84 A;  2PF4 E;  2KNH A;  3GEH A;  3L8I A;  3M1C B;  3TJ6 A;  5DVW A;  3UMK A;  1Q0M A;  4K0D A;  1SMY F;  2HKV A;  1TR2 A;  4P6I C;  2LSE A;  2R7R A;  3B0U X;  2H8A A;  1G4U S;  2J8W A;  2YLI A;  1NSG B;  4ER9 A;  1U89 A;  3RKO F;  1M56 C;  1E86 A;  2UUI A;  1UG7 A;  2W45 A;  3HKK A;  1NFN A;  2A69 F;  1PCX A;  3POV A;  1ORY A;  2VCA A;  2P1A A;  2NSG A;  3GM1 A;  3HNI A;  2MHR A;  3QZC A;  3O55 A;  3TOM A;  1D0Z A;  2P7V A;  2EPO A;  3X2Q C;  4IAO A;  1OKK A;  3GEI A;  4PAC A;  2H7B A;  4PR9 A;  4G7Z F;  2HMQ A;  3L8J A;  1D0Y A;  3N0T A;  2CCY A;  2YL7 A;  1OW8 A;  4EWC A;  2HZ8 A;  4EIY A;  1NZE A;  1MMN A;  1PD1 A;  3WG7 C;  5L0H A;  4CIP A;  4XLN F;  2R7O A;  2GFH A;  3W8I A;  3CSK A;  5JT4 A;  1L7C A;  1LKX A;  4MW3 A;  3OA1 A;  2OU6 A;  5A6B D;  1GM5 A;  3O39 A;  5JUA A;  2D5R B;  1QKR A;  3U2L A;  4PJL A;  2FAP B;  3DAF A;  3IPM O;  5KYY B;  2GWW A;  4JEA A;  4PJM A;  2GA0 A;  1FFT C;  1QQ3 A;  3LLK A;  1A7D A;  2D4U A;  2VCC A;  3HJC A;  1E85 A;  1GQA A;  1SF8 A;  2J7P D;  2Q3T A;  4C3B A;  2CDQ A;  1O5H A;  3RIP A;  1OCO C;  3LJB A;  5F5F A;  1MQV A;  2BE5 F;  4RD9 A;  4DVZ A;  3R2P A;  4KNV A;  4N6C A;  3GM2 A;  2Q4F A;  2A68 F;  1HE9 A;  3LS0 A;  4QI0 A;  2Y3B A;  3JT1 A;  5A6A A;  5L3V A;  4YL1 A;  1G4W R;  1VLT A;  2P61 A;  3EHM A;  3N2Z B;  2XLW A;  3U3F A;  2Z15 A;  4G7O F;  1R4T A;  1ZYR F;  4DOZ A;  1TKN A;  1CPQ A;  2YQY A;  4YN0 B;  1S7Z A;  4NQF A;  2PX3 A;  1A0B A;  1LS4 A;  1ORS C;  2LP4 A;  2M4E A;  3CQZ A;  2MWQ A;  3I4U A;  3Q7L A;  4U9D A;  4ULW A;  5JLI A;  1OKK D;  2A6E F;  1GGQ A;  2J9W A;  5HV9 A;  1LVK A;  3DJN B;  4MVS A;  3ASO C;  3IHU A;  1Z5Z A;  2I15 A;  4U5C E;  4K1O A;  1U0B B;  1R5I D;  5KYX B;  2R7U A;  1LS1 A;  3AGU A;  4J7T A;  2O9X A;  4XEV A;  1TWH A;  2L7A A;  1I5N A;  2YL1 A;  4RDA A;  3RQF A;  4QDL A;  4AE4 A;  4YT4 A;  1HMD A;  4Q5S F;  4N4W A;  5TJ5 E;  3TOL A;  4BJ5 C;  5KYW A;  2NG1 A;  3QMK A;  1AVO B;  3UMI A;  1U6H A;  1PD0 A;  3MYF A;  3W8H A;  4ZLD A;  1FR0 A;  3S28 A;  4C3E A;  5DQT A;  4XEK A;  2OQM A;  3K1I C;  5F5H A;  3EGD A;  2C03 A;  2CNW D;  3VF0 A;  1LIH A;  3PCV A;  2PBE A;  3UNG C;  4WGY A; 
#chains in the Genus database with same CATH homology
 4E0I A;  1OQC A;  2HJ3 A;  3O55 A;  1JRA A;  4LDK A;  3U2L A;  4E0H A;  3TD7 A;  3MBG A;  3LLI A;  3W4Y A;  3U2M A;  3TK0 A;  3R7C A;  3U5S A;  1JR8 A;  3GWN A;  3GWL A;  3LLK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...