3U2LA

Crystal structure of human alr mutant c142s.
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
115
structure length
115
Chain Sequence
FREDCPPDREELGRHSWAVLHTLAAYYPDLPTPEQQQDMAQFIHLFSKFYPSEECAEDLRKRLARNHPDTRTRAAFTQWLCHLHNEVNRKLGKPDFDCSKVDERWRDGWKDGSCD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An electron-transfer path through an extended disulfide relay system: the case of the redox protein ALR.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Flavoprotein
molecule keywords FAD-linked sulfhydryl oxidase ALR
total genus 42
structure length 115
sequence length 115
ec nomenclature ec 1.8.3.2: Thiol oxidase.
pdb deposition date 2011-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04777 Evr1_Alr Erv1 / Alr family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.310 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) ERV/ALR sulfhydryl oxidase domain 3u2lA00
3R7CA 3GWNA 3O55A 4E0IA 3U2LA 3W4YA 4LDKA 3GWLA 3U5SA 4E0HA 3LLKA 3LLIA 3MBGA 1JR8A 3TK0A 3U2MA 1JRAA 1OQCA 2HJ3A 3TD7A
chains in the Genus database with same CATH superfamily
1EQ1A 3R7CA 1G5ZA 1D0YA 1Z3IX 3AG1C 4CS9C 2DI3A 3TK0A 2J9UA 2LCHA 4MVZA 4PJMA 4XWJA 3EH2A 1LIHA 2YEVA 3DAGA 1QKRA 2HS5A 3WG7C 3RF3A 2R7QA 1ZW3A 1IW7F 4QI2A 4MQ9F 3L8JA 4AL1A 4WABA 3T6BA 1D1CA 2PF4E 3KKBA 5KYUA 3GEEA 3UNGC 3DKAA 2XLWA 2P7VA 3EQLF 1Y6DA 5DS5A 1MNEA 1CPRA 1EA8A 2EPMX 2EPKX 3HNLA 4XEKA 3M79A 4CS8A 2Q9BA 5JT4A 2A68F 4NY3A 2WL8A 3V5YA 3TJ5A 1EI7A 5F28E 1RXQA 3S28A 1Q0KA 3B0VC 3G50A 5DLJA 4DXWA 4EBBA 5KYXA 3LS0A 1C03A 1B68A 4MW8A 2R7UA 2J7PA 4JTAB 3WHNA 3FDQA 4JEAA 2Q3TA 4LDRA 4D4XA 2J45A 3JYHA 1VOMA 4AK9A 2E87A 4MS2A 1T6IA 3NMKA 4O7GA 3LEVA 4YJWA 3JSZA 1HW1A 2H7BA 2O9XA 4I3MA 3SEOA 4DRHB 2OEVA 4U5GA 3GM2A 4E0HA 3S90A 3KH2A 2XXAA 2R02A 5T1DB 3SZRA 2Y39A 1ZHYA 2Q9AA 3FOPA 3HNJA 4JURI 5L0IA 4JIOA 5KYWB 3NYJA 2R7VA 1M57C 1E2XA 2V3CC 1HW2A 1ZHZA 3C8ZA 4JCHA 5K0IA 4PK4A 1Z6AA 2MYSA 1SR2A 2I15A 4XPYA 4HEAJ 3RQGA 4BEJA 3E9VA 3E70C 4BJ6A 1YDIA 3V7OA 2EPNA 2RD9A 4JCZA 4PJJA 3GWNA 2QE9A 1MMGA 1HY5A 2A6HF 4PFPA 4PJLA 1VLTA 2QLAA 2IXNA 3C8GA 5EK0A 3PMRA 3C7JA 1UG7A 4AE4B 3QMKA 2AWCA 4EKWA 5JRAA 2XLDA 3F46A 2MWQA 4BJ5A 3GM1A 3I5PA 4Q4ZF 1A41A 3U2LA 4G0HA 4LDQA 2LD6A 3QVZA 1D1AA 4CSAC 3DAFA 2B0HA 2QNLA 4U5EE 2XXAB 3ASNC 3ZQYA 3U9MA 1BR1A 5E33A 2HZ8A 1C17M 3PDMP 3EZHA 1NSGB 2LIGA 4NCQA 2HSQA 4OIPF 2IM8A 1Q0MA 1YYXA 3CSKA 3KYJA 2W45A 4CS7A 1Z23A 5COFA 1A0BA 2G3KA 4XPWA 3SYNA 4CDAA 1TWGA 2YVKA 5KYYB 1JAFA 1HMDA 2NPUA 2Y3DA 4EHPA 3EFOA 3NDBB 5T3TA 1ORYA 4CIPA 2BC5A 3G4ZA 5BQGA 3V5ZA 4MVUA 2R7RA 2D4UA 2KYHA 2XS8A 2KSFA 1A7DA 2P6VA 3SXMA 3W8IA 2XL8A 4N4WA 3EGXA 1BBHA 1NFOA 1ZHXA 1R4TA 2IXPA 2YLDA 4MVQA 4C3EA 1TWAA 4DRIB 5KYYA 4CSAA 2L9JA 1QVXA 2Y3HA 3RQFA 4D4NA 1JOGA 5F5FA 3QW1A 4CX9A 1NLXA 2XS1A 2WVOA 4BEMJ 4O6NA 3ATPA 1V74B 3N2ZB 2ZD9A 3Q7LA 4JKVA 3C18A 4YK5A 1XZPA 1VTMP 1K40A 4ULWA 1YYJA 5TJ5E 1HE1A 1FFTC 1NBBA 1RKCA 2WZLA 3MYFA 2Q7RA 4U5CE 4BG0A 2Y3BA 3TJ6A 1G8XA 3ZG1A 3L1MA 4E0IA 3MFNA 1OKKD 2IXOA 1T01A 4L6RA 2Y3GA 2J9BA 4DBQA 3JRTA 2G62A 1PD0A 1HE9A 256BA 3CAXA 3EH1A 3OWTA 4LERA 1R5ID 4CS9A 4G7OF 3SP1A 2J46A 4PACA 5COMA 2L6GA 3ZSUA 4LLEA 4U5FE 2XM4A 4J7YA 2J0WA 1FMVA 1WTYA 3FAPB 2YLGA 5DS6A 2CCYA 2GWWA 2XM0A 4E7SA 2V26A 3TOMA 2M4EA 2KQ9A 1G4WR 3GORA 2PBEA 2ZPAA 3U8PA 4CJOA 1TWHA 2HV7A 4HFKB 3TQOA 2R25A 2YL0A 2TMVP 4KI2A 3QZCA 3TULA 1T6QA 2R7OA 4MVSA 5COGA 5IY5C 4IWBA 1V4AA 2HKVA 2NUTB 5AC5A 3DD7A 1MQVA 2H8AA 3DMDA 1FFHA 1I4ZA 2HJMA 4IGGA 1BR4A 4NC3A 3GEHA 3GODA 1OCZC 4N6HA 5DVWA 4JC7A 1Q0DA 1YJGA 3SXYA 1K04A 1E85A 4I44A 2YKZA 2C04A 2AU5A 2YHSA 2AWYA 4MW3A 2YRFA 1ST6A 2XRHA 1CPQA 1PV3A 4NTFA 4CDVA 1E84A 1LE4A 2EINC 3JCUQ 2ICWG 4EBJA 5BQIA 4EUKB 2HJ3A 3AGUA 5L0CA 3H2UA 2ZXWC 2J8WA 2XLHA 4KNVA 3GEIA 2NSGA 1ORJA 1OW8A 4H4KC 5A6BA 1A7EA 4Q5SF 4MVOA 4YL0A 3ZVRA 2EPLX 3DE9A 5KYWA 1VK5A 3DM5A 3JRMO 1Y4CA 4O6YA 4PFOA 4G7ZF 3KPHA 1U0BB 3G4XA 3V5XA 1D1BA 2YLIA 4XTKA 3T6JA 4BPMA 5L3QA 1S7ZA 2ASRA 1MMDA 3GWLA 3POVA 2RSEB 4J30B 3OA1A 3DJNB 3EGDA 1VB5A 5JVEA 5KYXB 3BRJA 2VASA 2CGEA 3IEEA 2D5RB 1LI7A 4C7OB 5JSLA 3X1OA 5FCLA 2OG2A 2VH3A 1RKEA 4WJ0A 1OR3A 3FMSA 4GEHA 3H65A 1YZAA 3QW0A 4IARA 1NZEA 2M64A 3LS1A 4DRJB 1ZZPA 4J7TA 4QI0A 5A6KA 1VYKA 2FAPB 1OW7A 1YAUO 2QTVA 4JVSA 1ZHWA 1RMVA 2LK4A 1KU2A 4YT5A 5BUOA 2LQGA 4WGYA 2KNHA 1OR2A 2HFIA 1AEPA 1F1MA 2EIKC 2OQMA 4F4BA 4LACB 1T6UA 3ZC4A 5L0GA 1YVIA 3TD7A 2WZFA 4A4AA 5AC4A 4QDLA 4N6CA 4EWCA 4LDKA 1FAPB 1YA9A 3Q6NA 1D0XA 2XLVA 3T4RA 2YQYA 3K7DA 3GM3A 1E83A 1Q0GA 1WN0A 2J7PD 3DM9B 4YWQA 1LKXA 4H54A 3AG4C 4NTAA 3DXJF 4DJ9A 3H2VA 4G7HF 3EPVA 2XL4A 3W8HA 1H6GA 5B1BC 2Q00A 4ZLCA 5HSWA 3ABLC 4P6IC 3C62A 3O55A 4CDYA 2CNWA 3IHUA 3K1HA 3EJNA 5BQHA 2WVNA 2ETSA 4JJFA 2GDCA 1H9TA 4KBLA 4FWVA 1V55C 1GQAA 1OKKA 1ZW2A 1QSPA 3O10A 5L0DA 1L7CA 3AJMA 4N06A 3IQ5A 4E17A 3ZIBA 5L0JA 1SF8A 2W4BA 1RKEB 3A11A 3VF0A 1APCA 2KGOA 1Z7Qc 3DI5A 1GS9A 2DB4A 3O39A 5L3VA 4YL1A 2EPOA 2DYSC 1JR8A 3U8VA 1Q0FA 2KC3A 4G78A 1DOWA 2XSEA 4O6MA 3ZDLA 1CGOA 3IQTA 3U9JA 2H7VC 2J9VA 4K0DA 4MNDA 3ZTMA 5JLIA 4J32B 1ZYRF 2YL7A 3N0TA 5A6BD 1OCOC 3M4CA 2CNWD 3RFYA 3LNRA 3HLZA 1NG1A 2EIMC 1AUEA 1EKYA 2Q9CA 3KMIA 1IZMA 1FNTc 2YL1A 1E86A 1PCXA 4JW1A 4HFFB 4ULVA 3RIPA 3U2MA 4MVMA 3U0CA 3N24A 3RH3A 1H7IA 4KC9A 4W8KA 1OXBA 2J9WA 2OKUA 3UGOA 2CDQA 3AOUA 4UDVA 2A0UA 4BJ5C 1JMWA 2KW3C 5A6JA 4U9EA 1AVOB 4CBEA 1QZXA 3T6GB 3SXKA 5DQZA 5T3WA 3FAJA 4MTGA 3UMIA 4DBRA 5F5HA 4XEFA 5AGFA 3DJUB 4OIOF 1RJ9B 1TFKB 1OW6A 5KYNA 4KNWA 4LLCA 3B0UX 2PP4A 2Z15A 3MLGA 4P9FA 3PHF2 1Z63A 4CS8C 3IPMO 4Z9IA 2L81A 1GM5A 4XLNF 2HMQA 4IJJA 2NUPB 3K6BA 2I8BA 3U3BA 3S0XA 3I5QA 3ZQVA 2A69F 4IAOA 1TQGA 1JPNA 3AGTA 4CJGA 3MX3A 3B29A 4DVYP 1SMYF 5B3SC 4FX5A 1I5NA 3US6A 3DE8A 2UUIA 2BL2A 2YL3A 5E2QA 1PD1A 2UUHA 5JP7A 3RVZA 4OINF 1SZIA 2QUPA 4FESA 2IXMA 4MTFA 3HTKC 3JT1A 1TKNA 4K1OA 3K33A 1ZU5A 3B71A 3LEOA 5CI9A 3NKDA 3NMIA 5DS4A 5CI8A 2KK1A 3M15A 3EZIA 1FR0A 5DQTA 2YZSA 1V54C 1YLMA 2PX3A 3EHMA 5D92A 1OQCA 4CIHA 2KJGA 3RKOF 3SXZA 4JZAA 3EFOB 4XLPF 3TOLA 1RCPA 3W2WA 4DVZA 3FOOA 2PFDA 3HKKA 4M63A 3VRCA 2NSFA 1S05A 2OJQA 4E18A 3T9OA 4BJ1A 1A7VA 2FFHA 3JTLO 1LVKA 2XLMA 1T9KA 4BJTA 3B0PA 1K05A 4OIRF 1M6TA 5B3IA 3F47A 1NU9C 4EBKA 3CQZA 5A6AA 3EG9A 4XPXA 1D0ZA 3FHDA 4JTDB 2R7SA 4IAQA 1T5OA 2OU6A 1RJ9A 1N1CA 3C8GB 4U5BE 1FMWA 2DGJA 2IBFA 3JSEO 4C3BA 5L0HA 3J06A 1U89A 2IOQA 1BR2A 1WOLA 1O3UA 4Q7CA 2VCAA 4ER9A 2VB6A 4JTCB 2CW0F 5D91A 2GFHA 1CGNA 4R32A 4RBNA 2R7WA 1TR2A 4GQHA 2R7TA 1M2VA 2P0NA 2L6HA 4OD5A 2MHRA 3KL4A 3U3FA 2EIJC 2GAQA 1XZQA 1HMOA 3IQCA 4HE8D 1ZVZA 2QY9A 5FZTA 2OOCA 3LUTB 3S84A 1BZ4A 4FAPB 4C3DA 4IB4A 2JX0A 1LS1A 2BE5F 2OEXA 3EGDB 3MBGA 4JJGA 1KTMA 3CZ6A 1LM3B 1DOVA 3VYWA 5JUAA 4XQ1A 4JRZA 2G3VA 1JPJA 2JD3A 1VLSA 3EHNA 3QTHA 3QVYA 5CIVA 1ZU4A 2GA0A 1ORSC 3RQEA 3LLKA 2JPUA 3RVYA 3VM6A 1WATA 3B9QA 1JRAA 3BEHA 4JE9A 1MNDA 2PNOA 4I1OB 2F22A 3OEOA 1M56C 3U5SA 3EGXB 3R2PA 4NQFA 5E3AA 3UR3C 4E7ZA 2A0BA 1KNYA 2NG1A 3ASOC 3W2VA 2IYLD 1VMAA 3FXHA 3NYMA 1I4YA 3W4YA 2LFFA 2HMZA 3L0IA 4YT4A 1NU7D 3AG3C 1TWCA 3NG1A 3A9CA 4AL0A 4IRUA 3I4UA 3JYYA 1O87A 1YARO 3EG9B 1G4US 2LP4A 3LJBA 1W2WA 4ZLDA 2C03A 3ABMC 3M1CB 3WODF 3Q7GA 4OD4A 2NUTA 3NKEA 1QQ3A 3VAYA 1WASA 3HNKA 1LS4A 3ABKC 3Q6MA 4YN0B 4BJ6C 5L0FA 2NUPA 1MMAA 4PJNA 3PCVA 1LPEA 3ZWIA 4AX2A 3UMHA 2L7AA 2OJED 1M2VB 3AG2C 1J8YF 3AQBA 4U5HA 2XLOA 5E3CA 1M2OA 3ZTZA 2W4MA 4AE4A 4U5DE 5EGYA 4XEVA 4I1MA 1SYQA 5GPGB 1LE2A 3LAYA 2A6EF 4MTOA 4MVRA 2XLEA 2WB7A 3NRHA 3S29A 2W9YA 3HNIA 2AVKA 4ANJA 4YT2A 2CYDA 5A69A 4JEBA 3K1IA 2ZXRA 4B6IA 3HJCA 2X0CA 2L6FA 2P1AA 3FVYA 3K66A 3LNMB 1XWJA 3C8GD 4PR9A 1VYIA 2ZXOA 3MYIA 2LSEA 4GYTA 1TFOB 3CEXA 2WVQA 3S9OA 3ITFA 3C63A 2HSBA 3L8IA 3NMJA 4Z9JA 4C7OA 2R03A 3UMKA 1Z5ZA 2ZXPA 2J0XA 3X2QC 2YWAA 4DOZA 4W8PA 4X0RA 2FGYA 1NFNA 2P61A 2Y69C 1U6HA 1UFBA 3L34A 4YL3A 1CGME 5B1AC 3LLIA 4WGZA 1O5HA 1YZCA 1MMNA 3S27A 1OCRC 2AP3A 3WAQA 2A1DD 2Q4FA 1LI5A 1C02A 3JZ0A 3UGPA 1YA7O 3SNHA 3AQCA 3ECSA 2HV6A 4O79A 3DZAA 2PX0A 1GGQA 1WWPA 3KYIA 2R7XA 1J8MF 3RYLA 4P9TA 2VC9A 2X51A 2H7OA 2OCCC 1H9GA 4OIQF 1QPUA 1OXKA 4YT8A 4RD9A 3K1IC 3RW0A 4A2NB 5HV9A 4EIYA 2HUJA 2VCCA 4ONSA 2R9RB 2XL6A 4RDAA 1FTSA 3GANA 5EHHA 3IQ6A 3LESA 4K7BA 1ZHTA 5KYUB 1OCCC 2EILC 2DYRC 4NTBA 1WGWA 3NYLA 3O6XA 2LFDA 4U9DA 1QLEC 2B0JA 4Z9HA 1L3PA 2R05A 5JS5A 1BDJB 3M4BA 2VCBA 3DWWA 2WZGA
chains in the Genus database with same CATH topology
3R7CA 3GWNA 3O55A 4E0IA 3U2LA 3W4YA 4LDKA 3GWLA 3U5SA 4E0HA 3LLKA 3LLIA 3MBGA 1JR8A 3TK0A 3U2MA 1JRAA 1OQCA 2HJ3A 3TD7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3R7C A;  3GWN A;  3O55 A;  4E0I A;  3U2L A;  3W4Y A;  4LDK A;  3GWL A;  3U5S A;  4E0H A;  3LLK A;  3LLI A;  3MBG A;  1JR8 A;  3TK0 A;  3U2M A;  1JRA A;  1OQC A;  2HJ3 A;  3TD7 A; 
#chains in the Genus database with same CATH topology
 1EQ1 A;  3R7C A;  1G5Z A;  1D0Y A;  1Z3I X;  3AG1 C;  4CS9 C;  2DI3 A;  3TK0 A;  2J9U A;  2LCH A;  4MVZ A;  4PJM A;  4XWJ A;  3EH2 A;  1LIH A;  2YEV A;  3DAG A;  1QKR A;  2HS5 A;  3WG7 C;  3RF3 A;  2R7Q A;  1ZW3 A;  1IW7 F;  4QI2 A;  4MQ9 F;  3L8J A;  4AL1 A;  4WAB A;  3T6B A;  1D1C A;  2PF4 E;  3KKB A;  5KYU A;  3GEE A;  3UNG C;  3DKA A;  2XLW A;  2P7V A;  3EQL F;  1Y6D A;  5DS5 A;  1MNE A;  1CPR A;  1EA8 A;  2EPM X;  2EPK X;  3HNL A;  4XEK A;  3M79 A;  4CS8 A;  2Q9B A;  5JT4 A;  2A68 F;  4NY3 A;  2WL8 A;  3V5Y A;  3TJ5 A;  1EI7 A;  5F28 E;  1RXQ A;  3S28 A;  1Q0K A;  3B0V C;  3G50 A;  5DLJ A;  4DXW A;  4EBB A;  5KYX A;  3LS0 A;  1C03 A;  1B68 A;  4MW8 A;  2R7U A;  2J7P A;  4JTA B;  3WHN A;  3FDQ A;  4JEA A;  2Q3T A;  4LDR A;  4D4X A;  2J45 A;  3JYH A;  1VOM A;  4AK9 A;  2E87 A;  4MS2 A;  1T6I A;  3NMK A;  4O7G A;  3LEV A;  4YJW A;  3JSZ A;  1HW1 A;  2H7B A;  2O9X A;  4I3M A;  3SEO A;  4DRH B;  2OEV A;  4U5G A;  3GM2 A;  4E0H A;  3S90 A;  3KH2 A;  2XXA A;  2R02 A;  5T1D B;  3SZR A;  2Y39 A;  1ZHY A;  2Q9A A;  3FOP A;  3HNJ A;  4JUR I;  5L0I A;  4JIO A;  5KYW B;  3NYJ A;  2R7V A;  1M57 C;  1E2X A;  2V3C C;  1HW2 A;  1ZHZ A;  3C8Z A;  4JCH A;  5K0I A;  4PK4 A;  1Z6A A;  2MYS A;  1SR2 A;  2I15 A;  4XPY A;  4HEA J;  3RQG A;  4BEJ A;  3E9V A;  3E70 C;  4BJ6 A;  1YDI A;  3V7O A;  2EPN A;  2RD9 A;  4JCZ A;  4PJJ A;  3GWN A;  2QE9 A;  1MMG A;  1HY5 A;  2A6H F;  4PFP A;  4PJL A;  1VLT A;  2QLA A;  2IXN A;  3C8G A;  5EK0 A;  3PMR A;  3C7J A;  1UG7 A;  4AE4 B;  3QMK A;  2AWC A;  4EKW A;  5JRA A;  2XLD A;  3F46 A;  2MWQ A;  4BJ5 A;  3GM1 A;  3I5P A;  4Q4Z F;  1A41 A;  3U2L A;  4G0H A;  4LDQ A;  2LD6 A;  3QVZ A;  1D1A A;  4CSA C;  3DAF A;  2B0H A;  2QNL A;  4U5E E;  2XXA B;  3ASN C;  3ZQY A;  3U9M A;  1BR1 A;  5E33 A;  2HZ8 A;  1C17 M;  3PDM P;  3EZH A;  1NSG B;  2LIG A;  4NCQ A;  2HSQ A;  4OIP F;  2IM8 A;  1Q0M A;  1YYX A;  3CSK A;  3KYJ A;  2W45 A;  4CS7 A;  1Z23 A;  5COF A;  1A0B A;  2G3K A;  4XPW A;  3SYN A;  4CDA A;  1TWG A;  2YVK A;  5KYY B;  1JAF A;  1HMD A;  2NPU A;  2Y3D A;  4EHP A;  3EFO A;  3NDB B;  5T3T A;  1ORY A;  4CIP A;  2BC5 A;  3G4Z A;  5BQG A;  3V5Z A;  4MVU A;  2R7R A;  2D4U A;  2KYH A;  2XS8 A;  2KSF A;  1A7D A;  2P6V A;  3SXM A;  3W8I A;  2XL8 A;  4N4W A;  3EGX A;  1BBH A;  1NFO A;  1ZHX A;  1R4T A;  2IXP A;  2YLD A;  4MVQ A;  4C3E A;  1TWA A;  4DRI B;  5KYY A;  4CSA A;  2L9J A;  1QVX A;  2Y3H A;  3RQF A;  4D4N A;  1JOG A;  5F5F A;  3QW1 A;  4CX9 A;  1NLX A;  2XS1 A;  2WVO A;  4BEM J;  4O6N A;  3ATP A;  1V74 B;  3N2Z B;  2ZD9 A;  3Q7L A;  4JKV A;  3C18 A;  4YK5 A;  1XZP A;  1VTM P;  1K40 A;  4ULW A;  1YYJ A;  5TJ5 E;  1HE1 A;  1FFT C;  1NBB A;  1RKC A;  2WZL A;  3MYF A;  2Q7R A;  4U5C E;  4BG0 A;  2Y3B A;  3TJ6 A;  1G8X A;  3ZG1 A;  3L1M A;  4E0I A;  3MFN A;  1OKK D;  2IXO A;  1T01 A;  4L6R A;  2Y3G A;  2J9B A;  4DBQ A;  3JRT A;  2G62 A;  1PD0 A;  1HE9 A;  256B A;  3CAX A;  3EH1 A;  3OWT A;  4LER A;  1R5I D;  4CS9 A;  4G7O F;  3SP1 A;  2J46 A;  4PAC A;  5COM A;  2L6G A;  3ZSU A;  4LLE A;  4U5F E;  2XM4 A;  4J7Y A;  2J0W A;  1FMV A;  1WTY A;  3FAP B;  2YLG A;  5DS6 A;  2CCY A;  2GWW A;  2XM0 A;  4E7S A;  2V26 A;  3TOM A;  2M4E A;  2KQ9 A;  1G4W R;  3GOR A;  2PBE A;  2ZPA A;  3U8P A;  4CJO A;  1TWH A;  2HV7 A;  4HFK B;  3TQO A;  2R25 A;  2YL0 A;  2TMV P;  4KI2 A;  3QZC A;  3TUL A;  1T6Q A;  2R7O A;  4MVS A;  5COG A;  5IY5 C;  4IWB A;  1V4A A;  2HKV A;  2NUT B;  5AC5 A;  3DD7 A;  1MQV A;  2H8A A;  3DMD A;  1FFH A;  1I4Z A;  2HJM A;  4IGG A;  1BR4 A;  4NC3 A;  3GEH A;  3GOD A;  1OCZ C;  4N6H A;  5DVW A;  4JC7 A;  1Q0D A;  1YJG A;  3SXY A;  1K04 A;  1E85 A;  4I44 A;  2YKZ A;  2C04 A;  2AU5 A;  2YHS A;  2AWY A;  4MW3 A;  2YRF A;  1ST6 A;  2XRH A;  1CPQ A;  1PV3 A;  4NTF A;  4CDV A;  1E84 A;  1LE4 A;  2EIN C;  3JCU Q;  2ICW G;  4EBJ A;  5BQI A;  4EUK B;  2HJ3 A;  3AGU A;  5L0C A;  3H2U A;  2ZXW C;  2J8W A;  2XLH A;  4KNV A;  3GEI A;  2NSG A;  1ORJ A;  1OW8 A;  4H4K C;  5A6B A;  1A7E A;  4Q5S F;  4MVO A;  4YL0 A;  3ZVR A;  2EPL X;  3DE9 A;  5KYW A;  1VK5 A;  3DM5 A;  3JRM O;  1Y4C A;  4O6Y A;  4PFO A;  4G7Z F;  3KPH A;  1U0B B;  3G4X A;  3V5X A;  1D1B A;  2YLI A;  4XTK A;  3T6J A;  4BPM A;  5L3Q A;  1S7Z A;  2ASR A;  1MMD A;  3GWL A;  3POV A;  2RSE B;  4J30 B;  3OA1 A;  3DJN B;  3EGD A;  1VB5 A;  5JVE A;  5KYX B;  3BRJ A;  2VAS A;  2CGE A;  3IEE A;  2D5R B;  1LI7 A;  4C7O B;  5JSL A;  3X1O A;  5FCL A;  2OG2 A;  2VH3 A;  1RKE A;  4WJ0 A;  1OR3 A;  3FMS A;  4GEH A;  3H65 A;  1YZA A;  3QW0 A;  4IAR A;  1NZE A;  2M64 A;  3LS1 A;  4DRJ B;  1ZZP A;  4J7T A;  4QI0 A;  5A6K A;  1VYK A;  2FAP B;  1OW7 A;  1YAU O;  2QTV A;  4JVS A;  1ZHW A;  1RMV A;  2LK4 A;  1KU2 A;  4YT5 A;  5BUO A;  2LQG A;  4WGY A;  2KNH A;  1OR2 A;  2HFI A;  1AEP A;  1F1M A;  2EIK C;  2OQM A;  4F4B A;  4LAC B;  1T6U A;  3ZC4 A;  5L0G A;  1YVI A;  3TD7 A;  2WZF A;  4A4A A;  5AC4 A;  4QDL A;  4N6C A;  4EWC A;  4LDK A;  1FAP B;  1YA9 A;  3Q6N A;  1D0X A;  2XLV A;  3T4R A;  2YQY A;  3K7D A;  3GM3 A;  1E83 A;  1Q0G A;  1WN0 A;  2J7P D;  3DM9 B;  4YWQ A;  1LKX A;  4H54 A;  3AG4 C;  4NTA A;  3DXJ F;  4DJ9 A;  3H2V A;  4G7H F;  3EPV A;  2XL4 A;  3W8H A;  1H6G A;  5B1B C;  2Q00 A;  4ZLC A;  5HSW A;  3ABL C;  4P6I C;  3C62 A;  3O55 A;  4CDY A;  2CNW A;  3IHU A;  3K1H A;  3EJN A;  5BQH A;  2WVN A;  2ETS A;  4JJF A;  2GDC A;  1H9T A;  4KBL A;  4FWV A;  1V55 C;  1GQA A;  1OKK A;  1ZW2 A;  1QSP A;  3O10 A;  5L0D A;  1L7C A;  3AJM A;  4N06 A;  3IQ5 A;  4E17 A;  3ZIB A;  5L0J A;  1SF8 A;  2W4B A;  1RKE B;  3A11 A;  3VF0 A;  1APC A;  2KGO A;  1Z7Q c;  3DI5 A;  1GS9 A;  2DB4 A;  3O39 A;  5L3V A;  4YL1 A;  2EPO A;  2DYS C;  1JR8 A;  3U8V A;  1Q0F A;  2KC3 A;  4G78 A;  1DOW A;  2XSE A;  4O6M A;  3ZDL A;  1CGO A;  3IQT A;  3U9J A;  2H7V C;  2J9V A;  4K0D A;  4MND A;  3ZTM A;  5JLI A;  4J32 B;  1ZYR F;  2YL7 A;  3N0T A;  5A6B D;  1OCO C;  3M4C A;  2CNW D;  3RFY A;  3LNR A;  3HLZ A;  1NG1 A;  2EIM C;  1AUE A;  1EKY A;  2Q9C A;  3KMI A;  1IZM A;  1FNT c;  2YL1 A;  1E86 A;  1PCX A;  4JW1 A;  4HFF B;  4ULV A;  3RIP A;  3U2M A;  4MVM A;  3U0C A;  3N24 A;  3RH3 A;  1H7I A;  4KC9 A;  4W8K A;  1OXB A;  2J9W A;  2OKU A;  3UGO A;  2CDQ A;  3AOU A;  4UDV A;  2A0U A;  4BJ5 C;  1JMW A;  2KW3 C;  5A6J A;  4U9E A;  1AVO B;  4CBE A;  1QZX A;  3T6G B;  3SXK A;  5DQZ A;  5T3W A;  3FAJ A;  4MTG A;  3UMI A;  4DBR A;  5F5H A;  4XEF A;  5AGF A;  3DJU B;  4OIO F;  1RJ9 B;  1TFK B;  1OW6 A;  5KYN A;  4KNW A;  4LLC A;  3B0U X;  2PP4 A;  2Z15 A;  3MLG A;  4P9F A;  3PHF 2;  1Z63 A;  4CS8 C;  3IPM O;  4Z9I A;  2L81 A;  1GM5 A;  4XLN F;  2HMQ A;  4IJJ A;  2NUP B;  3K6B A;  2I8B A;  3U3B A;  3S0X A;  3I5Q A;  3ZQV A;  2A69 F;  4IAO A;  1TQG A;  1JPN A;  3AGT A;  4CJG A;  3MX3 A;  3B29 A;  4DVY P;  1SMY F;  5B3S C;  4FX5 A;  1I5N A;  3US6 A;  3DE8 A;  2UUI A;  2BL2 A;  2YL3 A;  5E2Q A;  1PD1 A;  2UUH A;  5JP7 A;  3RVZ A;  4OIN F;  1SZI A;  2QUP A;  4FES A;  2IXM A;  4MTF A;  3HTK C;  3JT1 A;  1TKN A;  4K1O A;  3K33 A;  1ZU5 A;  3B71 A;  3LEO A;  5CI9 A;  3NKD A;  3NMI A;  5DS4 A;  5CI8 A;  2KK1 A;  3M15 A;  3EZI A;  1FR0 A;  5DQT A;  2YZS A;  1V54 C;  1YLM A;  2PX3 A;  3EHM A;  5D92 A;  1OQC A;  4CIH A;  2KJG A;  3RKO F;  3SXZ A;  4JZA A;  3EFO B;  4XLP F;  3TOL A;  1RCP A;  3W2W A;  4DVZ A;  3FOO A;  2PFD A;  3HKK A;  4M63 A;  3VRC A;  2NSF A;  1S05 A;  2OJQ A;  4E18 A;  3T9O A;  4BJ1 A;  1A7V A;  2FFH A;  3JTL O;  1LVK A;  2XLM A;  1T9K A;  4BJT A;  3B0P A;  1K05 A;  4OIR F;  1M6T A;  5B3I A;  3F47 A;  1NU9 C;  4EBK A;  3CQZ A;  5A6A A;  3EG9 A;  4XPX A;  1D0Z A;  3FHD A;  4JTD B;  2R7S A;  4IAQ A;  1T5O A;  2OU6 A;  1RJ9 A;  1N1C A;  3C8G B;  4U5B E;  1FMW A;  2DGJ A;  2IBF A;  3JSE O;  4C3B A;  5L0H A;  3J06 A;  1U89 A;  2IOQ A;  1BR2 A;  1WOL A;  1O3U A;  4Q7C A;  2VCA A;  4ER9 A;  2VB6 A;  4JTC B;  2CW0 F;  5D91 A;  2GFH A;  1CGN A;  4R32 A;  4RBN A;  2R7W A;  1TR2 A;  4GQH A;  2R7T A;  1M2V A;  2P0N A;  2L6H A;  4OD5 A;  2MHR A;  3KL4 A;  3U3F A;  2EIJ C;  2GAQ A;  1XZQ A;  1HMO A;  3IQC A;  4HE8 D;  1ZVZ A;  2QY9 A;  5FZT A;  2OOC A;  3LUT B;  3S84 A;  1BZ4 A;  4FAP B;  4C3D A;  4IB4 A;  2JX0 A;  1LS1 A;  2BE5 F;  2OEX A;  3EGD B;  3MBG A;  4JJG A;  1KTM A;  3CZ6 A;  1LM3 B;  1DOV A;  3VYW A;  5JUA A;  4XQ1 A;  4JRZ A;  2G3V A;  1JPJ A;  2JD3 A;  1VLS A;  3EHN A;  3QTH A;  3QVY A;  5CIV A;  1ZU4 A;  2GA0 A;  1ORS C;  3RQE A;  3LLK A;  2JPU A;  3RVY A;  3VM6 A;  1WAT A;  3B9Q A;  1JRA A;  3BEH A;  4JE9 A;  1MND A;  2PNO A;  4I1O B;  2F22 A;  3OEO A;  1M56 C;  3U5S A;  3EGX B;  3R2P A;  4NQF A;  5E3A A;  3UR3 C;  4E7Z A;  2A0B A;  1KNY A;  2NG1 A;  3ASO C;  3W2V A;  2IYL D;  1VMA A;  3FXH A;  3NYM A;  1I4Y A;  3W4Y A;  2LFF A;  2HMZ A;  3L0I A;  4YT4 A;  1NU7 D;  3AG3 C;  1TWC A;  3NG1 A;  3A9C A;  4AL0 A;  4IRU A;  3I4U A;  3JYY A;  1O87 A;  1YAR O;  3EG9 B;  1G4U S;  2LP4 A;  3LJB A;  1W2W A;  4ZLD A;  2C03 A;  3ABM C;  3M1C B;  3WOD F;  3Q7G A;  4OD4 A;  2NUT A;  3NKE A;  1QQ3 A;  3VAY A;  1WAS A;  3HNK A;  1LS4 A;  3ABK C;  3Q6M A;  4YN0 B;  4BJ6 C;  5L0F A;  2NUP A;  1MMA A;  4PJN A;  3PCV A;  1LPE A;  3ZWI A;  4AX2 A;  3UMH A;  2L7A A;  2OJE D;  1M2V B;  3AG2 C;  1J8Y F;  3AQB A;  4U5H A;  2XLO A;  5E3C A;  1M2O A;  3ZTZ A;  2W4M A;  4AE4 A;  4U5D E;  5EGY A;  4XEV A;  4I1M A;  1SYQ A;  5GPG B;  1LE2 A;  3LAY A;  2A6E F;  4MTO A;  4MVR A;  2XLE A;  2WB7 A;  3NRH A;  3S29 A;  2W9Y A;  3HNI A;  2AVK A;  4ANJ A;  4YT2 A;  2CYD A;  5A69 A;  4JEB A;  3K1I A;  2ZXR A;  4B6I A;  3HJC A;  2X0C A;  2L6F A;  2P1A A;  3FVY A;  3K66 A;  3LNM B;  1XWJ A;  3C8G D;  4PR9 A;  1VYI A;  2ZXO A;  3MYI A;  2LSE A;  4GYT A;  1TFO B;  3CEX A;  2WVQ A;  3S9O A;  3ITF A;  3C63 A;  2HSB A;  3L8I A;  3NMJ A;  4Z9J A;  4C7O A;  2R03 A;  3UMK A;  1Z5Z A;  2ZXP A;  2J0X A;  3X2Q C;  2YWA A;  4DOZ A;  4W8P A;  4X0R A;  2FGY A;  1NFN A;  2P61 A;  2Y69 C;  1U6H A;  1UFB A;  3L34 A;  4YL3 A;  1CGM E;  5B1A C;  3LLI A;  4WGZ A;  1O5H A;  1YZC A;  1MMN A;  3S27 A;  1OCR C;  2AP3 A;  3WAQ A;  2A1D D;  2Q4F A;  1LI5 A;  1C02 A;  3JZ0 A;  3UGP A;  1YA7 O;  3SNH A;  3AQC A;  3ECS A;  2HV6 A;  4O79 A;  3DZA A;  2PX0 A;  1GGQ A;  1WWP A;  3KYI A;  2R7X A;  1J8M F;  3RYL A;  4P9T A;  2VC9 A;  2X51 A;  2H7O A;  2OCC C;  1H9G A;  4OIQ F;  1QPU A;  1OXK A;  4YT8 A;  4RD9 A;  3K1I C;  3RW0 A;  4A2N B;  5HV9 A;  4EIY A;  2HUJ A;  2VCC A;  4ONS A;  2R9R B;  2XL6 A;  4RDA A;  1FTS A;  3GAN A;  5EHH A;  3IQ6 A;  3LES A;  4K7B A;  1ZHT A;  5KYU B;  1OCC C;  2EIL C;  2DYR C;  4NTB A;  1WGW A;  3NYL A;  3O6X A;  2LFD A;  4U9D A;  1QLE C;  2B0J A;  4Z9H A;  1L3P A;  2R05 A;  5JS5 A;  1BDJ B;  3M4B A;  2VCB A;  3DWW A;  2WZG A; 
#chains in the Genus database with same CATH homology
 3R7C A;  3GWN A;  3O55 A;  4E0I A;  3U2L A;  3W4Y A;  4LDK A;  3GWL A;  3U5S A;  4E0H A;  3LLK A;  3LLI A;  3MBG A;  1JR8 A;  3TK0 A;  3U2M A;  1JRA A;  1OQC A;  2HJ3 A;  3TD7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...