2XSEA

The structural basis for recognition of j-base containing dna by a novel dna-binding domain in jbp1
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
167
structure length
160
Chain Sequence
MVSTAVEKKKYLDSEFLLHCISAQLLDMWKQARARWLELVGKEWAHMLALNPERKDFLWKNQSEMNSAFFDLCEVGKQVMLGLLGKEVALPKEEQAFWIMYAVHLSAACAEELHMPEVAMSLRKLNVKLKDFNFDMPPEEKKRRMERKQRIEEARRHGMP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxidoreductase
molecule keywords THYMINE DIOXYGENASE JBP1
publication title The Structural Basis for Recognition of Base J Containing DNA by a Novel DNA Binding Domain in Jbp1.
pubmed doi rcsb
source organism Leishmania tarentolae
total genus 52
structure length 160
sequence length 167
ec nomenclature ec 1.14.11.6: Thymine dioxygenase.
pdb deposition date 2010-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18526 DB_JBP1 Thymine dioxygenase JBP1 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1440 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 2xseA00
2XSEA
chains in the Genus database with same CATH superfamily
2UUIA 4DOZA 1U6HA 3BEHA 2D5RB 5L0CA 4BG0A 3DZAA 2WZFA 3MBGA 3UGOA 2OEVA 3WAQA 1C03A 3AOUA 2EIMC 4X0RA 3EZHA 3R7CA 4YT2A 3U2MA 3KYJA 3EJNA 3DAGA 3QW1A 1BR2A 1O3UA 4EUKB 5JSLA 3FDQA 2IXOA 4J32B 5COFA 1IW7F 1QLEC 4YJWA 5BQIA 1D1BA 3O6XA 4PR9A 1KNYA 2CGEA 1ST6A 2P7VA 5JUAA 2DB4A 2WB7A 1LVKA 1A7VA 5BQGA 1WATA 5KYUB 2Q9BA 1ZZPA 4DRHB 2NG1A 1D0ZA 2X51A 3S27A 4IGGA 1V55C 4BEMJ 1M57C 4P9TA 1TQGA 1YA7O 1ZHYA 4BJ6A 4H4KC 5D91A 2YWAA 3NDBB 3UNGC 2B0JA 2KW3C 4XEKA 4DBRA 4EWCA 3K1IA 1Q0KA 3TJ5A 1M2VA 3E9VA 3F47A 2EPNA 3GEHA 2L6GA 4JEAA 3Q7GA 3US6A 1OQCA 4U5CE 2OG2A 3IQ5A 4L6RA 2XS1A 4PFOA 3SEOA 4PJLA 3UGPA 3RW0A 2GFHA 3GM2A 3K7DA 3C8GA 1G8XA 4KNWA 1GS9A 4ULWA 2XL4A 4BEJA 3L8JA 2J9VA 5DVWA 3TOLA 256BA 4LLCA 5JT4A 3PMRA 2VCCA 2L6HA 2WVNA 1V4AA 5KYYA 1BBHA 1OKKD 1MMAA 2P1AA 3JZ0A 4NTBA 3UMHA 5K0IA 3K1IC 4MS2A 5KYWA 3VYWA 3FXHA 5DQTA 4ZLCA 1YDIA 1G5ZA 3ZIBA 2ZXRA 4M63A 2WL8A 3AQBA 4XPYA 1ZHWA 2LQGA 2DYRC 3U9JA 2YVKA 4ER9A 2BL2A 2W4BA 4DVZA 5L0DA 2QLAA 2A0BA 5JVEA 1T01A 2VB6A 2EIKC 1D0YA 2XL8A 3RH3A 1MMDA 2H7BA 3A11A 5D92A 5FZTA 3MYFA 2VASA 4Z9IA 4C3BA 3EZIA 3IQTA 3KMIA 1OXKA 3VRCA 4F4BA 2R7XA 2WVQA 3W8HA 1RKEB 1A41A 4CS9A 2ASRA 4CDAA 4D4XA 4E0HA 3TOMA 4MTGA 3DE8A 4NC3A 3LAYA 3FMSA 4ULVA 3AG2C 3SYNA 4C3DA 1KTMA 1WTYA 2WVOA 1FFHA 1I5NA 3GANA 1A7EA 3ZSUA 4JCHA 1TR2A 4WABA 2J7PA 2HZ8A 1M2OA 4LDQA 4N06A 2TMVP 3I5QA 1K04A 1BR1A 4JW1A 1PD0A 3MFNA 4XWJA 3ZG1A 1LIHA 3LNRA 5B3SC 4WGYA 5AC4A 4G7HF 2R7UA 1WGWA 2OKUA 1G4US 4CS9C 2Q4FA 4FX5A 2Y3BA 2G3VA 4XPXA 3U2LA 3U8VA 3JSEO 3W2VA 4U5EE 3RQEA 5DS5A 2J46A 4YL1A 3L0IA 1OW7A 1A7DA 1UFBA 3S9OA 3PHF2 1K05A 4MNDA 2YLDA 1DOVA 3JRTA 4U9EA 3X1OA 4BJ5A 1I4YA 1T9KA 4E18A 5L3VA 2XLVA 4MVUA 1YZAA 2CDQA 1D1CA 1NZEA 3LS1A 2Q9AA 5FCLA 2OU6A 5DS6A 3DM9B 4AL0A 3IPMO 2NUTA 1BR4A 2L6FA 2P0NA 3DAFA 4LACB 3S84A 4XLPF 4G78A 2R9RB 2A69F 1VMAA 2Q9CA 1U89A 2WZLA 4P9FA 4W8KA 3WHNA 5L0HA 5KYXA 4DBQA 1QPUA 2P61A 4DJ9A 3SNHA 2AP3A 4ZLDA 3K33A 1ZYRF 3CEXA 3ATPA 2R05A 1ZU4A 4NCQA 5T1DB 1E84A 1YYJA 3W8IA 1M2VB 1CGOA 4O6MA 4DRIB 3B0UX 1YJGA 2HV7A 1YLMA 1Z5ZA 4JTAB 1AEPA 2KNHA 3O55A 2GA0A 4JZAA 3U8PA 3AJMA 4LDRA 3JSZA 2R7SA 1VLTA 3C8GB 2L81A 3RF3A 1RKEA 4IAQA 4CS8A 4U9DA 3V5YA 2XSEA 5KYYB 1OCOC 4DRJB 1RJ9A 5A6JA 5GPGB 3POVA 2CNWA 5E2QA 3KH2A 4C3EA 5KYWB 2W45A 1QVXA 2W9YA 3G4ZA 4HFFB 4NTAA 4RD9A 1CGME 2VH3A 4I1OB 2XLEA 2GAQA 3RYLA 3K66A 5HSWA 3M4BA 1VYIA 3ABMC 3B71A 3LLIA 2FGYA 3M15A 4EBBA 1SMYF 1YAUO 2KQ9A 4QI2A 2YL0A 3VAYA 1SZIA 2KK1A 3ASNC 4U5HA 3CAXA 2R7RA 4KNVA 2IM8A 4XPWA 4NTFA 2XXAA 2XLOA 1H9TA 3GWLA 4I44A 1JPJA 3LLKA 4U5GA 5B1AC 2G3KA 2VCBA 4G7ZF 4OIPF 2MHRA 5L3QA 3HLZA 3J06A 5COGA 3T6GB 5L0FA 3ASOC 1OXBA 3CZ6A 3AG4C 1NU7D 3NKEA 2V3CC 3GEEA 1ORSC 3VM6A 4AL1A 4HEAJ 1APCA 2A68F 3KPHA 2MYSA 5B1BC 4OD5A 3C8ZA 2KC3A 3U9MA 1LM3B 1OCZC 3DI5A 4YWQA 2FAPB 1CPQA 2M64A 1T6IA 2XLHA 4I3MA 5E3CA 1VOMA 1MNEA 1Y6DA 3T4RA 3KL4A 2XM0A 3AQCA 2CW0F 3NKDA 3K6BA 3H2VA 2FFHA 4EHPA 2IXMA 4QDLA 3HTKC 3G4XA 3QVYA 1LPEA 3B0VC 1SF8A 2NSFA 3NYLA 4MTFA 2J9UA 5BUOA 5L0IA 1YARO 1L7CA 3FVYA 4MTOA 4CS7A 4BJ6C 2JD3A 3FOOA 3LNMB 3NMJA 3K1HA 3QTHA 2XS8A 3RKOF 5F28E 2HKVA 2A6EF 2NSGA 3DXJF 4K1OA 4EBKA 1E85A 2NUTB 2Y3GA 3BRJA 5A6BA 3S28A 1PCXA 3TULA 4C7OA 5T3TA 5DS4A 5KYXB 2JX0A 2HJ3A 1JAFA 1YYXA 3EG9A 4JVSA 4D4NA 2NPUA 3ZC4A 3GM3A 4EIYA 1GGQA 4E7SA 2F22A 3KYIA 3NYJA 3MX3A 1OCRC 4K7BA 5JS5A 3OEOA 1M56C 1S05A 1F1MA 1ZW2A 1EI7A 3Q7LA 3T6JA 2A6HF 4CBEA 4O79A 2YHSA 3NRHA 4NQFA 1IZMA 3EHMA 4OINF 1E86A 1FTSA 2HSBA 2L9JA 2XLMA 1U0BB 1JMWA 2NUPA 2LP4A 1JOGA 1LKXA 1VB5A 2UUHA 1Q0DA 3C63A 1D0XA 1E2XA 3S29A 1RJ9B 2EPOA 4JKVA 4YT4A 1Z63A 4YT8A 1HY5A 1MMNA 2DGJA 4W8PA 3UMKA 2YQYA 2AWYA 3M79A 5EGYA 2KGOA 1QSPA 1HE1A 2YLIA 3HJCA 4PJJA 4PFPA 3X2QC 2PX0A 3QVZA 3IQCA 3S90A 1VYKA 1TWHA 3E70C 3IQ6A 2H7OA 2R25A 3DWWA 3SZRA 5A6AA 4Z9JA 1SR2A 1ORJA 2PFDA 2Y39A 2KSFA 3PCVA 4N4WA 3SXYA 4EKWA 1N1CA 2C04A 2J9WA 3FOPA 4PJNA 5HV9A 2RSEB 2H7VC 3T9OA 2XXAB 1HMDA 3ECSA 3TJ6A 1ZHTA 3HNJA 4B6IA 4DXWA 2HUJA 2QTVA 2KJGA 2PF4E 5E33A 1JRAA 1RXQA 3C7JA 3OWTA 3U3BA 3RVZA 5B3IA 2R7WA 1M6TA 4WGZA 3WODF 4PJMA 4NY3A 4ONSA 1A0BA 4CX9A 4JJFA 4FAPB 4U5DE 4XLNF 1ZW3A 5EK0A 2G62A 2OEXA 5JP7A 5IY5C 3T6BA 3NG1A 1S7ZA 2Y3DA 3EH2A 2EILC 2C03A 2YRFA 3O39A 4E17A 4JJGA 4CSAA 3KKBA 3ZTZA 3IEEA 1TFKB 3EQLF 1DOWA 2QE9A 1ZU5A 2ZXOA 3C62A 3H2UA 3ZQVA 4BJ5C 3S0XA 3TK0A 3LJBA 2IBFA 4E7ZA 2D4UA 2LK4A 1HW2A 3VF0A 5TJ5E 1OR2A 2I8BA 4IARA 1RMVA 1OW6A 3LEVA 2V26A 1HW1A 5T3WA 3W2WA 4BJ1A 4OIQF 5F5HA 2Y3HA 3AGTA 2GWWA 4J30B 2PNOA 3JCUQ 2OJED 2R7QA 2A1DD 2LD6A 3L8IA 4MW8A 5E3AA 1O5HA 1R4TA 5BQHA 2ZD9A 3GODA 1VLSA 1ZVZA 4O6NA 4JCZA 1GM5A 1O87A 3EGXA 3O10A 4YK5A 3DM5A 4IB4A 3V5XA 1VTMP 4C7OB 4A2NB 3EG9B 3H65A 2R02A 2VC9A 4MQ9F 3W4YA 5A6KA 2KYHA 1D1AA 2OJQA 3R2PA 4CIHA 2J7PD 1H9GA 1LI7A 1KU2A 3ZWIA 4CS8C 2B0HA 4KI2A 1NBBA 3IHUA 5DLJA 1XZPA 5L0GA 1OKKA 3QMKA 4GYTA 3TQOA 2OQMA 1EKYA 4RBNA 1H7IA 2Z15A 4H54A 1HMOA 5A69A 2M4EA 2YLGA 1BZ4A 2NUPB 1FNTc 1FAPB 3TD7A 4QI0A 4P6IC 1NLXA 2YL1A 1AUEA 3MLGA 4PK4A 1LS1A 2IXPA 3EGDA 1MNDA 2WZGA 4JIOA 3RQFA 4OIOF 4AK9A 1NU9C 4J7YA 3N2ZB 1TWCA 4OIRF 3WG7C 1NG1A 1WOLA 1CPRA 2XM4A 3JYYA 2L7AA 3LS0A 3OA1A 4JC7A 4JE9A 3ZQYA 2R7VA 2P6VA 3B9QA 2AWCA 4JEBA 3CQZA 2BC5A 1NFOA 1RKCA 1PD1A 2Y69C 3EFOA 4HE8D 4JURI 5KYNA 3JYHA 4IAOA 2J8WA 3HKKA 4IWBA 2H8AA 1Z3IX 1C02A 1RCPA 1Z7Qc 2MWQA 4OD4A 1V74B 5JRAA 1EQ1A 5EHHA 3N24A 2I15A 2EIJC 1CGNA 3DJUB 2OOCA 4LERA 4O6YA 4CJGA 2CNWD 2IOQA 5AC5A 2J0WA 3HNKA 1TKNA 1C17M 1OW8A 1T6QA 2XL6A 1ORYA 1E83A 2XLWA 1LS4A 2HFIA 2ICWG 3I5PA 4U5BE 3RFYA 3B0PA 5JLIA 1FR0A 4AE4A 2IXNA 2BE5F 1Q0GA 2R7OA 1B68A 1ZHZA 4JRZA 3G50A 2PX3A 2QNLA 3AG1C 2AVKA 3AGUA 3AG3C 1R5ID 2VCAA 4LLEA 2W4MA 2EPMX 3NMKA 1LE2A 1Z23A 1OR3A 1ZHXA 2J9BA 3RQGA 1J8YF 5L0JA 1LI5A 1V54C 1OCCC 4RDAA 2ETSA 3Q6NA 3U5SA 3L34A 3JRMO 1MMGA 4DVYP 4G0HA 3GM1A 4MVMA 3EGXB 2LFFA 3ITFA 2HMZA 1YA9A 2XLDA 1T6UA 1VK5A 1YVIA 2YEVA 3HNLA 5AGFA 3ABKC 3DJNB 1UG7A 2DYSC 4Z9HA 1Q0MA 3DMDA 2RD9A 2XRHA 1LE4A 2Q00A 4EBJA 1EA8A 3V5ZA 4XQ1A 3V7OA 4Q5SF 3C18A 4MW3A 3ZVRA 1J8MF 2AU5A 2ZPAA 3UR3C 3M1CB 4YT5A 2X0CA 3FAPB 1FMWA 3SXZA 1WN0A 3DD7A 1TWAA 3C8GD 3EHNA 3F46A 5KYUA 2Q7RA 3SXKA 3LEOA 4Q7CA 3Q6MA 4YL0A 1W2WA 3N0TA 2Q3TA 1I4ZA 3MYIA 3SXMA 1JR8A 4FWVA 3ZDLA 2E87A 1TFOB 1QZXA 1TWGA 1FMVA 3ABLC 3EGDB 1H6GA 3JT1A 4R32A 4WJ0A 2QY9A 3L1MA 3LESA 4MVQA 4XEVA 2YKZA 5A6BD 4CDVA 2J0XA 3U3FA 4KBLA 3GWNA 2J45A 2JPUA 2LSEA 3GORA 1Q0FA 3A9CA 2R7TA 3LUTB 5DQZA 4G7OF 4CJOA 1K40A 3EPVA 2YL3A 2OCCC 2YL7A 3EFOB 3NMIA 4GQHA 4E0IA 4ANJA 2GDCA 1JPNA 4U5FE 4AX2A 4UDVA 2HMQA 3ZTMA 5COMA 1HE9A 4CDYA 4N6CA 5CIVA 3U0CA 3CSKA 4BJTA 1BDJB 1XWJA 1Y4CA 3RIPA 3UMIA 3PDMP 2A0UA 2O9XA 3DKAA 2HS5A 1YZCA 2PP4A 2EPKX 4JTDB 4Q4ZF 1MQVA 4CSAC 3I4UA 4MVOA 1Z6AA 1QKRA 1SYQA 4JTCB 2YZSA 4MVZA 2CCYA 2ZXWC 3FHDA 1PV3A 4IJJA 3DE9A 1L3PA 2HJMA 1WASA 2QUPA 3B29A 3EH1A 2HSQA 3GEIA 4I1MA 1G4WR 4O7GA 4MVSA 1WWPA 4N6HA 4XTKA 4YL3A 4MVRA 5F5FA 4IRUA 2R03A 2LFDA 1FFTC 3RVYA 3SP1A 1XZQA 2ZXPA 1QQ3A 4AE4B 5CI8A 4YN0B 3FAJA 1NFNA 1T5OA 2EINC 2IYLD 4GEHA 3JTLO 3QZCA 2LIGA 4KC9A 4K0DA 2EPLX 1NSGB 4BPMA 3HNIA 4FESA 4HFKB 2HV6A 2LCHA 2PBEA 1GQAA 4A4AA 2DI3A 3M4CA 4LDKA 4XEFA 4CIPA 4J7TA 4PACA 5CI9A 3QW0A 1AVOB 3NYMA 2CYDA
chains in the Genus database with same CATH topology
4DOZA 2D5RB 4BG0A 3DZAA 2WZFA 3UGOA 2EIMC 4X0RA 3EZHA 4YT2A 3EJNA 3DAGA 1BR2A 3FDQA 2IXOA 4J32B 1IW7F 1QLEC 4YJWA 1D1BA 3O6XA 2CGEA 1ST6A 2P7VA 2WB7A 1LVKA 5KYUB 2Q9BA 2NG1A 1D0ZA 2X51A 3S27A 1V55C 1M57C 1ZHYA 4BJ6A 4H4KC 5D91A 3NDBB 3UNGC 2B0JA 2KW3C 4DBRA 4EWCA 1M2VA 3E9VA 3F47A 3Q7GA 4U5CE 2OG2A 3SEOA 4PFOA 3UGPA 4PJLA 2GFHA 3K7DA 1G8XA 4KNWA 4ULWA 2XL4A 4BEJA 2J9VA 5DVWA 4LLCA 3PMRA 2WVNA 5KYYA 1OKKD 1MMAA 3UMHA 3K1IC 5KYWA 3VYWA 5DQTA 4ZLCA 3ZIBA 2ZXRA 4M63A 2WL8A 3AQBA 1ZHWA 2DYRC 2W4BA 4DVZA 2VB6A 2EIKC 1D0YA 3RH3A 1MMDA 2H7BA 5D92A 2VASA 4C3BA 3EZIA 3KMIA 4F4BA 2R7XA 2WVQA 3W8HA 4CS9A 4C3DA 3SYNA 3LAYA 3AG2C 2WVOA 1FFHA 3GANA 4JCHA 1TR2A 2J7PA 1M2OA 4N06A 3I5QA 1BR1A 4JW1A 1PD0A 4XWJA 3ZG1A 3LNRA 5B3SC 4G7HF 2R7UA 1WGWA 4CS9C 4FX5A 2Y3BA 2G3VA 3W2VA 4U5EE 2J46A 3L0IA 3PHF2 4MNDA 3JRTA 3X1OA 4BJ5A 5L3VA 1NZEA 1D1CA 2CDQA 3LS1A 2Q9AA 5FCLA 5DS6A 3DM9B 2NUTA 1BR4A 4LACB 3DAFA 4XLPF 2WZLA 2A69F 2Q9CA 1VMAA 4W8KA 5KYXA 4DBQA 4ZLDA 3SNHA 3K33A 1ZYRF 5T1DB 1ZU4A 3W8IA 1M2VB 4O6MA 3B0UX 2HV7A 1Z5ZA 4JZAA 2KNHA 3JSZA 2R7SA 2L81A 4CS8A 2XSEA 5KYYB 1OCOC 1RJ9A 3POVA 2CNWA 5E2QA 3KH2A 4C3EA 5KYWB 2W45A 2W9YA 4HFFB 4RD9A 2VH3A 4I1OB 3RYLA 3K66A 5HSWA 1VYIA 3ABMC 3LLIA 2FGYA 4EBBA 1SMYF 2KQ9A 4QI2A 3VAYA 1SZIA 3ASNC 4U5HA 2R7RA 4KNVA 2XXAA 4I44A 4OIPF 1JPJA 3LLKA 4U5GA 5B1AC 2G3KA 4G7ZF 5L3QA 3HLZA 3ASOC 3CZ6A 3AG4C 1NU7D 3NKEA 2V3CC 4HEAJ 2A68F 2MYSA 5B1BC 4OD5A 1OCZC 4YWQA 4I3MA 5E3CA 1VOMA 1MNEA 3T4RA 3KL4A 3AQCA 2CW0F 3NKDA 3K6BA 2FFHA 2IXMA 4QDLA 3HTKC 3B0VC 1SF8A 3NYLA 2J9UA 5BUOA 3FVYA 4CS7A 4BJ6C 2JD3A 3K1HA 3RKOF 2A6EF 3DXJF 2NUTB 2Y3GA 3S28A 1PCXA 4C7OA 5T3TA 5DS4A 5KYXB 4JVSA 3EG9A 3ZC4A 4E7SA 3NYJA 3MX3A 1OCRC 4K7BA 3OEOA 1M56C 3Q7LA 3T6JA 2A6HF 4CBEA 4O79A 2YHSA 3NRHA 1IZMA 3EHMA 4OINF 1FTSA 2L9JA 2NUPA 1LKXA 1D0XA 3S29A 1RJ9B 4YT4A 1Z63A 4YT8A 1MMNA 2DGJA 3UMKA 5EGYA 2KGOA 3HJCA 4PJJA 4PFPA 3X2QC 2PX0A 1VYKA 1TWHA 3E70C 2H7OA 3SZRA 2PFDA 2Y39A 1N1CA 2C04A 2J9WA 4PJNA 2H7VC 2XXAB 3ECSA 1ZHTA 4B6IA 2QTVA 2KJGA 2PF4E 5E33A 3OWTA 2R7WA 3WODF 4PJMA 4NY3A 4JJFA 4U5DE 4XLNF 5IY5C 2G62A 3T6BA 3NG1A 1S7ZA 2Y3DA 3EH2A 2EILC 2C03A 3O39A 4CSAA 4JJGA 3KKBA 3IEEA 3EQLF 3S0XA 1ZU5A 2ZXOA 4BJ5C 3LJBA 4E7ZA 2I8BA 3LEVA 2V26A 3W2WA 5T3WA 4BJ1A 4OIQF 5F5HA 2Y3HA 4J30B 3JCUQ 2R7QA 2A1DD 5E3AA 1O5HA 3GODA 4O6NA 1O87A 3EGXA 3DM5A 4C7OB 4A2NB 3EG9B 3H65A 4MQ9F 1D1AA 4CIHA 2J7PD 1KU2A 4CS8C 4KI2A 5DLJA 1OKKA 3QMKA 4GYTA 4RBNA 2Z15A 2M4EA 2NUPB 3TD7A 4QI0A 4P6IC 3MLGA 4PK4A 1LS1A 2IXPA 3EGDA 1MNDA 2WZGA 4OIOF 4AK9A 1NU9C 3N2ZB 1TWCA 4OIRF 3WG7C 1NG1A 3LS0A 3OA1A 2R7VA 2P6VA 3B9QA 3CQZA 2Y69C 1PD1A 4HE8D 3EFOA 4JURI 5KYNA 3JYHA 4IAOA 4IWBA 1Z3IX 2MWQA 4OD4A 5EHHA 3N24A 3DJUB 2EIJC 4LERA 4O6YA 2CNWD 2IOQA 2J0WA 1TKNA 4U5BE 3RFYA 3I5PA 3B0PA 4AE4A 2IXNA 2BE5F 2R7OA 1ZHZA 2PX3A 3AG1C 3AG3C 4LLEA 2W4MA 1Z23A 1ZHXA 1J8YF 1V54C 1OCCC 4RDAA 3Q6NA 3L34A 1MMGA 4DVYP 4G0HA 3EGXB 3ITFA 1VK5A 2YEVA 3ABKC 3DJNB 2DYSC 3DMDA 2XRHA 3V7OA 4Q5SF 3ZVRA 1J8MF 2ZPAA 3UR3C 3M1CB 4YT5A 1FMWA 3DD7A 1TWAA 3EHNA 3F46A 5KYUA 4Q7CA 3Q6MA 1W2WA 3N0TA 2Q3TA 4FWVA 2E87A 1TWGA 1QZXA 3ABLC 1FMVA 3EGDB 3JT1A 4WJ0A 3UMIA 5DS5A 2QY9A 3LESA 2J0XA 4KBLA 2J45A 2LSEA 2R7TA 5DQZA 4G7OF 3EPVA 2OCCC 3EFOB 4ANJA 1JPNA 4U5FE 4AX2A 3CSKA 4BJTA 3RIPA 2O9XA 2PP4A 4Q4ZF 4CSAC 3I4UA 1Z6AA 2YZSA 2ZXWC 3FHDA 4IJJA 3ZSUA 4I1MA 3EH1A 4O7GA 4XTKA 5F5FA 4IRUA 3SP1A 1FFTC 4AE4B 2ZXPA 5CI8A 4YN0B 3FAJA 2IYLD 2EINC 4GEHA 3QZCA 4KC9A 4K0DA 4FESA 4HFKB 2HV6A 5CI9A 3NYMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XSE A; 
#chains in the Genus database with same CATH topology
 2UUI A;  4DOZ A;  1U6H A;  3BEH A;  2D5R B;  5L0C A;  4BG0 A;  3DZA A;  2WZF A;  3MBG A;  3UGO A;  2OEV A;  3WAQ A;  1C03 A;  3AOU A;  2EIM C;  4X0R A;  3EZH A;  3R7C A;  4YT2 A;  3U2M A;  3KYJ A;  3EJN A;  3DAG A;  3QW1 A;  1BR2 A;  1O3U A;  4EUK B;  5JSL A;  3FDQ A;  2IXO A;  4J32 B;  5COF A;  1IW7 F;  1QLE C;  4YJW A;  5BQI A;  1D1B A;  3O6X A;  4PR9 A;  1KNY A;  2CGE A;  1ST6 A;  2P7V A;  5JUA A;  2DB4 A;  2WB7 A;  1LVK A;  1A7V A;  5BQG A;  1WAT A;  5KYU B;  2Q9B A;  1ZZP A;  4DRH B;  2NG1 A;  1D0Z A;  2X51 A;  3S27 A;  4IGG A;  1V55 C;  4BEM J;  1M57 C;  4P9T A;  1TQG A;  1YA7 O;  1ZHY A;  4BJ6 A;  4H4K C;  5D91 A;  2YWA A;  3NDB B;  3UNG C;  2B0J A;  2KW3 C;  4XEK A;  4DBR A;  4EWC A;  3K1I A;  1Q0K A;  3TJ5 A;  1M2V A;  3E9V A;  3F47 A;  2EPN A;  3GEH A;  2L6G A;  4JEA A;  3Q7G A;  3US6 A;  1OQC A;  4U5C E;  2OG2 A;  3IQ5 A;  4L6R A;  2XS1 A;  4PFO A;  3SEO A;  4PJL A;  3UGP A;  3RW0 A;  2GFH A;  3GM2 A;  3K7D A;  3C8G A;  1G8X A;  4KNW A;  1GS9 A;  4ULW A;  2XL4 A;  4BEJ A;  3L8J A;  2J9V A;  5DVW A;  3TOL A;  256B A;  4LLC A;  5JT4 A;  3PMR A;  2VCC A;  2L6H A;  2WVN A;  1V4A A;  5KYY A;  1BBH A;  1OKK D;  1MMA A;  2P1A A;  3JZ0 A;  4NTB A;  3UMH A;  5K0I A;  3K1I C;  4MS2 A;  5KYW A;  3VYW A;  3FXH A;  5DQT A;  4ZLC A;  1YDI A;  1G5Z A;  3ZIB A;  2ZXR A;  4M63 A;  2WL8 A;  3AQB A;  4XPY A;  1ZHW A;  2LQG A;  2DYR C;  3U9J A;  2YVK A;  4ER9 A;  2BL2 A;  2W4B A;  4DVZ A;  5L0D A;  2QLA A;  2A0B A;  5JVE A;  1T01 A;  2VB6 A;  2EIK C;  1D0Y A;  2XL8 A;  3RH3 A;  1MMD A;  2H7B A;  3A11 A;  5D92 A;  5FZT A;  3MYF A;  2VAS A;  4Z9I A;  4C3B A;  3EZI A;  3IQT A;  3KMI A;  1OXK A;  3VRC A;  4F4B A;  2R7X A;  2WVQ A;  3W8H A;  1RKE B;  1A41 A;  4CS9 A;  2ASR A;  4CDA A;  4D4X A;  4E0H A;  3TOM A;  4MTG A;  3DE8 A;  4NC3 A;  3LAY A;  3FMS A;  4ULV A;  3AG2 C;  3SYN A;  4C3D A;  1KTM A;  1WTY A;  2WVO A;  1FFH A;  1I5N A;  3GAN A;  1A7E A;  3ZSU A;  4JCH A;  1TR2 A;  4WAB A;  2J7P A;  2HZ8 A;  1M2O A;  4LDQ A;  4N06 A;  2TMV P;  3I5Q A;  1K04 A;  1BR1 A;  4JW1 A;  1PD0 A;  3MFN A;  4XWJ A;  3ZG1 A;  1LIH A;  3LNR A;  5B3S C;  4WGY A;  5AC4 A;  4G7H F;  2R7U A;  1WGW A;  2OKU A;  1G4U S;  4CS9 C;  2Q4F A;  4FX5 A;  2Y3B A;  2G3V A;  4XPX A;  3U2L A;  3U8V A;  3JSE O;  3W2V A;  4U5E E;  3RQE A;  5DS5 A;  2J46 A;  4YL1 A;  3L0I A;  1OW7 A;  1A7D A;  1UFB A;  3S9O A;  3PHF 2;  1K05 A;  4MND A;  2YLD A;  1DOV A;  3JRT A;  4U9E A;  3X1O A;  4BJ5 A;  1I4Y A;  1T9K A;  4E18 A;  5L3V A;  2XLV A;  4MVU A;  1YZA A;  2CDQ A;  1D1C A;  1NZE A;  3LS1 A;  2Q9A A;  5FCL A;  2OU6 A;  5DS6 A;  3DM9 B;  4AL0 A;  3IPM O;  2NUT A;  1BR4 A;  2L6F A;  2P0N A;  3DAF A;  4LAC B;  3S84 A;  4XLP F;  4G78 A;  2R9R B;  2A69 F;  1VMA A;  2Q9C A;  1U89 A;  2WZL A;  4P9F A;  4W8K A;  3WHN A;  5L0H A;  5KYX A;  4DBQ A;  1QPU A;  2P61 A;  4DJ9 A;  3SNH A;  2AP3 A;  4ZLD A;  3K33 A;  1ZYR F;  3CEX A;  3ATP A;  2R05 A;  1ZU4 A;  4NCQ A;  5T1D B;  1E84 A;  1YYJ A;  3W8I A;  1M2V B;  1CGO A;  4O6M A;  4DRI B;  3B0U X;  1YJG A;  2HV7 A;  1YLM A;  1Z5Z A;  4JTA B;  1AEP A;  2KNH A;  3O55 A;  2GA0 A;  4JZA A;  3U8P A;  3AJM A;  4LDR A;  3JSZ A;  2R7S A;  1VLT A;  3C8G B;  2L81 A;  3RF3 A;  1RKE A;  4IAQ A;  4CS8 A;  4U9D A;  3V5Y A;  2XSE A;  5KYY B;  1OCO C;  4DRJ B;  1RJ9 A;  5A6J A;  5GPG B;  3POV A;  2CNW A;  5E2Q A;  3KH2 A;  4C3E A;  5KYW B;  2W45 A;  1QVX A;  2W9Y A;  3G4Z A;  4HFF B;  4NTA A;  4RD9 A;  1CGM E;  2VH3 A;  4I1O B;  2XLE A;  2GAQ A;  3RYL A;  3K66 A;  5HSW A;  3M4B A;  1VYI A;  3ABM C;  3B71 A;  3LLI A;  2FGY A;  3M15 A;  4EBB A;  1SMY F;  1YAU O;  2KQ9 A;  4QI2 A;  2YL0 A;  3VAY A;  1SZI A;  2KK1 A;  3ASN C;  4U5H A;  3CAX A;  2R7R A;  4KNV A;  2IM8 A;  4XPW A;  4NTF A;  2XXA A;  2XLO A;  1H9T A;  3GWL A;  4I44 A;  1JPJ A;  3LLK A;  4U5G A;  5B1A C;  2G3K A;  2VCB A;  4G7Z F;  4OIP F;  2MHR A;  5L3Q A;  3HLZ A;  3J06 A;  5COG A;  3T6G B;  5L0F A;  3ASO C;  1OXB A;  3CZ6 A;  3AG4 C;  1NU7 D;  3NKE A;  2V3C C;  3GEE A;  1ORS C;  3VM6 A;  4AL1 A;  4HEA J;  1APC A;  2A68 F;  3KPH A;  2MYS A;  5B1B C;  4OD5 A;  3C8Z A;  2KC3 A;  3U9M A;  1LM3 B;  1OCZ C;  3DI5 A;  4YWQ A;  2FAP B;  1CPQ A;  2M64 A;  1T6I A;  2XLH A;  4I3M A;  5E3C A;  1VOM A;  1MNE A;  1Y6D A;  3T4R A;  3KL4 A;  2XM0 A;  3AQC A;  2CW0 F;  3NKD A;  3K6B A;  3H2V A;  2FFH A;  4EHP A;  2IXM A;  4QDL A;  3HTK C;  3G4X A;  3QVY A;  1LPE A;  3B0V C;  1SF8 A;  2NSF A;  3NYL A;  4MTF A;  2J9U A;  5BUO A;  5L0I A;  1YAR O;  1L7C A;  3FVY A;  4MTO A;  4CS7 A;  4BJ6 C;  2JD3 A;  3FOO A;  3LNM B;  3NMJ A;  3K1H A;  3QTH A;  2XS8 A;  3RKO F;  5F28 E;  2HKV A;  2A6E F;  2NSG A;  3DXJ F;  4K1O A;  4EBK A;  1E85 A;  2NUT B;  2Y3G A;  3BRJ A;  5A6B A;  3S28 A;  1PCX A;  3TUL A;  4C7O A;  5T3T A;  5DS4 A;  5KYX B;  2JX0 A;  2HJ3 A;  1JAF A;  1YYX A;  3EG9 A;  4JVS A;  4D4N A;  2NPU A;  3ZC4 A;  3GM3 A;  4EIY A;  1GGQ A;  4E7S A;  2F22 A;  3KYI A;  3NYJ A;  3MX3 A;  1OCR C;  4K7B A;  5JS5 A;  3OEO A;  1M56 C;  1S05 A;  1F1M A;  1ZW2 A;  1EI7 A;  3Q7L A;  3T6J A;  2A6H F;  4CBE A;  4O79 A;  2YHS A;  3NRH A;  4NQF A;  1IZM A;  3EHM A;  4OIN F;  1E86 A;  1FTS A;  2HSB A;  2L9J A;  2XLM A;  1U0B B;  1JMW A;  2NUP A;  2LP4 A;  1JOG A;  1LKX A;  1VB5 A;  2UUH A;  1Q0D A;  3C63 A;  1D0X A;  1E2X A;  3S29 A;  1RJ9 B;  2EPO A;  4JKV A;  4YT4 A;  1Z63 A;  4YT8 A;  1HY5 A;  1MMN A;  2DGJ A;  4W8P A;  3UMK A;  2YQY A;  2AWY A;  3M79 A;  5EGY A;  2KGO A;  1QSP A;  1HE1 A;  2YLI A;  3HJC A;  4PJJ A;  4PFP A;  3X2Q C;  2PX0 A;  3QVZ A;  3IQC A;  3S90 A;  1VYK A;  1TWH A;  3E70 C;  3IQ6 A;  2H7O A;  2R25 A;  3DWW A;  3SZR A;  5A6A A;  4Z9J A;  1SR2 A;  1ORJ A;  2PFD A;  2Y39 A;  2KSF A;  3PCV A;  4N4W A;  3SXY A;  4EKW A;  1N1C A;  2C04 A;  2J9W A;  3FOP A;  4PJN A;  5HV9 A;  2RSE B;  2H7V C;  3T9O A;  2XXA B;  1HMD A;  3ECS A;  3TJ6 A;  1ZHT A;  3HNJ A;  4B6I A;  4DXW A;  2HUJ A;  2QTV A;  2KJG A;  2PF4 E;  5E33 A;  1JRA A;  1RXQ A;  3C7J A;  3OWT A;  3U3B A;  3RVZ A;  5B3I A;  2R7W A;  1M6T A;  4WGZ A;  3WOD F;  4PJM A;  4NY3 A;  4ONS A;  1A0B A;  4CX9 A;  4JJF A;  4FAP B;  4U5D E;  4XLN F;  1ZW3 A;  5EK0 A;  2G62 A;  2OEX A;  5JP7 A;  5IY5 C;  3T6B A;  3NG1 A;  1S7Z A;  2Y3D A;  3EH2 A;  2EIL C;  2C03 A;  2YRF A;  3O39 A;  4E17 A;  4JJG A;  4CSA A;  3KKB A;  3ZTZ A;  3IEE A;  1TFK B;  3EQL F;  1DOW A;  2QE9 A;  1ZU5 A;  2ZXO A;  3C62 A;  3H2U A;  3ZQV A;  4BJ5 C;  3S0X A;  3TK0 A;  3LJB A;  2IBF A;  4E7Z A;  2D4U A;  2LK4 A;  1HW2 A;  3VF0 A;  5TJ5 E;  1OR2 A;  2I8B A;  4IAR A;  1RMV A;  1OW6 A;  3LEV A;  2V26 A;  1HW1 A;  5T3W A;  3W2W A;  4BJ1 A;  4OIQ F;  5F5H A;  2Y3H A;  3AGT A;  2GWW A;  4J30 B;  2PNO A;  3JCU Q;  2OJE D;  2R7Q A;  2A1D D;  2LD6 A;  3L8I A;  4MW8 A;  5E3A A;  1O5H A;  1R4T A;  5BQH A;  2ZD9 A;  3GOD A;  1VLS A;  1ZVZ A;  4O6N A;  4JCZ A;  1GM5 A;  1O87 A;  3EGX A;  3O10 A;  4YK5 A;  3DM5 A;  4IB4 A;  3V5X A;  1VTM P;  4C7O B;  4A2N B;  3EG9 B;  3H65 A;  2R02 A;  2VC9 A;  4MQ9 F;  3W4Y A;  5A6K A;  2KYH A;  1D1A A;  2OJQ A;  3R2P A;  4CIH A;  2J7P D;  1H9G A;  1LI7 A;  1KU2 A;  3ZWI A;  4CS8 C;  2B0H A;  4KI2 A;  1NBB A;  3IHU A;  5DLJ A;  1XZP A;  5L0G A;  1OKK A;  3QMK A;  4GYT A;  3TQO A;  2OQM A;  1EKY A;  4RBN A;  1H7I A;  2Z15 A;  4H54 A;  1HMO A;  5A69 A;  2M4E A;  2YLG A;  1BZ4 A;  2NUP B;  1FNT c;  1FAP B;  3TD7 A;  4QI0 A;  4P6I C;  1NLX A;  2YL1 A;  1AUE A;  3MLG A;  4PK4 A;  1LS1 A;  2IXP A;  3EGD A;  1MND A;  2WZG A;  4JIO A;  3RQF A;  4OIO F;  4AK9 A;  1NU9 C;  4J7Y A;  3N2Z B;  1TWC A;  4OIR F;  3WG7 C;  1NG1 A;  1WOL A;  1CPR A;  2XM4 A;  3JYY A;  2L7A A;  3LS0 A;  3OA1 A;  4JC7 A;  4JE9 A;  3ZQY A;  2R7V A;  2P6V A;  3B9Q A;  2AWC A;  4JEB A;  3CQZ A;  2BC5 A;  1NFO A;  1RKC A;  1PD1 A;  2Y69 C;  3EFO A;  4HE8 D;  4JUR I;  5KYN A;  3JYH A;  4IAO A;  2J8W A;  3HKK A;  4IWB A;  2H8A A;  1Z3I X;  1C02 A;  1RCP A;  1Z7Q c;  2MWQ A;  4OD4 A;  1V74 B;  5JRA A;  1EQ1 A;  5EHH A;  3N24 A;  2I15 A;  2EIJ C;  1CGN A;  3DJU B;  2OOC A;  4LER A;  4O6Y A;  4CJG A;  2CNW D;  2IOQ A;  5AC5 A;  2J0W A;  3HNK A;  1TKN A;  1C17 M;  1OW8 A;  1T6Q A;  2XL6 A;  1ORY A;  1E83 A;  2XLW A;  1LS4 A;  2HFI A;  2ICW G;  3I5P A;  4U5B E;  3RFY A;  3B0P A;  5JLI A;  1FR0 A;  4AE4 A;  2IXN A;  2BE5 F;  1Q0G A;  2R7O A;  1B68 A;  1ZHZ A;  4JRZ A;  3G50 A;  2PX3 A;  2QNL A;  3AG1 C;  2AVK A;  3AGU A;  3AG3 C;  1R5I D;  2VCA A;  4LLE A;  2W4M A;  2EPM X;  3NMK A;  1LE2 A;  1Z23 A;  1OR3 A;  1ZHX A;  2J9B A;  3RQG A;  1J8Y F;  5L0J A;  1LI5 A;  1V54 C;  1OCC C;  4RDA A;  2ETS A;  3Q6N A;  3U5S A;  3L34 A;  3JRM O;  1MMG A;  4DVY P;  4G0H A;  3GM1 A;  4MVM A;  3EGX B;  2LFF A;  3ITF A;  2HMZ A;  1YA9 A;  2XLD A;  1T6U A;  1VK5 A;  1YVI A;  2YEV A;  3HNL A;  5AGF A;  3ABK C;  3DJN B;  1UG7 A;  2DYS C;  4Z9H A;  1Q0M A;  3DMD A;  2RD9 A;  2XRH A;  1LE4 A;  2Q00 A;  4EBJ A;  1EA8 A;  3V5Z A;  4XQ1 A;  3V7O A;  4Q5S F;  3C18 A;  4MW3 A;  3ZVR A;  1J8M F;  2AU5 A;  2ZPA A;  3UR3 C;  3M1C B;  4YT5 A;  2X0C A;  3FAP B;  1FMW A;  3SXZ A;  1WN0 A;  3DD7 A;  1TWA A;  3C8G D;  3EHN A;  3F46 A;  5KYU A;  2Q7R A;  3SXK A;  3LEO A;  4Q7C A;  3Q6M A;  4YL0 A;  1W2W A;  3N0T A;  2Q3T A;  1I4Z A;  3MYI A;  3SXM A;  1JR8 A;  4FWV A;  3ZDL A;  2E87 A;  1TFO B;  1QZX A;  1TWG A;  1FMV A;  3ABL C;  3EGD B;  1H6G A;  3JT1 A;  4R32 A;  4WJ0 A;  2QY9 A;  3L1M A;  3LES A;  4MVQ A;  4XEV A;  2YKZ A;  5A6B D;  4CDV A;  2J0X A;  3U3F A;  4KBL A;  3GWN A;  2J45 A;  2JPU A;  2LSE A;  3GOR A;  1Q0F A;  3A9C A;  2R7T A;  3LUT B;  5DQZ A;  4G7O F;  4CJO A;  1K40 A;  3EPV A;  2YL3 A;  2OCC C;  2YL7 A;  3EFO B;  3NMI A;  4GQH A;  4E0I A;  4ANJ A;  2GDC A;  1JPN A;  4U5F E;  4AX2 A;  4UDV A;  2HMQ A;  3ZTM A;  5COM A;  1HE9 A;  4CDY A;  4N6C A;  5CIV A;  3U0C A;  3CSK A;  4BJT A;  1BDJ B;  1XWJ A;  1Y4C A;  3RIP A;  3UMI A;  3PDM P;  2A0U A;  2O9X A;  3DKA A;  2HS5 A;  1YZC A;  2PP4 A;  2EPK X;  4JTD B;  4Q4Z F;  1MQV A;  4CSA C;  3I4U A;  4MVO A;  1Z6A A;  1QKR A;  1SYQ A;  4JTC B;  2YZS A;  4MVZ A;  2CCY A;  2ZXW C;  3FHD A;  1PV3 A;  4IJJ A;  3DE9 A;  1L3P A;  2HJM A;  1WAS A;  2QUP A;  3B29 A;  3EH1 A;  2HSQ A;  3GEI A;  4I1M A;  1G4W R;  4O7G A;  4MVS A;  1WWP A;  4N6H A;  4XTK A;  4YL3 A;  4MVR A;  5F5F A;  4IRU A;  2R03 A;  2LFD A;  1FFT C;  3RVY A;  3SP1 A;  1XZQ A;  2ZXP A;  1QQ3 A;  4AE4 B;  5CI8 A;  4YN0 B;  3FAJ A;  1NFN A;  1T5O A;  2EIN C;  2IYL D;  4GEH A;  3JTL O;  3QZC A;  2LIG A;  4KC9 A;  4K0D A;  2EPL X;  1NSG B;  4BPM A;  3HNI A;  4FES A;  4HFK B;  2HV6 A;  2LCH A;  2PBE A;  1GQA A;  4A4A A;  2DI3 A;  3M4C A;  4LDK A;  4XEF A;  4CIP A;  4J7T A;  4PAC A;  5CI9 A;  3QW0 A;  1AVO B;  3NYM A;  2CYD A; 
#chains in the Genus database with same CATH homology
 4DOZ A;  2D5R B;  4BG0 A;  3DZA A;  2WZF A;  3UGO A;  2EIM C;  4X0R A;  3EZH A;  4YT2 A;  3EJN A;  3DAG A;  1BR2 A;  3FDQ A;  2IXO A;  4J32 B;  1IW7 F;  1QLE C;  4YJW A;  1D1B A;  3O6X A;  2CGE A;  1ST6 A;  2P7V A;  2WB7 A;  1LVK A;  5KYU B;  2Q9B A;  2NG1 A;  1D0Z A;  2X51 A;  3S27 A;  1V55 C;  1M57 C;  1ZHY A;  4BJ6 A;  4H4K C;  5D91 A;  3NDB B;  3UNG C;  2B0J A;  2KW3 C;  4DBR A;  4EWC A;  1M2V A;  3E9V A;  3F47 A;  3Q7G A;  4U5C E;  2OG2 A;  3SEO A;  4PFO A;  3UGP A;  4PJL A;  2GFH A;  3K7D A;  1G8X A;  4KNW A;  4ULW A;  2XL4 A;  4BEJ A;  2J9V A;  5DVW A;  4LLC A;  3PMR A;  2WVN A;  5KYY A;  1OKK D;  1MMA A;  3UMH A;  3K1I C;  5KYW A;  3VYW A;  5DQT A;  4ZLC A;  3ZIB A;  2ZXR A;  4M63 A;  2WL8 A;  3AQB A;  1ZHW A;  2DYR C;  2W4B A;  4DVZ A;  2VB6 A;  2EIK C;  1D0Y A;  3RH3 A;  1MMD A;  2H7B A;  5D92 A;  2VAS A;  4C3B A;  3EZI A;  3KMI A;  4F4B A;  2R7X A;  2WVQ A;  3W8H A;  4CS9 A;  4C3D A;  3SYN A;  3LAY A;  3AG2 C;  2WVO A;  1FFH A;  3GAN A;  4JCH A;  1TR2 A;  2J7P A;  1M2O A;  4N06 A;  3I5Q A;  1BR1 A;  4JW1 A;  1PD0 A;  4XWJ A;  3ZG1 A;  3LNR A;  5B3S C;  4G7H F;  2R7U A;  1WGW A;  4CS9 C;  4FX5 A;  2Y3B A;  2G3V A;  3W2V A;  4U5E E;  2J46 A;  3L0I A;  3PHF 2;  4MND A;  3JRT A;  3X1O A;  4BJ5 A;  5L3V A;  1NZE A;  1D1C A;  2CDQ A;  3LS1 A;  2Q9A A;  5FCL A;  5DS6 A;  3DM9 B;  2NUT A;  1BR4 A;  4LAC B;  3DAF A;  4XLP F;  2WZL A;  2A69 F;  2Q9C A;  1VMA A;  4W8K A;  5KYX A;  4DBQ A;  4ZLD A;  3SNH A;  3K33 A;  1ZYR F;  5T1D B;  1ZU4 A;  3W8I A;  1M2V B;  4O6M A;  3B0U X;  2HV7 A;  1Z5Z A;  4JZA A;  2KNH A;  3JSZ A;  2R7S A;  2L81 A;  4CS8 A;  2XSE A;  5KYY B;  1OCO C;  1RJ9 A;  3POV A;  2CNW A;  5E2Q A;  3KH2 A;  4C3E A;  5KYW B;  2W45 A;  2W9Y A;  4HFF B;  4RD9 A;  2VH3 A;  4I1O B;  3RYL A;  3K66 A;  5HSW A;  1VYI A;  3ABM C;  3LLI A;  2FGY A;  4EBB A;  1SMY F;  2KQ9 A;  4QI2 A;  3VAY A;  1SZI A;  3ASN C;  4U5H A;  2R7R A;  4KNV A;  2XXA A;  4I44 A;  4OIP F;  1JPJ A;  3LLK A;  4U5G A;  5B1A C;  2G3K A;  4G7Z F;  5L3Q A;  3HLZ A;  3ASO C;  3CZ6 A;  3AG4 C;  1NU7 D;  3NKE A;  2V3C C;  4HEA J;  2A68 F;  2MYS A;  5B1B C;  4OD5 A;  1OCZ C;  4YWQ A;  4I3M A;  5E3C A;  1VOM A;  1MNE A;  3T4R A;  3KL4 A;  3AQC A;  2CW0 F;  3NKD A;  3K6B A;  2FFH A;  2IXM A;  4QDL A;  3HTK C;  3B0V C;  1SF8 A;  3NYL A;  2J9U A;  5BUO A;  3FVY A;  4CS7 A;  4BJ6 C;  2JD3 A;  3K1H A;  3RKO F;  2A6E F;  3DXJ F;  2NUT B;  2Y3G A;  3S28 A;  1PCX A;  4C7O A;  5T3T A;  5DS4 A;  5KYX B;  4JVS A;  3EG9 A;  3ZC4 A;  4E7S A;  3NYJ A;  3MX3 A;  1OCR C;  4K7B A;  3OEO A;  1M56 C;  3Q7L A;  3T6J A;  2A6H F;  4CBE A;  4O79 A;  2YHS A;  3NRH A;  1IZM A;  3EHM A;  4OIN F;  1FTS A;  2L9J A;  2NUP A;  1LKX A;  1D0X A;  3S29 A;  1RJ9 B;  4YT4 A;  1Z63 A;  4YT8 A;  1MMN A;  2DGJ A;  3UMK A;  5EGY A;  2KGO A;  3HJC A;  4PJJ A;  4PFP A;  3X2Q C;  2PX0 A;  1VYK A;  1TWH A;  3E70 C;  2H7O A;  3SZR A;  2PFD A;  2Y39 A;  1N1C A;  2C04 A;  2J9W A;  4PJN A;  2H7V C;  2XXA B;  3ECS A;  1ZHT A;  4B6I A;  2QTV A;  2KJG A;  2PF4 E;  5E33 A;  3OWT A;  2R7W A;  3WOD F;  4PJM A;  4NY3 A;  4JJF A;  4U5D E;  4XLN F;  5IY5 C;  2G62 A;  3T6B A;  3NG1 A;  1S7Z A;  2Y3D A;  3EH2 A;  2EIL C;  2C03 A;  3O39 A;  4CSA A;  4JJG A;  3KKB A;  3IEE A;  3EQL F;  3S0X A;  1ZU5 A;  2ZXO A;  4BJ5 C;  3LJB A;  4E7Z A;  2I8B A;  3LEV A;  2V26 A;  3W2W A;  5T3W A;  4BJ1 A;  4OIQ F;  5F5H A;  2Y3H A;  4J30 B;  3JCU Q;  2R7Q A;  2A1D D;  5E3A A;  1O5H A;  3GOD A;  4O6N A;  1O87 A;  3EGX A;  3DM5 A;  4C7O B;  4A2N B;  3EG9 B;  3H65 A;  4MQ9 F;  1D1A A;  4CIH A;  2J7P D;  1KU2 A;  4CS8 C;  4KI2 A;  5DLJ A;  1OKK A;  3QMK A;  4GYT A;  4RBN A;  2Z15 A;  2M4E A;  2NUP B;  3TD7 A;  4QI0 A;  4P6I C;  3MLG A;  4PK4 A;  1LS1 A;  2IXP A;  3EGD A;  1MND A;  2WZG A;  4OIO F;  4AK9 A;  1NU9 C;  3N2Z B;  1TWC A;  4OIR F;  3WG7 C;  1NG1 A;  3LS0 A;  3OA1 A;  2R7V A;  2P6V A;  3B9Q A;  3CQZ A;  2Y69 C;  1PD1 A;  4HE8 D;  3EFO A;  4JUR I;  5KYN A;  3JYH A;  4IAO A;  4IWB A;  1Z3I X;  2MWQ A;  4OD4 A;  5EHH A;  3N24 A;  3DJU B;  2EIJ C;  4LER A;  4O6Y A;  2CNW D;  2IOQ A;  2J0W A;  1TKN A;  4U5B E;  3RFY A;  3I5P A;  3B0P A;  4AE4 A;  2IXN A;  2BE5 F;  2R7O A;  1ZHZ A;  2PX3 A;  3AG1 C;  3AG3 C;  4LLE A;  2W4M A;  1Z23 A;  1ZHX A;  1J8Y F;  1V54 C;  1OCC C;  4RDA A;  3Q6N A;  3L34 A;  1MMG A;  4DVY P;  4G0H A;  3EGX B;  3ITF A;  1VK5 A;  2YEV A;  3ABK C;  3DJN B;  2DYS C;  3DMD A;  2XRH A;  3V7O A;  4Q5S F;  3ZVR A;  1J8M F;  2ZPA A;  3UR3 C;  3M1C B;  4YT5 A;  1FMW A;  3DD7 A;  1TWA A;  3EHN A;  3F46 A;  5KYU A;  4Q7C A;  3Q6M A;  1W2W A;  3N0T A;  2Q3T A;  4FWV A;  2E87 A;  1TWG A;  1QZX A;  3ABL C;  1FMV A;  3EGD B;  3JT1 A;  4WJ0 A;  3UMI A;  5DS5 A;  2QY9 A;  3LES A;  2J0X A;  4KBL A;  2J45 A;  2LSE A;  2R7T A;  5DQZ A;  4G7O F;  3EPV A;  2OCC C;  3EFO B;  4ANJ A;  1JPN A;  4U5F E;  4AX2 A;  3CSK A;  4BJT A;  3RIP A;  2O9X A;  2PP4 A;  4Q4Z F;  4CSA C;  3I4U A;  1Z6A A;  2YZS A;  2ZXW C;  3FHD A;  4IJJ A;  3ZSU A;  4I1M A;  3EH1 A;  4O7G A;  4XTK A;  5F5F A;  4IRU A;  3SP1 A;  1FFT C;  4AE4 B;  2ZXP A;  5CI8 A;  4YN0 B;  3FAJ A;  2IYL D;  2EIN C;  4GEH A;  3QZC A;  4KC9 A;  4K0D A;  4FES A;  4HFK B;  2HV6 A;  5CI9 A;  3NYM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...