2XSEA

The structural basis for recognition of j-base containing dna by a novel dna-binding domain in jbp1
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
167
structure length
160
Chain Sequence
MVSTAVEKKKYLDSEFLLHCISAQLLDMWKQARARWLELVGKEWAHMLALNPERKDFLWKNQSEMNSAFFDLCEVGKQVMLGLLGKEVALPKEEQAFWIMYAVHLSAACAEELHMPEVAMSLRKLNVKLKDFNFDMPPEEKKRRMERKQRIEEARRHGMP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords THYMINE DIOXYGENASE JBP1
publication title The Structural Basis for Recognition of Base J Containing DNA by a Novel DNA Binding Domain in Jbp1.
pubmed doi rcsb
source organism Leishmania tarentolae
molecule tags Oxidoreductase
total genus 52
structure length 160
sequence length 167
ec nomenclature ec 1.14.11.6: Thymine dioxygenase.
pdb deposition date 2010-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18526 DB_JBP1 Thymine dioxygenase JBP1 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1440 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 2xseA00
2XSEA
chains in the Genus database with same CATH superfamily
4BEJA 1TR2A 3RVZA 3GEIA 2Y69C 2J8WA 3LEOA 4CS7A 5T3TA 4OIOF 4OIQF 1ST6A 2OJED 3U5SA 3V5ZA 3POVA 3WAQA 2FGYA 1SF8A 2XM4A 4L6RA 3W2WA 3ZDLA 3JCUQ 1A7EA 4BJ6C 5FCLA 3GM1A 2AWYA 4C3DA 2NUTB 2R05A 3IQTA 1MMGA 2YRFA 4PACA 3EFOB 5B1BC 5L0HA 2KSFA 2YL7A 3AG3C 3ZVRA 3IQ6A 1JPNA 4MVOA 2XM0A 5COGA 4G7OF 2PP4A 3MFNA 3JRMO 3BEHA 1Z23A 5DS4A 2NUPB 1Z3IX 2OU6A 2A6HF 4N6HA 5JRAA 2CGEA 4JTCB 3EQLF 3TD7A 3EG9B 2DGJA 4U9EA 3M4BA 4DJ9A 1WN0A 2XS8A 4NTFA 3SZRA 1OR2A 5TJ5E 3PHF2 3RF3A 1V74B 3M4CA 5JSLA 3T6GB 1M56C 3B0VC 4JE9A 4WGYA 3HNIA 2YQYA 3U2LA 4CBEA 3ASNC 2EPOA 1YZAA 2W4MA 4EWCA 1L7CA 3N2ZB 5GPGB 3K33A 2KYHA 4NC3A 5EK0A 4ER9A 1H6GA 3ATPA 3I4UA 3S84A 4IAOA 1ORSC 2EPLX 1ZW3A 4P9TA 3WG7C 4E7ZA 1LI5A 4LDQA 3RIPA 1N1CA 4BJ6A 4OINF 3GEHA 1IZMA 2HMZA 2IOQA 4U5EE 1ORJA 2EIJC 4BJ5C 1QSPA 1Y4CA 1E84A 1EQ1A 3GM3A 4JEAA 2DB4A 3U3FA 2QNLA 3E9VA 3PCVA 4HE8D 3AG1C 1EI7A 2M64A 3C63A 1H9GA 2HKVA 2VB6A 3DJUB 3K6BA 3NMKA 4DRIB 1FMVA 2JD3A 3EGXB 3EHMA 3NRHA 2A0BA 4IWBA 3J06A 3AOUA 1GQAA 3B9QA 3SNHA 1OR3A 2UUHA 1C03A 4O6MA 2BE5F 1E86A 4G78A 3RH3A 1HW2A 4OIPF 4ULVA 1L3PA 2R7OA 5JLIA 4HEAJ 1CPQA 2IXOA 2M4EA 1Q0DA 2KGOA 4BG0A 1JOGA 4RDAA 1VYIA 3SXKA 4U5GA 1ZHXA 3T6BA 1NSGB 1MMAA 4X0RA 2XSEA 4E17A 2EIKC 3U2MA 2VH3A 5L0CA 4GEHA 4XLNF 1O3UA 2XLWA 2J0WA 1RJ9A 5E2QA 3QVYA 3JT1A 4UDVA 5A6BD 3DD7A 4KBLA 1K05A 1EA8A 1JMWA 4JURI 2VCCA 3W8HA 2PX0A 1G5ZA 2DYRC 3FHDA 4DRJB 2NPUA 2A0UA 1UG7A 5L3VA 1FMWA 5K0IA 3LS1A 1C02A 2FFHA 2Y3BA 3LUTB 1E85A 4XPWA 3FXHA 2VC9A 2ZD9A 3B0UX 3RFYA 1AEPA 2H8AA 4CX9A 5KYNA 4JZAA 4RD9A 1XZPA 3FMSA 3I5PA 1ZVZA 1MNEA 3C8ZA 3CQZA 2GA0A 3S29A 4MVRA 2YL3A 5BQHA 1IW7F 4RBNA 256BA 5L0IA 2F22A 1CGNA 1ZZPA 4EBJA 1A7DA 3GM2A 4PK4A 2CCYA 2R7QA 3SYNA 4XEKA 1BBHA 1VMAA 3LLKA 2LIGA 1VB5A 2KQ9A 4N4WA 3S9OA 1NU9C 3NYJA 2P6VA 1I5NA 2OEVA 4IRUA 3LNRA 4YL0A 1YYXA 4ZLDA 3U0CA 3CSKA 3UMHA 4JJGA 1YAUO 1GM5A 4JCZA 1A0BA 2A6EF 4BJTA 4F4BA 3L1MA 1D0XA 5JVEA 2Y3HA 4JVSA 1OXKA 3W8IA 3NYMA 4U5BE 1FAPB 1LIHA 1D1BA 5A6KA 2PF4E 5DQZA 2H7OA 3EGDB 2AP3A 2YL1A 1ORYA 3EZIA 1DOWA 3HTKC 3L8IA 4GQHA 4KNWA 4JW1A 4C7OB 4B6IA 5KYWA 4AE4A 2C03A 1QKRA 1TFOB 4WGZA 2J45A 4YT8A 4YK5A 4YWQA 4YT2A 2IXNA 5KYYB 2R7RA 1ZW2A 2L6FA 3EHNA 2HSBA 5COMA 1LE4A 5DS5A 1NBBA 1GGQA 2VASA 4M63A 4P6IC 1T9KA 5HSWA 1OCOC 2W4BA 3SP1A 1CGME 3JYYA 3VM6A 5F5HA 4HFFB 1I4YA 3C8GD 3DI5A 1FFTC 2R7XA 2J0XA 1M2VB 2XL4A 5CI9A 4ANJA 4FWVA 1LVKA 1UFBA 5DS6A 2OEXA 4XLPF 4EUKB 3DXJF 3FOPA 3UR3C 3S90A 1DOVA 3F47A 2FAPB 4AL1A 1WWPA 2EPNA 1PCXA 4GYTA 2R7TA 5KYUA 3QTHA 2OG2A 2KJGA 2J7PD 4EHPA 3Q6MA 3NDBB 4CSAA 1J8YF 3S27A 1G4US 1ZHYA 2YVKA 3O6XA 2J9BA 3SXMA 1T6QA 2GWWA 4EBKA 2ICWG 2L81A 4JJFA 3U8PA 4JTAB 1T6UA 4XQ1A 1OCCC 4MTFA 1BZ4A 1FR0A 4D4NA 1OKKA 4XWJA 2HV7A 1VLTA 2KW3C 2R7UA 3DMDA 2C04A 2YHSA 1PD1A 1ZHWA 2W9YA 3TK0A 4J7YA 5F5FA 4PFPA 3WODF 2CW0F 2GAQA 5L0GA 3DM9B 1AUEA 3DWWA 4AL0A 2DYSC 1OQCA 3HKKA 2CDQA 2MWQA 3DZAA 3ZWIA 2NUTA 3TOMA 4A4AA 3ABLC 3NYLA 3EFOA 1H9TA 4JEBA 3ZQVA 2XLOA 2XS1A 4JC7A 2HSQA 2BL2A 3NMJA 2XLMA 2HS5A 5BQIA 3QW1A 1ZHTA 2NUPA 2YZSA 3OEOA 3T4RA 1LI7A 3ZG1A 2GFHA 1Z5ZA 1Q0MA 1WOLA 2OKUA 3EG9A 4AX2A 1U0BB 3GWNA 1LS4A 3SXYA 3C8GB 3JRTA 4BPMA 2Q9CA 2G3KA 5DLJA 3UGPA 3SEOA 1D0YA 5A6AA 3O10A 1RKEB 4PJLA 4FESA 2ZXRA 3SXZA 4XEFA 4J7TA 4Z9JA 2XXAB 1FNTc 3AGUA 1G8XA 3L34A 2HFIA 3B0PA 1U89A 1VOMA 1D0ZA 2XLEA 3KMIA 5D92A 2QUPA 4O79A 2R02A 3QMKA 3W4YA 2XLHA 4JIOA 1GS9A 4EIYA 5HV9A 3IEEA 3M79A 4IJJA 4G7HF 4E7SA 1T5OA 1TWHA 4LDKA 3FAPB 2QTVA 3ABMC 3QW0A 3VF0A 3C62A 1RCPA 4CDYA 3V5XA 3ZQYA 4J32B 3PDMP 1HE1A 2I15A 1K40A 3QVZA 1QZXA 3CZ6A 4LACB 1H7IA 3ECSA 2R7SA 1OW8A 2D4UA 2YKZA 3LLIA 4OIRF 4EKWA 2WVOA 5KYXB 2Z15A 1TKNA 2O9XA 1S05A 1SMYF 3KL4A 3EGXA 3JZ0A 1M6TA 3OA1A 2LFDA 4MVUA 4YN0B 4DRHB 2CNWD 5E3AA 3L8JA 2R7WA 4LDRA 4MW3A 3O39A 4U5HA 5F28E 1I4ZA 1WATA 2LK4A 3IQCA 1LKXA 2BC5A 4WABA 3IPMO 2WVNA 1JAFA 3U9JA 1YLMA 1NFNA 5IY5C 1RKCA 2A1DD 3FVYA 4KC9A 3U9MA 2KNHA 2J46A 2YLGA 4P9FA 5AGFA 1O87A 3U8VA 3AQBA 3U3BA 4CDVA 3CEXA 3HJCA 1BR4A 2G62A 4CJOA 1R4TA 4LLEA 4E0IA 3X1OA 3K7DA 1SR2A 5L0JA 4I1OB 2P1AA 2L6GA 1XWJA 1F1MA 4NTAA 3AGTA 4PFOA 3GANA 3DE9A 1WASA 5T3WA 3JYHA 3GORA 2OCCC 2OJQA 4N6CA 4NY3A 3TOLA 3BRJA 4CS9C 1APCA 2Y39A 3G4XA 2JX0A 3KYIA 2VCBA 1Q0KA 2V3CC 3EPVA 1Z6AA 4U5CE 2X51A 4CDAA 3WHNA 4R32A 4CSAC 1OW6A 1LS1A 2EILC 2ZPAA 1D1CA 4PJJA 4H54A 4MQ9F 3RW0A 1KNYA 2AVKA 1RXQA 2EPKX 2XLVA 2VCAA 2P0NA 4DVYP 4XPXA 3GWLA 4NQFA 2CYDA 4O6YA 4WJ0A 4BJ1A 5JUAA 3LJBA 1SYQA 3RQGA 1HMDA 3S28A 4EBBA 1A7VA 1NU7D 1BR2A 1CGOA 2HJMA 2W45A 3LEVA 3ZTZA 3G4ZA 4G7ZF 2EINC 1YARO 2L7AA 3MBGA 3VYWA 3DAFA 3B71A 4IGGA 3HNKA 3LS0A 3QZCA 4NCQA 4XTKA 4MVZA 4MS2A 1YA7O 1VYKA 1MQVA 2PX3A 3NG1A 4J30B 4OD4A 4ONSA 3R2PA 3VAYA 4E0HA 4FX5A 3EH1A 4DBRA 4O7GA 2MYSA 1QLEC 2XRHA 2L6HA 2HV6A 1EKYA 5D91A 2J9UA 2J9WA 4CS9A 4JCHA 1MMNA 2IXPA 4LERA 4MW8A 4XEVA 3EGDA 3NKEA 1OW7A 3ABKC 3Q7GA 4YL1A 1JPJA 3M15A 5A6BA 3A9CA 2L9JA 3G50A 5FZTA 4C7OA 3ZTMA 5KYYA 2LFFA 1M2OA 4Q7CA 2RSEB 5L3QA 3ZIBA 3H2VA 2XLDA 2ZXPA 4O6NA 3JSZA 2H7BA 4I44A 4CIHA 4DOZA 2UUIA 1C17M 2IXMA 5L0FA 2OQMA 3AG2C 3E70C 3X2QC 1V54C 4MNDA 4U5DE 2NSGA 1V55C 2P61A 1M2VA 1R5ID 5A6JA 1J8MF 4FAPB 3C7JA 2WVQA 2Q3TA 3ITFA 5T1DB 2Q9BA 2Y3GA 2EPMX 3ZC4A 2LCHA 3F46A 1B68A 2AWCA 3LNMB 4Z9HA 2E87A 2ETSA 1NG1A 2YLIA 3W2VA 3TJ6A 3DE8A 2R03A 4IB4A 3CAXA 3RKOF 2XL6A 1Q0GA 1G4WR 1TWCA 3TQOA 3AJMA 4IARA 4YT4A 2G3VA 1TWAA 1LPEA 3HNJA 4OD5A 4MVSA 1NLXA 2R9RB 1JR8A 1HMOA 3MX3A 3NMIA 2Q9AA 3K66A 4G0HA 4YJWA 2WZLA 4XPYA 1VLSA 4ZLCA 3Q7LA 5JS5A 5B3SC 4JKVA 3Q6NA 3HLZA 2A69F 3B29A 1FFHA 1CPRA 1OXBA 2V26A 4JRZA 4K0DA 4MVQA 5E33A 3UMKA 4CJGA 4DVZA 3AQCA 2PNOA 2LP4A 1TFKB 3V7OA 3N0TA 1U6HA 3DKAA 2GDCA 2I8BA 2EIMC 4Q5SF 4NTBA 2QE9A 2Q00A 3LESA 1YVIA 4H4KC 4DXWA 1PD0A 1Z63A 3FAJA 1YJGA 5AC5A 3MYIA 2IM8A 3C18A 2B0HA 4Q4ZF 1KTMA 2HUJA 2KK1A 5L0DA 1QQ3A 3H2UA 2DI3A 2X0CA 1RJ9B 1ZYRF 2NG1A 1RMVA 1HY5A 1XZQA 2Q4FA 2R7VA 1KU2A 1FTSA 2WL8A 2ZXOA 3C8GA 3UGOA 4MTOA 1T01A 3KKBA 5B1AC 4C3BA 2IYLD 5EGYA 4MTGA 3S0XA 1SZIA 5E3CA 1RKEA 3DJNB 3EH2A 1OCZC 3KYJA 5B3IA 1WTYA 3PMRA 3DAGA 4U5FE 2XXAA 1LE2A 2YLDA 4LLCA 4Z9IA 1JRAA 2WZGA 3K1HA 2RD9A 3JTLO 4ULWA 2ZXWC 1ZU4A 4QI0A 4CIPA 1PV3A 5JT4A 2TMVP 1VK5A 2HZ8A 2J7PA 2R25A 2WB7A 1YZCA 4PR9A 5CIVA 1D1AA 1YA9A 4PJMA 3KPHA 1S7ZA 3UNGC 1V4AA 4AK9A 4D4XA 2Q7RA 3OWTA 1HE9A 1TWGA 3AG4C 5CI8A 5AC4A 4A2NB 4KI2A 4YT5A 3NKDA 2PBEA 5BUOA 3IHUA 3I5QA 3ZSUA 2MHRA 2PFDA 4MVMA 4N06A 1NFOA 1QPUA 1O5HA 2WZFA 3K1IC 3M1CB 3MYFA 3RQEA 1QVXA 4U9DA 1WGWA 2LSEA 2JPUA 2QLAA 3LAYA 4BJ5A 5DQTA 2YWAA 1M57C 3FOOA 5KYXA 4PJNA 3EJNA 4K7BA 1YDIA 2HJ3A 3UMIA 1T6IA 2J9VA 1OKKD 4W8KA 3RVYA 3N24A 3RYLA 2AU5A 2QY9A 4E18A 3KH2A 3EZHA 4YL3A 5DVWA 3FDQA 4QDLA 5COFA 4DBQA 2Y3DA 1TQGA 5A69A 3DM5A 3ASOC 3VRCA 1VTMP 1NZEA 5JP7A 1ZHZA 3H65A 4CS8C 5KYWB 1E83A 4AE4B 3T6JA 1OCRC 2D5RB 3HNLA 3IQ5A 3V5YA 2A68F 3TULA 4W8PA 4K1OA 4QI2A 3L0IA 1YYJA 1BR1A 2ASRA 3O55A 5EHHA 3TJ5A 1Z7Qc 1MNDA 1K04A 1BDJB 1E2XA 1W2WA 3K1IA 1MMDA 4BEMJ 4HFKB 1Q0FA 4KNVA 2IBFA 3US6A 2LD6A 2NSFA 1Y6DA 1A41A 3R7CA 3T9OA 1HW1A 2H7VC 2LQGA 4JTDB 2P7VA 3A11A 4I1MA 5KYUB 1AVOB 3MLGA 1ZU5A 3GODA 3JSEO 3GEEA 4I3MA 1LM3B 2B0JA 2OOCA 4C3EA 2XL8A 2YL0A 5BQGA 2CNWA 2KC3A 2YEVA 4IAQA 4CS8A 2HMQA 3RQFA
chains in the Genus database with same CATH topology
4BEJA 1TR2A 2Y69C 4CS7A 5T3TA 4OIQF 1ST6A 3POVA 2FGYA 1SF8A 3W2WA 3JCUQ 4BJ6C 5FCLA 4C3DA 2NUTB 1MMGA 5B1BC 3EFOB 3AG3C 3ZVRA 1JPNA 4G7OF 2PP4A 1Z23A 5DS4A 2NUPB 1Z3IX 2A6HF 2CGEA 3EQLF 3TD7A 3EG9B 2DGJA 3SZRA 3PHF2 3B0VC 1M56C 4CBEA 3ASNC 4EWCA 2W4MA 3N2ZB 3K33A 3I4UA 4IAOA 3WG7C 4E7ZA 3RIPA 1N1CA 4BJ6A 4OINF 1IZMA 2IOQA 4U5EE 4BJ5C 2EIJC 3E9VA 4HE8D 3AG1C 3DJUB 2VB6A 3K6BA 1FMVA 2JD3A 3EGXB 3EHMA 3NRHA 4IWBA 3B9QA 3SNHA 4O6MA 2BE5F 3RH3A 4OIPF 2R7OA 4HEAJ 2IXOA 2M4EA 2KGOA 4BG0A 4RDAA 1VYIA 4U5GA 1ZHXA 3T6BA 1MMAA 4X0RA 2XSEA 2EIKC 2VH3A 4GEHA 4XLNF 2J0WA 1RJ9A 5E2QA 3JT1A 3DD7A 4KBLA 4JURI 3W8HA 2PX0A 2DYRC 3FHDA 5L3VA 1FMWA 3LS1A 2FFHA 2Y3BA 3B0UX 3RFYA 5KYNA 4JZAA 4RD9A 3I5PA 1MNEA 3CQZA 3S29A 1IW7F 4RBNA 4PK4A 2R7QA 3SYNA 1VMAA 3LLKA 2KQ9A 1NU9C 3NYJA 2P6VA 4IRUA 3LNRA 4ZLDA 3CSKA 3UMHA 4JJGA 2A6EF 4BJTA 4F4BA 2Y3HA 4JVSA 3W8IA 3NYMA 4U5BE 1D1BA 2PF4E 5DQZA 2H7OA 3EGDB 3EZIA 3HTKC 4KNWA 4JW1A 4C7OB 4B6IA 5KYWA 4AE4A 2C03A 4YT8A 4YWQA 2R7RA 2J45A 5KYYB 4YT2A 2IXNA 3EHNA 5DS5A 2VASA 4M63A 4P6IC 5HSWA 1OCOC 2W4BA 3SP1A 5F5HA 4HFFB 1FFTC 2R7XA 2J0XA 1M2VB 2XL4A 5CI9A 4ANJA 4FWVA 1LVKA 4XLPF 5DS6A 3DXJF 3UR3C 3F47A 4GYTA 1PCXA 2R7TA 5KYUA 2OG2A 2KJGA 2J7PD 3Q6MA 3NDBB 4CSAA 1J8YF 3S27A 1ZHYA 3O6XA 2L81A 4JJFA 1OCCC 1OKKA 4XWJA 2HV7A 2KW3C 2R7UA 3DMDA 2C04A 2YHSA 1PD1A 1ZHWA 2W9YA 5F5FA 4PFPA 3WODF 2CW0F 3DM9B 2DYSC 2CDQA 2MWQA 3DZAA 2NUTA 3ABLC 3NYLA 3EFOA 1ZHTA 2NUPA 2YZSA 3OEOA 3T4RA 3ZG1A 2GFHA 1Z5ZA 3EG9A 4AX2A 3JRTA 2Q9CA 2G3KA 5DLJA 3UGPA 3SEOA 1D0YA 4PJLA 4FESA 2ZXRA 2XXAB 1G8XA 3L34A 3B0PA 1VOMA 1D0ZA 3KMIA 5D92A 4O79A 3QMKA 3IEEA 4IJJA 4G7HF 4E7SA 1TWHA 2QTVA 3ABMC 4J32B 1QZXA 3CZ6A 4LACB 3ECSA 2R7SA 4OIRF 3LLIA 2WVOA 5KYXB 2Z15A 1TKNA 2O9XA 3OA1A 1SMYF 3KL4A 3EGXA 4YN0B 2CNWD 5E3AA 2R7WA 3O39A 4U5HA 1LKXA 2WVNA 5IY5C 2A1DD 3FVYA 4KC9A 2KNHA 2J46A 1O87A 3AQBA 3HJCA 1BR4A 2G62A 4LLEA 3X1OA 3K7DA 4I1OB 4PFOA 3GANA 5T3WA 3JYHA 2OCCC 4NY3A 4CS9C 2Y39A 2V3CC 3EPVA 1Z6AA 4U5CE 2X51A 4CSAC 2EILC 1LS1A 2ZPAA 1D1CA 4PJJA 4MQ9F 4DVYP 4OIOF 4BJ1A 4O6YA 4WJ0A 3LJBA 3S28A 4EBBA 2W45A 1NU7D 1BR2A 3LEVA 4G7ZF 2EINC 3VYWA 3DAFA 3LS0A 3QZCA 4XTKA 4OD4A 2PX3A 1VYKA 3NG1A 4J30B 3VAYA 4FX5A 3EH1A 4DBRA 4O7GA 2MYSA 1QLEC 2XRHA 2HV6A 5D91A 2J9UA 2J9WA 4CS9A 4JCHA 1MMNA 2IXPA 4LERA 3EGDA 3NKEA 3ABKC 3Q7GA 1JPJA 4C7OA 2L9JA 5KYYA 1M2OA 4Q7CA 5L3QA 3ZIBA 2ZXPA 4O6NA 3JSZA 2H7BA 4I44A 4CIHA 4DOZA 2IXMA 3E70C 3AG2C 3X2QC 1V54C 4MNDA 4U5DE 1V55C 1M2VA 1J8MF 2WVQA 2Q3TA 3ITFA 5T1DB 2Q9BA 2Y3GA 3ZC4A 3F46A 2E87A 1NG1A 3W2VA 3RKOF 1TWCA 4YT4A 2G3VA 1TWAA 4OD5A 3MX3A 2Q9AA 3K66A 4G0HA 4YJWA 2WZLA 4ZLCA 3Q7LA 5B3SC 3Q6NA 3HLZA 2A69F 4K0DA 1FFHA 5E33A 2V26A 3UMKA 4DVZA 3AQCA 3V7OA 3N0TA 2I8BA 2EIMC 4Q5SF 3LESA 4H4KC 1PD0A 1Z63A 3FAJA 4Q4ZF 1RJ9B 1ZYRF 2NG1A 2R7VA 1FTSA 1KU2A 2WL8A 2ZXOA 3UGOA 4C3BA 3KKBA 5B1AC 5EGYA 2IYLD 3S0XA 1SZIA 5E3CA 3DJNB 3EH2A 1OCZC 3PMRA 3DAGA 4U5FE 2XXAA 4LLCA 2WZGA 3K1HA 4ULWA 2ZXWC 1ZU4A 4QI0A 1VK5A 2J7PA 2WB7A 1D1AA 4PJMA 3UNGC 1S7ZA 4AK9A 3OWTA 5CI8A 1TWGA 3AG4C 4A2NB 4KI2A 4YT5A 3NKDA 5BUOA 3I5QA 3ZSUA 2PFDA 4N06A 3M1CB 3K1IC 1O5HA 2WZFA 1WGWA 2LSEA 3LAYA 4BJ5A 5KYXA 5DQTA 1M57C 4PJNA 3EJNA 4K7BA 3UMIA 2J9VA 1OKKD 4W8KA 3N24A 3RYLA 2QY9A 3KH2A 3EZHA 5DVWA 3FDQA 4QDLA 4DBQA 2Y3DA 3DM5A 3ASOC 1NZEA 1ZHZA 3H65A 4CS8C 5KYWB 4AE4B 3T6JA 1OCRC 2D5RB 2A68F 4QI2A 3L0IA 1BR1A 5EHHA 1MNDA 1W2WA 1MMDA 4HFKB 4KNVA 2H7VC 2P7VA 4I1MA 5KYUB 3MLGA 1ZU5A 3GODA 4I3MA 2B0JA 4C3EA 2CNWA 2YEVA 4CS8A 1D0XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XSE A; 
#chains in the Genus database with same CATH topology
 4BEJ A;  1TR2 A;  3RVZ A;  3GEI A;  2Y69 C;  2J8W A;  3LEO A;  4CS7 A;  5T3T A;  4OIO F;  4OIQ F;  1ST6 A;  2OJE D;  3U5S A;  3V5Z A;  3POV A;  3WAQ A;  2FGY A;  1SF8 A;  2XM4 A;  4L6R A;  3W2W A;  3ZDL A;  3JCU Q;  1A7E A;  4BJ6 C;  5FCL A;  3GM1 A;  2AWY A;  4C3D A;  2NUT B;  2R05 A;  3IQT A;  1MMG A;  2YRF A;  4PAC A;  3EFO B;  5B1B C;  5L0H A;  2KSF A;  2YL7 A;  3AG3 C;  3ZVR A;  3IQ6 A;  1JPN A;  4MVO A;  2XM0 A;  5COG A;  4G7O F;  2PP4 A;  3MFN A;  3JRM O;  3BEH A;  1Z23 A;  5DS4 A;  2NUP B;  1Z3I X;  2OU6 A;  2A6H F;  4N6H A;  5JRA A;  2CGE A;  4JTC B;  3EQL F;  3TD7 A;  3EG9 B;  2DGJ A;  4U9E A;  3M4B A;  4DJ9 A;  1WN0 A;  2XS8 A;  4NTF A;  3SZR A;  1OR2 A;  5TJ5 E;  3PHF 2;  3RF3 A;  1V74 B;  3M4C A;  5JSL A;  3T6G B;  1M56 C;  3B0V C;  4JE9 A;  4WGY A;  3HNI A;  2YQY A;  3U2L A;  4CBE A;  3ASN C;  2EPO A;  1YZA A;  2W4M A;  4EWC A;  1L7C A;  3N2Z B;  5GPG B;  3K33 A;  2KYH A;  4NC3 A;  5EK0 A;  4ER9 A;  1H6G A;  3ATP A;  3I4U A;  3S84 A;  4IAO A;  1ORS C;  2EPL X;  1ZW3 A;  4P9T A;  3WG7 C;  4E7Z A;  1LI5 A;  4LDQ A;  3RIP A;  1N1C A;  4BJ6 A;  4OIN F;  3GEH A;  1IZM A;  2HMZ A;  2IOQ A;  4U5E E;  1ORJ A;  2EIJ C;  4BJ5 C;  1QSP A;  1Y4C A;  1E84 A;  1EQ1 A;  3GM3 A;  4JEA A;  2DB4 A;  3U3F A;  2QNL A;  3E9V A;  3PCV A;  4HE8 D;  3AG1 C;  1EI7 A;  2M64 A;  3C63 A;  1H9G A;  2HKV A;  2VB6 A;  3DJU B;  3K6B A;  3NMK A;  4DRI B;  1FMV A;  2JD3 A;  3EGX B;  3EHM A;  3NRH A;  2A0B A;  4IWB A;  3J06 A;  3AOU A;  1GQA A;  3B9Q A;  3SNH A;  1OR3 A;  2UUH A;  1C03 A;  4O6M A;  2BE5 F;  1E86 A;  4G78 A;  3RH3 A;  1HW2 A;  4OIP F;  4ULV A;  1L3P A;  2R7O A;  5JLI A;  4HEA J;  1CPQ A;  2IXO A;  2M4E A;  1Q0D A;  2KGO A;  4BG0 A;  1JOG A;  4RDA A;  1VYI A;  3SXK A;  4U5G A;  1ZHX A;  3T6B A;  1NSG B;  1MMA A;  4X0R A;  2XSE A;  4E17 A;  2EIK C;  3U2M A;  2VH3 A;  5L0C A;  4GEH A;  4XLN F;  1O3U A;  2XLW A;  2J0W A;  1RJ9 A;  5E2Q A;  3QVY A;  3JT1 A;  4UDV A;  5A6B D;  3DD7 A;  4KBL A;  1K05 A;  1EA8 A;  1JMW A;  4JUR I;  2VCC A;  3W8H A;  2PX0 A;  1G5Z A;  2DYR C;  3FHD A;  4DRJ B;  2NPU A;  2A0U A;  1UG7 A;  5L3V A;  1FMW A;  5K0I A;  3LS1 A;  1C02 A;  2FFH A;  2Y3B A;  3LUT B;  1E85 A;  4XPW A;  3FXH A;  2VC9 A;  2ZD9 A;  3B0U X;  3RFY A;  1AEP A;  2H8A A;  4CX9 A;  5KYN A;  4JZA A;  4RD9 A;  1XZP A;  3FMS A;  3I5P A;  1ZVZ A;  1MNE A;  3C8Z A;  3CQZ A;  2GA0 A;  3S29 A;  4MVR A;  2YL3 A;  5BQH A;  1IW7 F;  4RBN A;  256B A;  5L0I A;  2F22 A;  1CGN A;  1ZZP A;  4EBJ A;  1A7D A;  3GM2 A;  4PK4 A;  2CCY A;  2R7Q A;  3SYN A;  4XEK A;  1BBH A;  1VMA A;  3LLK A;  2LIG A;  1VB5 A;  2KQ9 A;  4N4W A;  3S9O A;  1NU9 C;  3NYJ A;  2P6V A;  1I5N A;  2OEV A;  4IRU A;  3LNR A;  4YL0 A;  1YYX A;  4ZLD A;  3U0C A;  3CSK A;  3UMH A;  4JJG A;  1YAU O;  1GM5 A;  4JCZ A;  1A0B A;  2A6E F;  4BJT A;  4F4B A;  3L1M A;  1D0X A;  5JVE A;  2Y3H A;  4JVS A;  1OXK A;  3W8I A;  3NYM A;  4U5B E;  1FAP B;  1LIH A;  1D1B A;  5A6K A;  2PF4 E;  5DQZ A;  2H7O A;  3EGD B;  2AP3 A;  2YL1 A;  1ORY A;  3EZI A;  1DOW A;  3HTK C;  3L8I A;  4GQH A;  4KNW A;  4JW1 A;  4C7O B;  4B6I A;  5KYW A;  4AE4 A;  2C03 A;  1QKR A;  1TFO B;  4WGZ A;  2J45 A;  4YT8 A;  4YK5 A;  4YWQ A;  4YT2 A;  2IXN A;  5KYY B;  2R7R A;  1ZW2 A;  2L6F A;  3EHN A;  2HSB A;  5COM A;  1LE4 A;  5DS5 A;  1NBB A;  1GGQ A;  2VAS A;  4M63 A;  4P6I C;  1T9K A;  5HSW A;  1OCO C;  2W4B A;  3SP1 A;  1CGM E;  3JYY A;  3VM6 A;  5F5H A;  4HFF B;  1I4Y A;  3C8G D;  3DI5 A;  1FFT C;  2R7X A;  2J0X A;  1M2V B;  2XL4 A;  5CI9 A;  4ANJ A;  4FWV A;  1LVK A;  1UFB A;  5DS6 A;  2OEX A;  4XLP F;  4EUK B;  3DXJ F;  3FOP A;  3UR3 C;  3S90 A;  1DOV A;  3F47 A;  2FAP B;  4AL1 A;  1WWP A;  2EPN A;  1PCX A;  4GYT A;  2R7T A;  5KYU A;  3QTH A;  2OG2 A;  2KJG A;  2J7P D;  4EHP A;  3Q6M A;  3NDB B;  4CSA A;  1J8Y F;  3S27 A;  1G4U S;  1ZHY A;  2YVK A;  3O6X A;  2J9B A;  3SXM A;  1T6Q A;  2GWW A;  4EBK A;  2ICW G;  2L81 A;  4JJF A;  3U8P A;  4JTA B;  1T6U A;  4XQ1 A;  1OCC C;  4MTF A;  1BZ4 A;  1FR0 A;  4D4N A;  1OKK A;  4XWJ A;  2HV7 A;  1VLT A;  2KW3 C;  2R7U A;  3DMD A;  2C04 A;  2YHS A;  1PD1 A;  1ZHW A;  2W9Y A;  3TK0 A;  4J7Y A;  5F5F A;  4PFP A;  3WOD F;  2CW0 F;  2GAQ A;  5L0G A;  3DM9 B;  1AUE A;  3DWW A;  4AL0 A;  2DYS C;  1OQC A;  3HKK A;  2CDQ A;  2MWQ A;  3DZA A;  3ZWI A;  2NUT A;  3TOM A;  4A4A A;  3ABL C;  3NYL A;  3EFO A;  1H9T A;  4JEB A;  3ZQV A;  2XLO A;  2XS1 A;  4JC7 A;  2HSQ A;  2BL2 A;  3NMJ A;  2XLM A;  2HS5 A;  5BQI A;  3QW1 A;  1ZHT A;  2NUP A;  2YZS A;  3OEO A;  3T4R A;  1LI7 A;  3ZG1 A;  2GFH A;  1Z5Z A;  1Q0M A;  1WOL A;  2OKU A;  3EG9 A;  4AX2 A;  1U0B B;  3GWN A;  1LS4 A;  3SXY A;  3C8G B;  3JRT A;  4BPM A;  2Q9C A;  2G3K A;  5DLJ A;  3UGP A;  3SEO A;  1D0Y A;  5A6A A;  3O10 A;  1RKE B;  4PJL A;  4FES A;  2ZXR A;  3SXZ A;  4XEF A;  4J7T A;  4Z9J A;  2XXA B;  1FNT c;  3AGU A;  1G8X A;  3L34 A;  2HFI A;  3B0P A;  1U89 A;  1VOM A;  1D0Z A;  2XLE A;  3KMI A;  5D92 A;  2QUP A;  4O79 A;  2R02 A;  3QMK A;  3W4Y A;  2XLH A;  4JIO A;  1GS9 A;  4EIY A;  5HV9 A;  3IEE A;  3M79 A;  4IJJ A;  4G7H F;  4E7S A;  1T5O A;  1TWH A;  4LDK A;  3FAP B;  2QTV A;  3ABM C;  3QW0 A;  3VF0 A;  3C62 A;  1RCP A;  4CDY A;  3V5X A;  3ZQY A;  4J32 B;  3PDM P;  1HE1 A;  2I15 A;  1K40 A;  3QVZ A;  1QZX A;  3CZ6 A;  4LAC B;  1H7I A;  3ECS A;  2R7S A;  1OW8 A;  2D4U A;  2YKZ A;  3LLI A;  4OIR F;  4EKW A;  2WVO A;  5KYX B;  2Z15 A;  1TKN A;  2O9X A;  1S05 A;  1SMY F;  3KL4 A;  3EGX A;  3JZ0 A;  1M6T A;  3OA1 A;  2LFD A;  4MVU A;  4YN0 B;  4DRH B;  2CNW D;  5E3A A;  3L8J A;  2R7W A;  4LDR A;  4MW3 A;  3O39 A;  4U5H A;  5F28 E;  1I4Z A;  1WAT A;  2LK4 A;  3IQC A;  1LKX A;  2BC5 A;  4WAB A;  3IPM O;  2WVN A;  1JAF A;  3U9J A;  1YLM A;  1NFN A;  5IY5 C;  1RKC A;  2A1D D;  3FVY A;  4KC9 A;  3U9M A;  2KNH A;  2J46 A;  2YLG A;  4P9F A;  5AGF A;  1O87 A;  3U8V A;  3AQB A;  3U3B A;  4CDV A;  3CEX A;  3HJC A;  1BR4 A;  2G62 A;  4CJO A;  1R4T A;  4LLE A;  4E0I A;  3X1O A;  3K7D A;  1SR2 A;  5L0J A;  4I1O B;  2P1A A;  2L6G A;  1XWJ A;  1F1M A;  4NTA A;  3AGT A;  4PFO A;  3GAN A;  3DE9 A;  1WAS A;  5T3W A;  3JYH A;  3GOR A;  2OCC C;  2OJQ A;  4N6C A;  4NY3 A;  3TOL A;  3BRJ A;  4CS9 C;  1APC A;  2Y39 A;  3G4X A;  2JX0 A;  3KYI A;  2VCB A;  1Q0K A;  2V3C C;  3EPV A;  1Z6A A;  4U5C E;  2X51 A;  4CDA A;  3WHN A;  4R32 A;  4CSA C;  1OW6 A;  1LS1 A;  2EIL C;  2ZPA A;  1D1C A;  4PJJ A;  4H54 A;  4MQ9 F;  3RW0 A;  1KNY A;  2AVK A;  1RXQ A;  2EPK X;  2XLV A;  2VCA A;  2P0N A;  4DVY P;  4XPX A;  3GWL A;  4NQF A;  2CYD A;  4O6Y A;  4WJ0 A;  4BJ1 A;  5JUA A;  3LJB A;  1SYQ A;  3RQG A;  1HMD A;  3S28 A;  4EBB A;  1A7V A;  1NU7 D;  1BR2 A;  1CGO A;  2HJM A;  2W45 A;  3LEV A;  3ZTZ A;  3G4Z A;  4G7Z F;  2EIN C;  1YAR O;  2L7A A;  3MBG A;  3VYW A;  3DAF A;  3B71 A;  4IGG A;  3HNK A;  3LS0 A;  3QZC A;  4NCQ A;  4XTK A;  4MVZ A;  4MS2 A;  1YA7 O;  1VYK A;  1MQV A;  2PX3 A;  3NG1 A;  4J30 B;  4OD4 A;  4ONS A;  3R2P A;  3VAY A;  4E0H A;  4FX5 A;  3EH1 A;  4DBR A;  4O7G A;  2MYS A;  1QLE C;  2XRH A;  2L6H A;  2HV6 A;  1EKY A;  5D91 A;  2J9U A;  2J9W A;  4CS9 A;  4JCH A;  1MMN A;  2IXP A;  4LER A;  4MW8 A;  4XEV A;  3EGD A;  3NKE A;  1OW7 A;  3ABK C;  3Q7G A;  4YL1 A;  1JPJ A;  3M15 A;  5A6B A;  3A9C A;  2L9J A;  3G50 A;  5FZT A;  4C7O A;  3ZTM A;  5KYY A;  2LFF A;  1M2O A;  4Q7C A;  2RSE B;  5L3Q A;  3ZIB A;  3H2V A;  2XLD A;  2ZXP A;  4O6N A;  3JSZ A;  2H7B A;  4I44 A;  4CIH A;  4DOZ A;  2UUI A;  1C17 M;  2IXM A;  5L0F A;  2OQM A;  3AG2 C;  3E70 C;  3X2Q C;  1V54 C;  4MND A;  4U5D E;  2NSG A;  1V55 C;  2P61 A;  1M2V A;  1R5I D;  5A6J A;  1J8M F;  4FAP B;  3C7J A;  2WVQ A;  2Q3T A;  3ITF A;  5T1D B;  2Q9B A;  2Y3G A;  2EPM X;  3ZC4 A;  2LCH A;  3F46 A;  1B68 A;  2AWC A;  3LNM B;  4Z9H A;  2E87 A;  2ETS A;  1NG1 A;  2YLI A;  3W2V A;  3TJ6 A;  3DE8 A;  2R03 A;  4IB4 A;  3CAX A;  3RKO F;  2XL6 A;  1Q0G A;  1G4W R;  1TWC A;  3TQO A;  3AJM A;  4IAR A;  4YT4 A;  2G3V A;  1TWA A;  1LPE A;  3HNJ A;  4OD5 A;  4MVS A;  1NLX A;  2R9R B;  1JR8 A;  1HMO A;  3MX3 A;  3NMI A;  2Q9A A;  3K66 A;  4G0H A;  4YJW A;  2WZL A;  4XPY A;  1VLS A;  4ZLC A;  3Q7L A;  5JS5 A;  5B3S C;  4JKV A;  3Q6N A;  3HLZ A;  2A69 F;  3B29 A;  1FFH A;  1CPR A;  1OXB A;  2V26 A;  4JRZ A;  4K0D A;  4MVQ A;  5E33 A;  3UMK A;  4CJG A;  4DVZ A;  3AQC A;  2PNO A;  2LP4 A;  1TFK B;  3V7O A;  3N0T A;  1U6H A;  3DKA A;  2GDC A;  2I8B A;  2EIM C;  4Q5S F;  4NTB A;  2QE9 A;  2Q00 A;  3LES A;  1YVI A;  4H4K C;  4DXW A;  1PD0 A;  1Z63 A;  3FAJ A;  1YJG A;  5AC5 A;  3MYI A;  2IM8 A;  3C18 A;  2B0H A;  4Q4Z F;  1KTM A;  2HUJ A;  2KK1 A;  5L0D A;  1QQ3 A;  3H2U A;  2DI3 A;  2X0C A;  1RJ9 B;  1ZYR F;  2NG1 A;  1RMV A;  1HY5 A;  1XZQ A;  2Q4F A;  2R7V A;  1KU2 A;  1FTS A;  2WL8 A;  2ZXO A;  3C8G A;  3UGO A;  4MTO A;  1T01 A;  3KKB A;  5B1A C;  4C3B A;  2IYL D;  5EGY A;  4MTG A;  3S0X A;  1SZI A;  5E3C A;  1RKE A;  3DJN B;  3EH2 A;  1OCZ C;  3KYJ A;  5B3I A;  1WTY A;  3PMR A;  3DAG A;  4U5F E;  2XXA A;  1LE2 A;  2YLD A;  4LLC A;  4Z9I A;  1JRA A;  2WZG A;  3K1H A;  2RD9 A;  3JTL O;  4ULW A;  2ZXW C;  1ZU4 A;  4QI0 A;  4CIP A;  1PV3 A;  5JT4 A;  2TMV P;  1VK5 A;  2HZ8 A;  2J7P A;  2R25 A;  2WB7 A;  1YZC A;  4PR9 A;  5CIV A;  1D1A A;  1YA9 A;  4PJM A;  3KPH A;  1S7Z A;  3UNG C;  1V4A A;  4AK9 A;  4D4X A;  2Q7R A;  3OWT A;  1HE9 A;  1TWG A;  3AG4 C;  5CI8 A;  5AC4 A;  4A2N B;  4KI2 A;  4YT5 A;  3NKD A;  2PBE A;  5BUO A;  3IHU A;  3I5Q A;  3ZSU A;  2MHR A;  2PFD A;  4MVM A;  4N06 A;  1NFO A;  1QPU A;  1O5H A;  2WZF A;  3K1I C;  3M1C B;  3MYF A;  3RQE A;  1QVX A;  4U9D A;  1WGW A;  2LSE A;  2JPU A;  2QLA A;  3LAY A;  4BJ5 A;  5DQT A;  2YWA A;  1M57 C;  3FOO A;  5KYX A;  4PJN A;  3EJN A;  4K7B A;  1YDI A;  2HJ3 A;  3UMI A;  1T6I A;  2J9V A;  1OKK D;  4W8K A;  3RVY A;  3N24 A;  3RYL A;  2AU5 A;  2QY9 A;  4E18 A;  3KH2 A;  3EZH A;  4YL3 A;  5DVW A;  3FDQ A;  4QDL A;  5COF A;  4DBQ A;  2Y3D A;  1TQG A;  5A69 A;  3DM5 A;  3ASO C;  3VRC A;  1VTM P;  1NZE A;  5JP7 A;  1ZHZ A;  3H65 A;  4CS8 C;  5KYW B;  1E83 A;  4AE4 B;  3T6J A;  1OCR C;  2D5R B;  3HNL A;  3IQ5 A;  3V5Y A;  2A68 F;  3TUL A;  4W8P A;  4K1O A;  4QI2 A;  3L0I A;  1YYJ A;  1BR1 A;  2ASR A;  3O55 A;  5EHH A;  3TJ5 A;  1Z7Q c;  1MND A;  1K04 A;  1BDJ B;  1E2X A;  1W2W A;  3K1I A;  1MMD A;  4BEM J;  4HFK B;  1Q0F A;  4KNV A;  2IBF A;  3US6 A;  2LD6 A;  2NSF A;  1Y6D A;  1A41 A;  3R7C A;  3T9O A;  1HW1 A;  2H7V C;  2LQG A;  4JTD B;  2P7V A;  3A11 A;  4I1M A;  5KYU B;  1AVO B;  3MLG A;  1ZU5 A;  3GOD A;  3JSE O;  3GEE A;  4I3M A;  1LM3 B;  2B0J A;  2OOC A;  4C3E A;  2XL8 A;  2YL0 A;  5BQG A;  2CNW A;  2KC3 A;  2YEV A;  4IAQ A;  4CS8 A;  2HMQ A;  3RQF A; 
#chains in the Genus database with same CATH homology
 4BEJ A;  1TR2 A;  2Y69 C;  4CS7 A;  5T3T A;  4OIQ F;  1ST6 A;  3POV A;  2FGY A;  1SF8 A;  3W2W A;  3JCU Q;  4BJ6 C;  5FCL A;  4C3D A;  2NUT B;  1MMG A;  5B1B C;  3EFO B;  3AG3 C;  3ZVR A;  1JPN A;  4G7O F;  2PP4 A;  1Z23 A;  5DS4 A;  2NUP B;  1Z3I X;  2A6H F;  2CGE A;  3EQL F;  3TD7 A;  3EG9 B;  2DGJ A;  3SZR A;  3PHF 2;  3B0V C;  1M56 C;  4CBE A;  3ASN C;  4EWC A;  2W4M A;  3N2Z B;  3K33 A;  3I4U A;  4IAO A;  3WG7 C;  4E7Z A;  3RIP A;  1N1C A;  4BJ6 A;  4OIN F;  1IZM A;  2IOQ A;  4U5E E;  4BJ5 C;  2EIJ C;  3E9V A;  4HE8 D;  3AG1 C;  3DJU B;  2VB6 A;  3K6B A;  1FMV A;  2JD3 A;  3EGX B;  3EHM A;  3NRH A;  4IWB A;  3B9Q A;  3SNH A;  4O6M A;  2BE5 F;  3RH3 A;  4OIP F;  2R7O A;  4HEA J;  2IXO A;  2M4E A;  2KGO A;  4BG0 A;  4RDA A;  1VYI A;  4U5G A;  1ZHX A;  3T6B A;  1MMA A;  4X0R A;  2XSE A;  2EIK C;  2VH3 A;  4GEH A;  4XLN F;  2J0W A;  1RJ9 A;  5E2Q A;  3JT1 A;  3DD7 A;  4KBL A;  4JUR I;  3W8H A;  2PX0 A;  2DYR C;  3FHD A;  5L3V A;  1FMW A;  3LS1 A;  2FFH A;  2Y3B A;  3B0U X;  3RFY A;  5KYN A;  4JZA A;  4RD9 A;  3I5P A;  1MNE A;  3CQZ A;  3S29 A;  1IW7 F;  4RBN A;  4PK4 A;  2R7Q A;  3SYN A;  1VMA A;  3LLK A;  2KQ9 A;  1NU9 C;  3NYJ A;  2P6V A;  4IRU A;  3LNR A;  4ZLD A;  3CSK A;  3UMH A;  4JJG A;  2A6E F;  4BJT A;  4F4B A;  2Y3H A;  4JVS A;  3W8I A;  3NYM A;  4U5B E;  1D1B A;  2PF4 E;  5DQZ A;  2H7O A;  3EGD B;  3EZI A;  3HTK C;  4KNW A;  4JW1 A;  4C7O B;  4B6I A;  5KYW A;  4AE4 A;  2C03 A;  4YT8 A;  4YWQ A;  2R7R A;  2J45 A;  5KYY B;  4YT2 A;  2IXN A;  3EHN A;  5DS5 A;  2VAS A;  4M63 A;  4P6I C;  5HSW A;  1OCO C;  2W4B A;  3SP1 A;  5F5H A;  4HFF B;  1FFT C;  2R7X A;  2J0X A;  1M2V B;  2XL4 A;  5CI9 A;  4ANJ A;  4FWV A;  1LVK A;  4XLP F;  5DS6 A;  3DXJ F;  3UR3 C;  3F47 A;  4GYT A;  1PCX A;  2R7T A;  5KYU A;  2OG2 A;  2KJG A;  2J7P D;  3Q6M A;  3NDB B;  4CSA A;  1J8Y F;  3S27 A;  1ZHY A;  3O6X A;  2L81 A;  4JJF A;  1OCC C;  1OKK A;  4XWJ A;  2HV7 A;  2KW3 C;  2R7U A;  3DMD A;  2C04 A;  2YHS A;  1PD1 A;  1ZHW A;  2W9Y A;  5F5F A;  4PFP A;  3WOD F;  2CW0 F;  3DM9 B;  2DYS C;  2CDQ A;  2MWQ A;  3DZA A;  2NUT A;  3ABL C;  3NYL A;  3EFO A;  1ZHT A;  2NUP A;  2YZS A;  3OEO A;  3T4R A;  3ZG1 A;  2GFH A;  1Z5Z A;  3EG9 A;  4AX2 A;  3JRT A;  2Q9C A;  2G3K A;  5DLJ A;  3UGP A;  3SEO A;  1D0Y A;  4PJL A;  4FES A;  2ZXR A;  2XXA B;  1G8X A;  3L34 A;  3B0P A;  1VOM A;  1D0Z A;  3KMI A;  5D92 A;  4O79 A;  3QMK A;  3IEE A;  4IJJ A;  4G7H F;  4E7S A;  1TWH A;  2QTV A;  3ABM C;  4J32 B;  1QZX A;  3CZ6 A;  4LAC B;  3ECS A;  2R7S A;  4OIR F;  3LLI A;  2WVO A;  5KYX B;  2Z15 A;  1TKN A;  2O9X A;  3OA1 A;  1SMY F;  3KL4 A;  3EGX A;  4YN0 B;  2CNW D;  5E3A A;  2R7W A;  3O39 A;  4U5H A;  1LKX A;  2WVN A;  5IY5 C;  2A1D D;  3FVY A;  4KC9 A;  2KNH A;  2J46 A;  1O87 A;  3AQB A;  3HJC A;  1BR4 A;  2G62 A;  4LLE A;  3X1O A;  3K7D A;  4I1O B;  4PFO A;  3GAN A;  5T3W A;  3JYH A;  2OCC C;  4NY3 A;  4CS9 C;  2Y39 A;  2V3C C;  3EPV A;  1Z6A A;  4U5C E;  2X51 A;  4CSA C;  2EIL C;  1LS1 A;  2ZPA A;  1D1C A;  4PJJ A;  4MQ9 F;  4DVY P;  4OIO F;  4BJ1 A;  4O6Y A;  4WJ0 A;  3LJB A;  3S28 A;  4EBB A;  2W45 A;  1NU7 D;  1BR2 A;  3LEV A;  4G7Z F;  2EIN C;  3VYW A;  3DAF A;  3LS0 A;  3QZC A;  4XTK A;  4OD4 A;  2PX3 A;  1VYK A;  3NG1 A;  4J30 B;  3VAY A;  4FX5 A;  3EH1 A;  4DBR A;  4O7G A;  2MYS A;  1QLE C;  2XRH A;  2HV6 A;  5D91 A;  2J9U A;  2J9W A;  4CS9 A;  4JCH A;  1MMN A;  2IXP A;  4LER A;  3EGD A;  3NKE A;  3ABK C;  3Q7G A;  1JPJ A;  4C7O A;  2L9J A;  5KYY A;  1M2O A;  4Q7C A;  5L3Q A;  3ZIB A;  2ZXP A;  4O6N A;  3JSZ A;  2H7B A;  4I44 A;  4CIH A;  4DOZ A;  2IXM A;  3E70 C;  3AG2 C;  3X2Q C;  1V54 C;  4MND A;  4U5D E;  1V55 C;  1M2V A;  1J8M F;  2WVQ A;  2Q3T A;  3ITF A;  5T1D B;  2Q9B A;  2Y3G A;  3ZC4 A;  3F46 A;  2E87 A;  1NG1 A;  3W2V A;  3RKO F;  1TWC A;  4YT4 A;  2G3V A;  1TWA A;  4OD5 A;  3MX3 A;  2Q9A A;  3K66 A;  4G0H A;  4YJW A;  2WZL A;  4ZLC A;  3Q7L A;  5B3S C;  3Q6N A;  3HLZ A;  2A69 F;  4K0D A;  1FFH A;  5E33 A;  2V26 A;  3UMK A;  4DVZ A;  3AQC A;  3V7O A;  3N0T A;  2I8B A;  2EIM C;  4Q5S F;  3LES A;  4H4K C;  1PD0 A;  1Z63 A;  3FAJ A;  4Q4Z F;  1RJ9 B;  1ZYR F;  2NG1 A;  2R7V A;  1FTS A;  1KU2 A;  2WL8 A;  2ZXO A;  3UGO A;  4C3B A;  3KKB A;  5B1A C;  5EGY A;  2IYL D;  3S0X A;  1SZI A;  5E3C A;  3DJN B;  3EH2 A;  1OCZ C;  3PMR A;  3DAG A;  4U5F E;  2XXA A;  4LLC A;  2WZG A;  3K1H A;  4ULW A;  2ZXW C;  1ZU4 A;  4QI0 A;  1VK5 A;  2J7P A;  2WB7 A;  1D1A A;  4PJM A;  3UNG C;  1S7Z A;  4AK9 A;  3OWT A;  5CI8 A;  1TWG A;  3AG4 C;  4A2N B;  4KI2 A;  4YT5 A;  3NKD A;  5BUO A;  3I5Q A;  3ZSU A;  2PFD A;  4N06 A;  3M1C B;  3K1I C;  1O5H A;  2WZF A;  1WGW A;  2LSE A;  3LAY A;  4BJ5 A;  5KYX A;  5DQT A;  1M57 C;  4PJN A;  3EJN A;  4K7B A;  3UMI A;  2J9V A;  1OKK D;  4W8K A;  3N24 A;  3RYL A;  2QY9 A;  3KH2 A;  3EZH A;  5DVW A;  3FDQ A;  4QDL A;  4DBQ A;  2Y3D A;  3DM5 A;  3ASO C;  1NZE A;  1ZHZ A;  3H65 A;  4CS8 C;  5KYW B;  4AE4 B;  3T6J A;  1OCR C;  2D5R B;  2A68 F;  4QI2 A;  3L0I A;  1BR1 A;  5EHH A;  1MND A;  1W2W A;  1MMD A;  4HFK B;  4KNV A;  2H7V C;  2P7V A;  4I1M A;  5KYU B;  3MLG A;  1ZU5 A;  3GOD A;  4I3M A;  2B0J A;  4C3E A;  2CNW A;  2YEV A;  4CS8 A;  1D0X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...