2XSEA

The structural basis for recognition of j-base containing dna by a novel dna-binding domain in jbp1
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
167
structure length
160
Chain Sequence
MVSTAVEKKKYLDSEFLLHCISAQLLDMWKQARARWLELVGKEWAHMLALNPERKDFLWKNQSEMNSAFFDLCEVGKQVMLGLLGKEVALPKEEQAFWIMYAVHLSAACAEELHMPEVAMSLRKLNVKLKDFNFDMPPEEKKRRMERKQRIEEARRHGMP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords THYMINE DIOXYGENASE JBP1
publication title The Structural Basis for Recognition of Base J Containing DNA by a Novel DNA Binding Domain in Jbp1.
pubmed doi rcsb
source organism Leishmania tarentolae
molecule tags Oxidoreductase
total genus 52
structure length 160
sequence length 167
ec nomenclature ec 1.14.11.6: Thymine dioxygenase.
pdb deposition date 2010-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18526 DB_JBP1 Thymine dioxygenase JBP1 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1440 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 2xseA00
2XSEA
chains in the Genus database with same CATH superfamily
2WZFA 4XWJA 4N4WA 1VLSA 2W9YA 4CJOA 2QY9A 4JURI 1NFNA 2LFDA 1JPJA 4F4BA 1C02A 2XLWA 4CJGA 4L6RA 3Q7LA 4MVRA 1JAFA 1S05A 1Q0GA 3I5PA 3PMRA 4MW3A 3U2LA 4YT4A 2YL1A 5B1AC 1HY5A 3B9QA 1YARO 5CI9A 3DE9A 1GQAA 4JIOA 3J06A 5EGYA 2J0XA 5JT4A 1R5ID 3L8JA 4AE4A 2P7VA 1E85A 2Z15A 4X0RA 4GEHA 4FAPB 2AU5A 1OW6A 5COFA 5KYNA 2FAPB 2IXMA 4C7OA 2Q9CA 3ZWIA 1HE9A 2P6VA 3HNIA 3L1MA 4PJNA 3LS1A 2HV6A 2HZ8A 2QUPA 3ABKC 5A6JA 2DYRC 4LLEA 2AWYA 1T6QA 2LD6A 3M79A 3T6JA 2R7SA 1H9GA 1WGWA 1IZMA 3LEVA 3T6GB 4EBBA 2L6FA 5BQIA 2AP3A 1Y4CA 1QQ3A 5COGA 2QNLA 3JTLO 1C03A 1QVXA 2W4MA 3C63A 2IYLD 4H4KC 3RH3A 1OCOC 4PFOA 3T9OA 3EGDA 1M2VA 1T01A 1AVOB 1YYJA 4QI0A 1CGME 1H6GA 1YLMA 3RF3A 1CGNA 2EPMX 2NG1A 3RKOF 3LLIA 4LDRA 3LAYA 3KYJA 2L9JA 2ZXWC 2JPUA 1V55C 3N0TA 2EPLX 5CI8A 2KSFA 1BBHA 4QDLA 5EK0A 1GGQA 1NZEA 2KW3C 2J9VA 3I4UA 3JCUQ 3N24A 4MTFA 2J46A 3U8VA 1SF8A 3DM5A 2HSQA 3GEEA 3MBGA 4NTAA 2GAQA 2YVKA 3OEOA 4LACB 2BC5A 3DM9B 3V7OA 4DRIB 4EBJA 1UG7A 4BJ5C 4D4NA 2D4UA 4DBRA 4XPYA 1MMDA 1OCCC 1OCRC 4IJJA 3X1OA 3FDQA 1MNEA 3HJCA 2H7VC 3FAPB 3AGUA 5FZTA 1ZU4A 3W4YA 2G3VA 3ZQYA 3SEOA 4XEFA 2NUPB 2Y3BA 3HLZA 3RQEA 1Z3IX 3NYJA 4CS8C 1NG1A 2NUTB 3UMHA 2V3CC 5FCLA 3AQBA 3TULA 1TKNA 4BPMA 2P1AA 5CIVA 2A6EF 2LCHA 1T9KA 3TD7A 3LNRA 2XL4A 4YT5A 2YL7A 1D1BA 1Q0DA 2CNWA 1RJ9B 4K7BA 3ZDLA 1ZHXA 3VRCA 5KYXB 3ZQVA 3FXHA 4CS7A 1U89A 5DLJA 3U5SA 3RVYA 1ZW3A 2VC9A 1D1CA 2OQMA 2XSEA 1NLXA 2GDCA 1PCXA 1MMNA 2YZSA 3RVZA 3DXJF 5B3SC 4DVYP 3NMJA 2Q3TA 5A6AA 4IARA 2A68F 4A2NB 3POVA 1BR2A 4JCZA 4JTAB 4BJ1A 1R4TA 2CW0F 2Q4FA 2XM0A 3G4XA 2WVQA 3NKDA 5L0FA 1SMYF 1WOLA 1ZHYA 4QI2A 1FR0A 4JCHA 3IQ5A 5TJ5E 5KYUB 2H8AA 1RKEB 2DI3A 3DI5A 3K1HA 4MVZA 2YL3A 1IW7F 4JJFA 4OD4A 5JP7A 1E84A 4KI2A 1U6HA 3GWNA 1K04A 3AJMA 4HFKB 4IB4A 3TJ5A 4ZLCA 1WASA 1CPQA 2YKZA 2V26A 2J7PA 4DBQA 2OEXA 3ECSA 3X2QC 4MW8A 3GM3A 3K1IC 2HFIA 2W4BA 1SZIA 2P61A 2YLIA 4H54A 2OOCA 2NSGA 3IHUA 4MVUA 4N06A 2CGEA 5T3WA 2Y39A 4OINF 1WWPA 2A1DD 4JW1A 3SXYA 3MLGA 1WTYA 2B0HA 1ZHTA 2KC3A 3M1CB 1D1AA 2LFFA 4KBLA 3G50A 2M64A 1OXBA 4BJTA 2HMZA 4E18A 2KGOA 3JSZA 4G7HF 2XM4A 2ZXRA 3TQOA 3S27A 3SZRA 3WAQA 4BEMJ 4CDAA 1MNDA 1A0BA 1VYIA 4AE4B 5EHHA 4CSAA 2EIMC 2R02A 3LLKA 3VYWA 3JYHA 3TK0A 4C7OB 4YN0B 3IPMO 2R9RB 3H2VA 1RKCA 2PF4E 2FFHA 2HJMA 4FWVA 4HEAJ 4WGZA 1HW1A 2DB4A 3JT1A 3L8IA 1BDJB 1MMGA 2A0BA 3JRMO 2LSEA 2MHRA 4Z9JA 4CIHA 3S0XA 4ULWA 1LI5A 3NKEA 4W8KA 2HMQA 3IQ6A 4ANJA 4CS9A 1M57C 1VOMA 4KNWA 3KMIA 4G7OF 2R05A 1A41A 4YT8A 5DS5A 2E87A 1A7VA 4JC7A 1QSPA 2BE5F 2CNWD 3C18A 4YT2A 1OW8A 2ASRA 3CEXA 2R03A 5JUAA 1TWAA 1U0BB 3JYYA 3M4BA 2G62A 2XXAA 2ETSA 1LE2A 1M2VB 3EGDB 4JRZA 4LLCA 4O6NA 3JSEO 4WJ0A 5GPGB 5AC4A 1BZ4A 2ZPAA 3UGPA 4DJ9A 1JMWA 1PD0A 3DZAA 5HSWA 4Q4ZF 3ATPA 3FOPA 4U5GA 2IXNA 3QTHA 2B0JA 3EH1A 1E86A 3WG7C 1NSGB 4EKWA 1APCA 1HE1A 1TR2A 3Q7GA 1HMOA 4XEVA 4XEKA 5BQGA 3SNHA 256BA 1KU2A 3V5ZA 2QE9A 3PHF2 3A11A 2C04A 5BQHA 3MYIA 1LKXA 1ZHWA 4OIRF 3EZIA 1OR2A 1JRAA 1RCPA 2YWAA 4N6HA 3VM6A 1E83A 2IOQA 2YL0A 2KNHA 2YRFA 3V5YA 4CIPA 3KPHA 4AK9A 3SP1A 3N2ZB 4XPXA 4EBKA 3GWLA 4BG0A 3EFOA 1YA7O 3DKAA 4P6IC 2XRHA 1VMAA 3F47A 3K33A 1DOVA 4DRHB 1EQ1A 2OJQA 1EI7A 3H65A 4WABA 3DD7A 2IXOA 4BJ6C 2CCYA 3HKKA 3RQFA 2G3KA 1M6TA 1SR2A 2H7BA 1G4WR 3CZ6A 4DOZA 1LI7A 1H9TA 1TFKB 4NTBA 3DAGA 3TJ6A 4MVMA 4MNDA 3UMIA 4J32B 5A6BA 3GEHA 3QVZA 1V74B 2WVOA 5E33A 5JLIA 5L0IA 2HKVA 3BEHA 1LS1A 1Z5ZA 3NMIA 3MYFA 1L7CA 3K7DA 4MVQA 4NCQA 5L3VA 4Q5SF 1W2WA 3QW0A 4E0IA 2R7VA 4ONSA 4C3DA 1BR1A 1G8XA 4U5DE 4GQHA 4FESA 3IQTA 1WN0A 4P9FA 2L81A 1TFOB 1YVIA 2Q7RA 3RYLA 4OIOF 2F22A 4PJLA 3RIPA 4LERA 3AG2C 1K05A 3CSKA 3B71A 3W2VA 4A4AA 1NFOA 4DXWA 1FFTC 2FGYA 4M63A 2WZGA 4U5BE 4IGGA 1DOWA 2OCCC 5K0IA 1TWHA 3GEIA 4O6YA 3FHDA 2VCBA 3R2PA 4IWBA 4E0HA 2Y3DA 2I15A 5L0GA 3ZC4A 4CDVA 4NQFA 3EQLF 1O3UA 1XWJA 3OWTA 2WL8A 4KC9A 5L0JA 2PP4A 5DQTA 1FMVA 4U5HA 5KYYA 3Q6NA 3PDMP 1TWGA 1ORJA 3OA1A 2KJGA 3DAFA 2WVNA 4Q7CA 4YJWA 3ASOC 4J7YA 4JEBA 4C3BA 2HUJA 3EG9A 1Q0MA 1D0ZA 2VH3A 3NYLA 3O6XA 2PFDA 4IRUA 3KYIA 4RBNA 3W8HA 3ZG1A 1BR4A 2YLGA 1Y6DA 1YDIA 3SXMA 3SXKA 1J8YF 4CX9A 1NU7D 1YZCA 3U9JA 3B29A 4XQ1A 2MYSA 4AL0A 2R7XA 4K0DA 4PJJA 3L0IA 4HE8D 3O55A 4BJ5A 4ZLDA 1YAUO 2TMVP 4Z9IA 3LNMB 3EJNA 2KK1A 2R7QA 1H7IA 4C3EA 3S28A 2IXPA 3EGXA 4D4XA 3C8GA 3ABMC 3HNKA 1OW7A 4CS8A 3NRHA 1ZYRF 2HV7A 5F5HA 3F46A 4MS2A 1YJGA 4JTDB 5T3TA 5BUOA 3VAYA 1VLTA 1ZU5A 2LQGA 1VB5A 5HV9A 2CYDA 2YHSA 1JOGA 2XLMA 4RD9A 3UR3C 5A6BD 1OKKA 3Q6MA 2HSBA 3ABLC 5E2QA 2YEVA 3GANA 4I3MA 3UMKA 3A9CA 1LIHA 3LUTB 2VCCA 3MX3A 1GM5A 3PCVA 3M15A 2XXAB 2VCAA 2GWWA 2EIJC 3KKBA 5JS5A 3RQGA 1EKYA 1VK5A 1UFBA 5DS6A 4K1OA 4E17A 4I44A 3HTKC 2Y3GA 4U9EA 4IAQA 2CDQA 4GYTA 5D92A 3RW0A 5AC5A 2DGJA 3H2UA 3LESA 4EIYA 2Q9AA 2Q9BA 3UGOA 1K40A 4ER9A 3JRTA 2RSEB 4PACA 1ZVZA 2EPNA 3U3BA 1HMDA 4MVSA 4XLNF 4NC3A 2Q00A 4CBEA 4E7ZA 4YL0A 3MFNA 1XZPA 3S29A 2BL2A 2ZXPA 1GS9A 1LE4A 3K1IA 4G0HA 2EIKC 2R7UA 3SXZA 3ZTMA 1ST6A 1PV3A 2A6HF 1YZAA 4IAOA 3EFOB 1B68A 3US6A 5KYWA 2OKUA 4YL1A 1KTMA 1QLEC 4JKVA 4U5FE 3QMKA 1NU9C 3B0UX 1Z23A 3ZVRA 2JD3A 1V4AA 3IQCA 1ORSC 1F1MA 1T6IA 2XS1A 1JR8A 2VASA 3UNGC 2AVKA 4U5EE 2D5RB 1TWCA 3U0CA 3KH2A 2P0NA 3LJBA 1XZQA 2J7PD 5DQZA 1ORYA 2GA0A 1OCZC 3NMKA 2PX0A 3C7JA 1TQGA 2J9WA 2W45A 2RD9A 3AGTA 3C8GD 5F28E 1FTSA 2XLDA 4J7TA 4BEJA 4I1MA 2PBEA 3JZ0A 1YA9A 3NYMA 1A7DA 4LDKA 5IY5C 2WB7A 3CAXA 4JZAA 4XPWA 4AL1A 3WHNA 4DVZA 1M56C 1LS4A 4XTKA 4G7ZF 2OG2A 3AQCA 1N1CA 1A7EA 3ASNC 1OKKD 1CPRA 2IBFA 3LEOA 4N6CA 4HFFB 2ZXOA 4RDAA 4YWQA 2XL8A 3C62A 3RFYA 1V54C 3GM1A 1HW2A 5L3QA 2Y3HA 4PR9A 2NSFA 4EUKB 3M4CA 4P9TA 3V5XA 3ZSUA 1MQVA 2XLHA 4JJGA 1OR3A 2OU6A 2YLDA 1Z7Qc 5AGFA 1MMAA 3EHMA 5COMA 1YYXA 5KYYB 2A0UA 1D0XA 3O39A 4U9DA 4B6IA 5B3IA 1O87A 1LVKA 3EZHA 5E3AA 5JRAA 4W8PA 4MQ9F 3EG9B 3S90A 2ZD9A 4E7SA 2L6GA 2LIGA 4MTOA 1FFHA 3SYNA 2R7TA 3ZIBA 3FVYA 3R7CA 3HNJA 2JX0A 3EPVA 2EILC 3QVYA 3K66A 3TOMA 1QZXA 3C8ZA 3ZTZA 2XLEA 1SYQA 2X0CA 3AG1C 3WODF 5L0DA 5L0HA 3FMSA 4UDVA 3VF0A 3EHNA 1L3PA 2AWCA 3W2WA 2DYSC 1OXKA 2ICWG 4Z9HA 2XLOA 4PFPA 3DJNB 4I1OB 2R7OA 1E2XA 2UUHA 5DVWA 4LDQA 3EGXB 2IM8A 1S7ZA 2L6HA 3C8GB 3E9VA 2OJED 2PX3A 3DJUB 3QZCA 3L34A 4JVSA 3U9MA 3CQZA 4EHPA 2R7WA 1VTMP 4JEAA 3G4ZA 3LS0A 1ZHZA 4BJ6A 3EH2A 5F5FA 1Q0FA 3DWWA 1ZW2A 5JSLA 1OQCA 2KQ9A 3BRJA 1M2OA 3TOLA 1G5ZA 2KYHA 4NY3A 4YL3A 4OIQF 4OD5A 4MVOA 1RMVA 1D0YA 4CSAC 3E70C 1VYKA 3KL4A 3U8PA 4WGYA 1I5NA 4XLPF 2UUIA 3IEEA 3B0VC 3O10A 1RXQA 1LPEA 2XLVA 3T4RA 1J8MF 3U2MA 5E3CA 4DRJB 3AOUA 1T6UA 1I4YA 2J0WA 1AEPA 2NPUA 2NUPA 3HNLA 3I5QA 3S9OA 5B1BC 2GFHA 1FMWA 1LM3B 2LK4A 3AG3C 4G78A 2I8BA 3NG1A 3GODA 2NUTA 2YQYA 1AUEA 3U3FA 1C17M 1KNYA 2J8WA 4CS9C 4OIPF 2XL6A 4AX2A 2VB6A 2J9UA 2PNOA 3DMDA 3QW1A 4CDYA 3W8IA 2L7AA 1Q0KA 1RJ9A 1Z63A 4FX5A 4U5CE 5KYXA 5L0CA 2OEVA 1NBBA 4NTFA 2O9XA 4O79A 3T6BA 5DS4A 2MWQA 4PJMA 3S84A 2QLAA 2Y69C 4PK4A 1G4US 2EPKX 4O6MA 1O5HA 1I4ZA 2EPOA 1Z6AA 2C03A 1ZZPA 2H7OA 2QTVA 2X51A 3B0PA 4JE9A 3AG4C 4ULVA 4EWCA 5KYWB 2LP4A 1FAPB 3GORA 2J45A 5D91A 1WATA 3FOOA 3FAJA 5A6KA 2HJ3A 3ITFA 2A69F 2WZLA 5JVEA 2M4EA 5KYUA 3NDBB 1QKRA 1RKEA 3DE8A 1QPUA 1FNTc 1EA8A 4KNVA 4YK5A 1JPNA 2EINC 2J9BA 4O7GA 2XS8A 4JTCB 2R7RA 1CGOA 2R25A 5T1DB 3GM2A 1T5OA 4R32A 2HS5A 4MTGA 5A69A 3K6BA 1PD1A 4J30B
chains in the Genus database with same CATH topology
2WZFA 4XWJA 2W9YA 2QY9A 4JURI 1JPJA 4F4BA 3Q7LA 3I5PA 3PMRA 5B1AC 3B9QA 5CI9A 5EGYA 2J0XA 4AE4A 2P7VA 2Z15A 4X0RA 4GEHA 4C7OA 5KYNA 2IXMA 2Q9CA 2P6VA 4PJNA 3LS1A 2HV6A 3ABKC 2DYRC 4LLEA 3T6JA 1WGWA 1IZMA 3LEVA 4EBBA 2W4MA 2IYLD 4H4KC 3RH3A 1OCOC 4PFOA 3EGDA 1M2VA 4QI0A 2NG1A 3RKOF 3LLIA 3LAYA 2L9JA 2ZXWC 3N0TA 1V55C 5CI8A 4QDLA 1NZEA 2KW3C 2J9VA 3I4UA 3JCUQ 3N24A 2J46A 1SF8A 3DM5A 3OEOA 4LACB 3V7OA 3DM9B 4BJ5C 4DBRA 1MMDA 1OCCC 1OCRC 4IJJA 3X1OA 3FDQA 1MNEA 3HJCA 2H7VC 1ZU4A 2G3VA 3SEOA 2NUPB 2Y3BA 3HLZA 1Z3IX 3NYJA 4CS8C 1NG1A 2NUTB 3UMHA 5FCLA 3AQBA 1TKNA 2A6EF 3TD7A 3LNRA 2XL4A 4YT5A 1D1BA 2CNWA 4K7BA 1RJ9B 1ZHXA 5KYXB 4CS7A 5DLJA 1D1CA 2XSEA 1PCXA 1MMNA 2YZSA 3DXJF 5B3SC 4DVYP 2Q3TA 2A68F 4A2NB 3POVA 1BR2A 4BJ1A 2CW0F 2WVQA 3NKDA 1SMYF 1ZHYA 4QI2A 4JCHA 5KYUB 4OD4A 3K1HA 1IW7F 4JJFA 4KI2A 4HFKB 4ZLCA 2V26A 2J7PA 4DBQA 3X2QC 3ECSA 3K1IC 2W4BA 1SZIA 5T3WA 4N06A 2CGEA 2Y39A 4OINF 2A1DD 4JW1A 3MLGA 1ZHTA 3M1CB 1D1AA 4KBLA 4BJTA 2KGOA 3JSZA 4G7HF 2ZXRA 3S27A 3SZRA 1MNDA 1VYIA 4AE4B 5EHHA 4CSAA 2EIMC 3LLKA 3VYWA 3JYHA 4C7OB 4YN0B 2PF4E 2FFHA 4FWVA 4HEAJ 3JT1A 1MMGA 2LSEA 4CIHA 3S0XA 4ULWA 3NKEA 4W8KA 4CS9A 4ANJA 1M57C 1VOMA 4KNWA 3KMIA 4G7OF 5DS5A 4YT8A 2E87A 2BE5F 2CNWD 4YT2A 1TWAA 2G62A 2XXAA 3EGDB 1M2VB 4LLCA 4WJ0A 4O6NA 2ZPAA 3UGPA 1PD0A 5HSWA 4Q4ZF 4U5GA 2IXNA 2B0JA 3EH1A 3WG7C 1TR2A 3Q7GA 3SNHA 1KU2A 3PHF2 2C04A 1LKXA 1ZHWA 4OIRF 3EZIA 2IOQA 2KNHA 4AK9A 3SP1A 3N2ZB 4BG0A 3EFOA 4P6IC 2XRHA 1VMAA 3F47A 3K33A 3H65A 3DD7A 2IXOA 4BJ6C 2G3KA 2H7BA 3CZ6A 4DOZA 3DAGA 3UMIA 4MNDA 4J32B 2WVOA 5E33A 1LS1A 1Z5ZA 5L3VA 3K7DA 4Q5SF 1W2WA 2R7VA 4C3DA 1BR1A 1G8XA 4U5DE 4FESA 2L81A 3RYLA 4OIOF 4PJLA 3RIPA 4LERA 3AG2C 3CSKA 3W2VA 1FFTC 2FGYA 4M63A 2WZGA 4U5BE 2OCCC 1TWHA 4O6YA 3FHDA 4IWBA 2Y3DA 3ZC4A 3EQLF 3OWTA 2WL8A 4KC9A 2PP4A 5DQTA 1FMVA 4U5HA 5KYYA 3Q6NA 1TWGA 3OA1A 2KJGA 3DAFA 2WVNA 4Q7CA 4YJWA 3ASOC 4C3BA 3EG9A 4IRUA 2VH3A 1D0ZA 3NYLA 4RBNA 3O6XA 2PFDA 3W8HA 3ZG1A 1BR4A 1J8YF 1NU7D 1PD1A 2MYSA 2R7XA 4K0DA 4PJJA 3L0IA 4HE8D 4BJ5A 4ZLDA 3EJNA 2R7QA 4C3EA 3S28A 2IXPA 3EGXA 3ABMC 4CS8A 3NRHA 1ZYRF 2HV7A 5F5HA 3F46A 5T3TA 5BUOA 3VAYA 1ZU5A 2YHSA 4RD9A 3UR3C 1OKKA 3Q6MA 3ABLC 5E2QA 2YEVA 3GANA 4I3MA 3UMKA 3MX3A 2XXAB 3KKBA 2EIJC 1VK5A 5DS6A 4I44A 3HTKC 2Y3GA 2CDQA 4GYTA 5D92A 2DGJA 3LESA 2Q9AA 2Q9BA 3UGOA 3JRTA 4XLNF 4CBEA 4E7ZA 3S29A 2ZXPA 4G0HA 2EIKC 2R7UA 1ST6A 2A6HF 4IAOA 5KYWA 3EFOB 1QLEC 4U5FE 3QMKA 1NU9C 3B0UX 1Z23A 3ZVRA 2JD3A 2VASA 3UNGC 4U5EE 2D5RB 1TWCA 3KH2A 3LJBA 5DQZA 2J7PD 1OCZC 2PX0A 2J9WA 2W45A 1FTSA 4BEJA 4I1MA 3NYMA 5IY5C 2WB7A 4JZAA 4DVZA 1M56C 4XTKA 4G7ZF 2OG2A 3AQCA 1N1CA 3ASNC 1OKKD 4RDAA 4HFFB 2ZXOA 4YWQA 3RFYA 1V54C 5L3QA 2Y3HA 3ZSUA 4JJGA 1MMAA 3EHMA 5KYYB 4B6IA 1D0XA 3O39A 1O87A 1LVKA 3EZHA 5E3AA 4MQ9F 3EG9B 4E7SA 1FFHA 3SYNA 2R7TA 3ZIBA 3FVYA 3EPVA 2EILC 3K66A 1QZXA 3AG1C 3WODF 3W2WA 3EHNA 2DYSC 4PFPA 3DJNB 4I1OB 2R7OA 5DVWA 4YT4A 3EGXB 1S7ZA 3E9VA 4JVSA 2R7SA 2PX3A 3DJUB 3QZCA 2R7WA 3L34A 2V3CC 3CQZA 3LS0A 1ZHZA 4BJ6A 3EH2A 5F5FA 2KQ9A 1M2OA 4NY3A 4OIQF 4OD5A 1D0YA 4CSAC 3E70C 1VYKA 3KL4A 4XLPF 3IEEA 3B0VC 3T4RA 1J8MF 5E3CA 2J0WA 2NUPA 3I5QA 5B1BC 2GFHA 1FMWA 3AG3C 2NUTA 2I8BA 3NG1A 3GODA 4CS9C 4OIPF 4AX2A 2VB6A 2J9UA 3DMDA 3W8IA 1RJ9A 1Z63A 4FX5A 4U5CE 5KYXA 3T6BA 4O79A 5DS4A 2O9XA 2MWQA 4PJMA 2Y69C 4PK4A 4O6MA 1O5HA 1Z6AA 2C03A 2H7OA 2X51A 2QTVA 3B0PA 4EWCA 3AG4C 5KYWB 5D91A 2J45A 3FAJA 3ITFA 2A69F 2WZLA 2M4EA 5KYUA 3NDBB 4KNVA 1JPNA 2EINC 4O7GA 2R7RA 5T1DB 3K6BA 3DZAA 4J30B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XSE A; 
#chains in the Genus database with same CATH topology
 2WZF A;  4XWJ A;  4N4W A;  1VLS A;  2W9Y A;  4CJO A;  2QY9 A;  4JUR I;  1NFN A;  2LFD A;  1JPJ A;  4F4B A;  1C02 A;  2XLW A;  4CJG A;  4L6R A;  3Q7L A;  4MVR A;  1JAF A;  1S05 A;  1Q0G A;  3I5P A;  3PMR A;  4MW3 A;  3U2L A;  4YT4 A;  2YL1 A;  5B1A C;  1HY5 A;  3B9Q A;  1YAR O;  5CI9 A;  3DE9 A;  1GQA A;  4JIO A;  3J06 A;  5EGY A;  2J0X A;  5JT4 A;  1R5I D;  3L8J A;  4AE4 A;  2P7V A;  1E85 A;  2Z15 A;  4X0R A;  4GEH A;  4FAP B;  2AU5 A;  1OW6 A;  5COF A;  5KYN A;  2FAP B;  2IXM A;  4C7O A;  2Q9C A;  3ZWI A;  1HE9 A;  2P6V A;  3HNI A;  3L1M A;  4PJN A;  3LS1 A;  2HV6 A;  2HZ8 A;  2QUP A;  3ABK C;  5A6J A;  2DYR C;  4LLE A;  2AWY A;  1T6Q A;  2LD6 A;  3M79 A;  3T6J A;  2R7S A;  1H9G A;  1WGW A;  1IZM A;  3LEV A;  3T6G B;  4EBB A;  2L6F A;  5BQI A;  2AP3 A;  1Y4C A;  1QQ3 A;  5COG A;  2QNL A;  3JTL O;  1C03 A;  1QVX A;  2W4M A;  3C63 A;  2IYL D;  4H4K C;  3RH3 A;  1OCO C;  4PFO A;  3T9O A;  3EGD A;  1M2V A;  1T01 A;  1AVO B;  1YYJ A;  4QI0 A;  1CGM E;  1H6G A;  1YLM A;  3RF3 A;  1CGN A;  2EPM X;  2NG1 A;  3RKO F;  3LLI A;  4LDR A;  3LAY A;  3KYJ A;  2L9J A;  2ZXW C;  2JPU A;  1V55 C;  3N0T A;  2EPL X;  5CI8 A;  2KSF A;  1BBH A;  4QDL A;  5EK0 A;  1GGQ A;  1NZE A;  2KW3 C;  2J9V A;  3I4U A;  3JCU Q;  3N24 A;  4MTF A;  2J46 A;  3U8V A;  1SF8 A;  3DM5 A;  2HSQ A;  3GEE A;  3MBG A;  4NTA A;  2GAQ A;  2YVK A;  3OEO A;  4LAC B;  2BC5 A;  3DM9 B;  3V7O A;  4DRI B;  4EBJ A;  1UG7 A;  4BJ5 C;  4D4N A;  2D4U A;  4DBR A;  4XPY A;  1MMD A;  1OCC C;  1OCR C;  4IJJ A;  3X1O A;  3FDQ A;  1MNE A;  3HJC A;  2H7V C;  3FAP B;  3AGU A;  5FZT A;  1ZU4 A;  3W4Y A;  2G3V A;  3ZQY A;  3SEO A;  4XEF A;  2NUP B;  2Y3B A;  3HLZ A;  3RQE A;  1Z3I X;  3NYJ A;  4CS8 C;  1NG1 A;  2NUT B;  3UMH A;  2V3C C;  5FCL A;  3AQB A;  3TUL A;  1TKN A;  4BPM A;  2P1A A;  5CIV A;  2A6E F;  2LCH A;  1T9K A;  3TD7 A;  3LNR A;  2XL4 A;  4YT5 A;  2YL7 A;  1D1B A;  1Q0D A;  2CNW A;  1RJ9 B;  4K7B A;  3ZDL A;  1ZHX A;  3VRC A;  5KYX B;  3ZQV A;  3FXH A;  4CS7 A;  1U89 A;  5DLJ A;  3U5S A;  3RVY A;  1ZW3 A;  2VC9 A;  1D1C A;  2OQM A;  2XSE A;  1NLX A;  2GDC A;  1PCX A;  1MMN A;  2YZS A;  3RVZ A;  3DXJ F;  5B3S C;  4DVY P;  3NMJ A;  2Q3T A;  5A6A A;  4IAR A;  2A68 F;  4A2N B;  3POV A;  1BR2 A;  4JCZ A;  4JTA B;  4BJ1 A;  1R4T A;  2CW0 F;  2Q4F A;  2XM0 A;  3G4X A;  2WVQ A;  3NKD A;  5L0F A;  1SMY F;  1WOL A;  1ZHY A;  4QI2 A;  1FR0 A;  4JCH A;  3IQ5 A;  5TJ5 E;  5KYU B;  2H8A A;  1RKE B;  2DI3 A;  3DI5 A;  3K1H A;  4MVZ A;  2YL3 A;  1IW7 F;  4JJF A;  4OD4 A;  5JP7 A;  1E84 A;  4KI2 A;  1U6H A;  3GWN A;  1K04 A;  3AJM A;  4HFK B;  4IB4 A;  3TJ5 A;  4ZLC A;  1WAS A;  1CPQ A;  2YKZ A;  2V26 A;  2J7P A;  4DBQ A;  2OEX A;  3ECS A;  3X2Q C;  4MW8 A;  3GM3 A;  3K1I C;  2HFI A;  2W4B A;  1SZI A;  2P61 A;  2YLI A;  4H54 A;  2OOC A;  2NSG A;  3IHU A;  4MVU A;  4N06 A;  2CGE A;  5T3W A;  2Y39 A;  4OIN F;  1WWP A;  2A1D D;  4JW1 A;  3SXY A;  3MLG A;  1WTY A;  2B0H A;  1ZHT A;  2KC3 A;  3M1C B;  1D1A A;  2LFF A;  4KBL A;  3G50 A;  2M64 A;  1OXB A;  4BJT A;  2HMZ A;  4E18 A;  2KGO A;  3JSZ A;  4G7H F;  2XM4 A;  2ZXR A;  3TQO A;  3S27 A;  3SZR A;  3WAQ A;  4BEM J;  4CDA A;  1MND A;  1A0B A;  1VYI A;  4AE4 B;  5EHH A;  4CSA A;  2EIM C;  2R02 A;  3LLK A;  3VYW A;  3JYH A;  3TK0 A;  4C7O B;  4YN0 B;  3IPM O;  2R9R B;  3H2V A;  1RKC A;  2PF4 E;  2FFH A;  2HJM A;  4FWV A;  4HEA J;  4WGZ A;  1HW1 A;  2DB4 A;  3JT1 A;  3L8I A;  1BDJ B;  1MMG A;  2A0B A;  3JRM O;  2LSE A;  2MHR A;  4Z9J A;  4CIH A;  3S0X A;  4ULW A;  1LI5 A;  3NKE A;  4W8K A;  2HMQ A;  3IQ6 A;  4ANJ A;  4CS9 A;  1M57 C;  1VOM A;  4KNW A;  3KMI A;  4G7O F;  2R05 A;  1A41 A;  4YT8 A;  5DS5 A;  2E87 A;  1A7V A;  4JC7 A;  1QSP A;  2BE5 F;  2CNW D;  3C18 A;  4YT2 A;  1OW8 A;  2ASR A;  3CEX A;  2R03 A;  5JUA A;  1TWA A;  1U0B B;  3JYY A;  3M4B A;  2G62 A;  2XXA A;  2ETS A;  1LE2 A;  1M2V B;  3EGD B;  4JRZ A;  4LLC A;  4O6N A;  3JSE O;  4WJ0 A;  5GPG B;  5AC4 A;  1BZ4 A;  2ZPA A;  3UGP A;  4DJ9 A;  1JMW A;  1PD0 A;  3DZA A;  5HSW A;  4Q4Z F;  3ATP A;  3FOP A;  4U5G A;  2IXN A;  3QTH A;  2B0J A;  3EH1 A;  1E86 A;  3WG7 C;  1NSG B;  4EKW A;  1APC A;  1HE1 A;  1TR2 A;  3Q7G A;  1HMO A;  4XEV A;  4XEK A;  5BQG A;  3SNH A;  256B A;  1KU2 A;  3V5Z A;  2QE9 A;  3PHF 2;  3A11 A;  2C04 A;  5BQH A;  3MYI A;  1LKX A;  1ZHW A;  4OIR F;  3EZI A;  1OR2 A;  1JRA A;  1RCP A;  2YWA A;  4N6H A;  3VM6 A;  1E83 A;  2IOQ A;  2YL0 A;  2KNH A;  2YRF A;  3V5Y A;  4CIP A;  3KPH A;  4AK9 A;  3SP1 A;  3N2Z B;  4XPX A;  4EBK A;  3GWL A;  4BG0 A;  3EFO A;  1YA7 O;  3DKA A;  4P6I C;  2XRH A;  1VMA A;  3F47 A;  3K33 A;  1DOV A;  4DRH B;  1EQ1 A;  2OJQ A;  1EI7 A;  3H65 A;  4WAB A;  3DD7 A;  2IXO A;  4BJ6 C;  2CCY A;  3HKK A;  3RQF A;  2G3K A;  1M6T A;  1SR2 A;  2H7B A;  1G4W R;  3CZ6 A;  4DOZ A;  1LI7 A;  1H9T A;  1TFK B;  4NTB A;  3DAG A;  3TJ6 A;  4MVM A;  4MND A;  3UMI A;  4J32 B;  5A6B A;  3GEH A;  3QVZ A;  1V74 B;  2WVO A;  5E33 A;  5JLI A;  5L0I A;  2HKV A;  3BEH A;  1LS1 A;  1Z5Z A;  3NMI A;  3MYF A;  1L7C A;  3K7D A;  4MVQ A;  4NCQ A;  5L3V A;  4Q5S F;  1W2W A;  3QW0 A;  4E0I A;  2R7V A;  4ONS A;  4C3D A;  1BR1 A;  1G8X A;  4U5D E;  4GQH A;  4FES A;  3IQT A;  1WN0 A;  4P9F A;  2L81 A;  1TFO B;  1YVI A;  2Q7R A;  3RYL A;  4OIO F;  2F22 A;  4PJL A;  3RIP A;  4LER A;  3AG2 C;  1K05 A;  3CSK A;  3B71 A;  3W2V A;  4A4A A;  1NFO A;  4DXW A;  1FFT C;  2FGY A;  4M63 A;  2WZG A;  4U5B E;  4IGG A;  1DOW A;  2OCC C;  5K0I A;  1TWH A;  3GEI A;  4O6Y A;  3FHD A;  2VCB A;  3R2P A;  4IWB A;  4E0H A;  2Y3D A;  2I15 A;  5L0G A;  3ZC4 A;  4CDV A;  4NQF A;  3EQL F;  1O3U A;  1XWJ A;  3OWT A;  2WL8 A;  4KC9 A;  5L0J A;  2PP4 A;  5DQT A;  1FMV A;  4U5H A;  5KYY A;  3Q6N A;  3PDM P;  1TWG A;  1ORJ A;  3OA1 A;  2KJG A;  3DAF A;  2WVN A;  4Q7C A;  4YJW A;  3ASO C;  4J7Y A;  4JEB A;  4C3B A;  2HUJ A;  3EG9 A;  1Q0M A;  1D0Z A;  2VH3 A;  3NYL A;  3O6X A;  2PFD A;  4IRU A;  3KYI A;  4RBN A;  3W8H A;  3ZG1 A;  1BR4 A;  2YLG A;  1Y6D A;  1YDI A;  3SXM A;  3SXK A;  1J8Y F;  4CX9 A;  1NU7 D;  1YZC A;  3U9J A;  3B29 A;  4XQ1 A;  2MYS A;  4AL0 A;  2R7X A;  4K0D A;  4PJJ A;  3L0I A;  4HE8 D;  3O55 A;  4BJ5 A;  4ZLD A;  1YAU O;  2TMV P;  4Z9I A;  3LNM B;  3EJN A;  2KK1 A;  2R7Q A;  1H7I A;  4C3E A;  3S28 A;  2IXP A;  3EGX A;  4D4X A;  3C8G A;  3ABM C;  3HNK A;  1OW7 A;  4CS8 A;  3NRH A;  1ZYR F;  2HV7 A;  5F5H A;  3F46 A;  4MS2 A;  1YJG A;  4JTD B;  5T3T A;  5BUO A;  3VAY A;  1VLT A;  1ZU5 A;  2LQG A;  1VB5 A;  5HV9 A;  2CYD A;  2YHS A;  1JOG A;  2XLM A;  4RD9 A;  3UR3 C;  5A6B D;  1OKK A;  3Q6M A;  2HSB A;  3ABL C;  5E2Q A;  2YEV A;  3GAN A;  4I3M A;  3UMK A;  3A9C A;  1LIH A;  3LUT B;  2VCC A;  3MX3 A;  1GM5 A;  3PCV A;  3M15 A;  2XXA B;  2VCA A;  2GWW A;  2EIJ C;  3KKB A;  5JS5 A;  3RQG A;  1EKY A;  1VK5 A;  1UFB A;  5DS6 A;  4K1O A;  4E17 A;  4I44 A;  3HTK C;  2Y3G A;  4U9E A;  4IAQ A;  2CDQ A;  4GYT A;  5D92 A;  3RW0 A;  5AC5 A;  2DGJ A;  3H2U A;  3LES A;  4EIY A;  2Q9A A;  2Q9B A;  3UGO A;  1K40 A;  4ER9 A;  3JRT A;  2RSE B;  4PAC A;  1ZVZ A;  2EPN A;  3U3B A;  1HMD A;  4MVS A;  4XLN F;  4NC3 A;  2Q00 A;  4CBE A;  4E7Z A;  4YL0 A;  3MFN A;  1XZP A;  3S29 A;  2BL2 A;  2ZXP A;  1GS9 A;  1LE4 A;  3K1I A;  4G0H A;  2EIK C;  2R7U A;  3SXZ A;  3ZTM A;  1ST6 A;  1PV3 A;  2A6H F;  1YZA A;  4IAO A;  3EFO B;  1B68 A;  3US6 A;  5KYW A;  2OKU A;  4YL1 A;  1KTM A;  1QLE C;  4JKV A;  4U5F E;  3QMK A;  1NU9 C;  3B0U X;  1Z23 A;  3ZVR A;  2JD3 A;  1V4A A;  3IQC A;  1ORS C;  1F1M A;  1T6I A;  2XS1 A;  1JR8 A;  2VAS A;  3UNG C;  2AVK A;  4U5E E;  2D5R B;  1TWC A;  3U0C A;  3KH2 A;  2P0N A;  3LJB A;  1XZQ A;  2J7P D;  5DQZ A;  1ORY A;  2GA0 A;  1OCZ C;  3NMK A;  2PX0 A;  3C7J A;  1TQG A;  2J9W A;  2W45 A;  2RD9 A;  3AGT A;  3C8G D;  5F28 E;  1FTS A;  2XLD A;  4J7T A;  4BEJ A;  4I1M A;  2PBE A;  3JZ0 A;  1YA9 A;  3NYM A;  1A7D A;  4LDK A;  5IY5 C;  2WB7 A;  3CAX A;  4JZA A;  4XPW A;  4AL1 A;  3WHN A;  4DVZ A;  1M56 C;  1LS4 A;  4XTK A;  4G7Z F;  2OG2 A;  3AQC A;  1N1C A;  1A7E A;  3ASN C;  1OKK D;  1CPR A;  2IBF A;  3LEO A;  4N6C A;  4HFF B;  2ZXO A;  4RDA A;  4YWQ A;  2XL8 A;  3C62 A;  3RFY A;  1V54 C;  3GM1 A;  1HW2 A;  5L3Q A;  2Y3H A;  4PR9 A;  2NSF A;  4EUK B;  3M4C A;  4P9T A;  3V5X A;  3ZSU A;  1MQV A;  2XLH A;  4JJG A;  1OR3 A;  2OU6 A;  2YLD A;  1Z7Q c;  5AGF A;  1MMA A;  3EHM A;  5COM A;  1YYX A;  5KYY B;  2A0U A;  1D0X A;  3O39 A;  4U9D A;  4B6I A;  5B3I A;  1O87 A;  1LVK A;  3EZH A;  5E3A A;  5JRA A;  4W8P A;  4MQ9 F;  3EG9 B;  3S90 A;  2ZD9 A;  4E7S A;  2L6G A;  2LIG A;  4MTO A;  1FFH A;  3SYN A;  2R7T A;  3ZIB A;  3FVY A;  3R7C A;  3HNJ A;  2JX0 A;  3EPV A;  2EIL C;  3QVY A;  3K66 A;  3TOM A;  1QZX A;  3C8Z A;  3ZTZ A;  2XLE A;  1SYQ A;  2X0C A;  3AG1 C;  3WOD F;  5L0D A;  5L0H A;  3FMS A;  4UDV A;  3VF0 A;  3EHN A;  1L3P A;  2AWC A;  3W2W A;  2DYS C;  1OXK A;  2ICW G;  4Z9H A;  2XLO A;  4PFP A;  3DJN B;  4I1O B;  2R7O A;  1E2X A;  2UUH A;  5DVW A;  4LDQ A;  3EGX B;  2IM8 A;  1S7Z A;  2L6H A;  3C8G B;  3E9V A;  2OJE D;  2PX3 A;  3DJU B;  3QZC A;  3L34 A;  4JVS A;  3U9M A;  3CQZ A;  4EHP A;  2R7W A;  1VTM P;  4JEA A;  3G4Z A;  3LS0 A;  1ZHZ A;  4BJ6 A;  3EH2 A;  5F5F A;  1Q0F A;  3DWW A;  1ZW2 A;  5JSL A;  1OQC A;  2KQ9 A;  3BRJ A;  1M2O A;  3TOL A;  1G5Z A;  2KYH A;  4NY3 A;  4YL3 A;  4OIQ F;  4OD5 A;  4MVO A;  1RMV A;  1D0Y A;  4CSA C;  3E70 C;  1VYK A;  3KL4 A;  3U8P A;  4WGY A;  1I5N A;  4XLP F;  2UUI A;  3IEE A;  3B0V C;  3O10 A;  1RXQ A;  1LPE A;  2XLV A;  3T4R A;  1J8M F;  3U2M A;  5E3C A;  4DRJ B;  3AOU A;  1T6U A;  1I4Y A;  2J0W A;  1AEP A;  2NPU A;  2NUP A;  3HNL A;  3I5Q A;  3S9O A;  5B1B C;  2GFH A;  1FMW A;  1LM3 B;  2LK4 A;  3AG3 C;  4G78 A;  2I8B A;  3NG1 A;  3GOD A;  2NUT A;  2YQY A;  1AUE A;  3U3F A;  1C17 M;  1KNY A;  2J8W A;  4CS9 C;  4OIP F;  2XL6 A;  4AX2 A;  2VB6 A;  2J9U A;  2PNO A;  3DMD A;  3QW1 A;  4CDY A;  3W8I A;  2L7A A;  1Q0K A;  1RJ9 A;  1Z63 A;  4FX5 A;  4U5C E;  5KYX A;  5L0C A;  2OEV A;  1NBB A;  4NTF A;  2O9X A;  4O79 A;  3T6B A;  5DS4 A;  2MWQ A;  4PJM A;  3S84 A;  2QLA A;  2Y69 C;  4PK4 A;  1G4U S;  2EPK X;  4O6M A;  1O5H A;  1I4Z A;  2EPO A;  1Z6A A;  2C03 A;  1ZZP A;  2H7O A;  2QTV A;  2X51 A;  3B0P A;  4JE9 A;  3AG4 C;  4ULV A;  4EWC A;  5KYW B;  2LP4 A;  1FAP B;  3GOR A;  2J45 A;  5D91 A;  1WAT A;  3FOO A;  3FAJ A;  5A6K A;  2HJ3 A;  3ITF A;  2A69 F;  2WZL A;  5JVE A;  2M4E A;  5KYU A;  3NDB B;  1QKR A;  1RKE A;  3DE8 A;  1QPU A;  1FNT c;  1EA8 A;  4KNV A;  4YK5 A;  1JPN A;  2EIN C;  2J9B A;  4O7G A;  2XS8 A;  4JTC B;  2R7R A;  1CGO A;  2R25 A;  5T1D B;  3GM2 A;  1T5O A;  4R32 A;  2HS5 A;  4MTG A;  5A69 A;  3K6B A;  1PD1 A;  4J30 B; 
#chains in the Genus database with same CATH homology
 2WZF A;  4XWJ A;  2W9Y A;  2QY9 A;  4JUR I;  1JPJ A;  4F4B A;  3Q7L A;  3I5P A;  3PMR A;  5B1A C;  3B9Q A;  5CI9 A;  5EGY A;  2J0X A;  4AE4 A;  2P7V A;  2Z15 A;  4X0R A;  4GEH A;  4C7O A;  5KYN A;  2IXM A;  2Q9C A;  2P6V A;  4PJN A;  3LS1 A;  2HV6 A;  3ABK C;  2DYR C;  4LLE A;  3T6J A;  1WGW A;  1IZM A;  3LEV A;  4EBB A;  2W4M A;  2IYL D;  4H4K C;  3RH3 A;  1OCO C;  4PFO A;  3EGD A;  1M2V A;  4QI0 A;  2NG1 A;  3RKO F;  3LLI A;  3LAY A;  2L9J A;  2ZXW C;  3N0T A;  1V55 C;  5CI8 A;  4QDL A;  1NZE A;  2KW3 C;  2J9V A;  3I4U A;  3JCU Q;  3N24 A;  2J46 A;  1SF8 A;  3DM5 A;  3OEO A;  4LAC B;  3V7O A;  3DM9 B;  4BJ5 C;  4DBR A;  1MMD A;  1OCC C;  1OCR C;  4IJJ A;  3X1O A;  3FDQ A;  1MNE A;  3HJC A;  2H7V C;  1ZU4 A;  2G3V A;  3SEO A;  2NUP B;  2Y3B A;  3HLZ A;  1Z3I X;  3NYJ A;  4CS8 C;  1NG1 A;  2NUT B;  3UMH A;  5FCL A;  3AQB A;  1TKN A;  2A6E F;  3TD7 A;  3LNR A;  2XL4 A;  4YT5 A;  1D1B A;  2CNW A;  4K7B A;  1RJ9 B;  1ZHX A;  5KYX B;  4CS7 A;  5DLJ A;  1D1C A;  2XSE A;  1PCX A;  1MMN A;  2YZS A;  3DXJ F;  5B3S C;  4DVY P;  2Q3T A;  2A68 F;  4A2N B;  3POV A;  1BR2 A;  4BJ1 A;  2CW0 F;  2WVQ A;  3NKD A;  1SMY F;  1ZHY A;  4QI2 A;  4JCH A;  5KYU B;  4OD4 A;  3K1H A;  1IW7 F;  4JJF A;  4KI2 A;  4HFK B;  4ZLC A;  2V26 A;  2J7P A;  4DBQ A;  3X2Q C;  3ECS A;  3K1I C;  2W4B A;  1SZI A;  5T3W A;  4N06 A;  2CGE A;  2Y39 A;  4OIN F;  2A1D D;  4JW1 A;  3MLG A;  1ZHT A;  3M1C B;  1D1A A;  4KBL A;  4BJT A;  2KGO A;  3JSZ A;  4G7H F;  2ZXR A;  3S27 A;  3SZR A;  1MND A;  1VYI A;  4AE4 B;  5EHH A;  4CSA A;  2EIM C;  3LLK A;  3VYW A;  3JYH A;  4C7O B;  4YN0 B;  2PF4 E;  2FFH A;  4FWV A;  4HEA J;  3JT1 A;  1MMG A;  2LSE A;  4CIH A;  3S0X A;  4ULW A;  3NKE A;  4W8K A;  4CS9 A;  4ANJ A;  1M57 C;  1VOM A;  4KNW A;  3KMI A;  4G7O F;  5DS5 A;  4YT8 A;  2E87 A;  2BE5 F;  2CNW D;  4YT2 A;  1TWA A;  2G62 A;  2XXA A;  3EGD B;  1M2V B;  4LLC A;  4WJ0 A;  4O6N A;  2ZPA A;  3UGP A;  1PD0 A;  5HSW A;  4Q4Z F;  4U5G A;  2IXN A;  2B0J A;  3EH1 A;  3WG7 C;  1TR2 A;  3Q7G A;  3SNH A;  1KU2 A;  3PHF 2;  2C04 A;  1LKX A;  1ZHW A;  4OIR F;  3EZI A;  2IOQ A;  2KNH A;  4AK9 A;  3SP1 A;  3N2Z B;  4BG0 A;  3EFO A;  4P6I C;  2XRH A;  1VMA A;  3F47 A;  3K33 A;  3H65 A;  3DD7 A;  2IXO A;  4BJ6 C;  2G3K A;  2H7B A;  3CZ6 A;  4DOZ A;  3DAG A;  3UMI A;  4MND A;  4J32 B;  2WVO A;  5E33 A;  1LS1 A;  1Z5Z A;  5L3V A;  3K7D A;  4Q5S F;  1W2W A;  2R7V A;  4C3D A;  1BR1 A;  1G8X A;  4U5D E;  4FES A;  2L81 A;  3RYL A;  4OIO F;  4PJL A;  3RIP A;  4LER A;  3AG2 C;  3CSK A;  3W2V A;  1FFT C;  2FGY A;  4M63 A;  2WZG A;  4U5B E;  2OCC C;  1TWH A;  4O6Y A;  3FHD A;  4IWB A;  2Y3D A;  3ZC4 A;  3EQL F;  3OWT A;  2WL8 A;  4KC9 A;  2PP4 A;  5DQT A;  1FMV A;  4U5H A;  5KYY A;  3Q6N A;  1TWG A;  3OA1 A;  2KJG A;  3DAF A;  2WVN A;  4Q7C A;  4YJW A;  3ASO C;  4C3B A;  3EG9 A;  4IRU A;  2VH3 A;  1D0Z A;  3NYL A;  4RBN A;  3O6X A;  2PFD A;  3W8H A;  3ZG1 A;  1BR4 A;  1J8Y F;  1NU7 D;  1PD1 A;  2MYS A;  2R7X A;  4K0D A;  4PJJ A;  3L0I A;  4HE8 D;  4BJ5 A;  4ZLD A;  3EJN A;  2R7Q A;  4C3E A;  3S28 A;  2IXP A;  3EGX A;  3ABM C;  4CS8 A;  3NRH A;  1ZYR F;  2HV7 A;  5F5H A;  3F46 A;  5T3T A;  5BUO A;  3VAY A;  1ZU5 A;  2YHS A;  4RD9 A;  3UR3 C;  1OKK A;  3Q6M A;  3ABL C;  5E2Q A;  2YEV A;  3GAN A;  4I3M A;  3UMK A;  3MX3 A;  2XXA B;  3KKB A;  2EIJ C;  1VK5 A;  5DS6 A;  4I44 A;  3HTK C;  2Y3G A;  2CDQ A;  4GYT A;  5D92 A;  2DGJ A;  3LES A;  2Q9A A;  2Q9B A;  3UGO A;  3JRT A;  4XLN F;  4CBE A;  4E7Z A;  3S29 A;  2ZXP A;  4G0H A;  2EIK C;  2R7U A;  1ST6 A;  2A6H F;  4IAO A;  5KYW A;  3EFO B;  1QLE C;  4U5F E;  3QMK A;  1NU9 C;  3B0U X;  1Z23 A;  3ZVR A;  2JD3 A;  2VAS A;  3UNG C;  4U5E E;  2D5R B;  1TWC A;  3KH2 A;  3LJB A;  5DQZ A;  2J7P D;  1OCZ C;  2PX0 A;  2J9W A;  2W45 A;  1FTS A;  4BEJ A;  4I1M A;  3NYM A;  5IY5 C;  2WB7 A;  4JZA A;  4DVZ A;  1M56 C;  4XTK A;  4G7Z F;  2OG2 A;  3AQC A;  1N1C A;  3ASN C;  1OKK D;  4RDA A;  4HFF B;  2ZXO A;  4YWQ A;  3RFY A;  1V54 C;  5L3Q A;  2Y3H A;  3ZSU A;  4JJG A;  1MMA A;  3EHM A;  5KYY B;  4B6I A;  1D0X A;  3O39 A;  1O87 A;  1LVK A;  3EZH A;  5E3A A;  4MQ9 F;  3EG9 B;  4E7S A;  1FFH A;  3SYN A;  2R7T A;  3ZIB A;  3FVY A;  3EPV A;  2EIL C;  3K66 A;  1QZX A;  3AG1 C;  3WOD F;  3W2W A;  3EHN A;  2DYS C;  4PFP A;  3DJN B;  4I1O B;  2R7O A;  5DVW A;  4YT4 A;  3EGX B;  1S7Z A;  3E9V A;  4JVS A;  2R7S A;  2PX3 A;  3DJU B;  3QZC A;  2R7W A;  3L34 A;  2V3C C;  3CQZ A;  3LS0 A;  1ZHZ A;  4BJ6 A;  3EH2 A;  5F5F A;  2KQ9 A;  1M2O A;  4NY3 A;  4OIQ F;  4OD5 A;  1D0Y A;  4CSA C;  3E70 C;  1VYK A;  3KL4 A;  4XLP F;  3IEE A;  3B0V C;  3T4R A;  1J8M F;  5E3C A;  2J0W A;  2NUP A;  3I5Q A;  5B1B C;  2GFH A;  1FMW A;  3AG3 C;  2NUT A;  2I8B A;  3NG1 A;  3GOD A;  4CS9 C;  4OIP F;  4AX2 A;  2VB6 A;  2J9U A;  3DMD A;  3W8I A;  1RJ9 A;  1Z63 A;  4FX5 A;  4U5C E;  5KYX A;  3T6B A;  4O79 A;  5DS4 A;  2O9X A;  2MWQ A;  4PJM A;  2Y69 C;  4PK4 A;  4O6M A;  1O5H A;  1Z6A A;  2C03 A;  2H7O A;  2X51 A;  2QTV A;  3B0P A;  4EWC A;  3AG4 C;  5KYW B;  5D91 A;  2J45 A;  3FAJ A;  3ITF A;  2A69 F;  2WZL A;  2M4E A;  5KYU A;  3NDB B;  4KNV A;  1JPN A;  2EIN C;  4O7G A;  2R7R A;  5T1D B;  3K6B A;  3DZA A;  4J30 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...