2XSEA

The structural basis for recognition of j-base containing dna by a novel dna-binding domain in jbp1
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
167
structure length
160
Chain Sequence
b'MVSTAVEKKKYLDSEFLLHCISAQLLDMWKQARARWLELVGKEWAHMLALNPERKDFLWKNQSEMNSAFFDLCEVGKQVMLGLLGKEVALPKEEQAFWIMYAVHLSAACAEELHMPEVAMSLRKLNVKLKDFNFDMPPEEKKRRMERKQRIEEARRHGMP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords THYMINE DIOXYGENASE JBP1
publication title The Structural Basis for Recognition of Base J Containing DNA by a Novel DNA Binding Domain in Jbp1.
pubmed doi rcsb
source organism Leishmania tarentolae
molecule tags Oxidoreductase
total genus 52
structure length 160
sequence length 167
ec nomenclature ec 1.14.11.6: Thymine dioxygenase.
pdb deposition date 2010-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18526 DB_JBP1 Thymine dioxygenase JBP1 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1440 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 2xseA00
2XSEA
chains in the Genus database with same CATH superfamily
2GWWA 5KYUA 3K1IA 4PR9A 4OINF 3U2LA 2E87A 2YL0A 2YL3A 4I44A 1H9GA 5L3QA 3ABKC 1KU2A 1C02A 2C04A 2AWYA 2WVQA 2YLDA 4J30B 4R32A 3UR3C 1OXBA 4LDKA 2A68F 5L0IA 2IXPA 1BZ4A 2D5RB 3QVZA 3POVA 4MTGA 2OKUA 2J9VA 2YRFA 3EZHA 1BR1A 2XLWA 1T5OA 3O55A 3EFOA 4CS8A 3AG1C 2W4MA 1RJ9A 3T6JA 5BUOA 3H2UA 3UGOA 2Q9CA 2ZXPA 2QLAA 3EG9A 3LS0A 3M79A 3DMDA 3RQGA 2XL4A 3ZWIA 2OEXA 4O79A 4D4NA 2J46A 1B68A 1OW8A 3WAQA 3OA1A 3U3BA 2J0WA 3HNLA 1HY5A 4M63A 1CGME 2KSFA 4XLPF 3DAGA 3B29A 4U5GA 3TOMA 1Q0FA 3FOPA 2HJ3A 4WGYA 1QPUA 4JW1A 5E2QA 1RKCA 1JRAA 3Q7GA 1VLSA 2L6HA 4JJGA 3RQEA 1WN0A 3TD7A 3L34A 4KNVA 4HFFB 3U5SA 3UMIA 4G7OF 2C03A 1Y4CA 2XRHA 1S7ZA 4CX9A 2R7RA 3CQZA 3X1OA 1A7VA 4J32B 2X51A 2DI3A 5F28E 3ABLC 3MLGA 5T1DB 2P61A 4CS7A 2HMZA 1PV3A 1C17M 3OEOA 4AX2A 3ASNC 3ZTMA 3AQBA 1BBHA 2PF4E 1WWPA 3RF3A 3GORA 1OW7A 2R7TA 4K0DA 4MTOA 1K05A 1G8XA 1SR2A 1XWJA 2J7PA 2LIGA 2NSGA 3T4RA 3V5YA 4CIPA 3GEHA 4IRUA 3U2MA 2MYSA 2EILC 5A6BA 2J45A 4U5BE 1HW1A 3LLKA 3DE8A 1LI5A 3JT1A 3S0XA 1RKEB 256BA 4JZAA 3EGDA 4XTKA 3U9JA 3X2QC 1VOMA 4B6IA 3MFNA 4C7OA 5E3AA 2R7XA 2BL2A 3BRJA 3EJNA 1ZHWA 2QE9A 3FVYA 5E3CA 3I5PA 5T3WA 4MVQA 5BQIA 5BQHA 1FNTc 3WG7C 3LS1A 1FR0A 5JT4A 3C8GB 4EBJA 2WZFA 4PJNA 4XPYA 4YT4A 2JD3A 3KYIA 1HE1A 3FDQA 2YQYA 2YEVA 1D0ZA 1Y6DA 1RKEA 2DYSC 1EKYA 2B0JA 3R2PA 3TK0A 2Y39A 1I4YA 4PJMA 5COFA 5DS5A 3JRMO 2IXNA 3HKKA 3MYFA 3QVYA 2WVNA 3K6BA 1FFHA 3SNHA 1QVXA 4CJOA 1LVKA 5B3IA 4KC9A 1YA7O 4FX5A 1LIHA 2DB4A 3GWNA 5KYYA 2XXAB 2J8WA 2VASA 3GM3A 1E83A 1G4US 3G4XA 2Z15A 3G50A 1WTYA 2IYLD 3IQTA 2W45A 2YVKA 1V4AA 3DI5A 3NRHA 1OKKD 2DYRC 2IXMA 4EBBA 4P9TA 4OD4A 4BEJA 1I4ZA 1SF8A 1VK5A 2B0HA 4Z9HA 5JUAA 3LAYA 3TOLA 4Q4ZF 3SXYA 3W2WA 2NUTB 2WZGA 4NC3A 4OIQF 3NDBB 1ZHYA 2YL1A 2HSQA 2KC3A 2RSEB 2YKZA 3UNGC 4BJTA 2VH3A 2FAPB 4CDAA 1Q0MA 2Q9AA 2XXAA 1ORJA 2HS5A 1LKXA 2D4UA 3C18A 3HJCA 2VC9A 4U5EE 2XLOA 3EH2A 2HFIA 5L0GA 1Z6AA 4BJ6C 1V54C 2P1AA 2HMQA 3M15A 4KBLA 4O6MA 4P6IC 5EK0A 3RW0A 1A0BA 1E84A 4JTCB 3WODF 1V74B 2ZD9A 2LCHA 4PACA 4Z9JA 5TJ5E 1JAFA 3RVYA 4C3EA 3IQ5A 4U5DE 2A69F 1N1CA 4FWVA 4JJFA 4BJ1A 4IAOA 3WHNA 3ITFA 2IOQA 2IXOA 3G4ZA 3LUTB 2VCBA 4H54A 3DJNB 1QZXA 4N06A 1LS1A 3EGXB 1CPQA 4J7YA 4DVZA 4E7SA 1MMNA 1WOLA 4QDLA 1KNYA 1ORYA 1Q0GA 3GM2A 1TQGA 5CIVA 3PDMP 2ZXWC 3DE9A 2F22A 3DM5A 2XL6A 3MYIA 1QQ3A 4ZLCA 1GGQA 3W8HA 2QY9A 3FAPB 4ZLDA 4DOZA 3OWTA 3NMKA 3U9MA 3UGPA 3W4YA 4NTAA 1TWAA 3AG4C 1A41A 4XWJA 2L81A 4OIOF 3GODA 2LQGA 5A6KA 1UFBA 5T3TA 2VCCA 4MVRA 3B0UX 1R4TA 1APCA 4G0HA 1J8YF 3HNKA 3L8JA 4NTBA 2BC5A 4OIPF 4U5HA 1T6UA 1JR8A 2ETSA 4DVYP 1L3PA 2NUPA 4GQHA 4NCQA 3AJMA 4XEVA 3KL4A 1PD0A 1D0YA 3LNRA 3UMHA 1EI7A 3S29A 4CDVA 5EHHA 2LSEA 1M2OA 4JTDB 2TMVP 3HNIA 1MNEA 2GFHA 2PFDA 1CGOA 2HKVA 1EA8A 3GM1A 3GEIA 4Z9IA 1A7EA 2HV6A 2NSFA 1TKNA 4HEAJ 4KI2A 2AWCA 2ZXRA 1RXQA 1PCXA 4NY3A 5A6BD 4YL3A 3JTLO 2KYHA 2M64A 3M4CA 1LE2A 4YWQA 1AEPA 1D1AA 2XL8A 3S90A 2A0BA 5DVWA 4RDAA 2L9JA 2A1DD 2KW3C 1PD1A 4ULVA 5A6AA 1TR2A 1LI7A 2WZLA 2EPNA 4MVOA 3N2ZB 4PJLA 4XPXA 1OR2A 4E7ZA 1NU9C 2Q00A 5A69A 3EH1A 1ZU4A 1OCOC 3EPVA 3K7DA 4LACB 3KH2A 1F1MA 4AE4B 4BPMA 1HMOA 3ABMC 3O6XA 2CW0F 2XM4A 3RKOF 1NBBA 5A6JA 1Q0KA 2R7UA 2XM0A 3B71A 1YDIA 2H7OA 3DJUB 3FAJA 4YK5A 5DS4A 1T01A 2XS8A 3U8VA 2UUIA 3JCUQ 4YT5A 3SP1A 3AGUA 1G5ZA 3DKAA 3LEOA 3T6BA 4K7BA 2R7SA 2KJGA 4G78A 1KTMA 3LLIA 3NKDA 2QUPA 2JX0A 2EPLX 5L0CA 2CYDA 3K66A 1ZW2A 5BQGA 1EQ1A 5HSWA 1FAPB 1TWHA 2UUHA 1U6HA 5F5HA 1OXKA 1VB5A 1Q0DA 3B9QA 2G3VA 1NFNA 3QW0A 4PK4A 5L3VA 2VCAA 4WGZA 3KMIA 1YYJA 1MMDA 2MHRA 1NG1A 3BEHA 4MW3A 3AG3C 4XEKA 2Y3DA 1Z3IX 1QLEC 3V5XA 2FGYA 2QTVA 1VTMP 2WVOA 3SXKA 4KNWA 3DWWA 3PHF2 1IZMA 4E17A 4C3DA 4G7HF 2R9RB 4CS9C 3C8GA 5L0HA 2YLIA 1OCRC 1LM3B 4E0HA 1FMWA 2ICWG 4HFKB 4H4KC 1YA9A 1M6TA 3US6A 5DS6A 1K04A 3ASOC 4I3MA 1JOGA 4E0IA 3ZVRA 5IY5C 2XLEA 2P7VA 5JP7A 4AK9A 1H7IA 1M56C 4LERA 2WL8A 3DXJF 5JSLA 1YZAA 2P6VA 4A2NB 3E9VA 2JPUA 2YL7A 4MW8A 3W2VA 2YLGA 3T6GB 4DRHB 4JC7A 4GYTA 2OOCA 2KK1A 1YJGA 4MNDA 5JS5A 2W9YA 4C3BA 2CDQA 3E70C 1TFKB 4JKVA 5GPGB 1FTSA 2FFHA 1RCPA 2A0UA 2Y3GA 3AOUA 1C03A 5COGA 3NMIA 3LEVA 4J7TA 3RVZA 3M4BA 4DBRA 3TJ5A 4QI2A 2NUTA 1VMAA 4IJJA 1V55C 4EKWA 1HW2A 2EIMC 2R02A 1LPEA 2XSEA 1LE4A 4F4BA 4AL0A 4MTFA 4BJ6A 1ZYRF 1OW6A 4RBNA 5CI8A 3ZQYA 1YARO 3SXZA 4O7GA 4N4WA 3CAXA 1L7CA 2H7VC 3NKEA 4DXWA 2LP4A 3I4UA 4LLCA 1M2VB 2CGEA 3HLZA 1IW7F 4IARA 4MVUA 1LS4A 1YAUO 1BR2A 1JPJA 3FMSA 2J9WA 3O39A 3DM9B 2G3KA 4U9DA 3J06A 3QMKA 3ECSA 2H8AA 4XQ1A 1NLXA 1HMDA 1ZVZA 5B1BC 1HE9A 1M57C 1ZHZA 3VRCA 5AC5A 5AC4A 1U0BB 1SZIA 4X0RA 4ANJA 2J9UA 3NG1A 4JE9A 4U5FE 5KYNA 4QI0A 1VLTA 3SEOA 2IBFA 3EGXA 3M1CB 4BEMJ 2V3CC 2YHSA 2GDCA 3A11A 1AVOB 3EQLF 5KYUB 5KYWB 5DLJA 2XLVA 2Q9BA 3LESA 3QZCA 3VAYA 5JVEA 4CSAC 5EGYA 3RQFA 3CZ6A 4ULWA 3KYJA 4WJ0A 3IPMO 3NYMA 4JURI 3L8IA 4JTAB 4DBQA 2PX0A 1E2XA 2XS1A 4YT2A 2I8BA 3DD7A 3IHUA 2X0CA 5F5FA 1BDJB 4YL1A 5HV9A 2OEVA 3HTKC 2LFFA 4I1MA 3EFOB 1OCZC 2P0NA 2NG1A 2M4EA 1RJ9B 2Q4FA 3KPHA 4XLNF 4U9EA 1TFOB 2PNOA 4HE8D 4CJGA 2J7PD 3EG9B 1OCCC 2A6HF 4CS8C 5KYWA 4YT8A 1FMVA 1I5NA 4Q5SF 2W4BA 1W2WA 4P9FA 1JPNA 4YJWA 4EUKB 2OQMA 4PJJA 1ZW3A 2EINC 1OQCA 1O87A 3ATPA 1ZHXA 1SYQA 2QNLA 3ZG1A 3JYYA 3U3FA 2V26A 2CNWA 4YN0B 2OU6A 1D0XA 1D1CA 3MBGA 4IB4A 3K1HA 1T6IA 4XPWA 2H7BA 4MVSA 2J0XA 2OCCC 1E85A 1CPRA 4W8KA 2OJQA 1A7DA 3MX3A 2HSBA 1MQVA 5K0IA 4LDRA 4N6HA 2Q7RA 5DQTA 4LLEA 3ZTZA 3B0VC 1NZEA 4UDVA 1MMGA 1H6GA 2KNHA 3Q6NA 3EZIA 3VM6A 2DGJA 3FXHA 1K40A 3I5QA 4OIRF 2OJED 3Q7LA 4CDYA 4EWCA 3GWLA 4IAQA 3S84A 5JLIA 2R25A 1Z5ZA 2ASRA 3C8GD 3C7JA 5D91A 4AE4A 2HUJA 1BR4A 2YWAA 3IQCA 3EGDB 4O6YA 4C7OB 5COMA 5B1AC 2L7AA 3F46A 5L0FA 1NSGB 3CEXA 3ZSUA 1CGNA 1YLMA 1ORSC 1XZPA 3FOOA 3C8ZA 3DZAA 1WGWA 4AL1A 3AQCA 4EHPA 2R03A 3TJ6A 4XEFA 2I15A 3PMRA 2KGOA 3TQOA 1YZCA 4K1OA 3R7CA 3TULA 4EBKA 1GS9A 1ZU5A 2PP4A 3AGTA 3LNMB 3NMJA 3S9OA 2GAQA 1WATA 2RD9A 2Y69C 5D92A 4W8PA 2HV7A 4G7ZF 1YVIA 4L6RA 1Z23A 3JZ0A 3V7OA 1UG7A 2EPOA 2WB7A 3F47A 2EPKX 3U8PA 3L1MA 4E18A 1RMVA 3U0CA 3JYHA 1H9TA 2J9BA 2AVKA 2R7OA 1R5ID 5L0JA 4JIOA 5JRAA 1T9KA 3FHDA 3N0TA 4BJ5C 5KYYB 1DOVA 5KYXB 3JSZA 3DAFA 4FAPB 3S28A 2LFDA 3ZQVA 1YYXA 2R7WA 4CS9A 3VF0A 1O5HA 4O6NA 4A4AA 2KQ9A 1WASA 2NPUA 3O10A 1J8MF 2L6GA 4IGGA 3QTHA 3EHNA 3PCVA 1ST6A 4JRZA 5AGFA 4BJ5A 4DRJB 4CIHA 2EIJC 5FZTA 4Q7CA 3QW1A 4LDQA 4MQ9F 3T9OA 3ZDLA 2R05A 3H2VA 3S27A 5KYXA 1AUEA 4FESA 4JCZA 1G4WR 2GA0A 4RD9A 3N24A 2YZSA 1ZZPA 2OG2A 3UMKA 3HNJA 1E86A 2MWQA 4WABA 1SMYF 3LJBA 1O3UA 3RFYA 3C63A 1Z7Qc 3ZIBA 2PX3A 3NYJA 4EIYA 2XLMA 3SZRA 1T6QA 3JRTA 2EIKC 4N6CA 1MNDA 2O9XA 1JMWA 2EPMX 4U5CE 3SYNA 3SXMA 1NFOA 2L6FA 5E33A 3ZC4A 1VYIA 3JSEO 4JVSA 1Z63A 4MS2A 2AP3A 2VB6A 4ER9A 2HZ8A 2R7QA 2XLDA 4MVZA 4D4XA 2XLHA 1MMAA 3KKBA 1TWCA 3NYLA 3RIPA 4DJ9A 1NU7D 2IM8A 2Q3TA 4JEAA 4PFOA 5DQZA 1GM5A 4IWBA 2ZPAA 3EHMA 4NTFA 2BE5F 2G62A 4OD5A 1VYKA 1DOWA 2Y3HA 3C62A 4I1OB 4JEBA 1OKKA 4MVMA 5CI9A 4BG0A 4CBEA 2CCYA 3W8IA 3A9CA 3H65A 1OR3A 5B3SC 1M2VA 4JCHA 2PBEA 1TWGA 3GANA 3IEEA 3L0IA 4DRIB 2ZXOA 2LK4A 3K1IC 2A6EF 2CNWD 3GEEA 3B0PA 3IQ6A 2LD6A 4ONSA 1GQAA 3RYLA 5L0DA 4GEHA 2AU5A 3K33A 1D1BA 1ZHTA 3VYWA 1FFTC 1QKRA 2R7VA 1U89A 5FCLA 1QSPA 2HJMA 3Q6MA 1S05A 2NUPB 4NQFA 1XZQA 3AG2C 3CSKA 4PFPA 3V5ZA 2Y3BA 3RH3A 4YL0A 4CSAA
chains in the Genus database with same CATH topology
5KYUA 4OINF 2E87A 4I44A 3ABKC 1KU2A 2C04A 2WVQA 3UR3C 4J30B 2A68F 2IXPA 2D5RB 3POVA 2J9VA 3EZHA 1BR1A 4CS8A 3EFOA 3AG1C 2W4MA 1RJ9A 3T6JA 5BUOA 3UGOA 2Q9CA 2ZXPA 3EG9A 3LS0A 3DMDA 2XL4A 4O79A 2J46A 3OA1A 2J0WA 4M63A 4XLPF 3DAGA 4U5GA 4JW1A 5E2QA 3Q7GA 4JJGA 3TD7A 3L34A 4KNVA 4HFFB 3UMIA 4G7OF 2C03A 2R7RA 2XRHA 1S7ZA 3CQZA 3X1OA 4J32B 2X51A 3ABLC 3MLGA 5T1DB 4CS7A 3OEOA 4AX2A 3ASNC 3AQBA 2PF4E 2R7TA 4K0DA 1G8XA 2J7PA 3T4RA 4IRUA 2MYSA 2EILC 2J45A 4U5BE 3LLKA 3JT1A 3S0XA 4JZAA 4XTKA 4B6IA 3EGDA 4C7OA 2R7XA 3X2QC 1VOMA 5E3AA 3EJNA 1ZHWA 3FVYA 5E3CA 3I5PA 5T3WA 3WG7C 3LS1A 2WZFA 4PJNA 4YT4A 2JD3A 3FDQA 2YEVA 1D0ZA 2DYSC 2B0JA 2Y39A 4PJMA 5DS5A 2IXNA 2WVNA 3K6BA 1FFHA 3SNHA 1LVKA 4KC9A 4FX5A 5KYYA 2XXAB 2VASA 2Z15A 2IYLD 2W45A 3NRHA 1OKKD 2DYRC 2IXMA 4EBBA 4OD4A 4BEJA 1SF8A 1VK5A 3LAYA 4Q4ZF 3W2WA 4OIQF 2NUTB 2WZGA 3NDBB 1ZHYA 4BJTA 3UNGC 2VH3A 2XXAA 2Q9AA 4U5EE 1LKXA 3HJCA 3EH2A 1Z6AA 4BJ6C 1V54C 4O6MA 4KBLA 4P6IC 3WODF 4C3EA 4U5DE 2A69F 1N1CA 4FWVA 4JJFA 4BJ1A 4IAOA 3ITFA 2IOQA 2IXOA 3DJNB 1QZXA 4N06A 1LS1A 3EGXB 4DVZA 4E7SA 1MMNA 4QDLA 2ZXWC 3DM5A 4ZLCA 3W8HA 2QY9A 4ZLDA 4DOZA 3OWTA 3UGPA 1TWAA 3AG4C 4XWJA 2L81A 4OIOF 3GODA 5T3TA 3B0UX 4G0HA 1J8YF 4OIPF 4U5HA 4DVYP 2NUPA 3KL4A 1PD0A 1D0YA 3LNRA 3UMHA 3S29A 5EHHA 2LSEA 1M2OA 1MNEA 2GFHA 2PFDA 4KI2A 2HV6A 4HEAJ 1TKNA 2ZXRA 4NY3A 1PCXA 4YWQA 1D1AA 5DVWA 4RDAA 2L9JA 2A1DD 2KW3C 1PD1A 1TR2A 2WZLA 3N2ZB 4PJLA 4E7ZA 1NU9C 3EH1A 1ZU4A 1OCOC 3EPVA 3K7DA 4LACB 3KH2A 4AE4B 3ABMC 3O6XA 2CW0F 3RKOF 2R7UA 3DJUB 2H7OA 3FAJA 5DS4A 3JCUQ 4YT5A 3SP1A 3T6BA 4K7BA 2R7SA 2KJGA 3LLIA 3NKDA 3K66A 5HSWA 1TWHA 5F5HA 3B9QA 2G3VA 4PK4A 5L3VA 3KMIA 1MMDA 1NG1A 3AG3C 2Y3DA 1Z3IX 1QLEC 2FGYA 2QTVA 2WVOA 4KNWA 3PHF2 1IZMA 4G7HF 4C3DA 4CS9C 1OCRC 1FMWA 4HFKB 4H4KC 5DS6A 3ASOC 4I3MA 5IY5C 3ZVRA 2P7VA 4AK9A 1M56C 4LERA 2WL8A 3DXJF 2P6VA 4A2NB 3E9VA 3W2VA 4MNDA 4GYTA 2W9YA 4C3BA 2CDQA 3E70C 1FTSA 2FFHA 2Y3GA 3LEVA 4QI2A 4DBRA 2NUTA 1VMAA 4IJJA 1V55C 2EIMC 2XSEA 4F4BA 4BJ6A 1ZYRF 4RBNA 5CI8A 4O7GA 2H7VC 3NKEA 3I4UA 4LLCA 1M2VB 2CGEA 3HLZA 1IW7F 1BR2A 1JPJA 3O39A 2J9WA 3DM9B 2G3KA 3QMKA 3ECSA 5B1BC 1M57C 1ZHZA 1SZIA 4X0RA 4ANJA 2J9UA 3NG1A 4U5FE 5KYNA 4QI0A 3SEOA 3EGXA 3M1CB 2V3CC 2YHSA 3EQLF 5KYUB 5KYWB 5DLJA 3LESA 2Q9BA 3VAYA 3QZCA 4CSAC 5EGYA 3CZ6A 4ULWA 4WJ0A 3NYMA 4JURI 4DBQA 2PX0A 4YT2A 2I8BA 3DD7A 5F5FA 3HTKC 4I1MA 3EFOB 1OCZC 4XLNF 2NG1A 2M4EA 1RJ9B 4HE8D 2J7PD 3EG9B 1OCCC 2A6HF 4CS8C 5KYWA 4YT8A 1FMVA 2W4BA 1W2WA 4YJWA 1JPNA 4PJJA 2EINC 1O87A 1ZHXA 3ZG1A 2V26A 2CNWA 4YN0B 1D0XA 1D1CA 3K1HA 2H7BA 2J0XA 2OCCC 4W8KA 3MX3A 5DQTA 4LLEA 3B0VC 1NZEA 1MMGA 3Q6NA 2KNHA 3EZIA 2DGJA 4OIRF 3I5QA 3Q7LA 4EWCA 1Z5ZA 4AE4A 5D91A 1BR4A 4O6YA 3EGDB 4C7OB 5B1AC 3F46A 3ZSUA 3DZAA 1WGWA 3AQCA 3PMRA 2KGOA 1ZU5A 2PP4A 4G7ZF 2Y69C 5D92A 2HV7A 1Z23A 3V7OA 2WB7A 3F47A 3JYHA 2R7OA 3N0TA 3FHDA 4BJ5C 5KYYB 5KYXB 3JSZA 3DAFA 3S28A 2R7WA 4CS9A 1O5HA 4O6NA 2KQ9A 1J8MF 4BJ5A 3EHNA 4CIHA 1ST6A 2EIJC 4Q7CA 4MQ9F 3S27A 5KYXA 4FESA 4RD9A 3N24A 2YZSA 2OG2A 3UMKA 2MWQA 1SMYF 3LJBA 3RFYA 3ZIBA 2PX3A 3NYJA 3SZRA 3JRTA 2EIKC 4U5CE 1MNDA 2O9XA 3SYNA 5E33A 3ZC4A 1VYIA 4JVSA 1Z63A 2VB6A 2R7QA 1MMAA 3KKBA 1TWCA 3NYLA 3RIPA 1NU7D 2Q3TA 4PFOA 5DQZA 4IWBA 2ZPAA 3EHMA 2BE5F 2G62A 4OD5A 1VYKA 2Y3HA 4I1OB 1OKKA 5CI9A 4BG0A 4CBEA 3W8IA 3H65A 5B3SC 1M2VA 4JCHA 1TWGA 3GANA 3IEEA 3L0IA 2ZXOA 3K1IC 2A6EF 2CNWD 5L3QA 3B0PA 4Q5SF 3RYLA 4GEHA 3K33A 1D1BA 1ZHTA 3VYWA 1FFTC 2R7VA 5FCLA 3Q6MA 2NUPB 3AG2C 3CSKA 4PFPA 2Y3BA 3RH3A 4CSAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XSE A; 
#chains in the Genus database with same CATH topology
 2GWW A;  5KYU A;  3K1I A;  4PR9 A;  4OIN F;  3U2L A;  2E87 A;  2YL0 A;  2YL3 A;  4I44 A;  1H9G A;  5L3Q A;  3ABK C;  1KU2 A;  1C02 A;  2C04 A;  2AWY A;  2WVQ A;  2YLD A;  4J30 B;  4R32 A;  3UR3 C;  1OXB A;  4LDK A;  2A68 F;  5L0I A;  2IXP A;  1BZ4 A;  2D5R B;  3QVZ A;  3POV A;  4MTG A;  2OKU A;  2J9V A;  2YRF A;  3EZH A;  1BR1 A;  2XLW A;  1T5O A;  3O55 A;  3EFO A;  4CS8 A;  3AG1 C;  2W4M A;  1RJ9 A;  3T6J A;  5BUO A;  3H2U A;  3UGO A;  2Q9C A;  2ZXP A;  2QLA A;  3EG9 A;  3LS0 A;  3M79 A;  3DMD A;  3RQG A;  2XL4 A;  3ZWI A;  2OEX A;  4O79 A;  4D4N A;  2J46 A;  1B68 A;  1OW8 A;  3WAQ A;  3OA1 A;  3U3B A;  2J0W A;  3HNL A;  1HY5 A;  4M63 A;  1CGM E;  2KSF A;  4XLP F;  3DAG A;  3B29 A;  4U5G A;  3TOM A;  1Q0F A;  3FOP A;  2HJ3 A;  4WGY A;  1QPU A;  4JW1 A;  5E2Q A;  1RKC A;  1JRA A;  3Q7G A;  1VLS A;  2L6H A;  4JJG A;  3RQE A;  1WN0 A;  3TD7 A;  3L34 A;  4KNV A;  4HFF B;  3U5S A;  3UMI A;  4G7O F;  2C03 A;  1Y4C A;  2XRH A;  1S7Z A;  4CX9 A;  2R7R A;  3CQZ A;  3X1O A;  1A7V A;  4J32 B;  2X51 A;  2DI3 A;  5F28 E;  3ABL C;  3MLG A;  5T1D B;  2P61 A;  4CS7 A;  2HMZ A;  1PV3 A;  1C17 M;  3OEO A;  4AX2 A;  3ASN C;  3ZTM A;  3AQB A;  1BBH A;  2PF4 E;  1WWP A;  3RF3 A;  3GOR A;  1OW7 A;  2R7T A;  4K0D A;  4MTO A;  1K05 A;  1G8X A;  1SR2 A;  1XWJ A;  2J7P A;  2LIG A;  2NSG A;  3T4R A;  3V5Y A;  4CIP A;  3GEH A;  4IRU A;  3U2M A;  2MYS A;  2EIL C;  5A6B A;  2J45 A;  4U5B E;  1HW1 A;  3LLK A;  3DE8 A;  1LI5 A;  3JT1 A;  3S0X A;  1RKE B;  256B A;  4JZA A;  3EGD A;  4XTK A;  3U9J A;  3X2Q C;  1VOM A;  4B6I A;  3MFN A;  4C7O A;  5E3A A;  2R7X A;  2BL2 A;  3BRJ A;  3EJN A;  1ZHW A;  2QE9 A;  3FVY A;  5E3C A;  3I5P A;  5T3W A;  4MVQ A;  5BQI A;  5BQH A;  1FNT c;  3WG7 C;  3LS1 A;  1FR0 A;  5JT4 A;  3C8G B;  4EBJ A;  2WZF A;  4PJN A;  4XPY A;  4YT4 A;  2JD3 A;  3KYI A;  1HE1 A;  3FDQ A;  2YQY A;  2YEV A;  1D0Z A;  1Y6D A;  1RKE A;  2DYS C;  1EKY A;  2B0J A;  3R2P A;  3TK0 A;  2Y39 A;  1I4Y A;  4PJM A;  5COF A;  5DS5 A;  3JRM O;  2IXN A;  3HKK A;  3MYF A;  3QVY A;  2WVN A;  3K6B A;  1FFH A;  3SNH A;  1QVX A;  4CJO A;  1LVK A;  5B3I A;  4KC9 A;  1YA7 O;  4FX5 A;  1LIH A;  2DB4 A;  3GWN A;  5KYY A;  2XXA B;  2J8W A;  2VAS A;  3GM3 A;  1E83 A;  1G4U S;  3G4X A;  2Z15 A;  3G50 A;  1WTY A;  2IYL D;  3IQT A;  2W45 A;  2YVK A;  1V4A A;  3DI5 A;  3NRH A;  1OKK D;  2DYR C;  2IXM A;  4EBB A;  4P9T A;  4OD4 A;  4BEJ A;  1I4Z A;  1SF8 A;  1VK5 A;  2B0H A;  4Z9H A;  5JUA A;  3LAY A;  3TOL A;  4Q4Z F;  3SXY A;  3W2W A;  2NUT B;  2WZG A;  4NC3 A;  4OIQ F;  3NDB B;  1ZHY A;  2YL1 A;  2HSQ A;  2KC3 A;  2RSE B;  2YKZ A;  3UNG C;  4BJT A;  2VH3 A;  2FAP B;  4CDA A;  1Q0M A;  2Q9A A;  2XXA A;  1ORJ A;  2HS5 A;  1LKX A;  2D4U A;  3C18 A;  3HJC A;  2VC9 A;  4U5E E;  2XLO A;  3EH2 A;  2HFI A;  5L0G A;  1Z6A A;  4BJ6 C;  1V54 C;  2P1A A;  2HMQ A;  3M15 A;  4KBL A;  4O6M A;  4P6I C;  5EK0 A;  3RW0 A;  1A0B A;  1E84 A;  4JTC B;  3WOD F;  1V74 B;  2ZD9 A;  2LCH A;  4PAC A;  4Z9J A;  5TJ5 E;  1JAF A;  3RVY A;  4C3E A;  3IQ5 A;  4U5D E;  2A69 F;  1N1C A;  4FWV A;  4JJF A;  4BJ1 A;  4IAO A;  3WHN A;  3ITF A;  2IOQ A;  2IXO A;  3G4Z A;  3LUT B;  2VCB A;  4H54 A;  3DJN B;  1QZX A;  4N06 A;  1LS1 A;  3EGX B;  1CPQ A;  4J7Y A;  4DVZ A;  4E7S A;  1MMN A;  1WOL A;  4QDL A;  1KNY A;  1ORY A;  1Q0G A;  3GM2 A;  1TQG A;  5CIV A;  3PDM P;  2ZXW C;  3DE9 A;  2F22 A;  3DM5 A;  2XL6 A;  3MYI A;  1QQ3 A;  4ZLC A;  1GGQ A;  3W8H A;  2QY9 A;  3FAP B;  4ZLD A;  4DOZ A;  3OWT A;  3NMK A;  3U9M A;  3UGP A;  3W4Y A;  4NTA A;  1TWA A;  3AG4 C;  1A41 A;  4XWJ A;  2L81 A;  4OIO F;  3GOD A;  2LQG A;  5A6K A;  1UFB A;  5T3T A;  2VCC A;  4MVR A;  3B0U X;  1R4T A;  1APC A;  4G0H A;  1J8Y F;  3HNK A;  3L8J A;  4NTB A;  2BC5 A;  4OIP F;  4U5H A;  1T6U A;  1JR8 A;  2ETS A;  4DVY P;  1L3P A;  2NUP A;  4GQH A;  4NCQ A;  3AJM A;  4XEV A;  3KL4 A;  1PD0 A;  1D0Y A;  3LNR A;  3UMH A;  1EI7 A;  3S29 A;  4CDV A;  5EHH A;  2LSE A;  1M2O A;  4JTD B;  2TMV P;  3HNI A;  1MNE A;  2GFH A;  2PFD A;  1CGO A;  2HKV A;  1EA8 A;  3GM1 A;  3GEI A;  4Z9I A;  1A7E A;  2HV6 A;  2NSF A;  1TKN A;  4HEA J;  4KI2 A;  2AWC A;  2ZXR A;  1RXQ A;  1PCX A;  4NY3 A;  5A6B D;  4YL3 A;  3JTL O;  2KYH A;  2M64 A;  3M4C A;  1LE2 A;  4YWQ A;  1AEP A;  1D1A A;  2XL8 A;  3S90 A;  2A0B A;  5DVW A;  4RDA A;  2L9J A;  2A1D D;  2KW3 C;  1PD1 A;  4ULV A;  5A6A A;  1TR2 A;  1LI7 A;  2WZL A;  2EPN A;  4MVO A;  3N2Z B;  4PJL A;  4XPX A;  1OR2 A;  4E7Z A;  1NU9 C;  2Q00 A;  5A69 A;  3EH1 A;  1ZU4 A;  1OCO C;  3EPV A;  3K7D A;  4LAC B;  3KH2 A;  1F1M A;  4AE4 B;  4BPM A;  1HMO A;  3ABM C;  3O6X A;  2CW0 F;  2XM4 A;  3RKO F;  1NBB A;  5A6J A;  1Q0K A;  2R7U A;  2XM0 A;  3B71 A;  1YDI A;  2H7O A;  3DJU B;  3FAJ A;  4YK5 A;  5DS4 A;  1T01 A;  2XS8 A;  3U8V A;  2UUI A;  3JCU Q;  4YT5 A;  3SP1 A;  3AGU A;  1G5Z A;  3DKA A;  3LEO A;  3T6B A;  4K7B A;  2R7S A;  2KJG A;  4G78 A;  1KTM A;  3LLI A;  3NKD A;  2QUP A;  2JX0 A;  2EPL X;  5L0C A;  2CYD A;  3K66 A;  1ZW2 A;  5BQG A;  1EQ1 A;  5HSW A;  1FAP B;  1TWH A;  2UUH A;  1U6H A;  5F5H A;  1OXK A;  1VB5 A;  1Q0D A;  3B9Q A;  2G3V A;  1NFN A;  3QW0 A;  4PK4 A;  5L3V A;  2VCA A;  4WGZ A;  3KMI A;  1YYJ A;  1MMD A;  2MHR A;  1NG1 A;  3BEH A;  4MW3 A;  3AG3 C;  4XEK A;  2Y3D A;  1Z3I X;  1QLE C;  3V5X A;  2FGY A;  2QTV A;  1VTM P;  2WVO A;  3SXK A;  4KNW A;  3DWW A;  3PHF 2;  1IZM A;  4E17 A;  4C3D A;  4G7H F;  2R9R B;  4CS9 C;  3C8G A;  5L0H A;  2YLI A;  1OCR C;  1LM3 B;  4E0H A;  1FMW A;  2ICW G;  4HFK B;  4H4K C;  1YA9 A;  1M6T A;  3US6 A;  5DS6 A;  1K04 A;  3ASO C;  4I3M A;  1JOG A;  4E0I A;  3ZVR A;  5IY5 C;  2XLE A;  2P7V A;  5JP7 A;  4AK9 A;  1H7I A;  1M56 C;  4LER A;  2WL8 A;  3DXJ F;  5JSL A;  1YZA A;  2P6V A;  4A2N B;  3E9V A;  2JPU A;  2YL7 A;  4MW8 A;  3W2V A;  2YLG A;  3T6G B;  4DRH B;  4JC7 A;  4GYT A;  2OOC A;  2KK1 A;  1YJG A;  4MND A;  5JS5 A;  2W9Y A;  4C3B A;  2CDQ A;  3E70 C;  1TFK B;  4JKV A;  5GPG B;  1FTS A;  2FFH A;  1RCP A;  2A0U A;  2Y3G A;  3AOU A;  1C03 A;  5COG A;  3NMI A;  3LEV A;  4J7T A;  3RVZ A;  3M4B A;  4DBR A;  3TJ5 A;  4QI2 A;  2NUT A;  1VMA A;  4IJJ A;  1V55 C;  4EKW A;  1HW2 A;  2EIM C;  2R02 A;  1LPE A;  2XSE A;  1LE4 A;  4F4B A;  4AL0 A;  4MTF A;  4BJ6 A;  1ZYR F;  1OW6 A;  4RBN A;  5CI8 A;  3ZQY A;  1YAR O;  3SXZ A;  4O7G A;  4N4W A;  3CAX A;  1L7C A;  2H7V C;  3NKE A;  4DXW A;  2LP4 A;  3I4U A;  4LLC A;  1M2V B;  2CGE A;  3HLZ A;  1IW7 F;  4IAR A;  4MVU A;  1LS4 A;  1YAU O;  1BR2 A;  1JPJ A;  3FMS A;  2J9W A;  3O39 A;  3DM9 B;  2G3K A;  4U9D A;  3J06 A;  3QMK A;  3ECS A;  2H8A A;  4XQ1 A;  1NLX A;  1HMD A;  1ZVZ A;  5B1B C;  1HE9 A;  1M57 C;  1ZHZ A;  3VRC A;  5AC5 A;  5AC4 A;  1U0B B;  1SZI A;  4X0R A;  4ANJ A;  2J9U A;  3NG1 A;  4JE9 A;  4U5F E;  5KYN A;  4QI0 A;  1VLT A;  3SEO A;  2IBF A;  3EGX A;  3M1C B;  4BEM J;  2V3C C;  2YHS A;  2GDC A;  3A11 A;  1AVO B;  3EQL F;  5KYU B;  5KYW B;  5DLJ A;  2XLV A;  2Q9B A;  3LES A;  3QZC A;  3VAY A;  5JVE A;  4CSA C;  5EGY A;  3RQF A;  3CZ6 A;  4ULW A;  3KYJ A;  4WJ0 A;  3IPM O;  3NYM A;  4JUR I;  3L8I A;  4JTA B;  4DBQ A;  2PX0 A;  1E2X A;  2XS1 A;  4YT2 A;  2I8B A;  3DD7 A;  3IHU A;  2X0C A;  5F5F A;  1BDJ B;  4YL1 A;  5HV9 A;  2OEV A;  3HTK C;  2LFF A;  4I1M A;  3EFO B;  1OCZ C;  2P0N A;  2NG1 A;  2M4E A;  1RJ9 B;  2Q4F A;  3KPH A;  4XLN F;  4U9E A;  1TFO B;  2PNO A;  4HE8 D;  4CJG A;  2J7P D;  3EG9 B;  1OCC C;  2A6H F;  4CS8 C;  5KYW A;  4YT8 A;  1FMV A;  1I5N A;  4Q5S F;  2W4B A;  1W2W A;  4P9F A;  1JPN A;  4YJW A;  4EUK B;  2OQM A;  4PJJ A;  1ZW3 A;  2EIN C;  1OQC A;  1O87 A;  3ATP A;  1ZHX A;  1SYQ A;  2QNL A;  3ZG1 A;  3JYY A;  3U3F A;  2V26 A;  2CNW A;  4YN0 B;  2OU6 A;  1D0X A;  1D1C A;  3MBG A;  4IB4 A;  3K1H A;  1T6I A;  4XPW A;  2H7B A;  4MVS A;  2J0X A;  2OCC C;  1E85 A;  1CPR A;  4W8K A;  2OJQ A;  1A7D A;  3MX3 A;  2HSB A;  1MQV A;  5K0I A;  4LDR A;  4N6H A;  2Q7R A;  5DQT A;  4LLE A;  3ZTZ A;  3B0V C;  1NZE A;  4UDV A;  1MMG A;  1H6G A;  2KNH A;  3Q6N A;  3EZI A;  3VM6 A;  2DGJ A;  3FXH A;  1K40 A;  3I5Q A;  4OIR F;  2OJE D;  3Q7L A;  4CDY A;  4EWC A;  3GWL A;  4IAQ A;  3S84 A;  5JLI A;  2R25 A;  1Z5Z A;  2ASR A;  3C8G D;  3C7J A;  5D91 A;  4AE4 A;  2HUJ A;  1BR4 A;  2YWA A;  3IQC A;  3EGD B;  4O6Y A;  4C7O B;  5COM A;  5B1A C;  2L7A A;  3F46 A;  5L0F A;  1NSG B;  3CEX A;  3ZSU A;  1CGN A;  1YLM A;  1ORS C;  1XZP A;  3FOO A;  3C8Z A;  3DZA A;  1WGW A;  4AL1 A;  3AQC A;  4EHP A;  2R03 A;  3TJ6 A;  4XEF A;  2I15 A;  3PMR A;  2KGO A;  3TQO A;  1YZC A;  4K1O A;  3R7C A;  3TUL A;  4EBK A;  1GS9 A;  1ZU5 A;  2PP4 A;  3AGT A;  3LNM B;  3NMJ A;  3S9O A;  2GAQ A;  1WAT A;  2RD9 A;  2Y69 C;  5D92 A;  4W8P A;  2HV7 A;  4G7Z F;  1YVI A;  4L6R A;  1Z23 A;  3JZ0 A;  3V7O A;  1UG7 A;  2EPO A;  2WB7 A;  3F47 A;  2EPK X;  3U8P A;  3L1M A;  4E18 A;  1RMV A;  3U0C A;  3JYH A;  1H9T A;  2J9B A;  2AVK A;  2R7O A;  1R5I D;  5L0J A;  4JIO A;  5JRA A;  1T9K A;  3FHD A;  3N0T A;  4BJ5 C;  5KYY B;  1DOV A;  5KYX B;  3JSZ A;  3DAF A;  4FAP B;  3S28 A;  2LFD A;  3ZQV A;  1YYX A;  2R7W A;  4CS9 A;  3VF0 A;  1O5H A;  4O6N A;  4A4A A;  2KQ9 A;  1WAS A;  2NPU A;  3O10 A;  1J8M F;  2L6G A;  4IGG A;  3QTH A;  3EHN A;  3PCV A;  1ST6 A;  4JRZ A;  5AGF A;  4BJ5 A;  4DRJ B;  4CIH A;  2EIJ C;  5FZT A;  4Q7C A;  3QW1 A;  4LDQ A;  4MQ9 F;  3T9O A;  3ZDL A;  2R05 A;  3H2V A;  3S27 A;  5KYX A;  1AUE A;  4FES A;  4JCZ A;  1G4W R;  2GA0 A;  4RD9 A;  3N24 A;  2YZS A;  1ZZP A;  2OG2 A;  3UMK A;  3HNJ A;  1E86 A;  2MWQ A;  4WAB A;  1SMY F;  3LJB A;  1O3U A;  3RFY A;  3C63 A;  1Z7Q c;  3ZIB A;  2PX3 A;  3NYJ A;  4EIY A;  2XLM A;  3SZR A;  1T6Q A;  3JRT A;  2EIK C;  4N6C A;  1MND A;  2O9X A;  1JMW A;  2EPM X;  4U5C E;  3SYN A;  3SXM A;  1NFO A;  2L6F A;  5E33 A;  3ZC4 A;  1VYI A;  3JSE O;  4JVS A;  1Z63 A;  4MS2 A;  2AP3 A;  2VB6 A;  4ER9 A;  2HZ8 A;  2R7Q A;  2XLD A;  4MVZ A;  4D4X A;  2XLH A;  1MMA A;  3KKB A;  1TWC A;  3NYL A;  3RIP A;  4DJ9 A;  1NU7 D;  2IM8 A;  2Q3T A;  4JEA A;  4PFO A;  5DQZ A;  1GM5 A;  4IWB A;  2ZPA A;  3EHM A;  4NTF A;  2BE5 F;  2G62 A;  4OD5 A;  1VYK A;  1DOW A;  2Y3H A;  3C62 A;  4I1O B;  4JEB A;  1OKK A;  4MVM A;  5CI9 A;  4BG0 A;  4CBE A;  2CCY A;  3W8I A;  3A9C A;  3H65 A;  1OR3 A;  5B3S C;  1M2V A;  4JCH A;  2PBE A;  1TWG A;  3GAN A;  3IEE A;  3L0I A;  4DRI B;  2ZXO A;  2LK4 A;  3K1I C;  2A6E F;  2CNW D;  3GEE A;  3B0P A;  3IQ6 A;  2LD6 A;  4ONS A;  1GQA A;  3RYL A;  5L0D A;  4GEH A;  2AU5 A;  3K33 A;  1D1B A;  1ZHT A;  3VYW A;  1FFT C;  1QKR A;  2R7V A;  1U89 A;  5FCL A;  1QSP A;  2HJM A;  3Q6M A;  1S05 A;  2NUP B;  4NQF A;  1XZQ A;  3AG2 C;  3CSK A;  4PFP A;  3V5Z A;  2Y3B A;  3RH3 A;  4YL0 A;  4CSA A; 
#chains in the Genus database with same CATH homology
 5KYU A;  4OIN F;  2E87 A;  4I44 A;  3ABK C;  1KU2 A;  2C04 A;  2WVQ A;  3UR3 C;  4J30 B;  2A68 F;  2IXP A;  2D5R B;  3POV A;  2J9V A;  3EZH A;  1BR1 A;  4CS8 A;  3EFO A;  3AG1 C;  2W4M A;  1RJ9 A;  3T6J A;  5BUO A;  3UGO A;  2Q9C A;  2ZXP A;  3EG9 A;  3LS0 A;  3DMD A;  2XL4 A;  4O79 A;  2J46 A;  3OA1 A;  2J0W A;  4M63 A;  4XLP F;  3DAG A;  4U5G A;  4JW1 A;  5E2Q A;  3Q7G A;  4JJG A;  3TD7 A;  3L34 A;  4KNV A;  4HFF B;  3UMI A;  4G7O F;  2C03 A;  2R7R A;  2XRH A;  1S7Z A;  3CQZ A;  3X1O A;  4J32 B;  2X51 A;  3ABL C;  3MLG A;  5T1D B;  4CS7 A;  3OEO A;  4AX2 A;  3ASN C;  3AQB A;  2PF4 E;  2R7T A;  4K0D A;  1G8X A;  2J7P A;  3T4R A;  4IRU A;  2MYS A;  2EIL C;  2J45 A;  4U5B E;  3LLK A;  3JT1 A;  3S0X A;  4JZA A;  4XTK A;  4B6I A;  3EGD A;  4C7O A;  2R7X A;  3X2Q C;  1VOM A;  5E3A A;  3EJN A;  1ZHW A;  3FVY A;  5E3C A;  3I5P A;  5T3W A;  3WG7 C;  3LS1 A;  2WZF A;  4PJN A;  4YT4 A;  2JD3 A;  3FDQ A;  2YEV A;  1D0Z A;  2DYS C;  2B0J A;  2Y39 A;  4PJM A;  5DS5 A;  2IXN A;  2WVN A;  3K6B A;  1FFH A;  3SNH A;  1LVK A;  4KC9 A;  4FX5 A;  5KYY A;  2XXA B;  2VAS A;  2Z15 A;  2IYL D;  2W45 A;  3NRH A;  1OKK D;  2DYR C;  2IXM A;  4EBB A;  4OD4 A;  4BEJ A;  1SF8 A;  1VK5 A;  3LAY A;  4Q4Z F;  3W2W A;  4OIQ F;  2NUT B;  2WZG A;  3NDB B;  1ZHY A;  4BJT A;  3UNG C;  2VH3 A;  2XXA A;  2Q9A A;  4U5E E;  1LKX A;  3HJC A;  3EH2 A;  1Z6A A;  4BJ6 C;  1V54 C;  4O6M A;  4KBL A;  4P6I C;  3WOD F;  4C3E A;  4U5D E;  2A69 F;  1N1C A;  4FWV A;  4JJF A;  4BJ1 A;  4IAO A;  3ITF A;  2IOQ A;  2IXO A;  3DJN B;  1QZX A;  4N06 A;  1LS1 A;  3EGX B;  4DVZ A;  4E7S A;  1MMN A;  4QDL A;  2ZXW C;  3DM5 A;  4ZLC A;  3W8H A;  2QY9 A;  4ZLD A;  4DOZ A;  3OWT A;  3UGP A;  1TWA A;  3AG4 C;  4XWJ A;  2L81 A;  4OIO F;  3GOD A;  5T3T A;  3B0U X;  4G0H A;  1J8Y F;  4OIP F;  4U5H A;  4DVY P;  2NUP A;  3KL4 A;  1PD0 A;  1D0Y A;  3LNR A;  3UMH A;  3S29 A;  5EHH A;  2LSE A;  1M2O A;  1MNE A;  2GFH A;  2PFD A;  4KI2 A;  2HV6 A;  4HEA J;  1TKN A;  2ZXR A;  4NY3 A;  1PCX A;  4YWQ A;  1D1A A;  5DVW A;  4RDA A;  2L9J A;  2A1D D;  2KW3 C;  1PD1 A;  1TR2 A;  2WZL A;  3N2Z B;  4PJL A;  4E7Z A;  1NU9 C;  3EH1 A;  1ZU4 A;  1OCO C;  3EPV A;  3K7D A;  4LAC B;  3KH2 A;  4AE4 B;  3ABM C;  3O6X A;  2CW0 F;  3RKO F;  2R7U A;  3DJU B;  2H7O A;  3FAJ A;  5DS4 A;  3JCU Q;  4YT5 A;  3SP1 A;  3T6B A;  4K7B A;  2R7S A;  2KJG A;  3LLI A;  3NKD A;  3K66 A;  5HSW A;  1TWH A;  5F5H A;  3B9Q A;  2G3V A;  4PK4 A;  5L3V A;  3KMI A;  1MMD A;  1NG1 A;  3AG3 C;  2Y3D A;  1Z3I X;  1QLE C;  2FGY A;  2QTV A;  2WVO A;  4KNW A;  3PHF 2;  1IZM A;  4G7H F;  4C3D A;  4CS9 C;  1OCR C;  1FMW A;  4HFK B;  4H4K C;  5DS6 A;  3ASO C;  4I3M A;  5IY5 C;  3ZVR A;  2P7V A;  4AK9 A;  1M56 C;  4LER A;  2WL8 A;  3DXJ F;  2P6V A;  4A2N B;  3E9V A;  3W2V A;  4MND A;  4GYT A;  2W9Y A;  4C3B A;  2CDQ A;  3E70 C;  1FTS A;  2FFH A;  2Y3G A;  3LEV A;  4QI2 A;  4DBR A;  2NUT A;  1VMA A;  4IJJ A;  1V55 C;  2EIM C;  2XSE A;  4F4B A;  4BJ6 A;  1ZYR F;  4RBN A;  5CI8 A;  4O7G A;  2H7V C;  3NKE A;  3I4U A;  4LLC A;  1M2V B;  2CGE A;  3HLZ A;  1IW7 F;  1BR2 A;  1JPJ A;  3O39 A;  2J9W A;  3DM9 B;  2G3K A;  3QMK A;  3ECS A;  5B1B C;  1M57 C;  1ZHZ A;  1SZI A;  4X0R A;  4ANJ A;  2J9U A;  3NG1 A;  4U5F E;  5KYN A;  4QI0 A;  3SEO A;  3EGX A;  3M1C B;  2V3C C;  2YHS A;  3EQL F;  5KYU B;  5KYW B;  5DLJ A;  3LES A;  2Q9B A;  3VAY A;  3QZC A;  4CSA C;  5EGY A;  3CZ6 A;  4ULW A;  4WJ0 A;  3NYM A;  4JUR I;  4DBQ A;  2PX0 A;  4YT2 A;  2I8B A;  3DD7 A;  5F5F A;  3HTK C;  4I1M A;  3EFO B;  1OCZ C;  4XLN F;  2NG1 A;  2M4E A;  1RJ9 B;  4HE8 D;  2J7P D;  3EG9 B;  1OCC C;  2A6H F;  4CS8 C;  5KYW A;  4YT8 A;  1FMV A;  2W4B A;  1W2W A;  4YJW A;  1JPN A;  4PJJ A;  2EIN C;  1O87 A;  1ZHX A;  3ZG1 A;  2V26 A;  2CNW A;  4YN0 B;  1D0X A;  1D1C A;  3K1H A;  2H7B A;  2J0X A;  2OCC C;  4W8K A;  3MX3 A;  5DQT A;  4LLE A;  3B0V C;  1NZE A;  1MMG A;  3Q6N A;  2KNH A;  3EZI A;  2DGJ A;  4OIR F;  3I5Q A;  3Q7L A;  4EWC A;  1Z5Z A;  4AE4 A;  5D91 A;  1BR4 A;  4O6Y A;  3EGD B;  4C7O B;  5B1A C;  3F46 A;  3ZSU A;  3DZA A;  1WGW A;  3AQC A;  3PMR A;  2KGO A;  1ZU5 A;  2PP4 A;  4G7Z F;  2Y69 C;  5D92 A;  2HV7 A;  1Z23 A;  3V7O A;  2WB7 A;  3F47 A;  3JYH A;  2R7O A;  3N0T A;  3FHD A;  4BJ5 C;  5KYY B;  5KYX B;  3JSZ A;  3DAF A;  3S28 A;  2R7W A;  4CS9 A;  1O5H A;  4O6N A;  2KQ9 A;  1J8M F;  4BJ5 A;  3EHN A;  4CIH A;  1ST6 A;  2EIJ C;  4Q7C A;  4MQ9 F;  3S27 A;  5KYX A;  4FES A;  4RD9 A;  3N24 A;  2YZS A;  2OG2 A;  3UMK A;  2MWQ A;  1SMY F;  3LJB A;  3RFY A;  3ZIB A;  2PX3 A;  3NYJ A;  3SZR A;  3JRT A;  2EIK C;  4U5C E;  1MND A;  2O9X A;  3SYN A;  5E33 A;  3ZC4 A;  1VYI A;  4JVS A;  1Z63 A;  2VB6 A;  2R7Q A;  1MMA A;  3KKB A;  1TWC A;  3NYL A;  3RIP A;  1NU7 D;  2Q3T A;  4PFO A;  5DQZ A;  4IWB A;  2ZPA A;  3EHM A;  2BE5 F;  2G62 A;  4OD5 A;  1VYK A;  2Y3H A;  4I1O B;  1OKK A;  5CI9 A;  4BG0 A;  4CBE A;  3W8I A;  3H65 A;  5B3S C;  1M2V A;  4JCH A;  1TWG A;  3GAN A;  3IEE A;  3L0I A;  2ZXO A;  3K1I C;  2A6E F;  2CNW D;  5L3Q A;  3B0P A;  4Q5S F;  3RYL A;  4GEH A;  3K33 A;  1D1B A;  1ZHT A;  3VYW A;  1FFT C;  2R7V A;  5FCL A;  3Q6M A;  2NUP B;  3AG2 C;  3CSK A;  4PFP A;  2Y3B A;  3RH3 A;  4CSA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...