4LDKA

Fad-linked sulfhydryl oxidase alr mutation
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
115
structure length
114
Chain Sequence
FREDCPPDREELGRHSWAVLHTLAAYYPDLPTPEQQQDMAQFIHLFSKFYPAEEAEDLRKRLARNHPDTRTRAAFTQWLCHLHNEVNRKLGKPDFDCSKVDERWRDGWKDGSCD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title FAD-linked sulfhydryl oxidase ALR mutation
rcsb
source organism Homo sapiens
molecule tags Flavoprotein, oxidoreductase
molecule keywords FAD-linked sulfhydryl oxidase ALR
total genus 43
structure length 114
sequence length 115
ec nomenclature ec 1.8.3.2: Thiol oxidase.
pdb deposition date 2013-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04777 Evr1_Alr Erv1 / Alr family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.310 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) ERV/ALR sulfhydryl oxidase domain 4ldkA00
3R7CA 3TK0A 3U5SA 3MBGA 3U2LA 3O55A 4E0IA 4E0HA 3LLIA 1JRAA 3TD7A 2HJ3A 3U2MA 1OQCA 1JR8A 3GWNA 3GWLA 4LDKA 3LLKA 3W4YA
chains in the Genus database with same CATH superfamily
4M63A 4P9FA 5JT4A 1FAPB 1FMWA 1ZHTA 3VYWA 5CI9A 4R32A 3LJBA 5F5FA 3DWWA 3T6GB 2DB4A 1NLXA 2ZXOA 3B71A 4JURI 4OINF 3JRTA 1D0ZA 3AG2C 5DLJA 5A6BD 2G62A 4RDAA 1ORJA 1ZU5A 1LS1A 1ZYRF 2L6HA 4EUKB 2R7UA 3RVZA 3EGXB 3KMIA 2IXMA 2VCAA 3FAPB 3QZCA 4EIYA 1MMNA 3WAQA 4XEKA 1ZU4A 5GPGB 3Q6NA 1K05A 4CBEA 4I3MA 3KYJA 2M4EA 4EHPA 2J9BA 2A6HF 1Q0DA 1NSGB 2R7QA 2YL0A 1YA9A 3C62A 3KH2A 3QMKA 4CJGA 4G7ZF 3FMSA 3K33A 3HNKA 3VF0A 1NU7D 4X0RA 1WASA 4EWCA 4YN0B 4YL0A 2MWQA 2IYLD 5KYWB 4CDVA 3N0TA 5BQHA 1Q0MA 4U5GA 1OCRC 2Q4FA 2A6EF 2G3KA 3AGTA 3G4ZA 2R7VA 4ZLDA 1YJGA 2OEVA 4K1OA 3W4YA 2JPUA 5DS4A 2W45A 4XEFA 2YL1A 1MQVA 1K40A 2XL6A 3CSKA 1VLSA 2IBFA 2PF4E 2LCHA 4MVMA 1AUEA 2HV6A 3EHMA 1EI7A 4BJ6C 4E7ZA 4LDQA 3KPHA 4U9DA 3UMHA 4YK5A 1KTMA 2FFHA 4JRZA 4BJ1A 4QI0A 4JC7A 5EHHA 3DM5A 2KJGA 3EGDB 3EGXA 2EPMX 3ZC4A 1U89A 1SZIA 3VAYA 3LS0A 3ZQYA 4FX5A 4I1OB 4H54A 4DXWA 1E85A 4HFFB 1TWAA 2NUPA 3F46A 3SXKA 2OU6A 5A69A 2HV7A 3AG1C 1OW8A 1OW6A 3AOUA 3DD7A 5COMA 2XM0A 1ZW2A 4G78A 2ETSA 3I5QA 3SNHA 2VB6A 5T1DB 4GYTA 1IW7F 1S7ZA 3US6A 1ZHWA 2Y3BA 2EIMC 5E33A 3NYMA 1CGNA 4AL1A 5L0DA 3QW0A 4LACB 3SXMA 4EBBA 4PJNA 2OJED 5JSLA 4O7GA 3UGPA 2OOCA 3U3BA 3DAGA 2R25A 1S05A 1MMDA 2CNWA 2VASA 1QSPA 4N06A 5B3SC 4CSAC 3S84A 2C04A 4E7SA 3ZTMA 1V4AA 1O87A 2A0UA 3O39A 4C3EA 2R9RB 4CS9C 3FOPA 4DBQA 1EA8A 2CDQA 3K7DA 4YJWA 1BDJB 2NUTB 1HW2A 1D1BA 4C7OB 2P1AA 4O6NA 3TD7A 4BEJA 3E70C 1APCA 3L34A 1MMAA 2YRFA 1Q0KA 5L0HA 256BA 2QE9A 3K1IA 3DKAA 2DYRC 4DRHB 1YVIA 4I44A 3B0UX 1FMVA 1OCOC 1GGQA 4KNVA 4Q4ZF 1C03A 4W8KA 4ULWA 2V26A 3FVYA 2A68F 3RQEA 5F28E 3ZVRA 4Z9IA 1NFNA 1RKEB 3LUTB 4NTFA 2R03A 4ANJA 2YEVA 3PDMP 1DOWA 4KBLA 1TWGA 3ZTZA 1SMYF 3ECSA 1ORYA 3LESA 1LKXA 4IGGA 4OD5A 3S9OA 3V5ZA 2D5RB 2W4MA 5FCLA 5JUAA 2Y3GA 2Y39A 1V74B 2IXPA 3RIPA 4E0HA 2A0BA 3K1IC 4MVZA 4PJLA 4WJ0A 2CNWD 3A9CA 2HKVA 4WGYA 1WN0A 3T9OA 5F5HA 4JKVA 2ZPAA 4NY3A 1TFKB 3S27A 4GQHA 3ZWIA 4JCZA 2CGEA 3IPMO 1CPRA 4YT2A 4XEVA 1HMDA 4JCHA 4C3DA 1QZXA 4A4AA 2ICWG 1L7CA 3BEHA 2XXAB 3HNLA 5AC4A 1C17M 4DVZA 1OQCA 5D92A 1FTSA 1FFHA 2BL2A 2YLDA 3Q6MA 2R7WA 3C8GB 2YL3A 2GAQA 2HSQA 1M6TA 3MX3A 1QPUA 1BR1A 4PK4A 2X0CA 3AGUA 2Y69C 4XPWA 4ULVA 3M15A 2B0HA 2H7OA 3NMKA 1Z5ZA 1OXKA 2EPNA 3DJNB 2LSEA 3EZHA 5KYYB 2P61A 1XWJA 2A69F 2OCCC 2WB7A 3EPVA 1G8XA 1Q0FA 3M1CB 4JTAB 5KYNA 2I15A 5E2QA 4JZAA 1M56C 2EPLX 2Q00A 4CJOA 2XS8A 4AE4B 4QI2A 1I5NA 5A6KA 4J30B 1TWHA 1NBBA 3U9MA 2KYHA 4PACA 4AX2A 4BJTA 1V55C 2OQMA 2XL8A 3IQCA 2XLVA 3L8JA 1Y6DA 1E86A 1ZW3A 3LNRA 4Q5SF 5KYUB 4EKWA 4NTAA 4MTFA 3DE8A 3SXYA 1LM3B 2IM8A 1PD1A 4C7OA 2LQGA 4G7HF 3KKBA 2YVKA 1RKEA 2ZXRA 3TOMA 4MW3A 1YYXA 4JJGA 3C18A 1H6GA 3FAJA 3K6BA 1FR0A 2HFIA 3KL4A 2YZSA 2J9UA 1O5HA 4RBNA 4ONSA 4YWQA 1PV3A 3DJUB 5DQZA 4PR9A 3R7CA 1AEPA 1T6UA 3B9QA 4O6YA 4DOZA 4XLNF 1ZHXA 3I5PA 1AVOB 4B6IA 4ZLCA 2HJMA 1YZCA 4N4WA 3FOOA 1M57C 4OIRF 2XLOA 1CGME 4XLPF 2AWCA 4YT8A 3EH1A 3EG9B 4MVOA 2DI3A 1T01A 2PNOA 3LEVA 5KYXB 2R7RA 3CZ6A 4XPXA 1YARO 1QVXA 2NUPB 3U8VA 3ZG1A 3GM2A 2QUPA 4NQFA 1OW7A 1SR2A 3TOLA 3HJCA 3X1OA 5KYXA 1TR2A 2HMQA 1YAUO 2HZ8A 5BQGA 4C3BA 5B1AC 4LLEA 4CIPA 2PP4A 5DVWA 2TMVP 2L7AA 1ZHYA 1A41A 3NKEA 4E18A 3LS1A 4QDLA 3VM6A 3G4XA 4CS7A 1Q0GA 1I4YA 2GWWA 4G7OF 1A7DA 2NPUA 1IZMA 3CEXA 3HNIA 3RQGA 3UNGC 1QLEC 1HY5A 4ER9A 3GM3A 4D4NA 1JR8A 1VYKA 3I4UA 3GWLA 3OEOA 2PFDA 4OD4A 1D1CA 3LLKA 2YL7A 3CQZA 1QKRA 4NC3A 1YA7O 1MNDA 3AG4C 3TULA 3HTKC 2P6VA 4FESA 4YT4A 3ASOC 4YL3A 5CI8A 5KYUA 4AL0A 2EIJC 5T3WA 2YLGA 1VK5A 2XSEA 3NMIA 4JE9A 3TK0A 5L3QA 2YLIA 3BRJA 2QTVA 3QW1A 2EPKX 3NRHA 1TFOB 3B0PA 1NG1A 2A1DD 1T5OA 3FHDA 3T6BA 3WG7C 1WOLA 4H4KC 3RFYA 2KW3C 3NDBB 3IEEA 4JIOA 3RQFA 4YT5A 2X51A 2Q9AA 3Q7GA 4EBKA 4MW8A 5COFA 3SZRA 3VRCA 2XLMA 1T9KA 1YDIA 3JRMO 3MBGA 3JYYA 1Y4CA 3C7JA 3QTHA 2XL4A 3UR3C 1A0BA 1HW1A 1SYQA 4JEAA 4KI2A 3W8HA 2UUIA 4LDKA 4MVSA 2DGJA 3RVYA 4CDAA 5L0FA 4BJ5A 1BBHA 3OWTA 3WODF 2R7SA 1WATA 4OIOF 3TJ6A 2M64A 2EPOA 1RKCA 2CW0F 4LLCA 5K0IA 2IXNA 1UG7A 2ZXWC 3DXJF 3K66A 2J9WA 2YWAA 2KGOA 3ATPA 3JSZA 4MS2A 2L9JA 3S90A 2PX3A 2W4BA 4E17A 3C63A 5L0CA 3L8IA 1MNEA 3GORA 3HNJA 1OKKD 2IXOA 1XZPA 3TQOA 4F4BA 4JEBA 3JZ0A 3V7OA 1R4TA 3EG9A 3B29A 3GEIA 1Z6AA 1TWCA 5HSWA 4L6RA 1W2WA 2XLEA 4XQ1A 5L3VA 4LERA 2J45A 4EBJA 3LNMB 1LE4A 4MVQA 5FZTA 5TJ5E 3X2QC 3PCVA 4LDRA 1A7EA 2HMZA 4XWJA 1LS4A 2XXAA 3S0XA 2MHRA 4Z9HA 3JSEO 3W2VA 5A6AA 4O79A 4DRJB 1I4ZA 1J8MF 2R7OA 2J7PA 4KC9A 1M2OA 4IWBA 1KNYA 2YQYA 4AE4A 4CS8A 4OIPF 1D0YA 2PBEA 4HFKB 1K04A 3K1HA 4J7YA 4JTDB 3U9JA 2AVKA 2VCCA 4N6CA 4Q7CA 3U5SA 3CAXA 2PX0A 1NU9C 4P9TA 1OCCC 2J8WA 3EQLF 3MFNA 3UMKA 4CX9A 2OG2A 1FNTc 2OKUA 2L81A 2ASRA 4MNDA 1TQGA 4AK9A 2EILC 2LK4A 2KNHA 2KC3A 2J9VA 4WABA 3C8GA 4A2NB 1LE2A 3H2UA 2WZLA 3NG1A 3EFOB 3O10A 4MTOA 2AWYA 4N6HA 2VCBA 3H65A 4NTBA 1RMVA 1U0BB 3TJ5A 2R05A 3T6JA 2R7TA 3GEHA 1F1MA 2JX0A 2QY9A 4U5CE 2Z15A 3M79A 4HEAJ 4PFPA 2ZD9A 4U5BE 4CS8C 4MVRA 5JVEA 1D0XA 2GDCA 1O3UA 1U6HA 2WZFA 4P6IC 4BEMJ 1T6IA 1C02A 4GEHA 3W8IA 2XLDA 2XM4A 3DE9A 5BQIA 4W8PA 3WHNA 1RXQA 1JRAA 3L0IA 3N2ZB 4K0DA 3SXZA 5JRAA 5E3AA 2HS5A 3RKOF 3GM1A 1VOMA 3SP1A 1RCPA 1ST6A 3MYIA 5DS5A 5AC5A 1G4WR 2YKZA 2GFHA 2J46A 1N1CA 2LP4A 3EFOA 1JAFA 2OEXA 1LI5A 3U2LA 1SF8A 4BPMA 4PJMA 2YHSA 3QVZA 1CGOA 2KSFA 4U5FE 2E87A 2KK1A 4BG0A 2WVQA 2W9YA 2VC9A 1LPEA 1H9GA 3C8ZA 3JCUQ 2Q3TA 5T3TA 5A6JA 4CS9A 2UUHA 2V3CC 2Y3HA 3R2PA 3DZAA 2O9XA 1M2VA 4U5EE 1ZHZA 3AQCA 3EJNA 3C8GD 1T6QA 2KQ9A 5EK0A 3UMIA 3RW0A 3DI5A 4I1MA 3EHNA 3LAYA 5CIVA 3LEOA 4DRIB 1VMAA 1WWPA 2P0NA 2MYSA 3EGDA 2H7VC 3NMJA 5JLIA 4O6MA 1PCXA 3PMRA 2R02A 5BUOA 4DBRA 1Z3IX 5L0JA 1JMWA 1BZ4A 3MYFA 3SEOA 3ABLC 3ZIBA 2AU5A 2FGYA 4PFOA 4D4XA 2NSFA 5EGYA 1QQ3A 3AJMA 1JPJA 3W2WA 3NKDA 2D4UA 3GEEA 1VLTA 1J8YF 1M2VB 3M4BA 3O55A 1YLMA 5B3IA 3B0VC 4IARA 1KU2A 2J0WA 2LFFA 4HE8D 1VTMP 3IQ6A 3DAFA 3G50A 3GWNA 4Z9JA 3ASNC 5KYYA 4JW1A 4XTKA 3O6XA 2RD9A 1GQAA 2HJ3A 3ABKC 1NFOA 1VB5A 2ZXPA 3GODA 3KYIA 4CDYA 1EQ1A 2Q7RA 2AP3A 4FAPB 1A7VA 1OKKA 2FAPB 3POVA 4NCQA 3A11A 3Q7LA 4KNWA 2Q9BA 1OR2A 3DMDA 4WGZA 1E2XA 3L1MA 1OXBA 4OIQF 1G5ZA 1E84A 2J0XA 2L6FA 1RJ9B 4YL1A 2XLWA 4IB4A 3S29A 3U2MA 4U5HA 1LVKA 2F22A 3QVYA 1ORSC 4RD9A 4CIHA 1TKNA 3FXHA 1YZAA 1EKYA 4PJJA 1B68A 2DYSC 4U5DE 3T4RA 3N24A 4XPYA 1VYIA 2EINC 3ABMC 1BR4A 1ZZPA 4MTGA 5COGA 5DS6A 2WVNA 4CSAA 2CYDA 1MMGA 5JS5A 4DVYP 4J7TA 2QNLA 3RYLA 2LFDA 2H7BA 2WVOA 3NYJA 1LI7A 2OJQA 2Y3DA 4MVUA 4IAQA 1HE1A 1D1AA 3GANA 5A6BA 2L6GA 3V5XA 3MLGA 2G3VA 1CPQA 3F47A 3ZQVA 3IQ5A 1PD0A 3V5YA 4U9EA 1LIHA 1WGWA 2I8BA 1L3PA 3AG3C 1H7IA 3SYNA 3M4CA 4JVSA 1V54C 2LIGA 3E9VA 1FFTC 2CCYA 1OCZC 2C03A 2BC5A 2WL8A 3LLIA 1OR3A 4J32B 4MQ9F 3ZSUA 2HSBA 5B1BC 5L0IA 1E83A 5IY5C 3PHF2 1Z7Qc 4IAOA 2XRHA 2B0JA 4DJ9A 1WTYA 1XZQA 3DM9B 2J7PD 2VH3A 3EH2A 4IRUA 5KYWA 4UDVA 5AGFA 1NZEA 3FDQA 4E0IA 3U8PA 4K7BA 2EIKC 1RJ9A 3S28A 2LD6A 1R5ID 3JYHA 2NUTA 3U3FA 4BJ6A 4BJ5C 5E3CA 2BE5F 3H2VA 3JTLO 4JJFA 5L0GA 1HMOA 1ZVZA 3HKKA 3ITFA 3NYLA 1DOVA 2IOQA 2JD3A 1GS9A 2QLAA 2GA0A 3IQTA 3HLZA 2XLHA 5D91A 3UGOA 3RF3A 1Z23A 2P7VA 3EZIA 2R7XA 1YYJA 1H9TA 3RH3A 4G0HA 1UFBA 2WZGA 3OA1A 2Q9CA 1Z63A 1JOGA 1HE9A 4FWVA 1GM5A 3JT1A 5DQTA 1JPNA 2HUJA 3U0CA 2NSGA 2NG1A 3AQBA 3IHUA 4IJJA 2RSEB 5JP7A 1BR2A 2H8AA 2XS1A 3ZDLA 5HV9A 1G4US 3J06A 4JTCB
chains in the Genus database with same CATH topology
3R7CA 3TK0A 3U5SA 3MBGA 3U2LA 3O55A 4E0IA 4E0HA 3LLIA 1JRAA 3TD7A 2HJ3A 3U2MA 1OQCA 1JR8A 3GWNA 3GWLA 4LDKA 3LLKA 3W4YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3R7C A;  3TK0 A;  3U5S A;  3MBG A;  3U2L A;  3O55 A;  4E0I A;  4E0H A;  3LLI A;  1JRA A;  3TD7 A;  2HJ3 A;  3U2M A;  1OQC A;  1JR8 A;  3GWN A;  3GWL A;  4LDK A;  3LLK A;  3W4Y A; 
#chains in the Genus database with same CATH topology
 4M63 A;  4P9F A;  5JT4 A;  1FAP B;  1FMW A;  1ZHT A;  3VYW A;  5CI9 A;  4R32 A;  3LJB A;  5F5F A;  3DWW A;  3T6G B;  2DB4 A;  1NLX A;  2ZXO A;  3B71 A;  4JUR I;  4OIN F;  3JRT A;  1D0Z A;  3AG2 C;  5DLJ A;  5A6B D;  2G62 A;  4RDA A;  1ORJ A;  1ZU5 A;  1LS1 A;  1ZYR F;  2L6H A;  4EUK B;  2R7U A;  3RVZ A;  3EGX B;  3KMI A;  2IXM A;  2VCA A;  3FAP B;  3QZC A;  4EIY A;  1MMN A;  3WAQ A;  4XEK A;  1ZU4 A;  5GPG B;  3Q6N A;  1K05 A;  4CBE A;  4I3M A;  3KYJ A;  2M4E A;  4EHP A;  2J9B A;  2A6H F;  1Q0D A;  1NSG B;  2R7Q A;  2YL0 A;  1YA9 A;  3C62 A;  3KH2 A;  3QMK A;  4CJG A;  4G7Z F;  3FMS A;  3K33 A;  3HNK A;  3VF0 A;  1NU7 D;  4X0R A;  1WAS A;  4EWC A;  4YN0 B;  4YL0 A;  2MWQ A;  2IYL D;  5KYW B;  4CDV A;  3N0T A;  5BQH A;  1Q0M A;  4U5G A;  1OCR C;  2Q4F A;  2A6E F;  2G3K A;  3AGT A;  3G4Z A;  2R7V A;  4ZLD A;  1YJG A;  2OEV A;  4K1O A;  3W4Y A;  2JPU A;  5DS4 A;  2W45 A;  4XEF A;  2YL1 A;  1MQV A;  1K40 A;  2XL6 A;  3CSK A;  1VLS A;  2IBF A;  2PF4 E;  2LCH A;  4MVM A;  1AUE A;  2HV6 A;  3EHM A;  1EI7 A;  4BJ6 C;  4E7Z A;  4LDQ A;  3KPH A;  4U9D A;  3UMH A;  4YK5 A;  1KTM A;  2FFH A;  4JRZ A;  4BJ1 A;  4QI0 A;  4JC7 A;  5EHH A;  3DM5 A;  2KJG A;  3EGD B;  3EGX A;  2EPM X;  3ZC4 A;  1U89 A;  1SZI A;  3VAY A;  3LS0 A;  3ZQY A;  4FX5 A;  4I1O B;  4H54 A;  4DXW A;  1E85 A;  4HFF B;  1TWA A;  2NUP A;  3F46 A;  3SXK A;  2OU6 A;  5A69 A;  2HV7 A;  3AG1 C;  1OW8 A;  1OW6 A;  3AOU A;  3DD7 A;  5COM A;  2XM0 A;  1ZW2 A;  4G78 A;  2ETS A;  3I5Q A;  3SNH A;  2VB6 A;  5T1D B;  4GYT A;  1IW7 F;  1S7Z A;  3US6 A;  1ZHW A;  2Y3B A;  2EIM C;  5E33 A;  3NYM A;  1CGN A;  4AL1 A;  5L0D A;  3QW0 A;  4LAC B;  3SXM A;  4EBB A;  4PJN A;  2OJE D;  5JSL A;  4O7G A;  3UGP A;  2OOC A;  3U3B A;  3DAG A;  2R25 A;  1S05 A;  1MMD A;  2CNW A;  2VAS A;  1QSP A;  4N06 A;  5B3S C;  4CSA C;  3S84 A;  2C04 A;  4E7S A;  3ZTM A;  1V4A A;  1O87 A;  2A0U A;  3O39 A;  4C3E A;  2R9R B;  4CS9 C;  3FOP A;  4DBQ A;  1EA8 A;  2CDQ A;  3K7D A;  4YJW A;  1BDJ B;  2NUT B;  1HW2 A;  1D1B A;  4C7O B;  2P1A A;  4O6N A;  3TD7 A;  4BEJ A;  3E70 C;  1APC A;  3L34 A;  1MMA A;  2YRF A;  1Q0K A;  5L0H A;  256B A;  2QE9 A;  3K1I A;  3DKA A;  2DYR C;  4DRH B;  1YVI A;  4I44 A;  3B0U X;  1FMV A;  1OCO C;  1GGQ A;  4KNV A;  4Q4Z F;  1C03 A;  4W8K A;  4ULW A;  2V26 A;  3FVY A;  2A68 F;  3RQE A;  5F28 E;  3ZVR A;  4Z9I A;  1NFN A;  1RKE B;  3LUT B;  4NTF A;  2R03 A;  4ANJ A;  2YEV A;  3PDM P;  1DOW A;  4KBL A;  1TWG A;  3ZTZ A;  1SMY F;  3ECS A;  1ORY A;  3LES A;  1LKX A;  4IGG A;  4OD5 A;  3S9O A;  3V5Z A;  2D5R B;  2W4M A;  5FCL A;  5JUA A;  2Y3G A;  2Y39 A;  1V74 B;  2IXP A;  3RIP A;  4E0H A;  2A0B A;  3K1I C;  4MVZ A;  4PJL A;  4WJ0 A;  2CNW D;  3A9C A;  2HKV A;  4WGY A;  1WN0 A;  3T9O A;  5F5H A;  4JKV A;  2ZPA A;  4NY3 A;  1TFK B;  3S27 A;  4GQH A;  3ZWI A;  4JCZ A;  2CGE A;  3IPM O;  1CPR A;  4YT2 A;  4XEV A;  1HMD A;  4JCH A;  4C3D A;  1QZX A;  4A4A A;  2ICW G;  1L7C A;  3BEH A;  2XXA B;  3HNL A;  5AC4 A;  1C17 M;  4DVZ A;  1OQC A;  5D92 A;  1FTS A;  1FFH A;  2BL2 A;  2YLD A;  3Q6M A;  2R7W A;  3C8G B;  2YL3 A;  2GAQ A;  2HSQ A;  1M6T A;  3MX3 A;  1QPU A;  1BR1 A;  4PK4 A;  2X0C A;  3AGU A;  2Y69 C;  4XPW A;  4ULV A;  3M15 A;  2B0H A;  2H7O A;  3NMK A;  1Z5Z A;  1OXK A;  2EPN A;  3DJN B;  2LSE A;  3EZH A;  5KYY B;  2P61 A;  1XWJ A;  2A69 F;  2OCC C;  2WB7 A;  3EPV A;  1G8X A;  1Q0F A;  3M1C B;  4JTA B;  5KYN A;  2I15 A;  5E2Q A;  4JZA A;  1M56 C;  2EPL X;  2Q00 A;  4CJO A;  2XS8 A;  4AE4 B;  4QI2 A;  1I5N A;  5A6K A;  4J30 B;  1TWH A;  1NBB A;  3U9M A;  2KYH A;  4PAC A;  4AX2 A;  4BJT A;  1V55 C;  2OQM A;  2XL8 A;  3IQC A;  2XLV A;  3L8J A;  1Y6D A;  1E86 A;  1ZW3 A;  3LNR A;  4Q5S F;  5KYU B;  4EKW A;  4NTA A;  4MTF A;  3DE8 A;  3SXY A;  1LM3 B;  2IM8 A;  1PD1 A;  4C7O A;  2LQG A;  4G7H F;  3KKB A;  2YVK A;  1RKE A;  2ZXR A;  3TOM A;  4MW3 A;  1YYX A;  4JJG A;  3C18 A;  1H6G A;  3FAJ A;  3K6B A;  1FR0 A;  2HFI A;  3KL4 A;  2YZS A;  2J9U A;  1O5H A;  4RBN A;  4ONS A;  4YWQ A;  1PV3 A;  3DJU B;  5DQZ A;  4PR9 A;  3R7C A;  1AEP A;  1T6U A;  3B9Q A;  4O6Y A;  4DOZ A;  4XLN F;  1ZHX A;  3I5P A;  1AVO B;  4B6I A;  4ZLC A;  2HJM A;  1YZC A;  4N4W A;  3FOO A;  1M57 C;  4OIR F;  2XLO A;  1CGM E;  4XLP F;  2AWC A;  4YT8 A;  3EH1 A;  3EG9 B;  4MVO A;  2DI3 A;  1T01 A;  2PNO A;  3LEV A;  5KYX B;  2R7R A;  3CZ6 A;  4XPX A;  1YAR O;  1QVX A;  2NUP B;  3U8V A;  3ZG1 A;  3GM2 A;  2QUP A;  4NQF A;  1OW7 A;  1SR2 A;  3TOL A;  3HJC A;  3X1O A;  5KYX A;  1TR2 A;  2HMQ A;  1YAU O;  2HZ8 A;  5BQG A;  4C3B A;  5B1A C;  4LLE A;  4CIP A;  2PP4 A;  5DVW A;  2TMV P;  2L7A A;  1ZHY A;  1A41 A;  3NKE A;  4E18 A;  3LS1 A;  4QDL A;  3VM6 A;  3G4X A;  4CS7 A;  1Q0G A;  1I4Y A;  2GWW A;  4G7O F;  1A7D A;  2NPU A;  1IZM A;  3CEX A;  3HNI A;  3RQG A;  3UNG C;  1QLE C;  1HY5 A;  4ER9 A;  3GM3 A;  4D4N A;  1JR8 A;  1VYK A;  3I4U A;  3GWL A;  3OEO A;  2PFD A;  4OD4 A;  1D1C A;  3LLK A;  2YL7 A;  3CQZ A;  1QKR A;  4NC3 A;  1YA7 O;  1MND A;  3AG4 C;  3TUL A;  3HTK C;  2P6V A;  4FES A;  4YT4 A;  3ASO C;  4YL3 A;  5CI8 A;  5KYU A;  4AL0 A;  2EIJ C;  5T3W A;  2YLG A;  1VK5 A;  2XSE A;  3NMI A;  4JE9 A;  3TK0 A;  5L3Q A;  2YLI A;  3BRJ A;  2QTV A;  3QW1 A;  2EPK X;  3NRH A;  1TFO B;  3B0P A;  1NG1 A;  2A1D D;  1T5O A;  3FHD A;  3T6B A;  3WG7 C;  1WOL A;  4H4K C;  3RFY A;  2KW3 C;  3NDB B;  3IEE A;  4JIO A;  3RQF A;  4YT5 A;  2X51 A;  2Q9A A;  3Q7G A;  4EBK A;  4MW8 A;  5COF A;  3SZR A;  3VRC A;  2XLM A;  1T9K A;  1YDI A;  3JRM O;  3MBG A;  3JYY A;  1Y4C A;  3C7J A;  3QTH A;  2XL4 A;  3UR3 C;  1A0B A;  1HW1 A;  1SYQ A;  4JEA A;  4KI2 A;  3W8H A;  2UUI A;  4LDK A;  4MVS A;  2DGJ A;  3RVY A;  4CDA A;  5L0F A;  4BJ5 A;  1BBH A;  3OWT A;  3WOD F;  2R7S A;  1WAT A;  4OIO F;  3TJ6 A;  2M64 A;  2EPO A;  1RKC A;  2CW0 F;  4LLC A;  5K0I A;  2IXN A;  1UG7 A;  2ZXW C;  3DXJ F;  3K66 A;  2J9W A;  2YWA A;  2KGO A;  3ATP A;  3JSZ A;  4MS2 A;  2L9J A;  3S90 A;  2PX3 A;  2W4B A;  4E17 A;  3C63 A;  5L0C A;  3L8I A;  1MNE A;  3GOR A;  3HNJ A;  1OKK D;  2IXO A;  1XZP A;  3TQO A;  4F4B A;  4JEB A;  3JZ0 A;  3V7O A;  1R4T A;  3EG9 A;  3B29 A;  3GEI A;  1Z6A A;  1TWC A;  5HSW A;  4L6R A;  1W2W A;  2XLE A;  4XQ1 A;  5L3V A;  4LER A;  2J45 A;  4EBJ A;  3LNM B;  1LE4 A;  4MVQ A;  5FZT A;  5TJ5 E;  3X2Q C;  3PCV A;  4LDR A;  1A7E A;  2HMZ A;  4XWJ A;  1LS4 A;  2XXA A;  3S0X A;  2MHR A;  4Z9H A;  3JSE O;  3W2V A;  5A6A A;  4O79 A;  4DRJ B;  1I4Z A;  1J8M F;  2R7O A;  2J7P A;  4KC9 A;  1M2O A;  4IWB A;  1KNY A;  2YQY A;  4AE4 A;  4CS8 A;  4OIP F;  1D0Y A;  2PBE A;  4HFK B;  1K04 A;  3K1H A;  4J7Y A;  4JTD B;  3U9J A;  2AVK A;  2VCC A;  4N6C A;  4Q7C A;  3U5S A;  3CAX A;  2PX0 A;  1NU9 C;  4P9T A;  1OCC C;  2J8W A;  3EQL F;  3MFN A;  3UMK A;  4CX9 A;  2OG2 A;  1FNT c;  2OKU A;  2L81 A;  2ASR A;  4MND A;  1TQG A;  4AK9 A;  2EIL C;  2LK4 A;  2KNH A;  2KC3 A;  2J9V A;  4WAB A;  3C8G A;  4A2N B;  1LE2 A;  3H2U A;  2WZL A;  3NG1 A;  3EFO B;  3O10 A;  4MTO A;  2AWY A;  4N6H A;  2VCB A;  3H65 A;  4NTB A;  1RMV A;  1U0B B;  3TJ5 A;  2R05 A;  3T6J A;  2R7T A;  3GEH A;  1F1M A;  2JX0 A;  2QY9 A;  4U5C E;  2Z15 A;  3M79 A;  4HEA J;  4PFP A;  2ZD9 A;  4U5B E;  4CS8 C;  4MVR A;  5JVE A;  1D0X A;  2GDC A;  1O3U A;  1U6H A;  2WZF A;  4P6I C;  4BEM J;  1T6I A;  1C02 A;  4GEH A;  3W8I A;  2XLD A;  2XM4 A;  3DE9 A;  5BQI A;  4W8P A;  3WHN A;  1RXQ A;  1JRA A;  3L0I A;  3N2Z B;  4K0D A;  3SXZ A;  5JRA A;  5E3A A;  2HS5 A;  3RKO F;  3GM1 A;  1VOM A;  3SP1 A;  1RCP A;  1ST6 A;  3MYI A;  5DS5 A;  5AC5 A;  1G4W R;  2YKZ A;  2GFH A;  2J46 A;  1N1C A;  2LP4 A;  3EFO A;  1JAF A;  2OEX A;  1LI5 A;  3U2L A;  1SF8 A;  4BPM A;  4PJM A;  2YHS A;  3QVZ A;  1CGO A;  2KSF A;  4U5F E;  2E87 A;  2KK1 A;  4BG0 A;  2WVQ A;  2W9Y A;  2VC9 A;  1LPE A;  1H9G A;  3C8Z A;  3JCU Q;  2Q3T A;  5T3T A;  5A6J A;  4CS9 A;  2UUH A;  2V3C C;  2Y3H A;  3R2P A;  3DZA A;  2O9X A;  1M2V A;  4U5E E;  1ZHZ A;  3AQC A;  3EJN A;  3C8G D;  1T6Q A;  2KQ9 A;  5EK0 A;  3UMI A;  3RW0 A;  3DI5 A;  4I1M A;  3EHN A;  3LAY A;  5CIV A;  3LEO A;  4DRI B;  1VMA A;  1WWP A;  2P0N A;  2MYS A;  3EGD A;  2H7V C;  3NMJ A;  5JLI A;  4O6M A;  1PCX A;  3PMR A;  2R02 A;  5BUO A;  4DBR A;  1Z3I X;  5L0J A;  1JMW A;  1BZ4 A;  3MYF A;  3SEO A;  3ABL C;  3ZIB A;  2AU5 A;  2FGY A;  4PFO A;  4D4X A;  2NSF A;  5EGY A;  1QQ3 A;  3AJM A;  1JPJ A;  3W2W A;  3NKD A;  2D4U A;  3GEE A;  1VLT A;  1J8Y F;  1M2V B;  3M4B A;  3O55 A;  1YLM A;  5B3I A;  3B0V C;  4IAR A;  1KU2 A;  2J0W A;  2LFF A;  4HE8 D;  1VTM P;  3IQ6 A;  3DAF A;  3G50 A;  3GWN A;  4Z9J A;  3ASN C;  5KYY A;  4JW1 A;  4XTK A;  3O6X A;  2RD9 A;  1GQA A;  2HJ3 A;  3ABK C;  1NFO A;  1VB5 A;  2ZXP A;  3GOD A;  3KYI A;  4CDY A;  1EQ1 A;  2Q7R A;  2AP3 A;  4FAP B;  1A7V A;  1OKK A;  2FAP B;  3POV A;  4NCQ A;  3A11 A;  3Q7L A;  4KNW A;  2Q9B A;  1OR2 A;  3DMD A;  4WGZ A;  1E2X A;  3L1M A;  1OXB A;  4OIQ F;  1G5Z A;  1E84 A;  2J0X A;  2L6F A;  1RJ9 B;  4YL1 A;  2XLW A;  4IB4 A;  3S29 A;  3U2M A;  4U5H A;  1LVK A;  2F22 A;  3QVY A;  1ORS C;  4RD9 A;  4CIH A;  1TKN A;  3FXH A;  1YZA A;  1EKY A;  4PJJ A;  1B68 A;  2DYS C;  4U5D E;  3T4R A;  3N24 A;  4XPY A;  1VYI A;  2EIN C;  3ABM C;  1BR4 A;  1ZZP A;  4MTG A;  5COG A;  5DS6 A;  2WVN A;  4CSA A;  2CYD A;  1MMG A;  5JS5 A;  4DVY P;  4J7T A;  2QNL A;  3RYL A;  2LFD A;  2H7B A;  2WVO A;  3NYJ A;  1LI7 A;  2OJQ A;  2Y3D A;  4MVU A;  4IAQ A;  1HE1 A;  1D1A A;  3GAN A;  5A6B A;  2L6G A;  3V5X A;  3MLG A;  2G3V A;  1CPQ A;  3F47 A;  3ZQV A;  3IQ5 A;  1PD0 A;  3V5Y A;  4U9E A;  1LIH A;  1WGW A;  2I8B A;  1L3P A;  3AG3 C;  1H7I A;  3SYN A;  3M4C A;  4JVS A;  1V54 C;  2LIG A;  3E9V A;  1FFT C;  2CCY A;  1OCZ C;  2C03 A;  2BC5 A;  2WL8 A;  3LLI A;  1OR3 A;  4J32 B;  4MQ9 F;  3ZSU A;  2HSB A;  5B1B C;  5L0I A;  1E83 A;  5IY5 C;  3PHF 2;  1Z7Q c;  4IAO A;  2XRH A;  2B0J A;  4DJ9 A;  1WTY A;  1XZQ A;  3DM9 B;  2J7P D;  2VH3 A;  3EH2 A;  4IRU A;  5KYW A;  4UDV A;  5AGF A;  1NZE A;  3FDQ A;  4E0I A;  3U8P A;  4K7B A;  2EIK C;  1RJ9 A;  3S28 A;  2LD6 A;  1R5I D;  3JYH A;  2NUT A;  3U3F A;  4BJ6 A;  4BJ5 C;  5E3C A;  2BE5 F;  3H2V A;  3JTL O;  4JJF A;  5L0G A;  1HMO A;  1ZVZ A;  3HKK A;  3ITF A;  3NYL A;  1DOV A;  2IOQ A;  2JD3 A;  1GS9 A;  2QLA A;  2GA0 A;  3IQT A;  3HLZ A;  2XLH A;  5D91 A;  3UGO A;  3RF3 A;  1Z23 A;  2P7V A;  3EZI A;  2R7X A;  1YYJ A;  1H9T A;  3RH3 A;  4G0H A;  1UFB A;  2WZG A;  3OA1 A;  2Q9C A;  1Z63 A;  1JOG A;  1HE9 A;  4FWV A;  1GM5 A;  3JT1 A;  5DQT A;  1JPN A;  2HUJ A;  3U0C A;  2NSG A;  2NG1 A;  3AQB A;  3IHU A;  4IJJ A;  2RSE B;  5JP7 A;  1BR2 A;  2H8A A;  2XS1 A;  3ZDL A;  5HV9 A;  1G4U S;  3J06 A;  4JTC B; 
#chains in the Genus database with same CATH homology
 3R7C A;  3TK0 A;  3U5S A;  3MBG A;  3U2L A;  3O55 A;  4E0I A;  4E0H A;  3LLI A;  1JRA A;  3TD7 A;  2HJ3 A;  3U2M A;  1OQC A;  1JR8 A;  3GWN A;  3GWL A;  4LDK A;  3LLK A;  3W4Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...