4LDKA

Fad-linked sulfhydryl oxidase alr mutation
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
115
structure length
114
Chain Sequence
FREDCPPDREELGRHSWAVLHTLAAYYPDLPTPEQQQDMAQFIHLFSKFYPAEEAEDLRKRLARNHPDTRTRAAFTQWLCHLHNEVNRKLGKPDFDCSKVDERWRDGWKDGSCD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FAD-linked sulfhydryl oxidase ALR
publication title FAD-linked sulfhydryl oxidase ALR mutation
rcsb
source organism Homo sapiens
molecule tags Flavoprotein, oxidoreductase
total genus 43
structure length 114
sequence length 115
ec nomenclature ec 1.8.3.2: Thiol oxidase.
pdb deposition date 2013-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04777 Evr1_Alr Erv1 / Alr family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.310 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) ERV/ALR sulfhydryl oxidase domain 4ldkA00
3R7CA 3U2LA 3GWLA 2HJ3A 3TK0A 4E0IA 3GWNA 3LLIA 4E0HA 3W4YA 3MBGA 4LDKA 3LLKA 3U2MA 1JR8A 1JRAA 3TD7A 1OQCA 3O55A 3U5SA
chains in the Genus database with same CATH superfamily
4QDLA 1Z23A 3SXZA 1BZ4A 4MVZA 1LE2A 4G7HF 1LIHA 3JYHA 4BPMA 4DRJB 4GQHA 1Q0MA 4BJ6C 5JT4A 3V5YA 5KYYA 4OIOF 5A6BD 5KYUA 4LACB 1O3UA 1OKKD 3Q7LA 3EQLF 5E2QA 4W8KA 2QTVA 1BR4A 2A6HF 2J0WA 2B0HA 4C3EA 4N06A 1I4ZA 4AX2A 4YL1A 2UUIA 2FFHA 1GS9A 3SXKA 3IEEA 5E33A 3AG3C 4MW8A 1YAUO 3MX3A 3M4CA 3U8VA 5L0IA 3AG4C 3S0XA 3RQEA 1HMDA 2YL0A 3C18A 1GM5A 2XLOA 4BJ6A 5E3CA 1NBBA 2Y3DA 4B6IA 3M79A 4A2NB 4MTOA 2AWCA 2YL1A 5KYWB 5HV9A 3KYJA 1KTMA 4JKVA 2HJ3A 3CZ6A 3N2ZB 3VRCA 3ABMC 2R02A 2YLDA 4JURI 1R4TA 1NU9C 2Y3HA 2C04A 4JCZA 3T6BA 5K0IA 2EPKX 4JJFA 1M2VB 4CIHA 2G3KA 4KC9A 4OIPF 1D0YA 4DRHB 2YZSA 4XEKA 4D4XA 1E2XA 4CBEA 2YLGA 3QVZA 4XQ1A 3W8IA 1RCPA 4PR9A 4P9TA 1ZVZA 4LDRA 2A1DD 5DQZA 3B0PA 3SNHA 2KQ9A 3N0TA 3DE9A 3RIPA 3SXYA 2HS5A 3ASNC 2J9WA 3EG9B 3QW0A 3EZIA 2UUHA 3M4BA 4PFOA 2G3VA 4WGYA 3CSKA 3ZTMA 3VM6A 5CI8A 1K40A 4C3DA 4G0HA 2R7WA 2IXPA 4JTDB 2GFHA 2WL8A 5T1DB 4E17A 3I5QA 3VF0A 1NSGB 3ZQVA 1KU2A 3H65A 4DBRA 5D92A 1Z63A 2HKVA 2YHSA 3JSEO 1VMAA 1V54C 2R7QA 2EPLX 3I5PA 2EPMX 5JP7A 1MNEA 5TJ5E 3RW0A 3B29A 2QY9A 2VCAA 3ZWIA 5JRAA 2A68F 3N24A 5FZTA 2VCBA 4K1OA 4AK9A 4XLPF 2V3CC 2XL8A 2NUPB 2P1AA 3EGDB 4I1MA 3IQ6A 4HFFB 1RKCA 2OCCC 2L81A 3ECSA 3QW1A 4CJGA 4Q5SF 1S05A 1EA8A 3CQZA 3WG7C 4KNWA 1LM3B 4IAOA 3DAGA 3KKBA 1I4YA 3O55A 4P9FA 4NY3A 5BQGA 4C7OA 1Z3IX 1I5NA 1NLXA 4N4WA 3QZCA 1BDJB 4IRUA 1A7VA 3F47A 1BR2A 3EFOB 2BL2A 5L3QA 2C03A 2L6GA 2P7VA 2KGOA 2HSBA 1AEPA 4BJTA 4CS7A 1BR1A 1RJ9B 1TQGA 5AC4A 2LFDA 3RFYA 2WB7A 2PF4E 4CIPA 3T6GB 4ONSA 2J46A 1G8XA 4JTAB 1FR0A 4YK5A 1MMNA 3KPHA 1S7ZA 5KYYB 1YZAA 5KYUB 3S84A 4MVUA 1RMVA 1M57C 3WAQA 1OCRC 4AE4A 3EHNA 3G4XA 5D91A 2W9YA 4DRIB 1WATA 2ZXWC 2LIGA 2P6VA 3DM9B 3H2VA 2ASRA 1JR8A 1XZQA 2EPOA 2DB4A 3S29A 3GEIA 1OQCA 4P6IC 4D4NA 1B68A 2A0BA 2LSEA 4CS9A 5B1AC 1O5HA 3TJ5A 1XWJA 4E7SA 1YYJA 2EPNA 3F46A 4JEAA 3ZIBA 2KW3C 3AQCA 3JTLO 2Q3TA 4U5HA 4X0RA 1WN0A 3IQTA 3A11A 4EBKA 4U5GA 4LLCA 3MLGA 1MMDA 1ZU4A 2R05A 1JPNA 1Y6DA 3PMRA 2FGYA 2W45A 4LLEA 4O79A 1E84A 3OWTA 1QVXA 1EKYA 1D0XA 3GEHA 1YVIA 3FHDA 2XXAB 2XM4A 4R32A 3W4YA 4PJLA 1IW7F 3JRMO 1HE1A 2JD3A 5KYXA 2ZPAA 3ZQYA 3K33A 3KH2A 1E83A 4JC7A 4XEVA 4MW3A 4YT8A 3LNMB 1CPRA 1Q0DA 1H7IA 4Q7CA 2OU6A 5COGA 2WVQA 3J06A 1A41A 4N6HA 1WOLA 2OG2A 4ULVA 3U2LA 3Q6MA 4DVYP 3IPMO 4HE8D 4IB4A 2KC3A 1VB5A 2A69F 3LEOA 4DOZA 3GM1A 4JRZA 4CDAA 4CDVA 3X2QC 2Y69C 2LD6A 2MYSA 2R7UA 4JCHA 2NSFA 2L7AA 4JW1A 3W2WA 1QLEC 3IQCA 5L0JA 4XPXA 5COMA 2KYHA 2H7BA 1PD0A 1H6GA 3FXHA 4MVMA 1SF8A 2PFDA 1YDIA 4J30B 1OCCC 1CGNA 2YL7A 4XPYA 2DYRC 4I3MA 1JAFA 3LESA 1U89A 1E86A 4G78A 1YARO 3H2UA 4AL0A 2DYSC 1TKNA 1Y4CA 3RQGA 4QI0A 5HSWA 4PJNA 4Z9HA 1Z6AA 3JCUQ 3C7JA 3ZC4A 2R25A 5JS5A 3HJCA 1OCZC 4IJJA 3DMDA 3SXMA 2YRFA 5L0DA 3FMSA 1V55C 4C7OB 2R7XA 2B0JA 3NMKA 2CGEA 2XL4A 4YJWA 1UFBA 2QLAA 3HNIA 1ORJA 3RVZA 2TMVP 4CSAC 3PDMP 3JT1A 1T6IA 4EBBA 2F22A 1QZXA 2WZGA 2HV7A 2YQYA 4GEHA 4A4AA 1V74B 1NU7D 1OW7A 3EHMA 2VH3A 1FFTC 1FNTc 1QQ3A 2EINC 4AL1A 1LS4A 3U3FA 3JSZA 2Q9AA 4HEAJ 3SZRA 3VAYA 4CJOA 2J8WA 4MVOA 2A6EF 3E9VA 1NFNA 1ST6A 1ZZPA 2IOQA 1OR3A 3PCVA 5GPGB 3LS0A 2R03A 4MQ9F 1YZCA 1T6QA 4AE4B 1SYQA 3KYIA 3U9MA 3B0VC 3DKAA 3X1OA 2M64A 1PV3A 256BA 4W8PA 1CGME 2NUTB 4CSAA 2P61A 1C17M 1BBHA 1NG1A 1ZHTA 3EJNA 3UMHA 2L6HA 1YA7O 2YKZA 3L0IA 3UNGC 3C62A 2EIJC 3UMIA 5B1BC 2I8BA 1ZYRF 4E0IA 1G4US 2OEXA 1JMWA 1MMAA 4RBNA 2OOCA 3ABLC 4NC3A 1TWAA 1YJGA 2CCYA 3UMKA 2YWAA 4KI2A 3LJBA 5IY5C 5JUAA 4GYTA 2YVKA 3LLIA 3L34A 1OR2A 1WASA 2HSQA 2J9UA 2XM0A 3NYLA 4LDKA 1CGOA 2JX0A 4YL0A 3U2MA 1Q0KA 2ZXPA 2LP4A 3QTHA 3ASOC 4DBQA 3ZG1A 1KNYA 4XEFA 4E18A 5BUOA 5CI9A 2Q9CA 3S28A 1TR2A 4LERA 3EH1A 2M4EA 1VOMA 2CNWA 3C8GA 4XTKA 1T9KA 2AWYA 2IXMA 2XSEA 4PFPA 4JEBA 2DGJA 2VCCA 3OA1A 4CS9C 4H4KC 2VC9A 2KSFA 3M1CB 1AUEA 2AVKA 4NTBA 4EWCA 2KJGA 1TWHA 2L9JA 4HFKB 2X0CA 3ITFA 5AGFA 3US6A 4CDYA 4JIOA 4JTCB 3W2VA 5A69A 2BC5A 2J9BA 1L7CA 1R5ID 2Z15A 1L3PA 4LDQA 2PX0A 3FOPA 5F5HA 5A6JA 4FWVA 2WZLA 2CNWD 3C8GD 4U9EA 1JOGA 1Q0FA 4U5BE 2Y3BA 1VK5A 3AG2C 4NCQA 5KYWA 2D4UA 1OXBA 1YLMA 3AOUA 4J7TA 2HFIA 1D1BA 2RD9A 3U9JA 3FAJA 2QNLA 2L6FA 4IARA 2EIMC 1Z7Qc 1HW2A 1GQAA 3MYFA 4WGZA 4ZLCA 2HMQA 1RKEA 1DOWA 3LUTB 4OIRF 3DXJF 4O6YA 3TK0A 1LS1A 2R7VA 2HZ8A 1TWGA 2KK1A 3GANA 2G62A 4MTGA 3Q7GA 5EK0A 3TULA 2KNHA 2XS8A 3EGXA 4IAQA 1ZHXA 3RF3A 3G50A 4EKWA 1HY5A 1SR2A 3EG9A 4IGGA 3W8HA 1LPEA 1W2WA 2RSEB 4I1OB 3K1HA 2GWWA 2EIKC 5DS4A 4PK4A 1A7EA 1VYIA 3MBGA 2OQMA 1E85A 4Z9JA 1Z5ZA 4WABA 1JRAA 2WVNA 3NMIA 1U0BB 4PJMA 4KBLA 4IWBA 4CX9A 4PACA 5AC5A 4FX5A 1GGQA 1VLTA 3TQOA 5L0HA 5E3AA 3LNRA 4ULWA 3EPVA 3B0UX 3TOLA 1EI7A 3NMJA 4K0DA 3Q6NA 3V5XA 1JPJA 3DJNB 1T5OA 2WZFA 4K7BA 1HW1A 4O6MA 3C8ZA 2GDCA 3WODF 4PJJA 3L1MA 2NUPA 1A0BA 3EGDA 3GORA 3JZ0A 1FTSA 4KNVA 2JPUA 2OJQA 4DVZA 2OKUA 3NDBB 1D0ZA 2J45A 3VYWA 3PHF2 2MWQA 2CYDA 3O6XA 2PP4A 2LCHA 1XZPA 1YYXA 1M2OA 5JSLA 4DJ9A 3ZDLA 3S90A 4CS8A 4L6RA 3ABKC 3KL4A 4J32B 1D1CA 1ZW3A 1AVOB 3DE8A 3EFOA 4MVRA 2W4MA 2Y3GA 1C03A 2AU5A 2VB6A 3DZAA 3LEVA 4NTFA 2IXNA 3BRJA 5T3WA 2ZXOA 3LS1A 3RVYA 3SYNA 1FMWA 3TOMA 5EHHA 3RH3A 3TD7A 5BQIA 3DM5A 4YWQA 2J0XA 2YLIA 3K1IC 2ZD9A 3ZSUA 3O10A 2EILC 5F5FA 1VYKA 3EZHA 2ZXRA 3IQ5A 2IXOA 4WJ0A 1HE9A 3MYIA 2IM8A 4G7OF 5DS6A 5L0CA 1CPQA 2Q9BA 4U5DE 1N1CA 1QKRA 3GM3A 3JYYA 3C8GB 3T9OA 4OD4A 2P0NA 5KYNA 1WTYA 3KMIA 1SZIA 1ORSC 3UR3C 2XS1A 3U8PA 4I44A 4JE9A 3FAPB 4BJ5C 3DAFA 4JZAA 3U0CA 4ER9A 2H7VC 1NZEA 2Y39A 3SP1A 3E70C 3FOOA 2H8AA 3AGTA 3K1IA 4MTFA 5L3VA 3UGOA 1APCA 3GEEA 3CEXA 5EGYA 2XRHA 1RXQA 2HJMA 3HNLA 3UGPA 1HMOA 2ETSA 3ATPA 3WHNA 2HUJA 2O9XA 3HNKA 3HNJA 4MVSA 4YT4A 3FVYA 1FAPB 2XLWA 4OINF 1M56C 3QMKA 1ZW2A 2YEVA 4BEMJ 3GWLA 1MNDA 2XXAA 4N6CA 5L0FA 2X51A 1LVKA 1YA9A 1OCOC 2MHRA 4U5CE 4JVSA 4O6NA 4BJ1A 2E87A 3GWNA 1F1MA 1RKEB 2HV6A 4BJ5A 2W4BA 2YL3A 1T6UA 4YN0B 4F4BA 5JLIA 1OW8A 2I15A 4Z9IA 2OEVA 3EGXB 1FMVA 5T3TA 3ZTZA 3K7DA 4MNDA 2NPUA 2XL6A 1TFKB 2Q7RA 5B3IA 3AQBA 3L8IA 4Q4ZF 1QPUA 1VLSA 3G4ZA 1K04A 3RYLA 4EUKB 3O39A 3DJUB 3R7CA 3RKOF 4FAPB 5KYXB 1LI5A 2V26A 2CW0F 5COFA 5FCLA 1H9TA 2DI3A 5JVEA 3V7OA 1D1AA 2H7OA 3BEHA 1UG7A 2CDQA 3OEOA 2XLVA 1J8MF 3T6JA 1V4AA 3MFNA 4OIQF 2PNOA 3EH2A 4NTAA 2D5RB 3R2PA 3AJMA 3JRTA 4YL3A 3SEOA 4UDVA 3AGUA 2LK4A 3NKEA 4QI2A 4RD9A 3L8JA 4E0HA 3NRHA 4H54A 4U9DA 4G7ZF 1DOVA 3POVA 3A9CA 3T4RA 4BEJA 2A0UA 1T01A 2IBFA 2XLHA 1NFOA 3LLKA 1EQ1A 2HMZA 3QVYA 3NYMA 3NYJA 1ZU5A 2ICWG 2QUPA 5F28E 3U3BA 1OW6A 3RQFA 5DLJA 5A6AA 3V5ZA 3ZVRA 4U5EE 4MS2A 3FDQA 4MVQA 2Q00A 2NG1A 5B3SC 4U5FE 1A7DA 1MQVA 3I4UA 4J7YA 1ZHWA 1M2VA 4YT2A 4M63A 2IYLD 5DVWA 1Q0GA 4NQFA 1LI7A 5DS5A 1LE4A 4EBJA 3GODA 2LFFA 3TJ6A 5L0GA 2R7SA 4OD5A 4DXWA 2FAPB 2XLEA 3K66A 1J8YF 1O87A 2OJED 4EIYA 4JJGA 1PCXA 2Q4FA 1U6HA 1SMYF 4E7ZA 2NUTA 1G4WR 3B71A 3HTKC 4EHPA 3IHUA 2XLDA 3AG1C 1LKXA 1FFHA 4BG0A 4CS8C 2R9RB 4ZLDA 1OXKA 5CIVA 2AP3A 1C02A 2BE5F 1PD1A 3S9OA 2R7TA 1G5ZA 4C3BA 2WVOA 3HKKA 1VTMP 3M15A 5A6KA 3NKDA 2J7PA 1QSPA 2XLMA 3DD7A 3DWWA 3C63A 4FESA 5BQHA 5DQTA 4YT5A 1WGWA 3GM2A 2PBEA 1TFOB 2PX3A 3HLZA 2R7RA 2NSGA 2QE9A 4XWJA 1M6TA 2GAQA 2R7OA 4ANJA 1WWPA 3NG1A 4RDAA 4O7GA 2J9VA 5A6BA 1OKKA 1K05A 1H9GA 3LAYA 3S27A 1ZHYA 2J7PD 3B9QA 4XPWA 3DI5A 1ZHZA 2GA0A 1IZMA 2LQGA 3CAXA 1MMGA 1TWCA 1RJ9A 1ORYA 2VASA 3U5SA 3K6BA 4XLNF
chains in the Genus database with same CATH topology
3R7CA 3U2LA 3GWLA 2HJ3A 3TK0A 4E0IA 3GWNA 3LLIA 4E0HA 3W4YA 3MBGA 4LDKA 3LLKA 3U2MA 1JR8A 1JRAA 3TD7A 1OQCA 3O55A 3U5SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3R7C A;  3U2L A;  3GWL A;  2HJ3 A;  3TK0 A;  4E0I A;  3GWN A;  3LLI A;  4E0H A;  3W4Y A;  3MBG A;  4LDK A;  3LLK A;  3U2M A;  1JR8 A;  1JRA A;  3TD7 A;  1OQC A;  3O55 A;  3U5S A; 
#chains in the Genus database with same CATH topology
 4QDL A;  1Z23 A;  3SXZ A;  1BZ4 A;  4MVZ A;  1LE2 A;  4G7H F;  1LIH A;  3JYH A;  4BPM A;  4DRJ B;  4GQH A;  1Q0M A;  4BJ6 C;  5JT4 A;  3V5Y A;  5KYY A;  4OIO F;  5A6B D;  5KYU A;  4LAC B;  1O3U A;  1OKK D;  3Q7L A;  3EQL F;  5E2Q A;  4W8K A;  2QTV A;  1BR4 A;  2A6H F;  2J0W A;  2B0H A;  4C3E A;  4N06 A;  1I4Z A;  4AX2 A;  4YL1 A;  2UUI A;  2FFH A;  1GS9 A;  3SXK A;  3IEE A;  5E33 A;  3AG3 C;  4MW8 A;  1YAU O;  3MX3 A;  3M4C A;  3U8V A;  5L0I A;  3AG4 C;  3S0X A;  3RQE A;  1HMD A;  2YL0 A;  3C18 A;  1GM5 A;  2XLO A;  4BJ6 A;  5E3C A;  1NBB A;  2Y3D A;  4B6I A;  3M79 A;  4A2N B;  4MTO A;  2AWC A;  2YL1 A;  5KYW B;  5HV9 A;  3KYJ A;  1KTM A;  4JKV A;  2HJ3 A;  3CZ6 A;  3N2Z B;  3VRC A;  3ABM C;  2R02 A;  2YLD A;  4JUR I;  1R4T A;  1NU9 C;  2Y3H A;  2C04 A;  4JCZ A;  3T6B A;  5K0I A;  2EPK X;  4JJF A;  1M2V B;  4CIH A;  2G3K A;  4KC9 A;  4OIP F;  1D0Y A;  4DRH B;  2YZS A;  4XEK A;  4D4X A;  1E2X A;  4CBE A;  2YLG A;  3QVZ A;  4XQ1 A;  3W8I A;  1RCP A;  4PR9 A;  4P9T A;  1ZVZ A;  4LDR A;  2A1D D;  5DQZ A;  3B0P A;  3SNH A;  2KQ9 A;  3N0T A;  3DE9 A;  3RIP A;  3SXY A;  2HS5 A;  3ASN C;  2J9W A;  3EG9 B;  3QW0 A;  3EZI A;  2UUH A;  3M4B A;  4PFO A;  2G3V A;  4WGY A;  3CSK A;  3ZTM A;  3VM6 A;  5CI8 A;  1K40 A;  4C3D A;  4G0H A;  2R7W A;  2IXP A;  4JTD B;  2GFH A;  2WL8 A;  5T1D B;  4E17 A;  3I5Q A;  3VF0 A;  1NSG B;  3ZQV A;  1KU2 A;  3H65 A;  4DBR A;  5D92 A;  1Z63 A;  2HKV A;  2YHS A;  3JSE O;  1VMA A;  1V54 C;  2R7Q A;  2EPL X;  3I5P A;  2EPM X;  5JP7 A;  1MNE A;  5TJ5 E;  3RW0 A;  3B29 A;  2QY9 A;  2VCA A;  3ZWI A;  5JRA A;  2A68 F;  3N24 A;  5FZT A;  2VCB A;  4K1O A;  4AK9 A;  4XLP F;  2V3C C;  2XL8 A;  2NUP B;  2P1A A;  3EGD B;  4I1M A;  3IQ6 A;  4HFF B;  1RKC A;  2OCC C;  2L81 A;  3ECS A;  3QW1 A;  4CJG A;  4Q5S F;  1S05 A;  1EA8 A;  3CQZ A;  3WG7 C;  4KNW A;  1LM3 B;  4IAO A;  3DAG A;  3KKB A;  1I4Y A;  3O55 A;  4P9F A;  4NY3 A;  5BQG A;  4C7O A;  1Z3I X;  1I5N A;  1NLX A;  4N4W A;  3QZC A;  1BDJ B;  4IRU A;  1A7V A;  3F47 A;  1BR2 A;  3EFO B;  2BL2 A;  5L3Q A;  2C03 A;  2L6G A;  2P7V A;  2KGO A;  2HSB A;  1AEP A;  4BJT A;  4CS7 A;  1BR1 A;  1RJ9 B;  1TQG A;  5AC4 A;  2LFD A;  3RFY A;  2WB7 A;  2PF4 E;  4CIP A;  3T6G B;  4ONS A;  2J46 A;  1G8X A;  4JTA B;  1FR0 A;  4YK5 A;  1MMN A;  3KPH A;  1S7Z A;  5KYY B;  1YZA A;  5KYU B;  3S84 A;  4MVU A;  1RMV A;  1M57 C;  3WAQ A;  1OCR C;  4AE4 A;  3EHN A;  3G4X A;  5D91 A;  2W9Y A;  4DRI B;  1WAT A;  2ZXW C;  2LIG A;  2P6V A;  3DM9 B;  3H2V A;  2ASR A;  1JR8 A;  1XZQ A;  2EPO A;  2DB4 A;  3S29 A;  3GEI A;  1OQC A;  4P6I C;  4D4N A;  1B68 A;  2A0B A;  2LSE A;  4CS9 A;  5B1A C;  1O5H A;  3TJ5 A;  1XWJ A;  4E7S A;  1YYJ A;  2EPN A;  3F46 A;  4JEA A;  3ZIB A;  2KW3 C;  3AQC A;  3JTL O;  2Q3T A;  4U5H A;  4X0R A;  1WN0 A;  3IQT A;  3A11 A;  4EBK A;  4U5G A;  4LLC A;  3MLG A;  1MMD A;  1ZU4 A;  2R05 A;  1JPN A;  1Y6D A;  3PMR A;  2FGY A;  2W45 A;  4LLE A;  4O79 A;  1E84 A;  3OWT A;  1QVX A;  1EKY A;  1D0X A;  3GEH A;  1YVI A;  3FHD A;  2XXA B;  2XM4 A;  4R32 A;  3W4Y A;  4PJL A;  1IW7 F;  3JRM O;  1HE1 A;  2JD3 A;  5KYX A;  2ZPA A;  3ZQY A;  3K33 A;  3KH2 A;  1E83 A;  4JC7 A;  4XEV A;  4MW3 A;  4YT8 A;  3LNM B;  1CPR A;  1Q0D A;  1H7I A;  4Q7C A;  2OU6 A;  5COG A;  2WVQ A;  3J06 A;  1A41 A;  4N6H A;  1WOL A;  2OG2 A;  4ULV A;  3U2L A;  3Q6M A;  4DVY P;  3IPM O;  4HE8 D;  4IB4 A;  2KC3 A;  1VB5 A;  2A69 F;  3LEO A;  4DOZ A;  3GM1 A;  4JRZ A;  4CDA A;  4CDV A;  3X2Q C;  2Y69 C;  2LD6 A;  2MYS A;  2R7U A;  4JCH A;  2NSF A;  2L7A A;  4JW1 A;  3W2W A;  1QLE C;  3IQC A;  5L0J A;  4XPX A;  5COM A;  2KYH A;  2H7B A;  1PD0 A;  1H6G A;  3FXH A;  4MVM A;  1SF8 A;  2PFD A;  1YDI A;  4J30 B;  1OCC C;  1CGN A;  2YL7 A;  4XPY A;  2DYR C;  4I3M A;  1JAF A;  3LES A;  1U89 A;  1E86 A;  4G78 A;  1YAR O;  3H2U A;  4AL0 A;  2DYS C;  1TKN A;  1Y4C A;  3RQG A;  4QI0 A;  5HSW A;  4PJN A;  4Z9H A;  1Z6A A;  3JCU Q;  3C7J A;  3ZC4 A;  2R25 A;  5JS5 A;  3HJC A;  1OCZ C;  4IJJ A;  3DMD A;  3SXM A;  2YRF A;  5L0D A;  3FMS A;  1V55 C;  4C7O B;  2R7X A;  2B0J A;  3NMK A;  2CGE A;  2XL4 A;  4YJW A;  1UFB A;  2QLA A;  3HNI A;  1ORJ A;  3RVZ A;  2TMV P;  4CSA C;  3PDM P;  3JT1 A;  1T6I A;  4EBB A;  2F22 A;  1QZX A;  2WZG A;  2HV7 A;  2YQY A;  4GEH A;  4A4A A;  1V74 B;  1NU7 D;  1OW7 A;  3EHM A;  2VH3 A;  1FFT C;  1FNT c;  1QQ3 A;  2EIN C;  4AL1 A;  1LS4 A;  3U3F A;  3JSZ A;  2Q9A A;  4HEA J;  3SZR A;  3VAY A;  4CJO A;  2J8W A;  4MVO A;  2A6E F;  3E9V A;  1NFN A;  1ST6 A;  1ZZP A;  2IOQ A;  1OR3 A;  3PCV A;  5GPG B;  3LS0 A;  2R03 A;  4MQ9 F;  1YZC A;  1T6Q A;  4AE4 B;  1SYQ A;  3KYI A;  3U9M A;  3B0V C;  3DKA A;  3X1O A;  2M64 A;  1PV3 A;  256B A;  4W8P A;  1CGM E;  2NUT B;  4CSA A;  2P61 A;  1C17 M;  1BBH A;  1NG1 A;  1ZHT A;  3EJN A;  3UMH A;  2L6H A;  1YA7 O;  2YKZ A;  3L0I A;  3UNG C;  3C62 A;  2EIJ C;  3UMI A;  5B1B C;  2I8B A;  1ZYR F;  4E0I A;  1G4U S;  2OEX A;  1JMW A;  1MMA A;  4RBN A;  2OOC A;  3ABL C;  4NC3 A;  1TWA A;  1YJG A;  2CCY A;  3UMK A;  2YWA A;  4KI2 A;  3LJB A;  5IY5 C;  5JUA A;  4GYT A;  2YVK A;  3LLI A;  3L34 A;  1OR2 A;  1WAS A;  2HSQ A;  2J9U A;  2XM0 A;  3NYL A;  4LDK A;  1CGO A;  2JX0 A;  4YL0 A;  3U2M A;  1Q0K A;  2ZXP A;  2LP4 A;  3QTH A;  3ASO C;  4DBQ A;  3ZG1 A;  1KNY A;  4XEF A;  4E18 A;  5BUO A;  5CI9 A;  2Q9C A;  3S28 A;  1TR2 A;  4LER A;  3EH1 A;  2M4E A;  1VOM A;  2CNW A;  3C8G A;  4XTK A;  1T9K A;  2AWY A;  2IXM A;  2XSE A;  4PFP A;  4JEB A;  2DGJ A;  2VCC A;  3OA1 A;  4CS9 C;  4H4K C;  2VC9 A;  2KSF A;  3M1C B;  1AUE A;  2AVK A;  4NTB A;  4EWC A;  2KJG A;  1TWH A;  2L9J A;  4HFK B;  2X0C A;  3ITF A;  5AGF A;  3US6 A;  4CDY A;  4JIO A;  4JTC B;  3W2V A;  5A69 A;  2BC5 A;  2J9B A;  1L7C A;  1R5I D;  2Z15 A;  1L3P A;  4LDQ A;  2PX0 A;  3FOP A;  5F5H A;  5A6J A;  4FWV A;  2WZL A;  2CNW D;  3C8G D;  4U9E A;  1JOG A;  1Q0F A;  4U5B E;  2Y3B A;  1VK5 A;  3AG2 C;  4NCQ A;  5KYW A;  2D4U A;  1OXB A;  1YLM A;  3AOU A;  4J7T A;  2HFI A;  1D1B A;  2RD9 A;  3U9J A;  3FAJ A;  2QNL A;  2L6F A;  4IAR A;  2EIM C;  1Z7Q c;  1HW2 A;  1GQA A;  3MYF A;  4WGZ A;  4ZLC A;  2HMQ A;  1RKE A;  1DOW A;  3LUT B;  4OIR F;  3DXJ F;  4O6Y A;  3TK0 A;  1LS1 A;  2R7V A;  2HZ8 A;  1TWG A;  2KK1 A;  3GAN A;  2G62 A;  4MTG A;  3Q7G A;  5EK0 A;  3TUL A;  2KNH A;  2XS8 A;  3EGX A;  4IAQ A;  1ZHX A;  3RF3 A;  3G50 A;  4EKW A;  1HY5 A;  1SR2 A;  3EG9 A;  4IGG A;  3W8H A;  1LPE A;  1W2W A;  2RSE B;  4I1O B;  3K1H A;  2GWW A;  2EIK C;  5DS4 A;  4PK4 A;  1A7E A;  1VYI A;  3MBG A;  2OQM A;  1E85 A;  4Z9J A;  1Z5Z A;  4WAB A;  1JRA A;  2WVN A;  3NMI A;  1U0B B;  4PJM A;  4KBL A;  4IWB A;  4CX9 A;  4PAC A;  5AC5 A;  4FX5 A;  1GGQ A;  1VLT A;  3TQO A;  5L0H A;  5E3A A;  3LNR A;  4ULW A;  3EPV A;  3B0U X;  3TOL A;  1EI7 A;  3NMJ A;  4K0D A;  3Q6N A;  3V5X A;  1JPJ A;  3DJN B;  1T5O A;  2WZF A;  4K7B A;  1HW1 A;  4O6M A;  3C8Z A;  2GDC A;  3WOD F;  4PJJ A;  3L1M A;  2NUP A;  1A0B A;  3EGD A;  3GOR A;  3JZ0 A;  1FTS A;  4KNV A;  2JPU A;  2OJQ A;  4DVZ A;  2OKU A;  3NDB B;  1D0Z A;  2J45 A;  3VYW A;  3PHF 2;  2MWQ A;  2CYD A;  3O6X A;  2PP4 A;  2LCH A;  1XZP A;  1YYX A;  1M2O A;  5JSL A;  4DJ9 A;  3ZDL A;  3S90 A;  4CS8 A;  4L6R A;  3ABK C;  3KL4 A;  4J32 B;  1D1C A;  1ZW3 A;  1AVO B;  3DE8 A;  3EFO A;  4MVR A;  2W4M A;  2Y3G A;  1C03 A;  2AU5 A;  2VB6 A;  3DZA A;  3LEV A;  4NTF A;  2IXN A;  3BRJ A;  5T3W A;  2ZXO A;  3LS1 A;  3RVY A;  3SYN A;  1FMW A;  3TOM A;  5EHH A;  3RH3 A;  3TD7 A;  5BQI A;  3DM5 A;  4YWQ A;  2J0X A;  2YLI A;  3K1I C;  2ZD9 A;  3ZSU A;  3O10 A;  2EIL C;  5F5F A;  1VYK A;  3EZH A;  2ZXR A;  3IQ5 A;  2IXO A;  4WJ0 A;  1HE9 A;  3MYI A;  2IM8 A;  4G7O F;  5DS6 A;  5L0C A;  1CPQ A;  2Q9B A;  4U5D E;  1N1C A;  1QKR A;  3GM3 A;  3JYY A;  3C8G B;  3T9O A;  4OD4 A;  2P0N A;  5KYN A;  1WTY A;  3KMI A;  1SZI A;  1ORS C;  3UR3 C;  2XS1 A;  3U8P A;  4I44 A;  4JE9 A;  3FAP B;  4BJ5 C;  3DAF A;  4JZA A;  3U0C A;  4ER9 A;  2H7V C;  1NZE A;  2Y39 A;  3SP1 A;  3E70 C;  3FOO A;  2H8A A;  3AGT A;  3K1I A;  4MTF A;  5L3V A;  3UGO A;  1APC A;  3GEE A;  3CEX A;  5EGY A;  2XRH A;  1RXQ A;  2HJM A;  3HNL A;  3UGP A;  1HMO A;  2ETS A;  3ATP A;  3WHN A;  2HUJ A;  2O9X A;  3HNK A;  3HNJ A;  4MVS A;  4YT4 A;  3FVY A;  1FAP B;  2XLW A;  4OIN F;  1M56 C;  3QMK A;  1ZW2 A;  2YEV A;  4BEM J;  3GWL A;  1MND A;  2XXA A;  4N6C A;  5L0F A;  2X51 A;  1LVK A;  1YA9 A;  1OCO C;  2MHR A;  4U5C E;  4JVS A;  4O6N A;  4BJ1 A;  2E87 A;  3GWN A;  1F1M A;  1RKE B;  2HV6 A;  4BJ5 A;  2W4B A;  2YL3 A;  1T6U A;  4YN0 B;  4F4B A;  5JLI A;  1OW8 A;  2I15 A;  4Z9I A;  2OEV A;  3EGX B;  1FMV A;  5T3T A;  3ZTZ A;  3K7D A;  4MND A;  2NPU A;  2XL6 A;  1TFK B;  2Q7R A;  5B3I A;  3AQB A;  3L8I A;  4Q4Z F;  1QPU A;  1VLS A;  3G4Z A;  1K04 A;  3RYL A;  4EUK B;  3O39 A;  3DJU B;  3R7C A;  3RKO F;  4FAP B;  5KYX B;  1LI5 A;  2V26 A;  2CW0 F;  5COF A;  5FCL A;  1H9T A;  2DI3 A;  5JVE A;  3V7O A;  1D1A A;  2H7O A;  3BEH A;  1UG7 A;  2CDQ A;  3OEO A;  2XLV A;  1J8M F;  3T6J A;  1V4A A;  3MFN A;  4OIQ F;  2PNO A;  3EH2 A;  4NTA A;  2D5R B;  3R2P A;  3AJM A;  3JRT A;  4YL3 A;  3SEO A;  4UDV A;  3AGU A;  2LK4 A;  3NKE A;  4QI2 A;  4RD9 A;  3L8J A;  4E0H A;  3NRH A;  4H54 A;  4U9D A;  4G7Z F;  1DOV A;  3POV A;  3A9C A;  3T4R A;  4BEJ A;  2A0U A;  1T01 A;  2IBF A;  2XLH A;  1NFO A;  3LLK A;  1EQ1 A;  2HMZ A;  3QVY A;  3NYM A;  3NYJ A;  1ZU5 A;  2ICW G;  2QUP A;  5F28 E;  3U3B A;  1OW6 A;  3RQF A;  5DLJ A;  5A6A A;  3V5Z A;  3ZVR A;  4U5E E;  4MS2 A;  3FDQ A;  4MVQ A;  2Q00 A;  2NG1 A;  5B3S C;  4U5F E;  1A7D A;  1MQV A;  3I4U A;  4J7Y A;  1ZHW A;  1M2V A;  4YT2 A;  4M63 A;  2IYL D;  5DVW A;  1Q0G A;  4NQF A;  1LI7 A;  5DS5 A;  1LE4 A;  4EBJ A;  3GOD A;  2LFF A;  3TJ6 A;  5L0G A;  2R7S A;  4OD5 A;  4DXW A;  2FAP B;  2XLE A;  3K66 A;  1J8Y F;  1O87 A;  2OJE D;  4EIY A;  4JJG A;  1PCX A;  2Q4F A;  1U6H A;  1SMY F;  4E7Z A;  2NUT A;  1G4W R;  3B71 A;  3HTK C;  4EHP A;  3IHU A;  2XLD A;  3AG1 C;  1LKX A;  1FFH A;  4BG0 A;  4CS8 C;  2R9R B;  4ZLD A;  1OXK A;  5CIV A;  2AP3 A;  1C02 A;  2BE5 F;  1PD1 A;  3S9O A;  2R7T A;  1G5Z A;  4C3B A;  2WVO A;  3HKK A;  1VTM P;  3M15 A;  5A6K A;  3NKD A;  2J7P A;  1QSP A;  2XLM A;  3DD7 A;  3DWW A;  3C63 A;  4FES A;  5BQH A;  5DQT A;  4YT5 A;  1WGW A;  3GM2 A;  2PBE A;  1TFO B;  2PX3 A;  3HLZ A;  2R7R A;  2NSG A;  2QE9 A;  4XWJ A;  1M6T A;  2GAQ A;  2R7O A;  4ANJ A;  1WWP A;  3NG1 A;  4RDA A;  4O7G A;  2J9V A;  5A6B A;  1OKK A;  1K05 A;  1H9G A;  3LAY A;  3S27 A;  1ZHY A;  2J7P D;  3B9Q A;  4XPW A;  3DI5 A;  1ZHZ A;  2GA0 A;  1IZM A;  2LQG A;  3CAX A;  1MMG A;  1TWC A;  1RJ9 A;  1ORY A;  2VAS A;  3U5S A;  3K6B A;  4XLN F; 
#chains in the Genus database with same CATH homology
 3R7C A;  3U2L A;  3GWL A;  2HJ3 A;  3TK0 A;  4E0I A;  3GWN A;  3LLI A;  4E0H A;  3W4Y A;  3MBG A;  4LDK A;  3LLK A;  3U2M A;  1JR8 A;  1JRA A;  3TD7 A;  1OQC A;  3O55 A;  3U5S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...