4LDKA

Fad-linked sulfhydryl oxidase alr mutation
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
115
structure length
114
Chain Sequence
b'FREDCPPDREELGRHSWAVLHTLAAYYPDLPTPEQQQDMAQFIHLFSKFYPAEEAEDLRKRLARNHPDTRTRAAFTQWLCHLHNEVNRKLGKPDFDCSKVDERWRDGWKDGSCD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FAD-linked sulfhydryl oxidase ALR
publication title FAD-linked sulfhydryl oxidase ALR mutation
rcsb
source organism Homo sapiens
molecule tags Flavoprotein, oxidoreductase
total genus 43
structure length 114
sequence length 115
ec nomenclature ec 1.8.3.2: Thiol oxidase.
pdb deposition date 2013-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04777 Evr1_Alr Erv1 / Alr family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.310 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) ERV/ALR sulfhydryl oxidase domain 4ldkA00
3TK0A 3R7CA 3U2MA 4E0IA 3U5SA 4E0HA 3U2LA 3MBGA 1JRAA 3TD7A 3GWNA 3LLIA 1OQCA 4LDKA 3LLKA 3W4YA 2HJ3A 3GWLA 3O55A 1JR8A
chains in the Genus database with same CATH superfamily
1Q0DA 2KC3A 1QQ3A 3ZG1A 3U2MA 4H4KC 3R2PA 4YK5A 3C8ZA 3EGXB 2RD9A 2LCHA 1WN0A 1B68A 2IXPA 2MYSA 2LP4A 2OG2A 1GQAA 3E70C 4OD5A 3DZAA 3PCVA 2WVNA 5KYWA 2Y39A 5L0JA 1QSPA 3EFOA 4BEMJ 2NUPA 1YDIA 3AGTA 1YZCA 3LJBA 2EINC 1VOMA 2R7SA 2Q9AA 5BQHA 3QW0A 4MVRA 4OIPF 2NSFA 3OWTA 1MNDA 3NMJA 5EHHA 2KYHA 2IBFA 2CNWA 2GAQA 2J9UA 1T6IA 2R25A 4DBRA 5L0GA 4XEFA 2J9BA 5JS5A 1D1CA 2ZXPA 3G4ZA 4JW1A 1FAPB 4JCZA 3OEOA 1OR3A 2LFFA 4BJ5C 1TWHA 1ZHXA 1QZXA 3C18A 2QE9A 2VCAA 3NG1A 3NRHA 4K0DA 3RH3A 4YWQA 1MMGA 3HTKC 2YZSA 5FCLA 3TQOA 5A6BA 4EUKB 4I44A 1OW8A 2XM0A 3UMHA 3FDQA 2OEVA 3M15A 1SF8A 4BEJA 4O6YA 3FMSA 1Z3IX 4MQ9F 3UGOA 1OR2A 2C04A 3EHNA 4LLCA 2HUJA 2G62A 1TKNA 4U9DA 2J7PA 3O39A 4CJOA 2YVKA 2G3KA 3W8HA 2WVQA 3FOPA 3MYIA 1VYKA 3UMIA 3K33A 1DOWA 3B0PA 2YL0A 1JPNA 1C03A 2Q4FA 1A7EA 4CS9A 1VYIA 4PJJA 4WJ0A 1BZ4A 2CCYA 2QLAA 2OQMA 4YL1A 5F5HA 1ST6A 4JVSA 2HSQA 3CZ6A 2EPNA 2OJQA 3WODF 1FMWA 5KYYB 5DQTA 3FAPB 5KYUA 4LERA 3DMDA 1YYXA 4PFOA 4U5HA 4HE8D 4NC3A 4EHPA 4CJGA 3L8JA 2A1DD 2W4BA 3AJMA 1VTMP 4PJNA 2UUIA 3Q7LA 1G4US 3DE8A 3EZHA 3V7OA 1GGQA 1E84A 1O3UA 4JIOA 2H7VC 4C3BA 2XS8A 4E17A 4RD9A 1C17M 4KNVA 4P9TA 3JTLO 4ULWA 4L6RA 3HNLA 4ANJA 1FFHA 2VCCA 3DXJF 3G4XA 3TJ5A 3I5QA 2NSGA 1PD0A 3DJNB 4W8KA 5DS4A 3FAJA 2B0HA 3ATPA 5COGA 3TULA 1M2VB 1SMYF 2QY9A 3UMKA 1ZW2A 4ER9A 4IARA 4QDLA 4E7SA 3EGDA 2VB6A 2W4MA 3ITFA 4NTFA 3K1IC 3PDMP 3T6JA 2PX0A 2EPMX 1D1BA 1V74B 2L81A 2P1AA 2V3CC 4OD4A 1I4YA 2KJGA 1RCPA 2Y3BA 3LNMB 4Q4ZF 4BJ5A 2R7UA 2XLEA 2IYLD 1CPQA 1DOVA 4I1MA 1TR2A 5E33A 1ZW3A 4J7YA 4FWVA 3W2WA 3RYLA 1RXQA 2GFHA 1KNYA 1NZEA 3FVYA 4H54A 3LNRA 1D1AA 2HV7A 4ULVA 1D0XA 3UGPA 3K6BA 2AWCA 2HS5A 4YN0B 4JURI 4MW8A 256BA 1LI7A 2FGYA 4X0RA 5JLIA 5K0IA 4WABA 4FX5A 1HE9A 4HFFB 4YJWA 3AG3C 3U3BA 2J0WA 3B9QA 4RDAA 1OKKD 4YL0A 5CIVA 2HZ8A 2JPUA 1ZHYA 2RSEB 3GEEA 2YL3A 2OKUA 1ZU4A 1NU9C 3V5XA 1T9KA 2XL8A 1BR1A 3RQEA 2OEXA 1XZPA 5KYNA 4MVSA 3JZ0A 4PJLA 2XM4A 4GQHA 4DXWA 3GWNA 1WWPA 4MS2A 4G0HA 3EHMA 2FFHA 4U5EE 1IW7F 4XPYA 2XRHA 4CDVA 2JD3A 5EGYA 5L3QA 5COMA 2LD6A 5DS6A 4WGZA 1RKEB 1N1CA 3Q6MA 4XWJA 1OXBA 1U89A 4NY3A 4BJ6C 2EPKX 2V26A 3C8GB 4D4XA 2L6HA 2A0UA 2WZGA 2R03A 3Q6NA 1ZHWA 4QI2A 2KSFA 2WL8A 3SXMA 1OW6A 3M4BA 3MX3A 3MLGA 4BJ1A 1YA7O 3DAGA 1E85A 3RQFA 3EG9B 5FZTA 3UR3C 2P6VA 1AUEA 1GS9A 4MVQA 3K66A 4IRUA 3T9OA 3JRMO 3X1OA 5HSWA 4HEAJ 2QTVA 1FR0A 1T5OA 5KYYA 2R05A 4IGGA 4ZLDA 4N6HA 4QI0A 2R02A 4J32B 1SR2A 1EA8A 2XLDA 5HV9A 3GWLA 3HNIA 3LEOA 4MVZA 3SXKA 2NUTA 3CAXA 4K1OA 5AGFA 4OIQF 3LS0A 1TWGA 2KNHA 3IQTA 2J8WA 2J46A 4N6CA 3W8IA 3ZQYA 3NYJA 2AU5A 4PK4A 1LS4A 2XXAB 3TK0A 1VK5A 3EH2A 3U5SA 5DS5A 4JEBA 4U5CE 4YT2A 2QUPA 3A9CA 2LQGA 1FFTC 2J45A 3S28A 1XWJA 2CNWD 3SNHA 1M2VA 1GM5A 2UUHA 4W8PA 3X2QC 3NDBB 2IXOA 2BC5A 2XLHA 1UG7A 2ETSA 3B71A 3VYWA 3ZDLA 2PF4E 3M79A 5AC5A 2R7VA 4YT5A 4N06A 1TQGA 4CDAA 2D5RB 2KQ9A 1OQCA 1G5ZA 4LDKA 1R4TA 2A6HF 1E86A 1MMAA 1T6UA 2EPOA 3DM5A 1U6HA 3L1MA 1LE4A 4JJFA 1A7DA 2HMZA 2A6EF 2H8AA 3TOLA 2Q7RA 1YYJA 3FHDA 3S90A 2EIMC 1QPUA 2OU6A 5GPGB 4CSAC 1K05A 1AEPA 1JAFA 1YVIA 1LM3B 1ZVZA 3AOUA 2YKZA 3OA1A 3BEHA 1JR8A 3K7DA 4I1OB 3CSKA 3IQCA 2GWWA 3SYNA 5A69A 1CPRA 1MQVA 2HJMA 2ICWG 2LK4A 4XQ1A 1BR4A 1FNTc 1U0BB 1JOGA 2J7PD 1EI7A 4UDVA 4MTFA 4ONSA 1BBHA 3MBGA 2LSEA 3JSZA 2CW0F 2TMVP 2NPUA 1G8XA 4YL3A 1E2XA 2OJED 5BQIA 3NMKA 3QMKA 1LE2A 3RFYA 2LIGA 1S05A 1OCZC 2I8BA 3ZQVA 3DM9B 3S9OA 3BRJA 5KYWB 4JTAB 2Z15A 2XL6A 1Z7Qc 4E7ZA 1WGWA 3E9VA 5B3IA 2DYSC 2ZD9A 3U9JA 3KL4A 3RF3A 1Q0KA 2IM8A 2YL1A 2F22A 4M63A 3IHUA 4LACB 1RMVA 2LFDA 5E2QA 2PNOA 4YT4A 2EIKC 4E0HA 3JT1A 2DYRC 4EIYA 5JSLA 3N2ZB 3GEHA 5L0IA 3EPVA 4IAQA 1WTYA 4XTKA 2DI3A 1RKEA 2HSBA 2ASRA 4GYTA 4IJJA 3DKAA 4MVOA 3TOMA 4GEHA 2GDCA 3GM3A 3LLIA 4PFPA 4DOZA 3POVA 3C8GA 4MTOA 5E3AA 3JCUQ 2XL4A 3AQBA 4MW3A 5BQGA 3W2VA 2MWQA 2JX0A 3PMRA 3HJCA 1V4AA 2L9JA 5A6JA 3JYYA 5COFA 2J9WA 4E18A 1V55C 3ZWIA 3EG9A 1NU7D 3DJUB 4O79A 2L6GA 3EGXA 4CS8C 3GEIA 5KYXB 3ABMC 5A6KA 1E83A 3HNKA 2EPLX 2HFIA 4CSAA 2I15A 3R7CA 3B0UX 1QVXA 1YJGA 5TJ5E 1LIHA 3QVZA 4PACA 3U2LA 3NKDA 1WOLA 2AP3A 3NYLA 5KYUB 4U5FE 4DRIB 2WVOA 1D0YA 2XLVA 2YQYA 2A68F 3C62A 4LDRA 3U3FA 2OOCA 2YRFA 4N4WA 1KTMA 1LKXA 1MMDA 3AGUA 3LEVA 1F1MA 3S0XA 4C7OB 4MVUA 3S27A 2R7RA 1ZHZA 2EIJC 2XLOA 2Y69C 4G7HF 2B0JA 4EKWA 4G78A 3VF0A 5L0DA 5CI9A 5A6AA 1ZHTA 1CGOA 2XXAA 4KI2A 3WAQA 3VM6A 1MNEA 3UNGC 3O10A 3EH1A 1Y6DA 1UFBA 4IB4A 3KYJA 1A41A 3IQ5A 1FTSA 4IWBA 3QTHA 1Z5ZA 3JSEO 1ORYA 1TFOB 3SZRA 3K1IA 4D4NA 4A4AA 3ZVRA 4YT8A 3S84A 1YAUO 2HKVA 3EGDB 5BUOA 2DGJA 1Z63A 1Y4CA 1JPJA 3IEEA 1M2OA 2BE5F 2Y3GA 4BPMA 4NTBA 3GM1A 4O6MA 4R32A 1H7IA 2EILC 2YHSA 2HV6A 3AG2C 3EQLF 1APCA 3TD7A 4AX2A 1HMOA 1HW2A 4CS9C 1VLTA 4NQFA 2D4UA 4AE4B 2FAPB 3H65A 3SEOA 4PR9A 2GA0A 3A11A 1V54C 2VASA 4OIRF 3U8PA 3ZC4A 5L0HA 4MNDA 1L3PA 2H7BA 1ORJA 3ZIBA 3MFNA 4G7OF 3K1HA 2R9RB 1L7CA 3B29A 4CDYA 2YLIA 2ZXRA 1Q0GA 4BG0A 4HFKB 5DQZA 3J06A 2KK1A 4CS8A 1VLSA 4Q7CA 4JC7A 4JKVA 3L0IA 1IZMA 1VMAA 4E0IA 5DLJA 1HE1A 1PV3A 3TJ6A 3V5ZA 4C3DA 1D0ZA 3CQZA 3LS1A 3I4UA 2P0NA 4EBKA 4FESA 1TWAA 2G3VA 3H2VA 4KBLA 1JRAA 3IPMO 1JMWA 1VB5A 1RJ9B 5B3SC 1SYQA 1LVKA 1EKYA 4JTCB 2CDQA 3C7JA 1LI5A 2PBEA 2W9YA 3Q7GA 4PJMA 2YLGA 2BL2A 4Z9HA 2W45A 2HJ3A 2A69F 4RBNA 3ABKC 5JUAA 3KH2A 3KKBA 3LAYA 1HMDA 1CGNA 3T6BA 3QVYA 1O5HA 4CBEA 4CX9A 5D92A 3NKEA 5F28E 5A6BD 4XEKA 2YLDA 3N24A 4I3MA 4O6NA 4WGYA 2C03A 5E3CA 4BJ6A 3ECSA 2VC9A 2ZXOA 3H2UA 1YZAA 1CGME 4O7GA 1OW7A 5B1BC 4FAPB 1XZQA 4DVYP 3U0CA 1OCOC 1SZIA 2Q00A 2WZLA 2YEVA 2XLMA 3DE9A 3L34A 3NMIA 5T1DB 2R7QA 3QZCA 2R7WA 4P6IC 1K40A 1J8YF 3AQCA 2QNLA 4BJTA 4Z9IA 3GANA 5KYXA 4Q5SF 2XSEA 5T3TA 3WG7C 1FMVA 1W2WA 3GODA 4U5BE 1Z6AA 3T4RA 4DBQA 4IAOA 3EJNA 1PD1A 3EFOB 2NUPB 4MVMA 2YWAA 1RKCA 3GM2A 4P9FA 4AL1A 4XLPF 1ZZPA 3FXHA 5IY5C 3FOOA 3RVZA 5L3VA 1ZYRF 3U8VA 3DI5A 3F46A 1NG1A 2P61A 3RQGA 4CIHA 2NUTB 1O87A 3LESA 4C7OA 2HMQA 2P7VA 4F4BA 4U9EA 1J8MF 2M4EA 3US6A 1QLEC 4JZAA 3RVYA 2NG1A 3C63A 2MHRA 3ASOC 2AVKA 4EBJA 3M4CA 4J30B 1Q0MA 3CEXA 4DRJB 2A0BA 1A7VA 3DAFA 3G50A 3GORA 3HKKA 4NCQA 3U9MA 1NLXA 2R7XA 5JRAA 2J9VA 4XEVA 4JCHA 4C3EA 1PCXA 1TFKB 4J7TA 5JP7A 4EBBA 1WASA 1LS1A 1AVOB 2XS1A 4K7BA 4DRHB 1I5NA 1K04A 1T6QA 3N0TA 4DJ9A 5L0FA 4JTDB 3HNJA 3EZIA 4G7ZF 2XLWA 2O9XA 3ABLC 4XPXA 2M64A 1YLMA 3C8GD 3AG4C 3KPHA 4JJGA 4AE4A 4EWCA 2H7OA 1H9TA 1OCCC 1OKKA 3I5PA 4AK9A 3ZTMA 2PP4A 2VH3A 3KMIA 4KC9A 4U5DE 3V5YA 3T6GB 4DVZA 4ZLCA 4OINF 2KGOA 2X0CA 2Y3DA 3LUTB 3WHNA 1ZU5A 5EK0A 3DWWA 3B0VC 1TWCA 2AWYA 2R7TA 3ZTZA 3S29A 3HLZA 1M6TA 1NFNA 3W4YA 4LLEA 1NSGB 3DD7A 3AG1C 3RIPA 1R5ID 3M1CB 2Q9BA 4LDQA 5L0CA 4XLNF 1BR2A 1Z23A 2E87A 2IXMA 4JE9A 1QKRA 4MTGA 2CGEA 2CYDA 1T01A 2L7AA 5CI8A 1Q0FA 2J0XA 3RW0A 4XPWA 3ZSUA 4OIOF 4U5GA 1NBBA 3JYHA 1LPEA 2OCCC 1RJ9A 3IQ6A 4KNWA 1I4ZA 3RKOF 2VCBA 4JRZA 1M57C 4JEAA 2KW3C 2YL7A 1G4WR 3PHF2 3L8IA 2DB4A 1HY5A 1A0BA 4AL0A 4CS7A 5AC4A 2PFDA 1EQ1A 5B1AC 1H9GA 1H6GA 1WATA 3ASNC 5D91A 1S7ZA 2PX3A 2WZFA 3KYIA 4CIPA 2R7OA 1MMNA 2L6FA 4Z9JA 1KU2A 2Y3HA 2IOQA 2ZXWC 3JRTA 3LLKA 3VRCA 3SP1A 1YARO 1OCRC 3MYFA 3O6XA 5T3WA 5F5FA 3NYMA 4A2NB 2WB7A 3O55A 1ORSC 1OXKA 1M56C 5JT4A 2X51A 2IXNA 2Q9CA 4B6IA 1NFOA 5JVEA 3SXZA 3F47A 1YA9A 3QW1A 4NTAA 5DVWA 3SXYA 3VAYA 2ZPAA 1HW1A 2Q3TA 1C02A 1BDJB
chains in the Genus database with same CATH topology
3TK0A 3R7CA 3U2MA 4E0IA 3U5SA 4E0HA 3U2LA 3MBGA 1JRAA 3TD7A 3GWNA 3LLIA 1OQCA 4LDKA 3LLKA 3W4YA 2HJ3A 3GWLA 3O55A 1JR8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TK0 A;  3R7C A;  3U2M A;  4E0I A;  3U5S A;  4E0H A;  3U2L A;  3MBG A;  1JRA A;  3TD7 A;  3GWN A;  3LLI A;  1OQC A;  4LDK A;  3LLK A;  3W4Y A;  2HJ3 A;  3GWL A;  3O55 A;  1JR8 A; 
#chains in the Genus database with same CATH topology
 1Q0D A;  2KC3 A;  1QQ3 A;  3ZG1 A;  3U2M A;  4H4K C;  3R2P A;  4YK5 A;  3C8Z A;  3EGX B;  2RD9 A;  2LCH A;  1WN0 A;  1B68 A;  2IXP A;  2MYS A;  2LP4 A;  2OG2 A;  1GQA A;  3E70 C;  4OD5 A;  3DZA A;  3PCV A;  2WVN A;  5KYW A;  2Y39 A;  5L0J A;  1QSP A;  3EFO A;  4BEM J;  2NUP A;  1YDI A;  3AGT A;  1YZC A;  3LJB A;  2EIN C;  1VOM A;  2R7S A;  2Q9A A;  5BQH A;  3QW0 A;  4MVR A;  4OIP F;  2NSF A;  3OWT A;  1MND A;  3NMJ A;  5EHH A;  2KYH A;  2IBF A;  2CNW A;  2GAQ A;  2J9U A;  1T6I A;  2R25 A;  4DBR A;  5L0G A;  4XEF A;  2J9B A;  5JS5 A;  1D1C A;  2ZXP A;  3G4Z A;  4JW1 A;  1FAP B;  4JCZ A;  3OEO A;  1OR3 A;  2LFF A;  4BJ5 C;  1TWH A;  1ZHX A;  1QZX A;  3C18 A;  2QE9 A;  2VCA A;  3NG1 A;  3NRH A;  4K0D A;  3RH3 A;  4YWQ A;  1MMG A;  3HTK C;  2YZS A;  5FCL A;  3TQO A;  5A6B A;  4EUK B;  4I44 A;  1OW8 A;  2XM0 A;  3UMH A;  3FDQ A;  2OEV A;  3M15 A;  1SF8 A;  4BEJ A;  4O6Y A;  3FMS A;  1Z3I X;  4MQ9 F;  3UGO A;  1OR2 A;  2C04 A;  3EHN A;  4LLC A;  2HUJ A;  2G62 A;  1TKN A;  4U9D A;  2J7P A;  3O39 A;  4CJO A;  2YVK A;  2G3K A;  3W8H A;  2WVQ A;  3FOP A;  3MYI A;  1VYK A;  3UMI A;  3K33 A;  1DOW A;  3B0P A;  2YL0 A;  1JPN A;  1C03 A;  2Q4F A;  1A7E A;  4CS9 A;  1VYI A;  4PJJ A;  4WJ0 A;  1BZ4 A;  2CCY A;  2QLA A;  2OQM A;  4YL1 A;  5F5H A;  1ST6 A;  4JVS A;  2HSQ A;  3CZ6 A;  2EPN A;  2OJQ A;  3WOD F;  1FMW A;  5KYY B;  5DQT A;  3FAP B;  5KYU A;  4LER A;  3DMD A;  1YYX A;  4PFO A;  4U5H A;  4HE8 D;  4NC3 A;  4EHP A;  4CJG A;  3L8J A;  2A1D D;  2W4B A;  3AJM A;  1VTM P;  4PJN A;  2UUI A;  3Q7L A;  1G4U S;  3DE8 A;  3EZH A;  3V7O A;  1GGQ A;  1E84 A;  1O3U A;  4JIO A;  2H7V C;  4C3B A;  2XS8 A;  4E17 A;  4RD9 A;  1C17 M;  4KNV A;  4P9T A;  3JTL O;  4ULW A;  4L6R A;  3HNL A;  4ANJ A;  1FFH A;  2VCC A;  3DXJ F;  3G4X A;  3TJ5 A;  3I5Q A;  2NSG A;  1PD0 A;  3DJN B;  4W8K A;  5DS4 A;  3FAJ A;  2B0H A;  3ATP A;  5COG A;  3TUL A;  1M2V B;  1SMY F;  2QY9 A;  3UMK A;  1ZW2 A;  4ER9 A;  4IAR A;  4QDL A;  4E7S A;  3EGD A;  2VB6 A;  2W4M A;  3ITF A;  4NTF A;  3K1I C;  3PDM P;  3T6J A;  2PX0 A;  2EPM X;  1D1B A;  1V74 B;  2L81 A;  2P1A A;  2V3C C;  4OD4 A;  1I4Y A;  2KJG A;  1RCP A;  2Y3B A;  3LNM B;  4Q4Z F;  4BJ5 A;  2R7U A;  2XLE A;  2IYL D;  1CPQ A;  1DOV A;  4I1M A;  1TR2 A;  5E33 A;  1ZW3 A;  4J7Y A;  4FWV A;  3W2W A;  3RYL A;  1RXQ A;  2GFH A;  1KNY A;  1NZE A;  3FVY A;  4H54 A;  3LNR A;  1D1A A;  2HV7 A;  4ULV A;  1D0X A;  3UGP A;  3K6B A;  2AWC A;  2HS5 A;  4YN0 B;  4JUR I;  4MW8 A;  256B A;  1LI7 A;  2FGY A;  4X0R A;  5JLI A;  5K0I A;  4WAB A;  4FX5 A;  1HE9 A;  4HFF B;  4YJW A;  3AG3 C;  3U3B A;  2J0W A;  3B9Q A;  4RDA A;  1OKK D;  4YL0 A;  5CIV A;  2HZ8 A;  2JPU A;  1ZHY A;  2RSE B;  3GEE A;  2YL3 A;  2OKU A;  1ZU4 A;  1NU9 C;  3V5X A;  1T9K A;  2XL8 A;  1BR1 A;  3RQE A;  2OEX A;  1XZP A;  5KYN A;  4MVS A;  3JZ0 A;  4PJL A;  2XM4 A;  4GQH A;  4DXW A;  3GWN A;  1WWP A;  4MS2 A;  4G0H A;  3EHM A;  2FFH A;  4U5E E;  1IW7 F;  4XPY A;  2XRH A;  4CDV A;  2JD3 A;  5EGY A;  5L3Q A;  5COM A;  2LD6 A;  5DS6 A;  4WGZ A;  1RKE B;  1N1C A;  3Q6M A;  4XWJ A;  1OXB A;  1U89 A;  4NY3 A;  4BJ6 C;  2EPK X;  2V26 A;  3C8G B;  4D4X A;  2L6H A;  2A0U A;  2WZG A;  2R03 A;  3Q6N A;  1ZHW A;  4QI2 A;  2KSF A;  2WL8 A;  3SXM A;  1OW6 A;  3M4B A;  3MX3 A;  3MLG A;  4BJ1 A;  1YA7 O;  3DAG A;  1E85 A;  3RQF A;  3EG9 B;  5FZT A;  3UR3 C;  2P6V A;  1AUE A;  1GS9 A;  4MVQ A;  3K66 A;  4IRU A;  3T9O A;  3JRM O;  3X1O A;  5HSW A;  4HEA J;  2QTV A;  1FR0 A;  1T5O A;  5KYY A;  2R05 A;  4IGG A;  4ZLD A;  4N6H A;  4QI0 A;  2R02 A;  4J32 B;  1SR2 A;  1EA8 A;  2XLD A;  5HV9 A;  3GWL A;  3HNI A;  3LEO A;  4MVZ A;  3SXK A;  2NUT A;  3CAX A;  4K1O A;  5AGF A;  4OIQ F;  3LS0 A;  1TWG A;  2KNH A;  3IQT A;  2J8W A;  2J46 A;  4N6C A;  3W8I A;  3ZQY A;  3NYJ A;  2AU5 A;  4PK4 A;  1LS4 A;  2XXA B;  3TK0 A;  1VK5 A;  3EH2 A;  3U5S A;  5DS5 A;  4JEB A;  4U5C E;  4YT2 A;  2QUP A;  3A9C A;  2LQG A;  1FFT C;  2J45 A;  3S28 A;  1XWJ A;  2CNW D;  3SNH A;  1M2V A;  1GM5 A;  2UUH A;  4W8P A;  3X2Q C;  3NDB B;  2IXO A;  2BC5 A;  2XLH A;  1UG7 A;  2ETS A;  3B71 A;  3VYW A;  3ZDL A;  2PF4 E;  3M79 A;  5AC5 A;  2R7V A;  4YT5 A;  4N06 A;  1TQG A;  4CDA A;  2D5R B;  2KQ9 A;  1OQC A;  1G5Z A;  4LDK A;  1R4T A;  2A6H F;  1E86 A;  1MMA A;  1T6U A;  2EPO A;  3DM5 A;  1U6H A;  3L1M A;  1LE4 A;  4JJF A;  1A7D A;  2HMZ A;  2A6E F;  2H8A A;  3TOL A;  2Q7R A;  1YYJ A;  3FHD A;  3S90 A;  2EIM C;  1QPU A;  2OU6 A;  5GPG B;  4CSA C;  1K05 A;  1AEP A;  1JAF A;  1YVI A;  1LM3 B;  1ZVZ A;  3AOU A;  2YKZ A;  3OA1 A;  3BEH A;  1JR8 A;  3K7D A;  4I1O B;  3CSK A;  3IQC A;  2GWW A;  3SYN A;  5A69 A;  1CPR A;  1MQV A;  2HJM A;  2ICW G;  2LK4 A;  4XQ1 A;  1BR4 A;  1FNT c;  1U0B B;  1JOG A;  2J7P D;  1EI7 A;  4UDV A;  4MTF A;  4ONS A;  1BBH A;  3MBG A;  2LSE A;  3JSZ A;  2CW0 F;  2TMV P;  2NPU A;  1G8X A;  4YL3 A;  1E2X A;  2OJE D;  5BQI A;  3NMK A;  3QMK A;  1LE2 A;  3RFY A;  2LIG A;  1S05 A;  1OCZ C;  2I8B A;  3ZQV A;  3DM9 B;  3S9O A;  3BRJ A;  5KYW B;  4JTA B;  2Z15 A;  2XL6 A;  1Z7Q c;  4E7Z A;  1WGW A;  3E9V A;  5B3I A;  2DYS C;  2ZD9 A;  3U9J A;  3KL4 A;  3RF3 A;  1Q0K A;  2IM8 A;  2YL1 A;  2F22 A;  4M63 A;  3IHU A;  4LAC B;  1RMV A;  2LFD A;  5E2Q A;  2PNO A;  4YT4 A;  2EIK C;  4E0H A;  3JT1 A;  2DYR C;  4EIY A;  5JSL A;  3N2Z B;  3GEH A;  5L0I A;  3EPV A;  4IAQ A;  1WTY A;  4XTK A;  2DI3 A;  1RKE A;  2HSB A;  2ASR A;  4GYT A;  4IJJ A;  3DKA A;  4MVO A;  3TOM A;  4GEH A;  2GDC A;  3GM3 A;  3LLI A;  4PFP A;  4DOZ A;  3POV A;  3C8G A;  4MTO A;  5E3A A;  3JCU Q;  2XL4 A;  3AQB A;  4MW3 A;  5BQG A;  3W2V A;  2MWQ A;  2JX0 A;  3PMR A;  3HJC A;  1V4A A;  2L9J A;  5A6J A;  3JYY A;  5COF A;  2J9W A;  4E18 A;  1V55 C;  3ZWI A;  3EG9 A;  1NU7 D;  3DJU B;  4O79 A;  2L6G A;  3EGX A;  4CS8 C;  3GEI A;  5KYX B;  3ABM C;  5A6K A;  1E83 A;  3HNK A;  2EPL X;  2HFI A;  4CSA A;  2I15 A;  3R7C A;  3B0U X;  1QVX A;  1YJG A;  5TJ5 E;  1LIH A;  3QVZ A;  4PAC A;  3U2L A;  3NKD A;  1WOL A;  2AP3 A;  3NYL A;  5KYU B;  4U5F E;  4DRI B;  2WVO A;  1D0Y A;  2XLV A;  2YQY A;  2A68 F;  3C62 A;  4LDR A;  3U3F A;  2OOC A;  2YRF A;  4N4W A;  1KTM A;  1LKX A;  1MMD A;  3AGU A;  3LEV A;  1F1M A;  3S0X A;  4C7O B;  4MVU A;  3S27 A;  2R7R A;  1ZHZ A;  2EIJ C;  2XLO A;  2Y69 C;  4G7H F;  2B0J A;  4EKW A;  4G78 A;  3VF0 A;  5L0D A;  5CI9 A;  5A6A A;  1ZHT A;  1CGO A;  2XXA A;  4KI2 A;  3WAQ A;  3VM6 A;  1MNE A;  3UNG C;  3O10 A;  3EH1 A;  1Y6D A;  1UFB A;  4IB4 A;  3KYJ A;  1A41 A;  3IQ5 A;  1FTS A;  4IWB A;  3QTH A;  1Z5Z A;  3JSE O;  1ORY A;  1TFO B;  3SZR A;  3K1I A;  4D4N A;  4A4A A;  3ZVR A;  4YT8 A;  3S84 A;  1YAU O;  2HKV A;  3EGD B;  5BUO A;  2DGJ A;  1Z63 A;  1Y4C A;  1JPJ A;  3IEE A;  1M2O A;  2BE5 F;  2Y3G A;  4BPM A;  4NTB A;  3GM1 A;  4O6M A;  4R32 A;  1H7I A;  2EIL C;  2YHS A;  2HV6 A;  3AG2 C;  3EQL F;  1APC A;  3TD7 A;  4AX2 A;  1HMO A;  1HW2 A;  4CS9 C;  1VLT A;  4NQF A;  2D4U A;  4AE4 B;  2FAP B;  3H65 A;  3SEO A;  4PR9 A;  2GA0 A;  3A11 A;  1V54 C;  2VAS A;  4OIR F;  3U8P A;  3ZC4 A;  5L0H A;  4MND A;  1L3P A;  2H7B A;  1ORJ A;  3ZIB A;  3MFN A;  4G7O F;  3K1H A;  2R9R B;  1L7C A;  3B29 A;  4CDY A;  2YLI A;  2ZXR A;  1Q0G A;  4BG0 A;  4HFK B;  5DQZ A;  3J06 A;  2KK1 A;  4CS8 A;  1VLS A;  4Q7C A;  4JC7 A;  4JKV A;  3L0I A;  1IZM A;  1VMA A;  4E0I A;  5DLJ A;  1HE1 A;  1PV3 A;  3TJ6 A;  3V5Z A;  4C3D A;  1D0Z A;  3CQZ A;  3LS1 A;  3I4U A;  2P0N A;  4EBK A;  4FES A;  1TWA A;  2G3V A;  3H2V A;  4KBL A;  1JRA A;  3IPM O;  1JMW A;  1VB5 A;  1RJ9 B;  5B3S C;  1SYQ A;  1LVK A;  1EKY A;  4JTC B;  2CDQ A;  3C7J A;  1LI5 A;  2PBE A;  2W9Y A;  3Q7G A;  4PJM A;  2YLG A;  2BL2 A;  4Z9H A;  2W45 A;  2HJ3 A;  2A69 F;  4RBN A;  3ABK C;  5JUA A;  3KH2 A;  3KKB A;  3LAY A;  1HMD A;  1CGN A;  3T6B A;  3QVY A;  1O5H A;  4CBE A;  4CX9 A;  5D92 A;  3NKE A;  5F28 E;  5A6B D;  4XEK A;  2YLD A;  3N24 A;  4I3M A;  4O6N A;  4WGY A;  2C03 A;  5E3C A;  4BJ6 A;  3ECS A;  2VC9 A;  2ZXO A;  3H2U A;  1YZA A;  1CGM E;  4O7G A;  1OW7 A;  5B1B C;  4FAP B;  1XZQ A;  4DVY P;  3U0C A;  1OCO C;  1SZI A;  2Q00 A;  2WZL A;  2YEV A;  2XLM A;  3DE9 A;  3L34 A;  3NMI A;  5T1D B;  2R7Q A;  3QZC A;  2R7W A;  4P6I C;  1K40 A;  1J8Y F;  3AQC A;  2QNL A;  4BJT A;  4Z9I A;  3GAN A;  5KYX A;  4Q5S F;  2XSE A;  5T3T A;  3WG7 C;  1FMV A;  1W2W A;  3GOD A;  4U5B E;  1Z6A A;  3T4R A;  4DBQ A;  4IAO A;  3EJN A;  1PD1 A;  3EFO B;  2NUP B;  4MVM A;  2YWA A;  1RKC A;  3GM2 A;  4P9F A;  4AL1 A;  4XLP F;  1ZZP A;  3FXH A;  5IY5 C;  3FOO A;  3RVZ A;  5L3V A;  1ZYR F;  3U8V A;  3DI5 A;  3F46 A;  1NG1 A;  2P61 A;  3RQG A;  4CIH A;  2NUT B;  1O87 A;  3LES A;  4C7O A;  2HMQ A;  2P7V A;  4F4B A;  4U9E A;  1J8M F;  2M4E A;  3US6 A;  1QLE C;  4JZA A;  3RVY A;  2NG1 A;  3C63 A;  2MHR A;  3ASO C;  2AVK A;  4EBJ A;  3M4C A;  4J30 B;  1Q0M A;  3CEX A;  4DRJ B;  2A0B A;  1A7V A;  3DAF A;  3G50 A;  3GOR A;  3HKK A;  4NCQ A;  3U9M A;  1NLX A;  2R7X A;  5JRA A;  2J9V A;  4XEV A;  4JCH A;  4C3E A;  1PCX A;  1TFK B;  4J7T A;  5JP7 A;  4EBB A;  1WAS A;  1LS1 A;  1AVO B;  2XS1 A;  4K7B A;  4DRH B;  1I5N A;  1K04 A;  1T6Q A;  3N0T A;  4DJ9 A;  5L0F A;  4JTD B;  3HNJ A;  3EZI A;  4G7Z F;  2XLW A;  2O9X A;  3ABL C;  4XPX A;  2M64 A;  1YLM A;  3C8G D;  3AG4 C;  3KPH A;  4JJG A;  4AE4 A;  4EWC A;  2H7O A;  1H9T A;  1OCC C;  1OKK A;  3I5P A;  4AK9 A;  3ZTM A;  2PP4 A;  2VH3 A;  3KMI A;  4KC9 A;  4U5D E;  3V5Y A;  3T6G B;  4DVZ A;  4ZLC A;  4OIN F;  2KGO A;  2X0C A;  2Y3D A;  3LUT B;  3WHN A;  1ZU5 A;  5EK0 A;  3DWW A;  3B0V C;  1TWC A;  2AWY A;  2R7T A;  3ZTZ A;  3S29 A;  3HLZ A;  1M6T A;  1NFN A;  3W4Y A;  4LLE A;  1NSG B;  3DD7 A;  3AG1 C;  3RIP A;  1R5I D;  3M1C B;  2Q9B A;  4LDQ A;  5L0C A;  4XLN F;  1BR2 A;  1Z23 A;  2E87 A;  2IXM A;  4JE9 A;  1QKR A;  4MTG A;  2CGE A;  2CYD A;  1T01 A;  2L7A A;  5CI8 A;  1Q0F A;  2J0X A;  3RW0 A;  4XPW A;  3ZSU A;  4OIO F;  4U5G A;  1NBB A;  3JYH A;  1LPE A;  2OCC C;  1RJ9 A;  3IQ6 A;  4KNW A;  1I4Z A;  3RKO F;  2VCB A;  4JRZ A;  1M57 C;  4JEA A;  2KW3 C;  2YL7 A;  1G4W R;  3PHF 2;  3L8I A;  2DB4 A;  1HY5 A;  1A0B A;  4AL0 A;  4CS7 A;  5AC4 A;  2PFD A;  1EQ1 A;  5B1A C;  1H9G A;  1H6G A;  1WAT A;  3ASN C;  5D91 A;  1S7Z A;  2PX3 A;  2WZF A;  3KYI A;  4CIP A;  2R7O A;  1MMN A;  2L6F A;  4Z9J A;  1KU2 A;  2Y3H A;  2IOQ A;  2ZXW C;  3JRT A;  3LLK A;  3VRC A;  3SP1 A;  1YAR O;  1OCR C;  3MYF A;  3O6X A;  5T3W A;  5F5F A;  3NYM A;  4A2N B;  2WB7 A;  3O55 A;  1ORS C;  1OXK A;  1M56 C;  5JT4 A;  2X51 A;  2IXN A;  2Q9C A;  4B6I A;  1NFO A;  5JVE A;  3SXZ A;  3F47 A;  1YA9 A;  3QW1 A;  4NTA A;  5DVW A;  3SXY A;  3VAY A;  2ZPA A;  1HW1 A;  2Q3T A;  1C02 A;  1BDJ B; 
#chains in the Genus database with same CATH homology
 3TK0 A;  3R7C A;  3U2M A;  4E0I A;  3U5S A;  4E0H A;  3U2L A;  3MBG A;  1JRA A;  3TD7 A;  3GWN A;  3LLI A;  1OQC A;  4LDK A;  3LLK A;  3W4Y A;  2HJ3 A;  3GWL A;  3O55 A;  1JR8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...