4LDKA

Fad-linked sulfhydryl oxidase alr mutation
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
115
structure length
114
Chain Sequence
FREDCPPDREELGRHSWAVLHTLAAYYPDLPTPEQQQDMAQFIHLFSKFYPAEEAEDLRKRLARNHPDTRTRAAFTQWLCHLHNEVNRKLGKPDFDCSKVDERWRDGWKDGSCD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Flavoprotein, oxidoreductase
molecule keywords FAD-linked sulfhydryl oxidase ALR
publication title FAD-linked sulfhydryl oxidase ALR mutation
rcsb
source organism Homo sapiens
total genus 43
structure length 114
sequence length 115
ec nomenclature ec 1.8.3.2: Thiol oxidase.
pdb deposition date 2013-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04777 Evr1_Alr Erv1 / Alr family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.310 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) ERV/ALR sulfhydryl oxidase domain 4ldkA00
4E0HA 3W4YA 4E0IA 3TK0A 3R7CA 1OQCA 3U2MA 4LDKA 3U5SA 3GWNA 1JR8A 3LLIA 3O55A 3LLKA 3GWLA 1JRAA 3MBGA 3U2LA 3TD7A 2HJ3A
chains in the Genus database with same CATH superfamily
3EJNA 4X0RA 4GEHA 4K0DA 4XLNF 3RIPA 3L0IA 1V4AA 3QW1A 4KBLA 1LKXA 1Z23A 4CDYA 3HLZA 4CSAC 3C8GB 1ZU5A 1OQCA 2DI3A 2H7OA 1D1AA 4LDKA 2XL8A 4XTKA 3T6BA 3TOMA 3KL4A 3ZC4A 1OW6A 4EBKA 4EWCA 2V3CC 2Q4FA 2NUPA 1S7ZA 2YRFA 2ZXPA 5JVEA 5DVWA 3SYNA 4MTOA 4QI2A 5L3VA 1Q0MA 4U5EE 3U9JA 1LIHA 2J7PD 3EG9A 2AP3A 4MQ9F 4BPMA 3QZCA 1BR4A 4J30B 4KI2A 3JCUQ 1O87A 1YZCA 2XLMA 3K6BA 3HNIA 3HNLA 3M79A 1OXKA 1YA9A 2E87A 3ZVRA 1RKEB 3ZTZA 3U9MA 2XLDA 1LE4A 3A11A 1ZHYA 4N6HA 3ZTMA 3AG1C 4D4XA 3NDBB 1ZZPA 2WZFA 3EHMA 1Z63A 1FR0A 1Q0FA 2P61A 2ICWG 4C7OB 5JSLA 3S9OA 1KU2A 3U2MA 2M64A 3DZAA 2HV6A 4YL3A 1GGQA 3B71A 4AX2A 2QTVA 4KNVA 1OCZC 2AWYA 2HMZA 5COMA 4LDQA 2KYHA 1HMOA 1EI7A 1NU7D 2HMQA 2XRHA 3G50A 4I3MA 1MMAA 2W4MA 2WZGA 1D1BA 2LP4A 1ZVZA 3DD7A 3EPVA 4WJ0A 1KTMA 2WVOA 4YWQA 3U2LA 2JX0A 2CCYA 5DLJA 4C3DA 4U5FE 3ZQYA 1ORSC 4CIHA 3Q6NA 1AEPA 3B29A 2A6EF 4LDRA 2R7WA 1OCCC 2R7SA 5COGA 2GAQA 3GEEA 4QI0A 4UDVA 3DAFA 3SEOA 2YL7A 4RD9A 4NCQA 4CS9A 1VYKA 3HJCA 4KC9A 3C8GD 3U0CA 4AE4A 3N24A 4HEAJ 2XLHA 2MWQA 1UFBA 1PD0A 3LAYA 4YK5A 3E70C 5D91A 3EQLF 5GPGB 4DRHB 2HSBA 2J0XA 4I44A 2J9VA 1H6GA 2H8AA 5A6AA 1M2VA 4DVZA 3DWWA 5CI8A 3SZRA 1SF8A 2BL2A 3I5QA 3PMRA 1M57C 1PV3A 3BEHA 3U8PA 2YL0A 3OA1A 5F28E 2EPLX 2TMVP 2MYSA 4PR9A 2AU5A 4R32A 1LS1A 1T6QA 3KMIA 3GANA 3NKDA 4JIOA 4MTGA 4E17A 2AWCA 3SXMA 1NSGB 4E0HA 2LD6A 4EBBA 3FHDA 1TWGA 3HTKC 2H7BA 1FTSA 5KYUB 3EGDA 4BJ5A 3QVZA 2HSQA 4FESA 2D5RB 3S27A 1LI5A 4ULVA 2YKZA 3S84A 1OW7A 2Z15A 5JLIA 2D4UA 3NYLA 2VCCA 4FX5A 4PJJA 3L34A 1DOWA 4WGYA 2J9WA 5KYXB 1VLSA 3CEXA 4NQFA 1Y6DA 2RSEB 1I5NA 3KKBA 1MMDA 1Q0KA 4WABA 2Y39A 3Q7GA 1BDJB 4U5GA 3RQGA 256BA 4AL1A 1AVOB 3O39A 1T6UA 2XS8A 5EHHA 5FCLA 3AG4C 5BUOA 3FDQA 2Q9CA 3G4ZA 3NMKA 4IWBA 1BBHA 4G7OF 5BQHA 3LS0A 2R25A 3C18A 2XXAA 5F5FA 4MVSA 3EGXA 3WG7C 2PFDA 4FWVA 2IBFA 3L1MA 1NZEA 2G3VA 3EZIA 4GYTA 4I1MA 3TQOA 2J8WA 1LVKA 1Z3IX 1H9GA 3CQZA 3UMHA 2OOCA 3OWTA 5DQZA 3IQ6A 4IAOA 2ASRA 4IRUA 4B6IA 1OKKD 4YT8A 2L9JA 3FMSA 3ZQVA 2ZD9A 2GWWA 3ZIBA 1XWJA 4NTAA 2QY9A 5L0IA 2ZXWC 3DAGA 3JTLO 1QSPA 3O55A 4JZAA 2KW3C 1VB5A 2LK4A 3DJUB 3DM5A 3MYIA 4DBRA 4YJWA 3B0VC 5A6KA 1Q0DA 1OR2A 3QW0A 2EPKX 3AJMA 3FAJA 4OIRF 5AC5A 4HE8D 3TD7A 3IQ5A 3NYJA 1C02A 4PK4A 1D0XA 2WVNA 3S28A 3AGUA 4U5DE 4BJTA 3T6JA 5L3QA 3GM3A 5DS6A 4LLCA 1XZPA 5HSWA 1D0ZA 2R7OA 3QMKA 4ER9A 4YL0A 3PCVA 3A9CA 4OINF 1VLTA 2CNWD 3Q6MA 3VM6A 2QE9A 3LEVA 1T5OA 3B0PA 3N2ZB 3RH3A 2CW0F 2OCCC 4MVZA 1XZQA 3RYLA 1YARO 2WZLA 3JRMO 1ZHWA 3VAYA 1SR2A 2ZXRA 3DXJF 1RJ9B 4O79A 3SP1A 2YL1A 2PX3A 2W9YA 2XL4A 3UR3C 3BRJA 4P9FA 2VC9A 2NUTA 1A7DA 1T01A 5L0GA 3LESA 4MVQA 1OCOC 1TWCA 2J0WA 5EK0A 1G8XA 3M4BA 3NKEA 4PJNA 3FOOA 2MHRA 3K1IA 1B68A 2ETSA 3M4CA 3RFYA 3CZ6A 3J06A 4EHPA 2YEVA 3ABKC 1MMGA 2C03A 2O9XA 4CDAA 2GDCA 1HW2A 2NSGA 5B3SC 4CS8A 4DRJB 3N0TA 3VYWA 2HKVA 4H54A 3GWNA 4JURI 2HV7A 4LACB 1M2OA 1ZW2A 4NTBA 1YLMA 1K04A 2J7PA 3EZHA 2IM8A 3IHUA 3K1HA 1HY5A 1FFHA 3NMJA 2R03A 3T6GB 1JPJA 3U3BA 1Z7Qc 2L6GA 2YLIA 3AGTA 4DBQA 4OIPF 2HFIA 3US6A 5D92A 2XLVA 4MVUA 5A6JA 3KYJA 4GQHA 5KYYB 2R7QA 3ZDLA 1CGME 4JJFA 2YLGA 4JTDB 1FAPB 4EKWA 2KQ9A 1J8MF 1JAFA 2DYSC 3LNRA 1ZHXA 1KNYA 2VH3A 2F22A 4ULWA 4AL0A 1NU9C 2Q7RA 2R7TA 1MMNA 3ASNC 3Q7LA 3JRTA 4YL1A 3K1IC 5KYWA 2DGJA 2LCHA 2Y3DA 2X0CA 3UGOA 3UGPA 1V55C 1CPRA 1LE2A 1TFKB 1YA7O 3RQEA 4JTAB 2Q9AA 3S29A 1H9TA 3EH2A 3HKKA 3F47A 3X1OA 2PNOA 2EIJC 2UUHA 2Y69C 3GM2A 1YAUO 4IAQA 5JRAA 3C7JA 1H7IA 4P6IC 1PD1A 3EFOB 4MNDA 1C17M 1NBBA 3O10A 1HW1A 2JPUA 1FMVA 2ZXOA 2ZPAA 4JE9A 3V5YA 1CGOA 3C8GA 3C62A 2IXOA 4YN0B 1L7CA 3UNGC 3RW0A 1D1CA 4JKVA 3LJBA 2XL6A 3CSKA 4N6CA 4BG0A 2I8BA 1LS4A 1F1MA 1TFOB 2H7VC 2W45A 1W2WA 4I1OB 5L0DA 1E84A 4ANJA 1VK5A 2HZ8A 3ECSA 1OXBA 2GFHA 1WN0A 3LS1A 3MLGA 4N06A 3AQCA 3K7DA 1S05A 3FXHA 3U8VA 3VF0A 4CS9C 4Z9JA 3ZWIA 4AK9A 5JUAA 2VCBA 3T4RA 1U6HA 5T3TA 1C03A 1RKEA 3ABLC 1YJGA 2OG2A 3HNJA 1HE1A 3H2VA 4K7BA 4W8KA 3UMIA 2YWAA 2GA0A 3WHNA 3VRCA 2FGYA 3SXKA 3LLKA 2XM0A 2Y3GA 2NUPB 2QNLA 1WTYA 1ZHTA 1G5ZA 1RXQA 2YL3A 3JYHA 4IB4A 3WAQA 4G7ZF 3DJNB 1NFNA 2M4EA 5FZTA 4C7OA 2QLAA 3RVZA 4O7GA 3EG9B 1TKNA 1VOMA 3EH1A 4J7YA 3S0XA 1ST6A 3NYMA 3I5PA 3K33A 4MVMA 4NC3A 3TJ5A 1YYXA 2DB4A 3TK0A 2P6VA 2PX0A 3W8HA 4C3EA 4D4NA 2HS5A 4XEFA 1FNTc 4PACA 3U3FA 1JOGA 3PDMP 2R7UA 1CGNA 3JZ0A 2WB7A 4QDLA 3RQFA 4U5CE 4ZLDA 3LLIA 3GM1A 2L6HA 3DMDA 1SMYF 3KH2A 4FAPB 4BJ5C 1SZIA 5COFA 1E83A 1RKCA 2FFHA 1J8YF 3H65A 4BEMJ 4DXWA 4CSAA 3M15A 3SXYA 3CAXA 2BC5A 1R5ID 3DE9A 5A6BD 1N1CA 1DOVA 4WGZA 4JCHA 2LFFA 4JTCB 4MVOA 3V7OA 4BJ6A 3JYYA 1IZMA 2C04A 2UUIA 4G0HA 4JEAA 2Q3TA 1OKKA 2XLOA 4XPYA 3RKOF 3GORA 3RVYA 2A0BA 4J32B 1JR8A 4C3BA 3MYFA 4PFOA 4J7TA 2J45A 2LQGA 1SYQA 2YQYA 5A69A 5L0FA 3AG3C 2QUPA 1ZW3A 1MQVA 2P0NA 4AE4B 4EBJA 2LSEA 3AQBA 4CS7A 4JJGA 1QQ3A 3KPHA 4G7HF 3MX3A 3JSZA 2PF4E 2YHSA 2KGOA 2R7VA 1FMWA 4HFKB 3POVA 1I4YA 3ATPA 3T9OA 3GEIA 1RMVA 2FAPB 2YVKA 3NRHA 4MW8A 4E7SA 5KYUA 5L0JA 1M2VB 3K66A 5AC4A 2CYDA 2CGEA 2WVQA 2CNWA 3W4YA 4EIYA 1ZU4A 3GODA 1OCRC 4E0IA 3R7CA 1VTMP 5CI9A 1BZ4A 2OJQA 1G4WR 5KYXA 1TR2A 3U5SA 4Q5SF 4F4BA 2IXPA 2LFDA 2A6HF 2NG1A 4IGGA 4A2NB 1LM3B 5E3CA 4BJ6C 2EPNA 4BEJA 3EGDB 4MS2A 4O6YA 2KNHA 1UG7A 4RBNA 2XM4A 3NG1A 1EQ1A 1K40A 1HE9A 3QTHA 4PJLA 5T1DB 1EKYA 3S90A 5L0HA 1A0BA 4O6NA 4EUKB 2A0UA 5K0IA 1TWHA 3MBGA 4KNWA 2YLDA 4G78A 4Q7CA 5F5HA 3E9VA 2RD9A 4DVYP 4CIPA 2EPOA 1V74B 1LPEA 1A7VA 4DOZA 4H4KC 5JP7A 3V5XA 3H2UA 5HV9A 2HJ3A 2PBEA 4CBEA 2P7VA 4NY3A 2X51A 1T6IA 2OU6A 5E33A 1WATA 1JPNA 3C8ZA 2XLWA 4LLEA 1OW8A 1Z5ZA 3OEOA 4JW1A 3FAPB 5TJ5E 3W2VA 3AG2C 3GEHA 1QVXA 2OQMA 3ABMC 2L7AA 2OEXA 3WODF 4DJ9A 5B3IA 5JT4A 2XXAB 2A1DD 3RF3A 3EGXB 2Y3HA 2YZSA 4ONSA 2IXNA 4U5BE 1K05A 5IY5C 2IOQA 2W4BA 2VCAA 3I4UA 5B1BC 4MW3A 4CS8C 4XPWA 3R2PA 5BQGA 1TQGA 1WWPA 3IQCA 4CDVA 2Q9BA 3GWLA 3MFNA 5AGFA 3V5ZA 3PHF2 1U89A 1I4ZA 4L6RA 2DYRC 5B1AC 2KK1A 2L81A 3C63A 1ZHZA 2VB6A 1QPUA 3ZSUA 3B0UX 3F46A 4DRIB 4XQ1A 1MNDA 4N4WA 4OIQF 4OD4A 4CJOA 5DS4A 5T3WA 4Z9IA 4P9TA 4JCZA 4PFPA 4YT5A 1O5HA 2B0JA 2EIMC 2AVKA 1WOLA 3JSEO 1JMWA 3X2QC 1V54C 1RJ9A 3ASOC 2HJMA 3DKAA 4OIOF 2JD3A 3B9QA 4XPXA 2R9RB 1QLEC 3ZG1A 2R02A 5BQIA 1E86A 5DS5A 2G3KA 4MVRA 2VASA 2Q00A 2R05A 4O6MA 1MNEA 2B0HA 4OD5A 2J9UA 1Q0GA 3L8JA 4CJGA 1WGWA 4RDAA 1A41A 3IQTA 2IXMA 4LERA 2HUJA 3EHNA 4Q4ZF 1M56C 2P1AA 1E85A 4PJMA 1VMAA 4Z9HA 5JS5A 1YZAA 3ITFA 1ORJA 2NUTB 2EIKC 1EA8A 1YVIA 3AOUA 1Y4CA 3LUTB 3LNMB 1LI7A 3UMKA 2XSEA 4A4AA 5CIVA 1L3PA 2J9BA 2R7XA 1BR2A 2OKUA 2EINC 4U5HA 5EGYA 3O6XA 4JC7A 1WASA 2OEVA 2XLEA 2WL8A 2XS1A 3TOLA 3W2WA 3SNHA 1NLXA 1BR1A 5KYYA 2BE5F 1G4US 1QZXA 1PCXA 3IPMO 4BJ1A 1R4TA 5L0CA 1CPQA 1JRAA 1TWAA 2EILC 2PP4A 5DQTA 4YT2A 2CDQA 1GM5A 3L8IA 2NPUA 2R7RA 1NG1A 2I15A 4HFFB 3NMIA 4MTFA 4XEKA 4E18A 1D0YA 4CX9A 4YT4A 1AUEA 1FFTC 1YYJA 1A7EA 3FOPA 1ZYRF 4JVSA 4U9DA 3DM9B 2KSFA 4ZLCA 2G62A 3DE8A 2L6FA 2Y3BA 2A69F 3DI5A 3IEEA 4M63A 3QVYA 1APCA 5E2QA 1ORYA 1E2XA 2J46A 4E7ZA 3TJ6A 5KYNA 1M6TA 4JEBA 2OJED 1O3UA 4XWJA 2KJGA 2KC3A 1QKRA 3EFOA 4U9EA 1RCPA 1HMDA 2NSFA 3HNKA 5KYWB 1IW7F 1GQAA 1Z6AA 3FVYA 3KYIA 1U0BB 3G4XA 1GS9A 4XEVA 3W8IA 1OR3A 4NTFA 1VYIA 3JT1A 1YDIA 3LEOA 5E3AA 4JRZA 4XLPF 2V26A 3SXZA 3M1CB 3TULA 2IYLD 4W8PA 1T9KA 5A6BA 4IARA 4IJJA 2A68F 2EPMX 1NFOA 4K1OA 2LIGA
chains in the Genus database with same CATH topology
4E0HA 3W4YA 4E0IA 3TK0A 3R7CA 1OQCA 3U2MA 4LDKA 3U5SA 3GWNA 1JR8A 3LLIA 3O55A 3LLKA 3GWLA 1JRAA 3MBGA 3U2LA 3TD7A 2HJ3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4E0H A;  3W4Y A;  4E0I A;  3TK0 A;  3R7C A;  1OQC A;  3U2M A;  4LDK A;  3U5S A;  3GWN A;  1JR8 A;  3LLI A;  3O55 A;  3LLK A;  3GWL A;  1JRA A;  3MBG A;  3U2L A;  3TD7 A;  2HJ3 A; 
#chains in the Genus database with same CATH topology
 3EJN A;  4X0R A;  4GEH A;  4K0D A;  4XLN F;  3RIP A;  3L0I A;  1V4A A;  3QW1 A;  4KBL A;  1LKX A;  1Z23 A;  4CDY A;  3HLZ A;  4CSA C;  3C8G B;  1ZU5 A;  1OQC A;  2DI3 A;  2H7O A;  1D1A A;  4LDK A;  2XL8 A;  4XTK A;  3T6B A;  3TOM A;  3KL4 A;  3ZC4 A;  1OW6 A;  4EBK A;  4EWC A;  2V3C C;  2Q4F A;  2NUP A;  1S7Z A;  2YRF A;  2ZXP A;  5JVE A;  5DVW A;  3SYN A;  4MTO A;  4QI2 A;  5L3V A;  1Q0M A;  4U5E E;  3U9J A;  1LIH A;  2J7P D;  3EG9 A;  2AP3 A;  4MQ9 F;  4BPM A;  3QZC A;  1BR4 A;  4J30 B;  4KI2 A;  3JCU Q;  1O87 A;  1YZC A;  2XLM A;  3K6B A;  3HNI A;  3HNL A;  3M79 A;  1OXK A;  1YA9 A;  2E87 A;  3ZVR A;  1RKE B;  3ZTZ A;  3U9M A;  2XLD A;  1LE4 A;  3A11 A;  1ZHY A;  4N6H A;  3ZTM A;  3AG1 C;  4D4X A;  3NDB B;  1ZZP A;  2WZF A;  3EHM A;  1Z63 A;  1FR0 A;  1Q0F A;  2P61 A;  2ICW G;  4C7O B;  5JSL A;  3S9O A;  1KU2 A;  3U2M A;  2M64 A;  3DZA A;  2HV6 A;  4YL3 A;  1GGQ A;  3B71 A;  4AX2 A;  2QTV A;  4KNV A;  1OCZ C;  2AWY A;  2HMZ A;  5COM A;  4LDQ A;  2KYH A;  1HMO A;  1EI7 A;  1NU7 D;  2HMQ A;  2XRH A;  3G50 A;  4I3M A;  1MMA A;  2W4M A;  2WZG A;  1D1B A;  2LP4 A;  1ZVZ A;  3DD7 A;  3EPV A;  4WJ0 A;  1KTM A;  2WVO A;  4YWQ A;  3U2L A;  2JX0 A;  2CCY A;  5DLJ A;  4C3D A;  4U5F E;  3ZQY A;  1ORS C;  4CIH A;  3Q6N A;  1AEP A;  3B29 A;  2A6E F;  4LDR A;  2R7W A;  1OCC C;  2R7S A;  5COG A;  2GAQ A;  3GEE A;  4QI0 A;  4UDV A;  3DAF A;  3SEO A;  2YL7 A;  4RD9 A;  4NCQ A;  4CS9 A;  1VYK A;  3HJC A;  4KC9 A;  3C8G D;  3U0C A;  4AE4 A;  3N24 A;  4HEA J;  2XLH A;  2MWQ A;  1UFB A;  1PD0 A;  3LAY A;  4YK5 A;  3E70 C;  5D91 A;  3EQL F;  5GPG B;  4DRH B;  2HSB A;  2J0X A;  4I44 A;  2J9V A;  1H6G A;  2H8A A;  5A6A A;  1M2V A;  4DVZ A;  3DWW A;  5CI8 A;  3SZR A;  1SF8 A;  2BL2 A;  3I5Q A;  3PMR A;  1M57 C;  1PV3 A;  3BEH A;  3U8P A;  2YL0 A;  3OA1 A;  5F28 E;  2EPL X;  2TMV P;  2MYS A;  4PR9 A;  2AU5 A;  4R32 A;  1LS1 A;  1T6Q A;  3KMI A;  3GAN A;  3NKD A;  4JIO A;  4MTG A;  4E17 A;  2AWC A;  3SXM A;  1NSG B;  4E0H A;  2LD6 A;  4EBB A;  3FHD A;  1TWG A;  3HTK C;  2H7B A;  1FTS A;  5KYU B;  3EGD A;  4BJ5 A;  3QVZ A;  2HSQ A;  4FES A;  2D5R B;  3S27 A;  1LI5 A;  4ULV A;  2YKZ A;  3S84 A;  1OW7 A;  2Z15 A;  5JLI A;  2D4U A;  3NYL A;  2VCC A;  4FX5 A;  4PJJ A;  3L34 A;  1DOW A;  4WGY A;  2J9W A;  5KYX B;  1VLS A;  3CEX A;  4NQF A;  1Y6D A;  2RSE B;  1I5N A;  3KKB A;  1MMD A;  1Q0K A;  4WAB A;  2Y39 A;  3Q7G A;  1BDJ B;  4U5G A;  3RQG A;  256B A;  4AL1 A;  1AVO B;  3O39 A;  1T6U A;  2XS8 A;  5EHH A;  5FCL A;  3AG4 C;  5BUO A;  3FDQ A;  2Q9C A;  3G4Z A;  3NMK A;  4IWB A;  1BBH A;  4G7O F;  5BQH A;  3LS0 A;  2R25 A;  3C18 A;  2XXA A;  5F5F A;  4MVS A;  3EGX A;  3WG7 C;  2PFD A;  4FWV A;  2IBF A;  3L1M A;  1NZE A;  2G3V A;  3EZI A;  4GYT A;  4I1M A;  3TQO A;  2J8W A;  1LVK A;  1Z3I X;  1H9G A;  3CQZ A;  3UMH A;  2OOC A;  3OWT A;  5DQZ A;  3IQ6 A;  4IAO A;  2ASR A;  4IRU A;  4B6I A;  1OKK D;  4YT8 A;  2L9J A;  3FMS A;  3ZQV A;  2ZD9 A;  2GWW A;  3ZIB A;  1XWJ A;  4NTA A;  2QY9 A;  5L0I A;  2ZXW C;  3DAG A;  3JTL O;  1QSP A;  3O55 A;  4JZA A;  2KW3 C;  1VB5 A;  2LK4 A;  3DJU B;  3DM5 A;  3MYI A;  4DBR A;  4YJW A;  3B0V C;  5A6K A;  1Q0D A;  1OR2 A;  3QW0 A;  2EPK X;  3AJM A;  3FAJ A;  4OIR F;  5AC5 A;  4HE8 D;  3TD7 A;  3IQ5 A;  3NYJ A;  1C02 A;  4PK4 A;  1D0X A;  2WVN A;  3S28 A;  3AGU A;  4U5D E;  4BJT A;  3T6J A;  5L3Q A;  3GM3 A;  5DS6 A;  4LLC A;  1XZP A;  5HSW A;  1D0Z A;  2R7O A;  3QMK A;  4ER9 A;  4YL0 A;  3PCV A;  3A9C A;  4OIN F;  1VLT A;  2CNW D;  3Q6M A;  3VM6 A;  2QE9 A;  3LEV A;  1T5O A;  3B0P A;  3N2Z B;  3RH3 A;  2CW0 F;  2OCC C;  4MVZ A;  1XZQ A;  3RYL A;  1YAR O;  2WZL A;  3JRM O;  1ZHW A;  3VAY A;  1SR2 A;  2ZXR A;  3DXJ F;  1RJ9 B;  4O79 A;  3SP1 A;  2YL1 A;  2PX3 A;  2W9Y A;  2XL4 A;  3UR3 C;  3BRJ A;  4P9F A;  2VC9 A;  2NUT A;  1A7D A;  1T01 A;  5L0G A;  3LES A;  4MVQ A;  1OCO C;  1TWC A;  2J0W A;  5EK0 A;  1G8X A;  3M4B A;  3NKE A;  4PJN A;  3FOO A;  2MHR A;  3K1I A;  1B68 A;  2ETS A;  3M4C A;  3RFY A;  3CZ6 A;  3J06 A;  4EHP A;  2YEV A;  3ABK C;  1MMG A;  2C03 A;  2O9X A;  4CDA A;  2GDC A;  1HW2 A;  2NSG A;  5B3S C;  4CS8 A;  4DRJ B;  3N0T A;  3VYW A;  2HKV A;  4H54 A;  3GWN A;  4JUR I;  2HV7 A;  4LAC B;  1M2O A;  1ZW2 A;  4NTB A;  1YLM A;  1K04 A;  2J7P A;  3EZH A;  2IM8 A;  3IHU A;  3K1H A;  1HY5 A;  1FFH A;  3NMJ A;  2R03 A;  3T6G B;  1JPJ A;  3U3B A;  1Z7Q c;  2L6G A;  2YLI A;  3AGT A;  4DBQ A;  4OIP F;  2HFI A;  3US6 A;  5D92 A;  2XLV A;  4MVU A;  5A6J A;  3KYJ A;  4GQH A;  5KYY B;  2R7Q A;  3ZDL A;  1CGM E;  4JJF A;  2YLG A;  4JTD B;  1FAP B;  4EKW A;  2KQ9 A;  1J8M F;  1JAF A;  2DYS C;  3LNR A;  1ZHX A;  1KNY A;  2VH3 A;  2F22 A;  4ULW A;  4AL0 A;  1NU9 C;  2Q7R A;  2R7T A;  1MMN A;  3ASN C;  3Q7L A;  3JRT A;  4YL1 A;  3K1I C;  5KYW A;  2DGJ A;  2LCH A;  2Y3D A;  2X0C A;  3UGO A;  3UGP A;  1V55 C;  1CPR A;  1LE2 A;  1TFK B;  1YA7 O;  3RQE A;  4JTA B;  2Q9A A;  3S29 A;  1H9T A;  3EH2 A;  3HKK A;  3F47 A;  3X1O A;  2PNO A;  2EIJ C;  2UUH A;  2Y69 C;  3GM2 A;  1YAU O;  4IAQ A;  5JRA A;  3C7J A;  1H7I A;  4P6I C;  1PD1 A;  3EFO B;  4MND A;  1C17 M;  1NBB A;  3O10 A;  1HW1 A;  2JPU A;  1FMV A;  2ZXO A;  2ZPA A;  4JE9 A;  3V5Y A;  1CGO A;  3C8G A;  3C62 A;  2IXO A;  4YN0 B;  1L7C A;  3UNG C;  3RW0 A;  1D1C A;  4JKV A;  3LJB A;  2XL6 A;  3CSK A;  4N6C A;  4BG0 A;  2I8B A;  1LS4 A;  1F1M A;  1TFO B;  2H7V C;  2W45 A;  1W2W A;  4I1O B;  5L0D A;  1E84 A;  4ANJ A;  1VK5 A;  2HZ8 A;  3ECS A;  1OXB A;  2GFH A;  1WN0 A;  3LS1 A;  3MLG A;  4N06 A;  3AQC A;  3K7D A;  1S05 A;  3FXH A;  3U8V A;  3VF0 A;  4CS9 C;  4Z9J A;  3ZWI A;  4AK9 A;  5JUA A;  2VCB A;  3T4R A;  1U6H A;  5T3T A;  1C03 A;  1RKE A;  3ABL C;  1YJG A;  2OG2 A;  3HNJ A;  1HE1 A;  3H2V A;  4K7B A;  4W8K A;  3UMI A;  2YWA A;  2GA0 A;  3WHN A;  3VRC A;  2FGY A;  3SXK A;  3LLK A;  2XM0 A;  2Y3G A;  2NUP B;  2QNL A;  1WTY A;  1ZHT A;  1G5Z A;  1RXQ A;  2YL3 A;  3JYH A;  4IB4 A;  3WAQ A;  4G7Z F;  3DJN B;  1NFN A;  2M4E A;  5FZT A;  4C7O A;  2QLA A;  3RVZ A;  4O7G A;  3EG9 B;  1TKN A;  1VOM A;  3EH1 A;  4J7Y A;  3S0X A;  1ST6 A;  3NYM A;  3I5P A;  3K33 A;  4MVM A;  4NC3 A;  3TJ5 A;  1YYX A;  2DB4 A;  3TK0 A;  2P6V A;  2PX0 A;  3W8H A;  4C3E A;  4D4N A;  2HS5 A;  4XEF A;  1FNT c;  4PAC A;  3U3F A;  1JOG A;  3PDM P;  2R7U A;  1CGN A;  3JZ0 A;  2WB7 A;  4QDL A;  3RQF A;  4U5C E;  4ZLD A;  3LLI A;  3GM1 A;  2L6H A;  3DMD A;  1SMY F;  3KH2 A;  4FAP B;  4BJ5 C;  1SZI A;  5COF A;  1E83 A;  1RKC A;  2FFH A;  1J8Y F;  3H65 A;  4BEM J;  4DXW A;  4CSA A;  3M15 A;  3SXY A;  3CAX A;  2BC5 A;  1R5I D;  3DE9 A;  5A6B D;  1N1C A;  1DOV A;  4WGZ A;  4JCH A;  2LFF A;  4JTC B;  4MVO A;  3V7O A;  4BJ6 A;  3JYY A;  1IZM A;  2C04 A;  2UUI A;  4G0H A;  4JEA A;  2Q3T A;  1OKK A;  2XLO A;  4XPY A;  3RKO F;  3GOR A;  3RVY A;  2A0B A;  4J32 B;  1JR8 A;  4C3B A;  3MYF A;  4PFO A;  4J7T A;  2J45 A;  2LQG A;  1SYQ A;  2YQY A;  5A69 A;  5L0F A;  3AG3 C;  2QUP A;  1ZW3 A;  1MQV A;  2P0N A;  4AE4 B;  4EBJ A;  2LSE A;  3AQB A;  4CS7 A;  4JJG A;  1QQ3 A;  3KPH A;  4G7H F;  3MX3 A;  3JSZ A;  2PF4 E;  2YHS A;  2KGO A;  2R7V A;  1FMW A;  4HFK B;  3POV A;  1I4Y A;  3ATP A;  3T9O A;  3GEI A;  1RMV A;  2FAP B;  2YVK A;  3NRH A;  4MW8 A;  4E7S A;  5KYU A;  5L0J A;  1M2V B;  3K66 A;  5AC4 A;  2CYD A;  2CGE A;  2WVQ A;  2CNW A;  3W4Y A;  4EIY A;  1ZU4 A;  3GOD A;  1OCR C;  4E0I A;  3R7C A;  1VTM P;  5CI9 A;  1BZ4 A;  2OJQ A;  1G4W R;  5KYX A;  1TR2 A;  3U5S A;  4Q5S F;  4F4B A;  2IXP A;  2LFD A;  2A6H F;  2NG1 A;  4IGG A;  4A2N B;  1LM3 B;  5E3C A;  4BJ6 C;  2EPN A;  4BEJ A;  3EGD B;  4MS2 A;  4O6Y A;  2KNH A;  1UG7 A;  4RBN A;  2XM4 A;  3NG1 A;  1EQ1 A;  1K40 A;  1HE9 A;  3QTH A;  4PJL A;  5T1D B;  1EKY A;  3S90 A;  5L0H A;  1A0B A;  4O6N A;  4EUK B;  2A0U A;  5K0I A;  1TWH A;  3MBG A;  4KNW A;  2YLD A;  4G78 A;  4Q7C A;  5F5H A;  3E9V A;  2RD9 A;  4DVY P;  4CIP A;  2EPO A;  1V74 B;  1LPE A;  1A7V A;  4DOZ A;  4H4K C;  5JP7 A;  3V5X A;  3H2U A;  5HV9 A;  2HJ3 A;  2PBE A;  4CBE A;  2P7V A;  4NY3 A;  2X51 A;  1T6I A;  2OU6 A;  5E33 A;  1WAT A;  1JPN A;  3C8Z A;  2XLW A;  4LLE A;  1OW8 A;  1Z5Z A;  3OEO A;  4JW1 A;  3FAP B;  5TJ5 E;  3W2V A;  3AG2 C;  3GEH A;  1QVX A;  2OQM A;  3ABM C;  2L7A A;  2OEX A;  3WOD F;  4DJ9 A;  5B3I A;  5JT4 A;  2XXA B;  2A1D D;  3RF3 A;  3EGX B;  2Y3H A;  2YZS A;  4ONS A;  2IXN A;  4U5B E;  1K05 A;  5IY5 C;  2IOQ A;  2W4B A;  2VCA A;  3I4U A;  5B1B C;  4MW3 A;  4CS8 C;  4XPW A;  3R2P A;  5BQG A;  1TQG A;  1WWP A;  3IQC A;  4CDV A;  2Q9B A;  3GWL A;  3MFN A;  5AGF A;  3V5Z A;  3PHF 2;  1U89 A;  1I4Z A;  4L6R A;  2DYR C;  5B1A C;  2KK1 A;  2L81 A;  3C63 A;  1ZHZ A;  2VB6 A;  1QPU A;  3ZSU A;  3B0U X;  3F46 A;  4DRI B;  4XQ1 A;  1MND A;  4N4W A;  4OIQ F;  4OD4 A;  4CJO A;  5DS4 A;  5T3W A;  4Z9I A;  4P9T A;  4JCZ A;  4PFP A;  4YT5 A;  1O5H A;  2B0J A;  2EIM C;  2AVK A;  1WOL A;  3JSE O;  1JMW A;  3X2Q C;  1V54 C;  1RJ9 A;  3ASO C;  2HJM A;  3DKA A;  4OIO F;  2JD3 A;  3B9Q A;  4XPX A;  2R9R B;  1QLE C;  3ZG1 A;  2R02 A;  5BQI A;  1E86 A;  5DS5 A;  2G3K A;  4MVR A;  2VAS A;  2Q00 A;  2R05 A;  4O6M A;  1MNE A;  2B0H A;  4OD5 A;  2J9U A;  1Q0G A;  3L8J A;  4CJG A;  1WGW A;  4RDA A;  1A41 A;  3IQT A;  2IXM A;  4LER A;  2HUJ A;  3EHN A;  4Q4Z F;  1M56 C;  2P1A A;  1E85 A;  4PJM A;  1VMA A;  4Z9H A;  5JS5 A;  1YZA A;  3ITF A;  1ORJ A;  2NUT B;  2EIK C;  1EA8 A;  1YVI A;  3AOU A;  1Y4C A;  3LUT B;  3LNM B;  1LI7 A;  3UMK A;  2XSE A;  4A4A A;  5CIV A;  1L3P A;  2J9B A;  2R7X A;  1BR2 A;  2OKU A;  2EIN C;  4U5H A;  5EGY A;  3O6X A;  4JC7 A;  1WAS A;  2OEV A;  2XLE A;  2WL8 A;  2XS1 A;  3TOL A;  3W2W A;  3SNH A;  1NLX A;  1BR1 A;  5KYY A;  2BE5 F;  1G4U S;  1QZX A;  1PCX A;  3IPM O;  4BJ1 A;  1R4T A;  5L0C A;  1CPQ A;  1JRA A;  1TWA A;  2EIL C;  2PP4 A;  5DQT A;  4YT2 A;  2CDQ A;  1GM5 A;  3L8I A;  2NPU A;  2R7R A;  1NG1 A;  2I15 A;  4HFF B;  3NMI A;  4MTF A;  4XEK A;  4E18 A;  1D0Y A;  4CX9 A;  4YT4 A;  1AUE A;  1FFT C;  1YYJ A;  1A7E A;  3FOP A;  1ZYR F;  4JVS A;  4U9D A;  3DM9 B;  2KSF A;  4ZLC A;  2G62 A;  3DE8 A;  2L6F A;  2Y3B A;  2A69 F;  3DI5 A;  3IEE A;  4M63 A;  3QVY A;  1APC A;  5E2Q A;  1ORY A;  1E2X A;  2J46 A;  4E7Z A;  3TJ6 A;  5KYN A;  1M6T A;  4JEB A;  2OJE D;  1O3U A;  4XWJ A;  2KJG A;  2KC3 A;  1QKR A;  3EFO A;  4U9E A;  1RCP A;  1HMD A;  2NSF A;  3HNK A;  5KYW B;  1IW7 F;  1GQA A;  1Z6A A;  3FVY A;  3KYI A;  1U0B B;  3G4X A;  1GS9 A;  4XEV A;  3W8I A;  1OR3 A;  4NTF A;  1VYI A;  3JT1 A;  1YDI A;  3LEO A;  5E3A A;  4JRZ A;  4XLP F;  2V26 A;  3SXZ A;  3M1C B;  3TUL A;  2IYL D;  4W8P A;  1T9K A;  5A6B A;  4IAR A;  4IJJ A;  2A68 F;  2EPM X;  1NFO A;  4K1O A;  2LIG A; 
#chains in the Genus database with same CATH homology
 4E0H A;  3W4Y A;  4E0I A;  3TK0 A;  3R7C A;  1OQC A;  3U2M A;  4LDK A;  3U5S A;  3GWN A;  1JR8 A;  3LLI A;  3O55 A;  3LLK A;  3GWL A;  1JRA A;  3MBG A;  3U2L A;  3TD7 A;  2HJ3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...