4KNWA

The crystal structure of human hdhd4 in complex with magnesium and the phosphate mimetic vanadate
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
239
structure length
239
Chain Sequence
SRVRAVFFDLDNTLIDTAGASRRGMLEVIKLLQSKYHYKEEAEIICDKVQVKLSKECFHPYNTCITDLRTSHWEEAIQETKGGAANRKLAEECYFLWKSTRLQHMTLAEDVKAMLTELRKEVRLLLLTNGDRQTQREKIEACACQSYFDAVVVGGEQREEKPAPSIFYYCCNLLGVQPGDCVMVGDTLETDIQGGLNAGLKATVWINKNGIVPLKSSPVPHYMVSSVLELPALLQSIDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Design, synthesis, functional and structural characterization of an inhibitor of N-acetylneuraminate-9-phosphate phosphatase: Observation of extensive dynamics in an enzyme/inhibitor complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords N-acylneuraminate-9-phosphatase
total genus 84
structure length 239
sequence length 239
chains with identical sequence B, C
ec nomenclature ec 3.1.3.29: N-acylneuraminate-9-phosphatase.
pdb deposition date 2013-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.710 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4knwA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4knwA01
3CNHA 5AVRA 4OHFA 2YMLA 3B9RA 2OA0A 2B82A 1KYTA 3AR9A 1ZRMA 1PW5A 4FYPA 3ET5A 1YNSA 2NO4A 3E8MA 3UM9A 1LTQA 3ZW7A 3ZWKA 3L1VA 1T5TA 2AMYA 5AK6A 3K1ZA 4I9GA 4EX6A 3QU2A 1ZOLA 3L0CA 4RETA 3F9RA 2HF2A 4Y2VA 2C88A 2I55A 4UATA 2FPWA 3QGMA 3WKAA 1IWOA 4C4TA 2W11A 3E84A 4OFZA 2I54A 1U7OA 5AW4A 2WFAA 3A3YA 4CF5A 1YDFA 1TE2A 3AR7A 4UMVA 1Z5GA 3ZVMA 3ZU6A 4BKMA 3QUCA 4NWIA 2YMQA 3L7YA 4YIHA 2Q4RA 3WK7A 4UARA 2WM8A 2YFYA 5AI9A 4EEKA 5AHXA 4Y2JA 2FEAA 4BX0A 1Z88A 5ALTA 2GO7A 4AS2A 2JAWA 4IG4A 1L7OA 3QUBA 3IJ5A 1N9KA 4ZEXA 3EF0A 3I6BA 3L5KA 5ALSA 3N1UA 3KBBA 3ZI4A 4BX2A 2RB5A 5ALNA 5ALGA 5AI4A 5ALVA 5AI0A 2YN4A 1WVIA 2I33A 4BNDB 4BX3A 3ZTWA 4Y2UA 4UM7A 2GMWA 3MPOA 2NO5A 4O8CA 1L8OA 1ZJJA 1SU4A 5AK4A 5AESA 3OCUA 2P69A 2FPUA 1SWWA 1ZD5A 2G1AA 1U7PA 4YGYA 3U13A 4J2TA 4QQFA 2W43A 3BWVA 4Y2SA 4Y2XA 5AW9A 3DNPA 5ALKA 1VFPA 3QNMA 3W5BA 2R8XA 1U2SA 3OCWA 5ALXA 2HCFA 5ALOA 3ZVLA 3KC2A 4Y2PA 5AM0A 3P96A 2RARA 5AVQA 1SWVA 3UMGA 5AVYA 2YBDA 3MN1A 1RKQA 2C9MA 4FFDA 4B6JA 5JJBA 5E0OA 1RLOA 4G63A 4MUMA 2DQSA 4UM5A 1Z4LA 3TLMA 3OCVA 4KX5A 4XE5A 5FP0A 2G07A 3AR8A 5ALFA 3QU5A 1NRWA 2WF8A 4XQ0A 5ALMA 4CE6A 3FPSA 4DW8A 2YY6A 3M1YA 2ZG6A 3MC1A 2W4MA 2FUEA 1QQ6A 3OCYA 5AM4A 3RF6A 5A3SA 1NF2A 3FPBA 4Y2YA 3PDWA 2O2XA 3ET4A 4RESA 2ZBFA 3L8FA 1VJ5A 1N8NA 3ZX5A 3ZX4A 5AKYA 4HGRA 1EK2A 5ALLA 5AKLA 1MH9A 2HEGA 1WR8A 2NYVA 2YJ3A 3E58A 4Y2RA 5AM2A 5ALYA 1Z4MA 3WK9A 5AVSA 1XP5A 1TJ5A 4L6CA 4UAUA 3QU7A 1CQZA 5ALIA 1RMYA 3NAMA 3NALA 3WKCA 2EATA 5A3QA 1VJRA 1Z4QA 2WHEA 3WKBA 2HO4A 2I6XA 3N28A 4HAIA 2ZBGA 1F5SA 5AVWA 1Z5UA 4YH1A 4XPZA 2HSZA 4IFTA 2HDOA 2GHTA 3WGUA 4EZEA 2G08A 3NRJA 1YJ5A 2WF9A 5AVVA 5AK3A 3KD3A 3SKYA 3QU9A 1RQLA 1J8DA 1QQ7A 2P11A 2I7DA 1L6RA 3N8GA 2PR7A 2GFHA 4JB3A 4H1WA 2X4DA 2PQ0A 3U19A 2YJ4A 1WPGA 5AKZA 3PGVA 2QLTA 4HGNA 3EWIA 3N07A 1Z4OA 2IYEA 3L8GA 4PNHA 4F71A 2HI0A 2JARA 4C4RA 3AR3A 3I76A 1J97A 4ZEWA 1RMTA 3A1CA 1JUDA 2CFTA 1TJ3A 3FM9A 1X42A 3S6JA 3SMVA 4BBJA 5AW0A 3U7GA 2YMPA 1XVIA 3PCTA 2I34A 1Y8AA 2D2VA 4C4SA 3QUQA 1ZD3A 3DAOA 5AIAA 3ESRA 5AM3A 5ALUA 4ZEVA 3R9KA 4YCLA 5IT4A 1ZRNA 1TA0A 2FI1A 4L6AA 2FPXA 4KX3A 4GXTA 3U7FB 3B8EA 4HGPA 4EENA 5ALHA 4NABA 2WF6A 2G09A 3SKXA 5AKIA 3WK8A 1RPZA 3AR6A 1ZD4A 3I1YA 4Y3UA 5T41A 3N5KA 3OTQA 1Z4NA 3L0BA 5AVTA 1L7PA 5AI5A 4BYGA 4UU1A 4UU0A 3U26A 3UMCA 4I9FA 3OPXA 2ZBEA 2HHLA 2IOHA 4UMFA 4CF4A 4F72A 1YMQA 1LVHA 4Y2QA 2YMMA 3FZQA 3SD7A 1QH9A 4UW9A 3KDPA 3R4CA 5AM1A 1Q92A 5AKHA 4NV0A 4J03A 1S2OA 4HYTA 3NASA 3SHQA 2B0CA 2B8JA 2BY4A 3W5CA 2FPRA 3DV9A 1S8OA 3ONNA 5ALEA 3L0YA 2G06A 4GIBA 3QXGA 5AICA 3OCZA 5AW6A 1U2TA 5AKJA 3IRUA 4E88A 1O08A 4XOUA 1RC8A 3A1DA 2OBBA 2P27A 5ALZA 3NIWA 2Q4TA 4KN8A 4QJBA 4OCZA 4NAVA 2RAVA 4UASA 3AR5A 4CNQA 4YCMA 2G0AA 1T5SA 5AKGA 2O9JA 3ZUPA 3UMBA 2ODAA 3L8HA 2IOFA 2MSNA 3WK6A 2FDRA 1QYIA 1XPJA 1RLTA 4UMDA 3HYCA 3J7TA 2FPSA 3WK5A 4OD0A 1K1EA 4KNWA 1U02A 3AR2A 3QU4A 1Z4KA 4YCNA 2PKEA 3HLTA 4UAVA 3OCXA 1Q91A 2JAOA 3L1UA 5ALPA 2C8KA 2WF5A 5ALDA 1NNLA 4EX7A 3NANA 2HF7A 2R8EA 4DFDA 2GHQA 4AP9A 2VKQA 5AIBA 3D6JA 3L8EA 3EF1A 3R09A 1Z4JA 3SF0A 5AKXA 5AKKA 5ALRA 4G9BA 1L7NA 3WGVA 5AVZA 1RQNA 1WZCA 2AH5A 3WKDA 2WF7A 4HGQA 1QQ5A 3IB6A 5ALWA 2OYCA 4YIKA 3QUTA 5AW1A 4FE3A 1TJ4A 3ZVNA 1FEZA 1YS9A 2OM6A 5AI6A 3KZXA 2R8ZA 5AW7A 1RRCA 2CFSA 5AKEA 3ED5A 2RBKA 2FUCA 2R8YA 3M9LA 1RKVA 4BNDA 2P9JA 4HGOA 2B30A 3ZWDA 1RMQA 2EAUA 5ALJA 3B9BA 5AW8A 3VAYA 2ZOSA 5AVUA 2ZBDA 3U7HB 4KYTA 1EK1A 2JAUA 4DWOA 4L57A 1ZS9A 2BDEA 2ZXEA 5AW2A 2B1QA 4JDPA 3W5DA 3W5AA 2QYHA 4UMEA 5ALQA 2CN1A 1CR6A 2MU1A 4DCCA 2YJ6A 1Z4PX 2HOQA 3QYPA 3I28A 5AI8A 2B1RA 3QLEA 3U7EB 4AS3A 3ESQA 2EARA 5AW3A 3ZTYA 5AK5A 1RDFA 2IA5A 1T9ZA 3GYGA 3KOOA 4BEWA 2C8LA 3BA6A 4MWOA 2YJ5A 1YV9A 2Q5EA 4KNVA 1RKUA 1L8LA 3DDHA 3PGLA 5IS2A 1L7MA 3EPRA 4BEVA 4CF3A 5AM5A 5AW5A 5A3RA 2IOFK 1RLMA 4EELA 4NFLA 2G80A 3RFUA 3E81A 4Y2TA 1ZD2P 2CFRA 3MMZA 5IT0A 3WKEA 5AVXA 2JGAA 2AUTA 3AR4A 2BDUA 3QX7A 2HX1A 3A1EA 1Z4IA 3FVVA 1AQ6A 3SLRA 2B8EA 1O03A 3FGOA 3WK4A 2C4NA 3NUQA 3CZ4A 2AGVA
chains in the Genus database with same CATH superfamily
1IZZA 4LYYA 1Z74A 5AVRA 1OPXA 3N0RA 1C4XA 4ZQGA 3HTKC 4FK8A 3WFZA 2G04A 4LZLA 5KOJB 2VHXA 3FMPB 5IHPA 2ADFA 1H8EA 5F98A 5MN6A 3TGLA 3PDJA 3GHHA 1DXYA 1L5VA 4HNHA 1R1DA 3DBRA 1H2XA 3DE7X 2BVNA 3LXXA 3N53A 1VG8A 1J00A 3LDAA 5LBUA 3MCZA 4PS1A 3KYDB 3PGKA 2D5LA 1O54A 2PHZA 3DDZX 4ZK2A 1M5RA 3E8MA 2R9RB 3K73O 5BN3A 3M4JA 3D7MA 3O2SB 1PZHA 1FSPA 4Z0NA 1TTTA 1Y1SA 2YWCA 3DJYA 1FTQA 3GFVA 4HHEA 4MZXA 4B9EA 5KKCA 4DCGA 1H05A 5DF1A 4GUDA 1ADGA 4BFCA 2YCLA 3WP0A 4HEAJ 3C98A 5FPQA 5JYBA 4TXLA 1KFEB 1HNXB 1AHHA 3LT0A 5KWSA 4URHA 1PVVA 4Q19A 5H82A 3U3RA 2ORVA 2VZ9A 1J21A 3GANA 2I55A 4Z0PA 3SZUA 4C88A 3L7DA 3P4YA 4H6VA 2PH5A 4ZODA 5EPOA 1CUVA 4RY8A 2IZ0A 2JIQA 3STUA 1SUFA 1ZMOA 5KU7A 1TAQA 2P9BA 4K05A 1G2OA 4R8LA 1ZIXA 3VKGA 3COSA 3S44A 3KR2A 1IIBA 1TM5E 2GA8A 3P9NA 3GGSA 2PUTA 5JECA 3FYDA 2YRWA 1I4EB 1N8SA 5CT5A 2FK8A 4UAJA 2J67A 1ZOIA 2XF8A 3L7YA 3Q9UA 4LHEA 4UBJA 4B73A 1LGYA 3PS9A 4ZKDA 3C7KA 4PVDA 1ULHA 4NU0A 3I2IA 2Y4OA 2D1RA 5EIHA 2XZPA 4GBED 1MH1A 4LZAA 1FE8A 2ZQ5A 5JCPA 5T7BA 1CRPA 2H0RA 1XF9A 5EXTA 4B81A 4BO7A 5EHHA 1EFHA 1ID8A 1L4MA 4U5XA 4ZHQA 4RENA 4OYRA 1ZNXA 4FI3C 4HBGA 2ZAYA 4NBVA 3UMJA 3VO9A 4ZEXA 5JFGA 3AI7A 5ETJA 2MMGA 3SIPA 1FPMA 2YL1A 1ZVKA 1CQXA 1GPLA 5ALNA 2GN8A 4M1TA 2YNMA 1U0JA 4IV0A 2V65A 3HVJA 4Y9SA 3W2FA 1NBWB 1PR2A 3T35A 3STVA 3EODA 5HFJA 4BNFA 1HE1C 4KYUA 4JJ6A 3UUWA 3VR3D 2EJUA 2AVKA 1WETA 1DOAA 3UHOA 2QE7A 5JS6A 3R6GA 3TM4A 4ATNA 2YL7A 2YC2C 1XVUA 3M6AA 1I1OA 3MPOA 2C0PA 2QRVB 4LOJA 2FJ0A 3DDOA 4N4AA 1VC2A 1T3GA 1SU4A 1ZJJA 2Q5CA 3JX9A 3L0IA 4GP6A 5J59A 2A33A 4J16C 3HK2A 4ZOLA 3SQOA 1CY1A 1T91A 4A6XA 5BWOA 5C5IA 2IW3A 3FJOA 3R3WA 1A9XA 4RORA 2FMHA 5K6AA 1XAIA 3D8TA 4UJ3A 4M8NE 2J5BA 1HMOA 3PHGA 4MR9B 3D6MA 1KDZA 4B6QA 2PUFA 4BNTA 3OD5A 3DLBA 1S1CA 4TT8A 4ABYA 1JN0A 3KYCB 4YO7A 1O6GA 1NYLA 3PUHA 5EJFA 2GJAA 4XEUA 1F3OA 1NY5A 2Y3HA 4PSAA 3B60A 1GCIA 2VH2A 1BS9A 4FYHA 4Q15A 1FX1A 2FEPA 3U40A 4B1FA 2SKEA 4AXBA 3UJ7A 1CETA 3WVNA 3SDSA 1RLOA 2MYNA 4REOA 3UG7A 1L8XA 4GC9A 4RK1A 4QG3A 3COVA 1ZH0A 2OM2A 1EG7A 2WDPA 1IMJA 3V4RA 1Q22A 4XEFA 1BFUA 4UVGA 3U7JA 1KHTA 3BFJA 4JC7A 3FW1A 3ZZUA 1WBBA 1UPCA 3GJSA 4H2DA 1JHXA 5ADWA 2W6IA 5EN4A 2VJAA 4EECA 3TOCA 4DDMA 1ZICA 2CXOA 9LDTA 1CFJA 4CE6A 1U8UA 4EGAA 5K0TA 2ADOA 2HQOA 3GRCA 1KGSA 4MSUA 3LUCA 1ESCA 1XMJA 1U2GC 3E3NA 1J0EA 4DW8A 5T1DB 4JLAA 3P0JA 2QJOA 1ABBA 3PP8A 1L1FA 4CDYA 4ZQBA 3TD9A 5JATA 5CJJA 3AV3A 3EVDA 3LDGA 3P0RA 4LBWA 3MJSA 1HDIA 3YASA 2DFLA 1OREA 1QHXA 1Y3DE 2FW0A 2H8AA 2I67A 2O2DA 1CPQA 3EQ7A 4US1R 5JASA 1G42A 1I6LA 3I2JA 2HJ3A 4DLZA 4DG8A 1T4CA 2HEGA 4JBLA 1HLGA 2FQXA 1NQAO 4MYHA 4TN5A 3ZWNA 2BGLA 4CYMA 2DUUA 4KGXA 5AUPB 4TYWA 2IELA 1JSXA 2UV8A 1HDYA 4FGLA 4J76A 2NU8B 2FUKA 3UAYA 2NX2A 1CQZA 1HA3A 1GQRA 1NLUA 2TS1A 4J1TA 4N18A 5ALIA 3FYHA 1V5GA 1SCUA 2HRCA 2VDJA 2D2IA 1YLMA 2MDTA 1US8A 3BREA 4FW8A 5EGSA 2ZU6A 5LXTF 3WLEA 3OE1A 1IVSA 2MR6A 4CJGA 2I5PO 1FRZA 3U4DA 2I6XA 3LVRE 3WYEA 1C80A 1OXUA 4Z51A 5EKSA 4HJXA 3WG9A 3SI7A 1A69A 1PJRA 5AVWA 3DOUA 1YZUA 4Q34A 3HS3A 4PN3A 8OHMA 5EWMB 3K70C 2V5AA 1V54C 1KQGA 3G1UA 3SC2B 1V48A 4HI0E 1I5RA 2NYUA 1JEEA 4XPXA 5H16A 3KEGA 5EQDA 2BJHA 5AK3A 4DILA 2YN2A 4LOIA 4H31A 4OQLA 2QENA 4W5WA 4AY4A 1EVKA 1L6IA 5M29A 2QRGA 3W9BA 2ZJ1A 4QHYA 1ODIA 3DVQX 2X2EA 3HDGA 4XIGS 1KZYC 5AVKA 2EJTA 3AOEA 1JDTA 2C5GA 2FW6A 4ENQA 2IYQA 2GVNA 2QZJA 1DEXA 2ON6A 1U8CB 1W5AA 2WTEA 1IHPA 4JZKA 2PZKA 1C81A 2PYDA 4ZDIA 3A0UA 1HNZB 3S84A 5TQ2B 4X41A 2BBTA 1ULUA 2G1JA 2VTEA 3CLUD 3OPVA 5HIIA 3RF6A 4XH9B 4AMZA 3H9BA 3T1QA 1EVLA 2FWPA 3GI1A 4L6IA 3WP1B 4OX9Y 4I50F 1QPBA 2D4UA 2G83A 3AEKA 1C9NA 2ZTMA 1RFLA 5E4TA 1EM8A 5LFAA 1VBKA 5JPDA 2R7TA 1BWQA 1EWYA 5ENZA 3DJUB 3ABKC 3QYJA 1RE1A 1MBZA 2OB2A 4O4IA 4N3NA 3VMMA 2ADMA 1PNQA 5GM1A 1F2UA 1KEEA 4XM1A 1QV6A 3CH6A 3C8HA 1XD2B 1SBZA 2F9FA 1K6JA 5A2GA 4OXIA 3NJ8A 4LXUA 3T3MB 3TKLA 5DOZA 1E9CA 4N47A 1OGIA 4E1AA 4LXTA 1FSGA 5CU7A 2EILC 5AVOA 1YHNA 2ACKA 2YDYA 1DKOA 1PYOA 3F5QA 2YUIA 3G8CA 3K2EA 3LPMA 4CCYA 2V6BA 4F5YA 1UMDA 1WMDA 1RYHA 3HSYA 5D85A 3D6TB 4MWTA 1UIRA 3B0PA 3CPEA 5FOUA 2VPPA 1HC7A 3JQDA 2CLLB 3PVSA 4QVGA 2GNAA 2FVYA 2WZCA 5GPBA 3ZG1A 1UJ5A 2N9UA 4DNPA 5KKNB 3M82A 4M1KA 1EGQA 4R51A 3HH8A 2GM9A 4I1UA 3IIIA 5LQJA 2HH9A 1RBQA 1KETA 2H57A 2WU8A 5L3ZA 4NK4A 4DEVA 2NVOA 4LV6A 3AF5A 2X0KA 4I4LA 1NWHA 4KOAA 4MRAA 2EX0A 4ULVA 2EP5A 1V74B 4PRZA 1O3YA 1PT6A 3WADA 5LKRA 4PHCA 2NVUB 4Z1MD 3J7AC 2IPMA 3GJ7A 3JT1A 3SHOA 3K1AB 1BYIA 3JASA 1BDBA 1MN6A 3MTAA 4QO7A 1RP7A 4FOSA 5KSPA 4Q9AA 2IYYA 3RDPA 5JJ5A 1UEXC 2JCYA 3KDSE 3QM1A 4CVNA 3IL2A 1ZG3A 2A94A 1W0KD 3EPHA 2OCCC 5TPZA 2VP3A 3HDVA 2CZCA 4QTUB 1IZ9A 1LS6A 4XGQA 5MGNA 5EP3A 2DUNA 3WLQA 1D7AA 2NSFA 2FOLA 4GHWA 4F6LA 4QEKA 3H0EA 1K66A 4HPWA 4IIJB 4ONEA 1GOTA 2C59A 4KFUA 1FFXA 2EYUA 2H2DA 5BP7A 1CQPA 3VPCA 1IY8A 2E4XA 2F3SA 3EUEA 3HP7A 5AH0A 4JI4B 2W2MA 1XLTA 4LERA 1BVHA 4REQB 2G06A 1JA9A 3SEZA 5HZMA 5H83A 2FCAA 2Y77A 2FAPB 1T3LA 2OAP1 1MC8A 3E7PA 1UH5A 4KCGA 5AJYA 4EF6A 3OJ0A 4M63A 1N2HA 4TT3D 1LRLA 5AXBA 3T7KA 1WB4A 4GFDA 1KXJA 1U1DA 1ZEJA 1PP4A 2VF7A 1VCIA 3EUAA 2IYFA 3GV0A 4IILA 5E0KB 3AL2A 1Z3IX 4KR7A 6AT1A 1CIPA 4QYMA 4ZRDA 4XPIB 2K4MA 4NQFA 3THXA 1WD5A 4MULA 1RC8A 1JL3A 3GRAA 2NV0A 4D82A 3I2HA 3HJAA 3RUEA 1X9HA 2Q4TA 4PCAA 3R7BA 1WF3A 3WZ2A 1PN3A 4PYJA 2SNIE 2HM7A 1OXVA 3NAQA 3FPFA 3DMNA 4NZNA 2V8OA 3KVOA 5C8XA 3NTVA 1P0IA 3TAXA 4MW1A 1WNTA 3BB4A 3GJ6A 4AO6A 3K66A 1IMOA 4KYIB 1KFCB 3O8QA 4RAQA 2FG5A 2M6RA 3K7DA 2WLTA 1YFKA 1E1CB 1YUNA 2CE2X 3AJRA 3M1AA 4FIZA 4IFEA 4JFAA 4PZYA 4XGRA 1DAPA 5CH5A 5I9IA 4BFYA 4DA4A 1TKRA 2BGGA 3TL2A 2GHRA 3GNLA 3WX0A 2XCIA 3DW1X 3SYMA 3LX8A 3KWFA 2Z9BA 4HB0A 4B35A 4BJHB 2E87A 4CUJA 1QFSA 3PNSA 1B76A 1AXGA 1J42A 1EJ2A 3FDJA 2WWWA 3JTEA 4QAJA 2O19A 2D5RB 1RTKA 3BEDA 1RXQA 4U63A 3RS5A 3OEEA 4YJDA 2NZWA 2O2SA 1XWIA 1TTHA 1IN8A 1AVTA 4TUYF 1MMFB 3RW9A 2WY2D 2P35A 1YZKA 4G1MB 3C8GD 2X9QA 3UNGC 3ZWPA 5EIBC 2Z6QA 2B3DA 5ALDA 2DCUA 4EX7A 3WGIA 3IPRA 3GM1A 1DPGA 3FMGA 1S0UA 3IQEA 3VZSA 4Q39A 4MUIA 5DYYA 2OKUA 1IONA 1WXEA 3H9UA 1M5TA 4LWZA 4A26A 5JBNA 2WWYA 2GLXA 1LFDB 2PPVA 2SHKA 4P38A 4YPVA 2BFWA 2JGRA 4WRRA 1HE3A 2GT1A 5DHSA 5JTUA 4OD5A 4QX6A 1AE1A 4E09A 1RQNA 2ASRA 2ZATA 1FSSA 2QX6A 5EZQA 2V7QA 3UJ8A 2H2FA 5KQSA 5DEOA 3HU2A 3O84A 1YQTA 4YRJA 4L8FA 1X7XB 1RJ9B 1MQVA 1SVOA 2J48A 2WYUA 3S29A 3P4UA 2C2XA 1UXOA 2F67A 3CAXA 3KDAA 1X1QA 3LECA 1NXOA 1A0BA 1SAYA 5E95A 3NVKI 3QJGA 3A9UA 4DRYA 4ACAA 3S2IA 2ETVA 2FR1A 3WTBA 4EW3A 1OFUX 1GZ3A 2WJWA 5G0SA 2BFNA 4IZ6A 4GO1A 3GEEA 2OTCA 2KMLA 1MDFA 2OPHA 5IH7A 4L74A 4OAQA 4ZOAA 4A92A 2G5CA 2QMHA 2XF2A 4RPJA 1OASA 1G5PA 3T3DA 1R9NA 1TXGA 4NMHA 3UHJA 5L7YA 4E33A 2IE8A 1RMQA 5IF3A 4RCVA 4WFQA 4L9AA 1RAEA 3A2LA 2ID7A 3LUJA 1MC1A 4L2IB 4PPNA 2QYTA 4NZOA 3F6EX 3V8QA 1R50A 3G1WA 4WZAE 3AVYA 3PEEA 3TSCA 3OT4A 2RCNA 3WLKX 1HKHA 5BWBA 3KL2A 1CNEA 1MFPA 1XZHA 2B4YA 1OJLA 4GBJA 3WBJA 2JBAA 3WJAA 4ARAA 2R751 4FI3F 4DWOA 1M34B 1PK8A 2V0NA 3PDHA 1OU4A 5FB3A 1UXJA 3BL8A 5DNUA 5EC8A 3G2LA 2VZ8A 2X1HA 3T0GA 3EXHC 2QYHA 5KNLA 2ODBA 2FG6C 2V45A 4GR9A 2DEUA 4ZGBA 4WDQA 1B2LA 3TLJA 5AOCA 4N03A 1E32A 1XZKA 4LXXA 4H16A 4NHEA 3L0PA 3V4LA 4E3WA 5JBIA 1RQGA 1RBZA 4DRHB 1TM3E 1GV0A 1AHIA 2R4TA 2NG1A 4OAOA 4FJ1A 5HKAA 3LBYA 1R8SA 2AWCA 3EVTA 1ZLYA 3DOIA 1J2UA 3UWOA 4DJEC 3N0VA 4JOSA 1E1MA 4RF4A 1LK7A 1W49A 3ECCA 4IVQA 4O4IB 1V11B 2VP5A 4IIUA 4YO8A 1AMOA 2EJVA 2VDLB 1YBMA 1RXVA 3IIEA 5DRYA 1GUDA 5GJVC 3ZDXB 5JEEA 4BGVA 3QXHA 2QROA 2W71A 5AJZA 3AW8A 1OBOA 3G5TA 4GX2A 3UZUA 4AKIA 3OZAA 1VJ0A 1L7MA 2Z58A 3TZ6A 1RWMA 3PXDA 4A10A 5LUBA 4PR3A 4Z7QB 5DN6D 4JR1A 4OG2A 4RVCA 2WIGA 3ZCQA 4RA6B 2H7BA 2G80A 1XQ6A 3H1TA 3K4QA 5DHUA 4NZZA 2QP4A 3DZKA 5B3KA 1T2UA 3PQDA 3Q7RA 1NJSA 2G7ZA 3QQ5A 5HIJA 3DMGA 4V0QA 2MYSA 3U3ZA 3RQGA 1BQ4A 1THTA 2BDUA 2XUZA 2Y0DA 4XB1A 1Z06A 1EDDA 1T2EA 4V38A 4LDRA 2DWOA 4E32A 1G7TA 1AGYA 1SCIA 2C07A 1YZTA 2XB8A 3EIUA 4B40A 2WNSA 4HWPA 4BMZA 5EHZA 2ZJ0A 5BUSA 1Y5NA 1QCYA 1W2WB 3CZ4A 4Q3AA 4EENA 1G41A 2B37A 4BB0A 2WSSA 4ZT2A 3ZHRA 3HYTA 1G5QA 3JS5A 1EUQA 2FRDA 2ZAOA 5EXDA 2EWWA 4D4NA 3R41A 4GD3Q 3TWOA 2C4VA 2Y92A 3LK7A 4R0VA 4D0LB 3R77A 2YS6A 1N6NA 1L7RA 3C3JA 4KUGA 1PW5A 4Q7JB 3TB6A 4DEYA 3PMRA 3FHDA 1XTSA 2E85A 2VDWB 3I04M 3B0VC 3E5HA 3QBDA 3IBYA 5H7XA 5JSYA 4IB4A 1YMVA 4BLRA 1TZ2A 4WOBA 2AP3A 2OY0A 4TXNA 2ZPTX 5C80A 4UCWA 4GSLA 4XPYA 2VF5X 4NL4H 4DPKA 2PSHA 3NS7A 4LYAA 5FO0A 4HXFB 3HUUA 2E7ZA 1E1RA 3OOSA 3UVEA 4ZRMA 5AK6A 4D9BA 3KFXA 2FKAA 4QYTA 1T8SA 3MG9A 5ARBA 1LBTA 1JKJB 1EFVA 1SBQA 1DBQA 2XNJA 2HF2A 3W3AH 5FL7D 4H0FA 3ZKAA 2W6NA 2MSDB 5EJ6A 2LUOA 4LCJA 2HJHA 4GX5A 4ZARA 4EVSA 4RKRA 3ZDQA 2WYWA 3HO6A 4Q7QA 2JI6A 2EGUA 2VQ3A 5DCWA 3SLGA 2OO7A 2QTLA 3CJRA 5CR9A 5C5DA 5SY9A 3EWNA 1J8FA 3A4YA 4YYEA 5B3SC 3EIXA 2VB6A 1IPHA 1LQUA 1ISHA 5DYWA 3B5IA 2O6LA 1CUDA 3CX6A 5A4JA 3BH6A 3S68A 3TMYA 1NHGA 3WLLA 5JYDA 3TW8A 3R0XA 4LOLA 3U2LA 4V0KA 1Z39A 4D4IA 4FE7A 4DCPA 3OHSX 3LPLA 4QGBA 3T9OA 1OIXA 1G4WR 4Z4EA 2J85A 1YOBA 2KWIA 1U2QA 2N42A 2OZKA 3TPFA 3PJEA 1FP7A 1Q74A 5DWQA 4EF5A 4PPQA 3HEBA 4IHJB 1N2IA 5CB6A 2WAOA 1E86A 3N3BC 5L9AA 3ILXA 2YINC 3CLRD 4PHTA 4PLWA 4DUZB 3SXPA 4EPYA 1Z82A 2X22A 1C9DB 2VJQA 4YMIA 1E62A 3QVYA 3UR3C 1E64A 2X8JB 4IZIA 3RJTA 5ALVA 4FWTA 1IY0A 1MB3A 3ZKWA 3F73A 3S2SA 4K3UA 2RBEA 5FR2A 4Z6KA 5J1SB 1SKMA 4H6WA 5LJLA 3PHLA 3TG2A 1DWPA 4EHNA 5K8JB 4J3NA 4L16A 1KVSA 4PAGA 4PEVA 5IW8A 1N6RA 4UM9B 5FLEX 2PGJA 4F3YA 5CLHA 3SC6A 2E4VA 1NONA 4MWEA 1KVTA 4L8WB 1DO8A 2Y69C 1CUJA 1NUTA 2QRVA 3X1WA 4Q3EA 4DDKA 2WE7A 1P5HA 2JKZA 4IH4A 2B4AA 1F17A 3D3QA 2VCHA 4I66A 1N5MA 2ZJ5A 4X54A 3ZHXA 4F4BA 4HQOA 5C37A 3II6X 4J2TA 3T7TA 2XRHA 2I8AA 3JQ7A 4Q1DA 3TLGA 4TLAA 3KKNA 3LP5A 2R8XA 1P5RA 3M49A 1GWNA 3BF7A 3UXHA 10MHA 1L4YA 1JFLA 3K5WA 2WKWA 4W5NA 5H1YA 4TMVA 4UOQA 4OXXA 4B2YA 4CKBB 1S7ZA 4QSHA 1NBBA 1IK6A 2A92A 3KC2A 1XD2A 3A4VA 5AVQA 1R4AA 3MRVA 5CNKA 2Q8PA 2ESRA 3WGHA 2R2GA 1PT5A 2FUG1 3CIOA 5HRCA 1M9NA 3FJYA 4OB6A 3UFBA 5JJBA 2RJ3A 4KQ1A 1KO4A 1TIPA 1V3QE 1CEXA 4MV4A 3LBNA 3IKLA 2VF2A 4R1OA 1PWHA 4MVJE 2JW5A 2FN9A 1W2WA 2Q4BA 3KSRA 3MBOA 5A5GA 1XDGA 3HCCA 4I1PA 4NNJA 1JS1X 3G59A 3OOHA 5A5DA 4DTCA 1W4CA 2G07A 4JYAB 2HMSA 1PFWA 2OYSA 2W48A 1GYRA 3AJ9A 2PX8A 1J23A 1J20A 1Y34E 1SKYE 3GELA 3ZQVA 3INNA 4GI7A 4RVFA 3TNFA 4CLRB 4KZPA 1ZHTA 1CDOA 2A5FA 2ZUDA 4PLGA 1RRGA 4TV8B 1T9BA 1SB8A 5B2EA 1FF9A 3H99A 2ZJAA 3NT2A 2X5XA 1VSTA 1XTUA 1P29A 1IG0A 2O2XA 1H1TA 1RXIA 2YZGA 4N7BA 4RESA 3VR6D 3IBTA 1PUXA 3SIRA 1MJNA 2PZFA 4LXGA 4LZPA 4EJMA 4EHAA 3RHSA 5FWYA 1XEWX 1NNSA 1CJMA 3WFIA 2JK0A 2REOA 3OBBA 1EDBA 3HR4A 1OFGA 3A1UA 2IHJA 1XMVA 3N9IA 2Y1KA 3WJ2A 1YFLA 2FZCA 5ILQA 2HIAA 2HKIA 4U2KA 4BO3A 4F2DA 3RYLA 1M6VB 4DDUA 1Z63A 4K5QA 4MAMA 3LPCA 1FFBA 2CJXA 2C42A 4G26A 3TL3A 1CDDA 3JZ0A 1H42A 1RYDA 3WQQA 2ZYTX 4Z54A 4RY9A 5EK0A 2EX4A 2IUUA 2EATA 5A3QA 4HAVA 5BWMA 3SDZA 3A6EA 3SBOA 3QI2A 1UXGA 1DB3A 3TTTA 1BAPA 1ORYA 3WSWA 5CDYA 2ZBGA 3ZVRA 4B7AA 3D3EA 2JPUA 1L3IA 1SC6A 4LRWA 5DWVA 2IU0A 2ZGVA 1RKEB 3TOMA 1KTVA 1V9LA 2JLCA 4N9QA 4L9RA 3RSLA 3VU3A 4EGSA 2XNKA 1RIFA 2GN2A 3FSEA 2ZRLA 1TA4A 3HI6A 3NRJA 4JGIA 4MP8A 3GGOA 4M0MA 2V3CC 1V6CA 1ZKDA 3SEFA 4CV2A 1D4ZA 1JG2A 4ZYXA 1R18A 3KTAA 4JXZA 1HW2A 1WD7A 2VNJA 3N2IA 3PFIA 4FZJA 3PRHA 5KC8A 1YRYE 4X97A 4OD4A 1WTCA 3L8JA 4WUVA 2XIJA 3BQ9A 3V8EA 5J3JA 1P4GA 3D0KA 5F9HA 1IEQA 2A0BA 4Q03A 1HOXA 2A8YA 3GAFA 1KMMA 4CBEA 1WX1A 1N6OA 2C5LA 4FCCA 1TVKA 4D92A 1YGPA 3DDUA 3ITKA 4Q6BA 1RE0A 1QPUA 3U17A 2M64A 2Q3HA 1I94B 3EQ9A 4DRXA 2UXDB 1N3IA 4IQ0A 3HLKA 3A1FA 4DZRA 1N7GA 4G0OA 3VKUA 4AKEA 1RC0A 4O2RA 2DUJA 3F6YA 4Y7CA 3HNJA 2BP7A 3G0GA 4LBVA 2D3TA 2PZBA 3FMIA 3KZ1E 4HMPA 1LSUA 3DTYA 4PG6A 4DQXA 1F2DA 4ENTA 4ME6A 1K04A 2GAQA 3AOGA 1FXSA 4RIEA 2FPIA 2D5AA 4Q3KA 4KXUA 5B12A 4B3CA 1M73E 2F8LA 2ODTX 3HB1A 3FTNA 1NXSA 1XXHA 2IY8A 2YICA 4O8ZA 4W63A 5EE1A 5FQOA 1H2WA 1EWRA 1W0KA 2HMAA 1OBVA 2D2VA 4FDAA 3HC7A 2C9CA 1HDCA 1XMXA 3EG9B 2ZJZA 4FMCF 4GM0A 1PG2A 1TL7C 4MW5A 4LS3A 4PCVA 1YZYA 4Y6SA 5JXHA 3DCYA 2FUG6 5EP1A 4NENB 1JAYA 1SIWA 2R3SA 2OD9A 3ZV5A 2YFKA 1D8TA 1QKIA 3MUFA 4BO5A 3ZXSA 1D6MA 2JLWA 1GYPA 4OK3A 1D2EA 3JTMA 4J29A 3X1ZA 1PI3A 4KX3A 3DBHB 2XOXA 1YARO 1QLHA 5EVJA 1GD1O 3UENA 5E2IA 2PVPA 4RSRA 2XB6A 3HGMA 4WK6A 1Z2NX 4FQ5A 3WB1A 7MHTA 4D9EA 1F4PA 2VLIA 3NHSA 2JGFA 2OK8A 3L4BA 5CJ2A 3O4GA 1MT0A 1R3UA 5ECYA 4ZXPA 1FP6A 2QEQA 1UBLS 3O92A 3ABOB 2ZIEA 1GHTA 1OWNA 7ADHA 3AKEA 4YAFA 4Z9YA 3I6QA 5K7SA 1YC2A 8ABPA 1JI3A 4BYGA 3UUGA 4JFRA 4F11A 1FJXA 4K0RA 1Z13A 4I8XA 5DOVA 4MS1A 3PHCA 3CEHA 4HDQB 5EMNA 3RHZA 4UTXA 4KUHA 4AP5A 4AROA 3O47A 1XRQA 1LTKA 3LJBA 1V96A 1W1IA 2V6IA 2ZBEA 4WEQA 3T38A 1DKNA 3ND9A 2LKDA 4CF4A 1TEZA 4KDFA 1RXYA 3DXFA 4N0DA 1KMHB 4XD7D 2IC5A 4EG6A 4OATA 3HBAA 4PF1A 4XX0A 4I1VA 3SD7A 1XTRA 2DPHA 1D9XA 2R7QA 1C3VA 2P4HX 2BF7A 2P7VA 1KY2A 4JTDB 1QIGA 1T0HB 3TSAA 1YI8A 4KAJA 3S28A 1SZJG 3V34A 1UOPA 4NCKA 2MCFA 2XRZA 1ZJZA 4Q21A 3DWIA 1NL3A 1AHPA 4HNRA 4QD3A 4TMKA 3LKDA 3CSSA 5BW5A 1XI2A 3I5QA 2I4OA 3ETJA 1N34B 4LE1A 3VPBA 2GPNA 3KAQA 4JH0A 4NEQA 2DFNA 2H1FA 2J5KA 2RHMA 3K35A 3LYHA 4GIBA 4UD6A 3I61A 3UKOA 3KKQA 3DWFA 3QQPA 3OCZA 1PLLA 2W9YA 3RFYA 2ZETA 1RYFA 1OMOA 3QUSA 4LDZA 1KDPA 1U2TA 3Q85A 5AO9A 3A0RB 3ML1A 3IRUA 3O21A 3E2PA 3HA7A 2I1LA 2AEJA 2VWHA 2WI8A 1FLNA 4UUQA 1RRKA 3JQEA 2G7MC 1L3BA 2NGRA 1EVQA 2FETA 5JPIA 4YLGA 2VAMA 1MVLA 3EXG2 4AWXA 4JITA 2J31A 3NHWA 5IABA 2HV7A 1A5BB 3R5HA 4KPEC 2GEBA 2J5XA 4IUBS 4C7BA 5IJWA 4ZCMA 1SU8A 1I6MA 1P9OA 1U2GA 3PXAA 4WN3A 2P77A 4DR4B 5I7SA 1Q6YA 2EIJC 2PLNA 3BXGA 2QA5A 3VPHA 4L0DA 1EHYA 2TMKA 2X1MA 1D2RA 2HA4A 3GFRA 1IRIA 4ULWA 2CLEB 4RK4A 3LVBA 2CXTA 1M2VA 2L0XA 2OHOA 1L5NA 1M2WA 4O4LB 4JCHA 5BWCA 2HWKA 5HS6A 3GH3A 1CCWA 4PZUA 2WPNA 1ZCJA 3ZWIA 1JJIA 2DFPA 2WBLC 1IEVA 3HYCA 4J7XA 5CP8A 2P6PA 3SE0A 4AZWA 4WK2B 1WLSA 3JYOA 4K87A 2YKZA 5HVNA 4CFZA 4DYHA 2WLSA 1A4RA 1O5HA 2CLFB 2ZXWC 2GPBA 2JZOA 2ONCA 1YMUA 2OCAA 1XZLA 4PBSA 2B0HA 2QPOA 1Z6XA 1U02A 1NW7A 4MQ4A 4WESB 5ERXA 3ZGYA 1FA9A 1MB2A 4JOCA 4YAIA 5KU1A 5L6MB 5I9NA 3KWLA 3M34A 4Y0NA 1C02A 4MCIA 1GNRA 2O48X 4TLMB 4LIPD 4L0QA 4UXIA 2W5UA 5A7GA 3AB8A 4DREA 4ZREA 5BNZA 4QXPA 2WIJA 1G4HA 1NMYA 2O1SA 3KVYA 3RKUA 1G9XA 3ND7A 4G0WA 5K4AA 2BGWA 1Y3CE 1MRZA 4K3VA 4M22A 1EFRA 5H0IA 3SF0A 4N76A 3EDRA 1P44A 3G9ZA 1EQ1A 1NJFA 1OFIA 2JHPA 3G0IA 2KQUA 4E5NA 4HGQA 2QQEA 5FH9A 1OB2A 3AGTA 3EVAA 1RZ3A 4K9DA 4MPJA 1VECA 1W8IA 1KI7A 4YRIA 1CUUA 3FCOA 2I1VB 5KOYA 3EMBA 1JAZA 1YS9A 3FDZB 1RKXA 1JECA 2ID9A 3J06A 5HUHA 2VJBA 1WCIB 5L0FA 2XQJA 1U3VA 3G02A 3SXJA 5DM1A 4TZKA 5AW7A 1U2PA 1ENZA 1I6WA 2JEYA 3O91A 4NYIQ 5AKEA 4J94A 3LUPA 3MOSA 4QULA 3SJ7A 1VKRA 2P6VA 3U4QB 2UUIA 3LH5A 2GZMA 2DAPA 1FLVA 3NV7A 3A3PA 4KQ6A 1UP6A 3NNSA 2O2ZA 4P6VF 5FHRA 1BHO1 3ZWDA 5A62A 3GOHA 4OMDA 4GNRA 4S04A 2PRJA 3PJGA 5BMOA 1R9JA 2H5LA 3INRA 4QOGA 1VGVA 3TXXA 3BRCA 3LLMA 3GFTA 5K0JA 4XSHA 5G1PA 1ZL0A 1SUIA 1N5JA 1Z22A 2B1IA 3A58B 4KYTA 3E9VA 2I7TA 3I52A 2OD7A 3RYIB 3U7QA 3ZHVA 1UMKA 1G4AE 4U5QA 3WLSA 1EFLA 1ZIPA 4EG0A 4XLLA 2IXMA 3U9MA 2ECOA 2GRJA 3BXXA 3WRVA 1YBFA 2JBWA 4C4AA 5FWNA 3JWIA 4P9FA 1SKQA 2UUPA 1J24A 2VSYA 4QDKA 3GWGA 2WVJA 2CUZA 3Q3HA 5EUCA 1IOVA 4MIKA 1MW9X 1V8ZA 1V1RA 4ZO4A 3RO7A 4QM6A 1QF6A 1XDDA 4PWZA 5G0UA 3Q0TA 3DVAB 2E4UA 3DB1A 4DIOA 1VYTA 4PGAA 5H4HA 4IIHA 4AS3A 5KMGB 2C1XA 2DJIA 3KD2A 4E18A 1KDTA 1KBOA 4K9OA 1FNNA 4NV3A 2DBRA 4LK2A 1XU9A 4KRFA 1DAFA 1PYDA 2REQA 4EKGA 4WOKA 5KMGA 4KRXA 1FMCA 2TMYA 5EY5B 3DO5A 4Y1FA 1XVLA 2C2GA 1C9JA 5B3LA 3OX1A 5FZTA 3TK1A 4IHQA 1WZEA 3DDHA 1V1RB 1C30B 2H11A 5IS2A 2EG9A 3D1JA 4OLFA 4MVJD 4PLTA 3A6PC 5KYTA 4HEJA 5E2BA 4BJ6C 1WO8A 1KP9A 1HFKA 1RJGA 1VI6A 2IU3A 2XYRA 1Q0QA 3IOYA 3BXZA 1CUHA 2ZJ2A 5IN5A 5FUQA 1M83A 3ZTMA 3BAFA 1RRMA 3FJ1A 1UPTA 3K4PA 3EWAA 4O4LF 2OZPA 3V7WA 1YE5A 2VTVA 8AT1A 1Z25A 2PR2A 3ESXA 4I36A 1YRAA 3ANLA 3SYRA 3U7QB 4E6EA 5IT0A 1KI6A 1KSFX 2AR9A 2FQ1A 3BZUA 3RVDA 4M88A 3S2GA 4AWBA 5FBVB 5EE9A 2QGNA 1GKYA 4P84A 3PE4A 1QTQA 2R7LA 2NPFA 2A9JA 1Z4IA 3IEEA 2QVXX 1FP4A 2H2AA 2PU7A 2P2LA 2VG8A 2X5OA 3RVLA 2A9KA 2HRRA 1QRRA 3LWNA 3K6KA 1FFCA 4I3MA 3DLAA 4DWJA 4GI1A 5IN4A 2B6NA 1WY5A 1KO7A 5GIOE 1RAHA 4FNGA 5GV8A 1WHSB 1HQKA 1W4BA 4IV5A 2Q62A 3D2AA 3RVNA 2GASA 2FA9A 4WW0A 4CS8A 1S2NA 4RAOA 1AQUA 2EC5A 3AQIA 1H94A 3A4NA 2B82A 1MB0A 3OY7A 1JR3E 4J7AA 2HCJB 2XYGA 2NW6A 3ZIUA 1L8AA 2PWYA 5CB8A 2PRZA 4ECEA 1A7AA 1GS9A 5IASA 1C9YA 1HSZA 2PL5A 1ICEA 4I19A 2HJGA 1G20E 2G9QA 1WSWA 5D91A 1ZDMA 1N7HA 2ZYVX 2D13A 3E82A 4M46A 4W7IA 1OA1A 1XTZA 5HQTA 1S8NA 1P80A 2FPOA 2NO1A 1PR1A 2X8JA 4JL8A 4JOBA 4V24A 5B4TA 1VMKA 1KEVA 3TEMA 4EYEA 1NFRA 2QE6A 1AMUA 1P73A 1OILA 3MM4A 1EDEA 4ZO7A 1Z5OA 1ZVJA 1AQYA 2HMYB 3NEPX 1PJAA 1MO4A 2C88A 4UEOA 5CA1A 3VHRA 3RVZA 1FDTA 5BQ5A 4CCSA 5D5QA 4OHVA 3QGMA 4OMFG 3D4NA 4A6DA 1B00A 2ACWA 2IXGA 3HJHA 2WTNA 3V5NA 3DLCA 3E84A 2GFQA 4NFSA 3QV2A 1G98A 4MKFA 1NZEA 1HKUA 4MYRA 1HGXA 1E66A 1NASA 5EWLB 3BJRA 5ADUS 2FX5A 4JJEA 1EUYA 1V4VA 2P9EA 4KU4A 4KE8A 1JZSA 2YV1A 1RWXA 3HACA 5LBTA 3P0HA 5JAPA 2DR3A 4LF5B 5B7GA 4EUNA 4UBLA 2ZS7A 4ZHQB 1YJCA 4XR4A 1PZMA 4LA4A 4W6QA 5MFZA 4EBJA 3WJ1A 2WSYB 4MIOA 1A9QA 3VPDA 4I2VA 1X15A 1U3TA 5IJZA 1TD9A 1LRKA 1NMSA 2GO7A 4M53A 2YV4A 1EIZA 4PSKA 4IG4A 2AEMA 4TKZA 1K2VN 4NKRA 5JD3A 3H2BA 4ODIA 3T3EA 3G13A 4B6PA 3BMXA 4IH1A 9ABPA 4KWTA 2BFFA 3TAHA 2ZAIA 2KK1A 3TQTA 3TQQA 4ALJA 3BX1A 3ZOKA 4B4OA 3O8CA 1GA4A 4JS0A 1ZEMA 2XITA 4YRTA 1H2HA 4H4KC 4MNDA 1ULSA 1MXHA 5E33A 1WVIA 2FN4A 1BA3A 4CSAA 3SQXA 3DOHA 3ESCA 3SE7A 1FNDA 2I6GA 2I71A 1ZESA 2NT4A 2NZJA 1TC2A 2QRNA 4LC9A 3EQZA 1G20A 1OWLA 1RXSA 5E7QA 5ER9A 1LX7A 1A2KC 5DGCA 5F7ZA 3BWCA 3L92A 3MUOA 1G6HA 1QIIA 4ZZ0A 2QKYA 3ZW8A 3UJ3X 2J46A 4U6QA 2RHOA 1NR7A 1KI1A 2HU2A 3EQ8A 4TTTS 3RU2A 5BR7A 4L50A 2IBFA 2FQYA 4C0JA 4U39A 2HA6A 2G70A 3R23A 5FI5A 5DSXA 3QVWA 5BVHB 4ZZIA 1SG6A 5C1PA 1OCZC 4X84A 2IXNA 4AG5A 4EMBA 4F8JA 3WV5A 4FN4A 2XV1A 3CUVA 1CZNA 1YUBA 2XJ9A 4B3HA 3EYWA 1E0KA 2Z09A 1QVRA 5C1IA 5E3JA 3G2NA 4MGZR 4BLQA 1BMTA 2LD4A 2C3OA 1WXXA 3HYRA 4G56A 5J4YA 1Y42X 2EBFX 2IUTA 1W47A 1F38A 4MJ7A 3T8YA 4U4AA 4B6FA 1V3VA 1VCHA 3LOUA 3HY4A 4DIBA 1U5BA 4AG3A 1B7GO 3AFOA 3S8YA 4WKCA 4RADA 2UXCB 3CJQA 5FTKA 1TKAA 2JI7A 3K2QA 2R1ZA 4G1FA 2VDNB 3FBWA 1J9GA 3HCDA 1QP4A 3TSZA 3AG4C 3HLZA 1BH2A 4AZ0A 3E23A 1I5NA 5LP1A 4IVRA 5HKKA 3UOWA 4KQGA 4KQEA 2VUSA 2UUHA 4MB2A 3NTUA 1NJ2A 2B7CA 4J90A 4MUNA 5CA0A 3VTFA 3ZUGA 4GGMX 1B68A 5E38A 3U44B 3PEUA 3RRZA 1FMVA 1A8QA 1E3DA 4MRNA 2X0EA 3ESBA 3RSQA 4BBAA 4OSOA 3EZ6A 2JFNA 1QG2A 1IBMB 1OUMA 1Z2CA 1P74A 3DR3A 3PYMA 4KGDA 3ICEA 1XYYA 2D7DA 3SZGA 4TWJA 1RZRD 4P80A 2XDQA 1PNRA 4RTSA 4LNUB 4DTIA 4BLSA 3KQKA 4RKEA 2HMVA 3BRWD 4HF7A 5KNBA 1OH6A 2BPOA 1L4NA 1Y5RA 3JRNA 4N5IX 4P1ZA 2XSEA 4JT8A 3FYUC 5E7IA 5EHNA 3LC7O 4MMXB 1IN6A 3Q3GE 1JH9A 5L0HA 4HEQA 1RMYA 3K9GA 3EF3A 3FPAA 3CC8A 2C2OA 3A9WA 1VJRA 4PO1A 4EHLA 3F4LA 3NMIA 2GXSA 2WHEA 3D1LA 3MS7A 4FHFA 5KTMA 3JCUQ 3OU7A 2ZBQA 2B21A 2DTDA 2VRBA 4IHJF 4YH1A 4W1SA 4GMDA 3VKHA 3DT8A 1LLCA 4E5KA 1H9GA 4ZJPA 1JV2B 2IQ5A 5NULA 3WGLA 3MCAA 4CMBA 5HSGA 3OE7A 2OC4A 3GPBA 2ZR0A 1G7CA 1KMNA 4G3XA 3FWZA 2MSWA 4UFNA 5DBHX 1P0CA 1JKXA 5T67A 3TTYA 4BP9A 3IPYA 3V8BA 4JQCA 2Q8QA 3PR2B 1NVUQ 1L5RA 1T1GA 2VHEA 5KYUA 3AX6A 1LY1A 2OCIA 4BNWA 1PHRA 1L6RA 3ZWYA 2F00A 1W5BA 4V1CI 3D3WA 4E1VA 4J4BA 2X4DA 3NJRA 2QUIA 2VCEA 4M1YA 3ZTZA 1E0JA 3IQDB 5MF6A 1DBVO 3EVFA 1ILWA 4UNPA 1YAUO 2QLTA 4HNGA 1R0LA 5ABPA 2ZB7A 1FB5A 2PGDA 1JPNA 2UUAB 1Z4OA 3H5WA 5M7EA 4OHMA 4HLQB 2CL5A 1O6ZA 4C6RA 1NQTA 4QREA 1II8A 4BC0A 2M32A 2LD6A 4JEBA 3Q9LA 4JLPA 4JUFA 5TEWA 3SX2A 4EFMA 3ZD9A 2GD2A 3WQBA 4H7PA 3UA3A 2Q6KA 3ONEA 1LI5A 5AD1A 5CX1A 3IPXA 4G36A 1TF5A 1TPZA 1RABA 4CM1A 2XCQA 1L1EA 2YMPA 1QH8A 2H51A 1G9TA 2WK1A 3CJTA 3QELB 3ZK7A 3OQIA 1K5HA 2I34A 3SR3A 2JDID 3TLCA 3H5VA 2EIMC 3SXYA 1P75A 2HBYA 4NRDA 5IBPA 2FFRA 1ZM7A 3ESRA 2AFRA 2GPTA 2QLJA 2RGGA 3HWX1 2Q4EA 2XAUA 3UB3A 2WU3A 1DX4A 1F06A 1BMQA 5COBA 2DR0A 3L5OA 3C7DB 2ATVA 2G71A 3AXSA 4PWYA 3LT1A 3KKBA 1A2QA 3F71A 3PKZA 4TLLB 4LZZA 4XSGA 1RWOA 1KERA 2I8CA 3A6KA 2JIRA 2EL9A 1ZW6A 2OO5A 2OR3A 4FDVA 1Z0FA 1TQGA 1XMIA 1KH3A 1MNQA 3O9ZA 1G20B 3A3OA 1Y4SA 1DJPA 5A4KA 1SO8A 1U2RA 3UUFA 4MW2A 2RAPA 3ZQJA 3VU0A 3G6WA 1CUCA 3WK8A 2D3WA 5E3IA 1P7CA 2C2MA 3QMMA 4D9HA 3CLKA 3E15A 1E77A 2EF0A 3U81A 4GLBA 4OU5A 4LHYA 2HF9A 5ESDA 2O2YA 2OV4A 4NQRA 1P1RA 3AG5A 4CM4B 1P1CA 1TTQB 4FEGA 3OLYA 4L6RA 4UU0A 4EKEA 2VP9A 2JD3A 1DLIA 3N7AA 4QYWA 4BDTA 4R0NA 2IITA 3O3MB 2JBHA 1CUBA 4ZDWA 4I81A 4H7IA 4M0PA 4WIAA 2CF6A 3H86A 1EFKA 5DK6A 2AD1A 1T5HX 2XWBF 2IW1A 2C7GA 4LMRA 4QUDA 4ROSA 3W0LB 2QBYB 2YMMA 1VMDA 3FZQA 4FONA 1QCDA 5JC1A 2M1XA 3V42A 1M1XB 3I9NA 1X1RA 1T3HA 1BGXT 5L95A 5I7OA 1WTYA 3BWMA 5IZ4A 3HA3A 2H1OA 2WL8A 1SXIA 4HR7A 5HK8A 1JG7A 3BXEA 3L6DA 1Z6PA 4FYWA 1B6RA 1E7RA 4N6NA 3QPDA 4MWDA 5AQEA 1LDYA 3MLGA 2OHXA 3MB5A 2WZLA 4JY7A 1WCYA 4RGVA 4XKJA 5B37A 3B3QA 3A37A 2F43B 1RM0A 1I4DD 3OLQA 1SIUA 2XGOA 3ABRB 3Q4GA 1G66A 1PR4A 2BFAA 4WZ6A 4YK7A 4YDHB 5I4IA 2PF4E 5AW6A 2DPMA 5CB4A 1W76A 1EZ1A 5JXJA 4RF3A 3S2EA 2X9LA 4FFMA 3KXDA 4L0MA 4DQDA 621PA 2Z5VA 3OU6A 1TX4B 4BCBA 5ARCA 2A9FA 3EUWA 4UD2A 3PR3A 2DQYA 4YJKA 3ICQB 2Q1XA 1KC1A 4R5HA 1GU1A 3KUDA 2HSGA 3IAS6 3MMNA 4R31A 4X92A 1S3IA 3PRJA 4OQQA 4N4WA 1WOLA 3G4ZA 1KK2A 3AIKA 3I34X 4RSHA 2IDZA 4EMTA 4F1JA 1WW8A 3AU8A 1X1SA 2QRZA 4MAFA 3B5EA 1LSSA 3PUWA 5E6RA 3HUEA 4MUFA 1MHPA 2O9JA 2RGXA 1Y9DA 5ELLA 3WBFA 2WJIA 2H0AA 5GV7A 3TLYA 3HDHA 4G5GA 3PHIA 4IJUA 4L5CA 3A14A 3PHHA 5JCOC 2EJWA 4OJKA 4UMDA 3CZAA 5AUQA 5LMCA 1XSEA 2XLCA 5TPWA 3QJ5A 2EU8A 2HMZA 4TWBA 2Q1TA 2V96A 5E9AA 4CGZA 4NCAA 2IYLD 1NVTA 1P18A 5B6JA 3R74A 4L75A 5IM5A 1AK2A 2IODA 3JQPA 1LE2A 2J9YB 3LGSA 4XM0A 4DSNA 2FLKA 1ZK3A 2V7XA 2COUA 1B3BA 4N7JA 1SYQA 3PSHA 1G8XA 1OLSA 2VF8A 2AEFA 3OCXA 4URWR 1Z2PX 3HY3A 1ODJA 4XDGA 5B4UA 4N40A 3RVKA 3LBAA 4QDZA 4Y8VA 5GWXA 3V97A 3VUEA 1WHTA 4IF4A 1JRAA 3A3KA 4MW4A 3A8TA 4A03A 2PEYA 2V9CA 4YJ3A 2GZAA 5AIBA 3CBGA 4RZIA 4I5IA 4CKWB 5J5CA 1C30A 5J23A 1UBOS 1IZYA 1JKJA 4WGGA 1JVNA 3WLPA 4A1OA 4B71A 1GSOA 1AQJA 4LTDA 4CQMD 4YJFB 2LWIA 4R9SA 4CUZA 3JU3A 1BXRB 4LY3A 1WZCA 1VL6A 4HOYA 5LYJF 1U9YA 1JPVA 2NXJA 4F3RA 3GDWA 4NFYA 1Z18A 5FTLA 1BE0A 1RFGE 3OLVA 2XLDA 2RK3A 1Q0GA 3BBLA 3ILSA 4KUEA 4UHBA 1TJ4A 2AMFA 4J07A 3WGMA 2CUNA 5KYXB 2KLHA 3ZSUA 5AI6A 1V41E 4EW2A 1E96A 2RH9B 1I9CA 1L5LA 3U3JA 4BO8A 3MUEA 3PRKE 3RS3A 3U49A 4CIPA 1ZAYA 1QCZA 1XZQA 4P5PA 2C3YA 2F59A 2PVSA 4F06A 2PD6A 3IULA 4WNIA 4E08A 4AQ7A 3BDVA 1A9TA 3M9LA 2D5IA 1JG4A 3RROA 4BQOA 5CB0A 3HWSA 2ID8A 4CMAA 4POOA 4HP8A 4G67A 4WZBB 4D3FA 1NRIA 2EAUA 2CW5A 4WT7A 3KYDA 2NSDA 2R6JA 1QX4A 4V03A 3TI7A 4AC9A 5K9ZA 5LU8A 2X3UA 3IQIX 3Q5DA 1F7UA 1XP8A 1EVZA 4RMNA 3V5XA 3HYLA 1T5OA 3EXFB 5GMOA 3PEFA 1ZQ1A 4WABA 3OQIB 5IT5A 1DC7A 3F1KA 1U7UA 4WXMA 2BDEA 1IXSB 1LI7A 3IQ6A 4CEIB 1EXWA 1N2CE 1ODLA 1QO9A 4D9KA 3K0SA 1IY1A 3ZWCA 2EZUA 3PX7A 1A8UA 1ZZPA 1E2HA 1QAOA 1ISIA 1S8FA 3RT9A 2VJKA 3U2QA 4O0LA 3U4QA 1NLFA 1OY1A 5JVEA 1D6SA 2JF0A 5KNCD 4ARIA 3SZOA 1U9JA 2FPGA 5EMLA 3A1WA 2XMBA 4D96A 3N2ZB 4MJLA 1XRJA 4G2NA 5I3CA 3EG9A 2FOIA 3OECA 5K2MA 4BEMJ 3ZTYA 4KAFA 3D8BA 4BPMA 3A7DA 1QVWA 5JSHA 3PXXA 1FP2A 3DZ8A 4OI2A 2JLUA 2AE1A 4I4TB 5FPTA 4ZCPA 2BTQB 5CXXA 4I4NA 2D5CA 3JQAA 2Q5EA 3BIFA 4GGOA 3TR6A 1RKUA 4ASUD 5IJAA 1XLWA 1M6EX 3U56A 5FFNA 4UPEA 1KYVA 1PIWA 4K9MA 3EPVA 2RHJA 2J3MA 4FMDB 5HFAA 3UANA 2IOFK 2GAIA 3JQAB 1F8YA 1ST6A 3FPLA 4AYXA 1W1UA 4MRMA 5J47A 3CCCA 3P27A 4I4TA 4QDOA 2GFIA 3ODGA 4KXYA 1R74A 1U31A 2RGBA 4TQGA 3SXUA 1Q2UA 5HJ7A 4KQXA 3QTHA 5AMXA 2JBAB 3PD1A 4BJ6A 1BOFA 2G77B 2W9XA 1TU0A 3OTWA 3ENQA 4ZCRA 3ZR4B 1W4LA 3R6WA 4G2TA 1R4NA 3NHJA 2D0OB 1CSEE 1F0PA 1PVDA 2LE0A 2A1DD 2VH1A 2RG7A 3CRNA 3OQPA 1TM7E 1VBFA 1TT5A 3EH2A 121PA 2JJ1A 3AFGA 2JB9A 2XX3A 2MSEB 3AY3A 3L79A 5GGXA 1X2BA 2AGVA 2WP8J 3CKYA 4ZVSA 3F6CA 3ESYA 3K8YA 1E6CA 3W9SA 1FDIA 5KVSA 1OLXA 3P2OA 3H13A 4G0XA 3E9YA 3T7IA 4AULA 4BMXA 1K3FA 4FZ3A 1RXCA 1ULZA 2ZIXB 5B2FA 5TMPA 1XD8A 3E5NA 1GT6A 1RPJA 3P8ZA 4DM4A 1G63A 3LLVA 1EP2B 2WM9B 5FBZA 4W5RA 2EG5A 1Z28A 1YCFA 3HFRA 1IQPA 3FVWA 5JY1A 1UBKS 3AEQB 3ZCUA 4FFOA 3BHJA 2Q4DA 5BNTA 1A88A 2VCAA 3ZWKA 4F86A 3K0CC 1CHNA 2C0CA 2BV3A 2R48A 4X8LA 3UIEA 4YA6A 4KR3A 1GZ6A 1GM5A 4PO9A 3KETA 3FCAA 3A1TA 3O82A 3QU2A 3ZG6A 2XMRA 3GD7A 2AXPA 4O3FA 1O9GA 4MRRA 3G23A 4C01A 2I4MA 1N2XA 3RG8A 4PFOA 2H4HA 4PXAA 1WXDA 1TYCA 2CHQA 5DGXA 3T4RA 2EBWA 2PL1A 3FKSD 3KCQA 1XG5A 5JS5A 3I9MA 2B2CA 5JD5A 2XS1A 4RVNA 3WFJA 4CQJA 1GG9A 4OKNA 1GKLA 1YE8A 2DB4A 4DXWA 1CVRA 2ODEA 2P2NA 3I45A 3H2HA 2J5QA 4PSCA 1XNHA 5CGQB 1ATIA 4G1VA 1ZLXA 2ORED 3LCRA 3C3CA 3DTVB 3ULKA 3I42A 1E3LA 1X7ZA 3G0BA 2F17A 4ZI5A 1GU0A 1XCBA 3L3BA 1WSAA 1Y1RA 4IRUB 4JJZA 2PBLA 4DS3A 4P83A 2GXUA 5JYEA 5T6MA 1MZPA 2A5DA 4BRZA 1GUBA 1Z12A 2V03A 4J8PA 4ID3A 4TZ6A 3PDIA 4E13A 4HBZA 5LDDC 1OI4A 3HVHA 4OHZA 4A27A 4RFLA 4EY3A 3QVTA 2TYSB 3TIFA 1VP9A 2R25B 3AHEA 3N0XA 2VJYA 3CNNA 2BTEA 1O89A 2KGOA 4TLCA 3KT6A 1RQPA 5B58C 3SR4A 1GZSA 5SY6A 2PX0A 1QM5A 3BCUA 1W8DA 3EOBI 3AJ8A 4RL6A 5LNK1 4WXRA 1Q17A 1VPTA 7ABPA 1I7LA 2YS7A 5CLQA 3U31A 2J0EA 4LCBA 4Z5XA 3ZLUA 1JEQB 4WSOA 1H4QA 3UFXB 4GQAA 3EZIA 5CX4A 1YJ8A 4L78A 5BO5A 2CLCX 5BUCA 5IJ0B 2QE7D 1TK2A 3FG9A 1F6DA 2HF8A 4ZOLF 1TGVA 1D0VA 3U9SA 3VRHA 4LC1A 4C7XA 1ZN2A 4Q9NA 5G1OA 4CR7A 2BI8A 1TA9A 3HN2A 4M9XA 4NF2A 4MGEA 1C7QA 4YWJA 5CI9A 1N1DA 1QP8A 1U6IA 3T41A 5EUQB 1JSLA 2F3TA 3BD7A 4LGCA 3K7EA 4DA9A 1TUIA 3IUMA 4M0DA 1FNSA 1RWKA 1YB1A 3TOVA 4N5NA 4CM7A 4TMTA 1YCGA 2BM9A 3AYZB 4EJSA 1IJEA 4HAXA 2Q2NA 4Y2PA 3WAJA 5GIPE 1RP1A 1DTSA 3UMGA 4Y67A 4R8VA 1X7WB 3MN1A 3OWXA 1RKQA 3EEOA 1D2AA 2CDNA 4Z9BA 4BVJA 3AY6A 1B3RA 4WLOA 5BSEA 1E3WA 4G4GA 2GCOA 1EX6A 2IV2X 1ZMRA 1QV9A 1YASA 1Z4LA 2Q28A 4COKA 1SG9A 2PLRA 4XE5A 4MK4A 4ED9A 2YW2A 3NT5A 3QU5A 3FNIA 5ITWA 3WIDA 1DXQA 3AXTA 4D3DA 1E1KA 2H6EA 1Y8RB 2VXYA 4DRXB 4GEHA 1NZDA 5YASA 3WYAA 3KK0A 1U9IA 1SQGA 7AT1A 4MTCA 1RHKA 2V59A 1L3PA 1VRWA 1EA8A 3OIWA 1DIGA 1URPA 4NP6A 5F52A 5TF4A 4BKPA 4E12A 4LY0A 4GKKB 2HJ9A 3H6HA 4DIFA 2ZBFA 1PZGA 4F21A 1XMOB 1FS5A 2H4XA 2QTZA 4QLOA 2I3GA 1BMFD 1AN9A 3MWDB 3PSAA 2CB0A 2OP0A 2QQ5A 3G2QA 2QP9X 3NHZA 1L1QA 1N2OA 3KKPA 3Q3IA 4I3GA 4N6GA 4AM8A 2B9VA 1MR3F 1JQLB 2AN9A 3A27A 1R0XA 1MOZA 4QWWA 1LK0A 1TJ5A 4P53A 1GIAA 1ESEA 4K7BA 3PJFA 2EGGA 2YHBA 5EE5B 3RUCA 4B6SA 4CLOB 2IEYA 3KVRA 2H4JA 5B1IA 5JRDS 3UWPA 4AUEA 1U3FA 2O8CB 4YBZA 1M7BA 1KJJA 3W1VA 1XEFA 3ROZA 5B3AA 8LDHA 4X62B 5EERA 3V7FA 2HO4A 2UZ3A 3ZBQA 4IW3B 2NAFA 2ZI4A 3N28A 4N5DA 1DC5A 1F2UB 1HOTA 1KEEB 3K72B 3NP9A 1DRJA 2C9YA 3B85A 4M9CA 1FMJA 4Q7CA 4MXDA 4W4TA 1MV5A 4ESVA 4PM4A 4KE7A 1Z6AA 3AWIA 3I6MA 3LK6A 4LISA 1XKTA 1KI2A 5T6BA 2W93A 1YYXA 3T5MA 2Y3DA 1NW5A 3BSFA 1E6LA 1SCNE 1BU5A 3HYNA 4MDEA 2CVFA 3AG2C 3U37A 2VNIA 2XUPA 3HCRA 2GWWA 3MINB 5D5PA 3NHBA 3WODF 2ZT5A 4Q66C 2XKAA 1NSFA 3PNQA 1VPEA 1QDLB 1PQPA 3MBGA 1UXKA 4L73A 1IM8A 2AXEA 3C7CB 1JFTA 2O8VA 3WMRA 1HG1A 1EK6A 3W4IA 4F71A 2OVFA 1ORHA 2CF5A 3BWBA 3MMPA 4M86A 3FKJA 3Q98A 1N6KA 2CXXA 1J9ZA 3UWMA 4CGYA 1S96A 1BDJA 2O2IA 3W2HA 1QGYA 1UC9A 2R47A 1SHKA 3A1CA 3ITEA 3R3YA 3RUIA 1E83A 2CFTA 3C3YA 4Q4JA 3EDQA 5FEUA 4D43A 1YQXA 2WKSA 3L2OB 3WB2A 5KREA 5F9FA 4YR7A 4C7JA 3TVYA 3RYIA 4EATA 3GUCA 3Q8XB 1LLDA 3R5JA 3CVWA 4N9WA 3HCWA 1F3LA 3U3XA 3FTPA 3O3CA 4HZIA 1W36C 3SHTA 5AHOA 2ZR7A 1US8B 3SIXA 3VM6A 1B42A 1COWD 2X6QA 1GG2A 5IT4A 1U2EA 1XK7A 2H7VA 4ZJYA 1J56A 1F6WA 4CTOA 4AZVA 4TTVA 1U0OC 4EA9A 2EZ9A 3I5PA 1RS0A 1KH1A 3VHQA 2RGRA 4UOEA 3QOFA 5ESWA 3ZE6A 3G7NA 1T4CB 1CRZA 1KC3A 1L3CA 5DT9A 3K2BA 2RD2A 4MGKR 3W2WA 1WF6A 1BXGB 1QVVA 2FUNB 2YVUA 4P58A 1GGVA 3FAZA 2R84A 2QY6A 1NUSA 4Q7MB 2ETSA 1ZHXA 5BUOA 1M2GA 2A6EF 2IJGX 3FZGA 3KOYA 4UHJA 4HZGA 4MV1A 4FSDA 3OA0A 3OP4A 1Y8CA 1KE1A 1XLVA 3F3SA 4FYJA 4X90A 3IR7A 5A9RA 4YMWA 3DW3X 3K9FC 2PZAA 2F1KA 2OP1A 2XWQA 3U26A 4INOA 5JSUA 3DMYA 1P1BA 1NFOA 2PE5A 4QTXA 3CMMA 3LY8A 4I9FA 5JY6A 4O2AA 4PG7A 2FSPA 1E69A 2EKDA 4OIFA 3RS4A 1UFBA 3HKEA 4F72A 5A7FA 2K87A 1XTPA 2BFBA 2N75A 1ZZEA 3DEAA 3HPRA 2XIQA 4WADA 4DBVO 3IAEA 3Q2KA 5HUJA 5DI3B 1QH9A 3PA8A 3JQBC 3KDPA 4MVJF 4OLAA 5HTOA 4FNOA 5AM1A 4F1KA 1T0IA 4EKDA 2O2HA 1E8MA 1IQ0A 5MHTA 5I8WA 3NXKA 3M2PA 2QZZA 1S2OA 2DR2A 3MRXA 2A9VA 1E9EA 1GSAA 2VJNA 2ZYUX 3AL0C 2X76A 2XMCA 1FIUA 2EV9A 3U9LA 1W7AA 1HY3A 2JFUA 1CS0B 2LV8A 4A2CA 3C8GA 1ORIA 5FWDA 2HLDA 3ZJTA 1TF7A 3VTAA 1N9GB 1QWSA 1F6BA 2ARKA 2MSKA 1AXEA 1UZMA 2YYYA 3BCSA 1YL5A 2G3YA 3GUHA 4N3CA 3IQGX 2KM1A 3IKJA 4F4JA 2R7RA 3PC4A 1T5LA 4UQPA 4A5SA 3PTAA 1LDNA 4KMSA 2EFEB 3R3VA 4ARSA 5C5EA 1BKYA 1MJHA 4XPWA 1Y7TA 3SLKA 3GJXC 2NSYA 3HXPA 4GM4A 1L7DA 1WPRA 5K0NA 1L5ZA 1QS0B 1YZAA 3L0ZA 4B3GA 3L6RA 4BV3A 3S8EA 3E9MA 2AX3A 2VK4A 1D8AA 1Y0BA 2R25A 4C7OB 1IH8A 1ZXXA 3OHPA 4QTTB 3EZNA 3S70A 1LCIA 3N75A 4D02A 1KIMA 2NYAA 4M1QA 5TE9A 1GFZA 4DCSA 2L69A 2PH7A 2IYTA 1SHUX 3LNTA 4B84A 4YJWA 3DSRA 4Q9IA 3DP7A 3UGQA 3ZW9A 1Q0FA 4YUWA 5BMVF 1RLTA 1CLUA 3QEJA 4IFBA 4JI6B 3RLFA 2OILA 3T94A 1VXRA 1B23P 1VCNA 3M9WA 3V8VA 4P92A 3TOLA 3J7TA 4L28A 3IUNA 2FEKA 5F2OA 4HUQB 4RPGA 3ZJVA 3S27A 1CZRA 1I2ZA 3Q88A 4MIYA 3DOOA 4PRYA 4U00A 5DE3A 3WDKA 4AMUA 3ZZ1A 3D6UA 1NUUA 4O6YA 4TM7A 3E6AA 1A7UA 4L22A 3ZU5A 2CLOB 5BSTA 3C8MA 3P9QA 4DUPA 2KE5A 3NBKA 1SU6A 2QMQA 4HEA1 1IDOA 2IYSA 1PJBA 2C5BA 1MJGM 4QNMA 2IS1A 3VPXA 3VX4A 3I9LA 2O8BA 2HSJA 2ZRAA 1W6UA 4EB6B 4KBFA 1GGQA 1UOQA 1WB5A 1PL7A 1TQHA 1YFZA 4L4YA 1W34A 4DFDA 3EA0A 2QTRA 1T6YA 4QKQA 5IF9A 1E59A 4RSGA 2UUCB 1XDUA 5HV9A 1NZFA 3OJOA 2PZJA 3QFFA 4NJMA 4Z0TA 3O8BA 5L3SB 2PT9A 5FJIA 1PT7A 1Z4JA 5K3CA 1C8VB 1VG9B 2ISQA 2LVBA 4IARA 1T6QA 1OE0A 4IIJA 5EPEA 3QLTA 1M72A 2QX9A 3M2TA 2P91A 3EGWA 5BXQC 3DQZA 4U9HS 2WF7A 1LFAA 5CTAA 1QHFA 4DF3A 5AW1A 2E4AA 7GPBA 2XYHA 3LXRA 1EJ0A 3EZYA 2GBIA 3VC7A 4F96A 5JEDA 2HQ1A 1U9ZA 3KOMA 2FH5B 2XTJA 3KPJA 3MERA 3PRYA 4GQBA 2GWHA 3W3AD 4JVSA 4BDSA 4MMZB 3HEAA 4U9DA 2I29A 2ISCA 2J30A 1RRCA 4F8EA 3UH1A 4P9TA 1N77A 2XJ4A 3ORRA 5B6PA 3RRMA 3MGBA 2RBKA 3TULA 2W22A 4MVZA 2C29D 4FS8A 1L9KA 5TRTA 1UMCA 1X1CA 1N9GA 2QL6A 2K2WA 2RKBA 4V02A 2XT9A 1BR2A 2QTGA 3QH4A 4HGOA 3TTSA 5JOQA 1L4HA 4ENRA 5L51A 4Q6WA 5JCJA 1Z7Qc 1FDWA 1P0MA 1W5TA 4RU1A 5BT8A 3QPVA 1FYDA 2AG1A 3K0BA 4JJKA 4IDEA 4PZCA 1CKEA 1XQ9A 3LE8A 4OGGA 4MV3A 2CNBA 4EARA 1H1LB 2D62A 4JT4A 4ER7A 1PRYA 3LC2O 2NZXA 3RTDA 4YV2A 4Y9UA 1YR3A 3UHPA 4AJIA 4EMUA 4PACA 2VUTA 1W5FA 3TIIA 3CV3A 3I01M 4RJ2A 3CLHA 4ZV4A 4GPBA 4HE8D 1JFVA 2HQBA 4MKHA 4CKYA 2E82A 1DIAA 4YCAA 2FDCA 2FEOA 3I6YA 2Q6LA 2BP7B 1Z0DA 2MU1A 2QLMA 1H6AA 3KOUA 4CQMA 1UDAA 3VR3A 5DS4A 1OFUA 4LJYA 3V1UA 3G5MA 4E03A 4JLUA 3WLTA 4CMGA 3KFLA 4JU8A 4D9IA 1Q50A 1FVHA 4CXMA 5C7IO 1SC1A 1ISFA 1E5LA 1HYGA 3HUDA 3MJEA 3GGJA 4FILA 3UKDA 4AT1A 1KH2A 1V9SA 2OMKA 3AFNA 3ICVA 4K46A 1XLUA 4LAFA 2XB9A 4ZCTA 1G4US 2RI6A 1KRXA 1HETA 3DOFA 4FSHA 4B83A 2ZRKA 2B7LA 1JXOA 4V0OA 4DBZA 3IELA 3MA0A 1UK8A 4LDKA 1H4TA 4LYGA 1GNVA 2H7CA 4KFRA 4DIDA 2NOAA 3KJIA 3EPRA 2D4HA 5AW5A 4BEBA 5JSZB 3T4PA 2YWDA 4BJTA 1H9TA 2PMEA 1YQQA 3BFXA 2UZAA 5B3JA 4BQQA 1WBDA 4RK0A 2ZYDA 3K3PA 4N8DA 1JG1A 2A1TS 2IXDA 2OFWA 2VS1A 2NP7A 2FMKA 1I13A 1SHTX 1R8JA 5AC5A 2GD0A 3ROMA 4EJFA 2CUTA 4GSKA 2IEIA 3ICPA 2VDMB 4X3PA 4DJAA 3FWYA 1FL9A 1Z6QA 5FAKA 4FDUA 2UYQA 2Q4FA 3HCNA 3LFHA 4HWSA 5G0TA 2DLCX 2VDWA 2H92A 3OAAA 3V8RA 2JKVA 2CYDA 2QVYX 1ZX1A 1PDOA 5KAPA 3VDXA 4HDCA 1AQ6A 2QPTA 1QIDA 4FOPA 5SYNA 3ADCA 1D1TA 4X9XA 2FZEA 3BA1A 2A9RA 5F5HA 3PEWA 3W9YA 2Y1GA 4C22A 5IVKA 1NW3A 1PK7A 2IHUA 3R8FA 1TUBB 1B8VA 4IAOA 1G60A 3SFZA 4WA8A 721PA 1P61B 4QEZA 3H5TA 3GT3A 1IBKB 4N0PA 3RC2A 1QRTA 1F1MA 4H7KA 2J5RA 2D74A 3QNWA 3K71B 1D9ZA 3LLKA 4BU1A 2Y68A 5IVDA 5EEGA 2PS9A 3CXUA 3JAKA 4G0HA 4MVJA 4ER3A 2X0FA 3U7IA 2P3LA 2HGZA 2XQGA 3I64A 4P82A 2FN7A 1K7XB 5F77A 1GPYA 2QVCA 4ZV9A 2A0FA 4M8IA 1JHVA 1W48A 5ITZA 3DLHA 4RY0A 3TMKA 1KYQA 2OJED 1VOTA 3FFTA 3L0DA 1R0WA 4YRQA 5HCNA 4AMVA 5C52B 3ZH9B 5I7RA 2WVHA 5DHRA 1DKUA 1QV7A 3S7TA 5FOTA 4MRVA 1WCIA 2FPWA 5H9VA 2E9SA 1FZQA 5K05A 1GKUB 1JMWA 1E7YA 1M8KA 3ZJ5A 4G8DA 4OFZA 1QGOA 5KNBH 2V9ZA 1G5FA 4Z1MA 2AFIB 5BYKA 4JA2A 3TQCA 4W9RA 1OLSB 4NXMB 4Q1CA 3PNVA 3B89A 1ZONA 1JQ5A 1J1UA 2HADA 2HCTA 3GDFA 2LP4A 4OA8A 4EWLA 4URVR 1YACA 4CKBA 3CVVA 1XRRA 3VR4H 3RUHA 1EVEA 1NMQA 3WQHA 4ARZB 2ZM5A 4EEKA 3WLIA 2HBRA 4V0LA 9MHTA 4ZTZB 4F2GA 3P32A 1UC5B 1TB4A 4RXTA 3FUCA 2CVZA 2PFKA 4MWZA 4UM9D 4DQ0A 3IQTA 3KUKA 3WDLA 2OHVA 3F3YA 5TVKA 1OX4B 3E53A 3D6VA 3WJ7A 5DBEX 4OGFA 1W44A 4JOQA 2XXAA 3ACDA 3NCHA 2G25A 4JBGA 2Z56A 3OM8A 2XE7A 4KZKA 2JLZA 4XDZA 3BTUA 3T5DA 1P2FA 3LDFA 3PFGA 2H1CA 2IZOA 3BEOA 4EKNB 1QRSA 1QZTA 1YHZA 2E4YA 1X94A 2MYUA 3D6FA 6REQA 1SZPA 2DY1A 2KW3C 3GEBA 4A36A 1UDBA 3NHRA 4MEJA 1E94E 1GGNA 4PK4A 2N3ZA 4UU8A 3ZD7A 4LSZA 2Y05A 3NKEA 1R5JA 2O57A 2RGYA 2P2CA 4ZIRA 4Y2UA 4UM7A 5GONB 5AFSA 1JHUA 1TCBA 4HYYA 1R8QA 1WZUA 1RVDA 4ZOLB 2XGJA 3AYXB 3FNEA 3DHVA 3D7LA 3N8KA 1KDYA 4U9EA 4TTQA 4FB5A 2CXPA 3PQ3A 1NLXA 2FPUA 2R60A 2R1TB 3LHFA 4CT4B 3Q15C 3LSTA 3RE1A 4XVUA 1CUZA 3ZZ0A 1E3WB 3L7OA 4AJOA 1KRHA 3I5MA 1N32B 1FBTA 1BA2A 2WG2A 1F2TA 4BLOA 1LBHA 4CCYB 4RTLA 4F4DA 2NP6A 4U0KA 5ALKA 1E6UA 1VFPA 4LGYA 1VGQA 4NYIR 3CFYA 4YPOA 3CWZA 2K7FA 1JHOA 1GQAA 5FPHA 2CJWB 4NG4A 1U7XA 1FYFA 4P33A 5ALXA 3DEYX 4ZVTA 1CRWG 1SXJA 4IWBA 3JZFA 3ZDBA 1DEHA 3QY9A 4KN6A 2BCJQ 3GAMA 1S2DA 1XEXA 4R68A 2WFLB 4JSYA 3EX7C 3W5SA 1BHSA 3IDZA 4OK6A 4LF7B 4PAOA 4DSOA 1ISSA 1PUIA 3EGXA 1LPSA 1Y6QA 3Q1KA 1J0BA 1O4WA 5D5HA 4HRVA 2C1ZA 5CDFE 3EFHA 4ESEA 2YWGA 5FULA 4C0WA 4LF6B 2GDJA 3N70A 3J81k 3NMUF 2CV0A 1Y9AA 1P1JA 4K0KB 1YRWA 2Q00A 1LBIA 3BCHA 3L6EA 1GRVA 1Z8DA 3NM4A 4N0QA 4P36A 5TQ0B 1N1GA 2X42A 5CNJA 1XNRB 1CF2O 1R9GA 4BFSA 1E89A 1VLZA 2BDTA 1KS2A 5AM4A 3SFVA 3H83A 3G5AA 4WDRA 4XYEA 3ER8A 4ND8A 4Q7KA 4AN1A 2YVQA 1U5AA 3ADDA 4Y2YA 1JMKC 4EFKA 5JBQA 5CMLA 3ET4A 2MR5A 4CDMA 4Q5SF 4IIDA 3IIMA 1BXZA 4M1ZA 4GOKA 4HS4A 3FE2A 3E18A 5AKYA 1W59A 2PNFA 3C3PA 4OKIA 2ZAMA 1QLEC 1HORA 3GJ8A 4JWTA 2YIVX 4LN1A 3UCXA 1GFWA 1HURA 1N5DA 4OB8A 2AA3A 1JDZA 1XP5A 2VRCA 1TUBA 3TCKA 1GCOA 2ZSDA 3GJ0A 3PE3A 4GMHA 4Y2GA 4E31A 3ESAA 1Z15A 3DVLA 4B5LA 4DRZA 5B53A 1SBNE 4BMOB 4ZEMA 2FGYA 4HPJB 1N2BA 1SEVA 4QBHA 1KXZA 1M2JA 4MGYR 1P4HA 2H2GA 4LQ4A 4ZXFA 1RKCA 2AR7A 1RBMA 5J40A 5T8KA 3SSMA 1MA0A 1T34A 3ZNQA 2XNSA 4YXWD 5HEKA 2QOEA 3B3AA 3R7DA 4WI1A 4B4VA 1L4BA 5DGTA 4MDHA 1Y4DE 3E7DA 1L8QA 2FPPB 1TTPB 2RCYA 3Q6NA 3AO0B 3P0EA 5HBGA 5A1TA 1TYEB 4JD5A 2YOFA 4Y1RA 1GL6A 3D4IA 1H5QA 5DNWA 5EKXA 2VQSA 2BH9A 1JFFB 3OF3A 2H4WA 1QFZA 3CZ9A 8GPBA 3KD3A 1DDOA 1E9AA 3L18A 3KOXA 1MQAA 2FQWA 2WUEA 4NJEB 4QBTA 4TLBA 1DHRA 2OB1A 3ZHOA 2J8WA 3CEPB 4HZUA 5BRNA 4AS1A 3THOA 4GAEA 5HJ2A 1C7RA 1V1MA 3IR5A 2DI3A 3H7IA 1WPQA 1YZCA 1V71A 2BUCA 1U04A 4JUCA 2JGDA 4FX5A 4MVJM 1WPGA 3PICA 5AKZA 3TFWA 5FUYA 3J81A 4ILEA 4W7SA 2GBFA 1C14A 2O4CA 2W6ZA 2XNDA 3K1AA 4IJWA 2VJCA 4I8DA 4X24A 4NC9A 1T2CA 1MMGA 3B5JA 4FR5A 4FMDF 3GDGA 1X87A 2RH8A 2MWQA 2ZIXA 1J97A 3BRQA 4ZEWA 4AAYA 1RMTA 2QF7A 1E2DA 1O6CA 2XMDA 4ND2A 1CR0A 5HQ3A 2YX1A 3PQ5A 5CBKA 3SJAA 4WHMA 1QHEA 4HDKA 3B8HA 2I4RA 5FEMA 1E2NA 4AY2A 4GGPA 3VVLA 1XZAA 1XVIA 2P2SA 5KNDD 3B9PA 4KGZA 4DLRA 3KQNA 1DVRA 3IIJA 2HU8A 1R4NB 1AGXA 1XJCA 1XWFA 3BICA 4HVTA 3VYRB 2OO5C 1M5UA 3BMQB 2CV1A 1ORWA 1B8OA 3K5HA 2C2WA 4MP3A 2ZPAA 4XASA 1U0HC 4BXOB 3K6BA 5AHRA 1NXXA 1NN1A 2GS9A 5BV0A 4EPXA 2Q7RA 4PPGA 4S1PA 4LLEA 5IBCA 1I1QB 5DVZA 2PU5A 4C5BA 3DEJA 1D6NA 4YAGA 4EUEA 3EQLF 5FPYA 1RKEA 1QIFA 1XA3A 4NDZA 3RJ9A 5DQZA 5B55A 3NP7A 5F1OA 1XGKA 2G1UA 2QQFA 2QRUA 3JVEA 1U4SA 1XZ8A 3DEFA 1DO2A 2A69F 2QZPA 3HUFA 3L6CA 4NABA 4QG7A 4BNXA 3LYUA 3BJIC 1P45A 1PFVA 3EBPA 1G5IA 2M98A 1Q12A 3CX8A 1VJTA 1BDIA 4MQFB 3L9WA 3FR8A 2WFZA 4TKUA 3I1YA 3V00A 4Q4ZF 2PS1A 4IAQA 1ZIOA 2DTXA 1LIHA 1E7WA 3C2QA 3MW8A 4JP8A 3L0BA 4EBBA 1VPWA 1UF9A 1G8FA 3AEKB 2AJDA 4IIBA 4RK6A 1JDUA 5FORA 3OJEA 3VR6H 1S9HA 4UXHA 5CTJA 4DG9A 1WZNA 3IAUA 4PRKA 1SUDA 3T4UA 1JE0A 3OPXA 2HHLA 2FSGA 2VP0A 1Y6ZA 4NJMB 1NSYA 4KV7A 4QA9A 4Q9KA 1FXWA 5G41A 1ZD8A 5JNTA 5FWAA 2CFCA 5G4KB 4BQPA 5AVJA 3S90A 2OCYC 2DVMA 1CNFA 4C05A 3AW9A 4PFPA 1VLVA 2Y1DA 3D64A 2Y71A 4BN4A 4EFDA 4W8PA 3ZBUA 5JAHA 3I62A 2W2VA 4BCCA 4OL9A