4KNWA

The crystal structure of human hdhd4 in complex with magnesium and the phosphate mimetic vanadate
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
239
structure length
239
Chain Sequence
SRVRAVFFDLDNTLIDTAGASRRGMLEVIKLLQSKYHYKEEAEIICDKVQVKLSKECFHPYNTCITDLRTSHWEEAIQETKGGAANRKLAEECYFLWKSTRLQHMTLAEDVKAMLTELRKEVRLLLLTNGDRQTQREKIEACACQSYFDAVVVGGEQREEKPAPSIFYYCCNLLGVQPGDCVMVGDTLETDIQGGLNAGLKATVWINKNGIVPLKSSPVPHYMVSSVLELPALLQSIDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords N-acylneuraminate-9-phosphatase
publication title Design, synthesis, functional and structural characterization of an inhibitor of N-acetylneuraminate-9-phosphate phosphatase: Observation of extensive dynamics in an enzyme/inhibitor complex.
pubmed doi rcsb
source organism Homo sapiens
total genus 84
structure length 239
sequence length 239
chains with identical sequence B, C
ec nomenclature ec 3.1.3.29: N-acylneuraminate-9-phosphatase.
pdb deposition date 2013-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.710 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4knwA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4knwA01
1Z4MA 1SWWA 1TE2A 1ZD4A 2EATA 4EZEA 2JAUA 1Z4QA 3R9KA 5IT0A 1RC8A 1XVIA 3WGUA 4EENA 4EELA 3QUQA 5ALKA 1L8OA 3W5DA 5AKEA 2OM6A 1RKQA 1EK2A 2AUTA 3AR5A 3NUQA 1RKVA 3OCUA 4L6AA 2RAVA 4HGQA 3KZXA 4Y2PA 1S2OA 2YMPA 3QLEA 3ZX5A 1Z4LA 4G63A 3ZTYA 5AW1A 3U7GA 4Y2RA 4DCCA 4BYGA 3P96A 4XE5A 3WKCA 5AW0A 1T5TA 3N8GA 1RLOA 3FM9A 4UM7A 4YCMA 2YMLA 2QLTA 1RMTA 3QNMA 2B8EA 3EF1A 2HI0A 5ALHA 2ZOSA 2EAUA 3ET4A 5ALQA 4ZEXA 3WGVA 5AHXA 2BY4A 4UMFA 1EK1A 2FPRA 1U2SA 2I54A 1MH9A 3B8EA 5ALNA 3WKEA 2PQ0A 5AVYA 5ALYA 3ZX4A 1RDFA 5ALFA 4Y2YA 4QJBA 1VJRA 3KBBA 3CNHA 3VAYA 3SKXA 2FPWA 4J2TA 2GFHA 2WM8A 2CN1A 3NANA 1J97A 5AVQA 2GHTA 5AW5A 3SMVA 2I7DA 5AK5A 3QU2A 2R8YA 3R4CA 1L8LA 2FEAA 2FPUA 1SU4A 2BDUA 4L6CA 1QQ7A 2IOFK 2P9JA 2R8EA 3IRUA 3ZVLA 4IFTA 4RETA 4UU1A 4Y2VA 5AI5A 4DWOA 5AKXA 3L0CA 1O08A 3MMZA 1CQZA 1WR8A 2FPSA 2DQSA 4NFLA 1Z4PX 3SD7A 3WK5A 3DNPA 2FDRA 1TJ4A 3OCWA 1ZRNA 4KX3A 4C4RA 4AS2A 4YCLA 3AR2A 3E58A 4OHFA 5AKYA 2VKQA 2JAWA 5AKZA 5AW3A 2AGVA 3OTQA 3WKDA 3N1UA 4OCZA 1WPGA 2HHLA 2ZXEA 3E84A 3L8FA 3AR6A 2B82A 1Z4IA 3KDPA 3QYPA 4PNHA 3MPOA 4H1WA 2CFSA 5AICA 3DDHA 4B6JA 3I6BA 4CF5A 3B9BA 2C88A 5AW8A 4BNDA 3IB6A 2W4MA 2I6XA 5AKIA 3FZQA 5AI8A 3OCVA 3ED5A 2YN4A 3ZUPA 2X4DA 5ALXA 2YJ5A 2ZBDA 1U02A 4CF4A 3L5KA 4Y2JA 5A3QA 5AVUA 5ALMA 3WKAA 2HF2A 4IG4A 3BWVA 3DV9A 2WF5A 3W5AA 4CF3A 3KC2A 3OPXA 2O2XA 5AI9A 2JARA 4XPZA 5AW4A 1ZD3A 4Y2SA 5AVWA 4NAVA 4MUMA 2YY6A 2CFTA 5AI0A 3L0YA 3OCYA 3QX7A 1RLMA 3FPSA 2RBKA 2IOFA 3UMBA 4BX0A 3I28A 1FEZA 4CNQA 4J03A 5AKHA 3ZVMA 1QYIA 1X42A 3RFUA 2NYVA 4UM5A 3OCXA 3W5BA 3K1ZA 3ESRA 5AVVA 3D6JA 4HYTA 2G0AA 2G06A 1N9KA 1KYTA 1F5SA 3N28A 1NNLA 5ALDA 2FUCA 1RMQA 1WZCA 3DAOA 2HEGA 2BDEA 2OYCA 3A3YA 2OBBA 1VFPA 5AVSA 1RQNA 4YGYA 2I55A 4NABA 2P27A 1WVIA 2R8ZA 5A3RA 1U2TA 2ZBGA 1L7NA 5T41A 4KX5A 4AS3A 5AM1A 2B0CA 2PR7A 4F71A 5AK3A 2YBDA 2B1RA 3UM9A 1RRCA 5IT4A 4Y2XA 3FPBA 3ZTWA 3NASA 1K1EA 5ALVA 1L6RA 4E88A 5AM4A 2HCFA 1Z4NA 5AVZA 1U7PA 5AM3A 3TLMA 3AR4A 3WK4A 1XPJA 2WF8A 1Z4OA 4UARA 3QUBA 3L8GA 1YV9A 4UATA 2FUEA 4GXTA 4G9BA 4EX6A 5ALGA 3NRJA 4YIKA 2MU1A 2ZBEA 3AR7A 3NALA 3PGVA 2W11A 2G09A 2ZG6A 1LTQA 4BKMA 1L7OA 1QH9A 2HX1A 3PCTA 4C4SA 3ZWDA 1ZD2P 4HGNA 3ZI4A 5AW7A 5ALPA 4I9GA 4KYTA 1O03A 1ZOLA 5ALJA 3SKYA 5AW2A 3MC1A 2GMWA 2WFAA 3A1DA 2JAOA 3L1VA 2WF7A 5JJBA 4UMVA 1CR6A 4UW9A 1IWOA 3E8MA 4Y3UA 3FGOA 3KOOA 1TJ5A 4I9FA 2FPXA 3ZW7A 4XOUA 4BEWA 4KNVA 1U7OA 3EPRA 5AIBA 4EX7A 3QU9A 4Y2QA 2I33A 3PGLA 4BEVA 4FYPA 1ZD5A 3HYCA 3WK7A 3I76A 3UMCA 1Z5GA 5AK4A 2I34A 2C4NA 5AVXA 3QUCA 3QUTA 4HGOA 2HSZA 4RESA 2RARA 3IJ5A 4Y2UA 3ESQA 5AK6A 3J7TA 3U7EB 5ALZA 1YMQA 1YDFA 2AH5A 4YIHA 5AVTA 1N8NA 1PW5A 3L0BA 5ALEA 3HLTA 1T9ZA 4MWOA 3CZ4A 1TA0A 1QQ6A 3R09A 4DFDA 3KD3A 5AESA 2B30A 1QQ5A 1Y8AA 1SWVA 3GYGA 5E0OA 2AMYA 1NF2A 3U7FB 2P11A 3FVVA 2FI1A 1VJ5A 4UMEA 1ZS9A 1JUDA 3ZWKA 1ZJJA 3MN1A 4UAVA 2G08A 2CFRA 4BBJA 3PDWA 3E81A 4L57A 5A3SA 2IYEA 2YMMA 3ZVNA 4DW8A 3QU4A 4XQ0A 4EEKA 3N07A 2WF9A 2YFYA 1YJ5A 3U26A 2NO5A 4HGRA 3AR3A 4C4TA 3AR9A 4BX3A 2GHQA 2HOQA 2YJ3A 5AM5A 2B1QA 4FE3A 5AKGA 5AM2A 2Q4TA 2EARA 3L8EA 1YNSA 4BX2A 4KNWA 3U19A 3QU7A 5ALWA 3M9LA 4F72A 5ALIA 5AW6A 4HAIA 2D2VA 3WK6A 4HGPA 2YJ6A 2O9JA 2NO4A 3W5CA 3AR8A 2Q4RA 4UASA 3L8HA 3B9RA 4ZEWA 2B8JA 3SF0A 3EWIA 4QQFA 3SHQA 2ODAA 4NV0A 3ONNA 2YJ4A 3F9RA 4BNDB 1Z4KA 1TJ3A 3ET5A 5ALTA 4OFZA 4UAUA 2G07A 2IA5A 2PKEA 4AP9A 2R8XA 2HF7A 1L7MA 1RKUA 3BA6A 4UU0A 1Z4JA 4YH1A 2C8LA 1RPZA 5AVRA 2P69A 4GIBA 1XP5A 3A1CA 5AI6A 5AM0A 2HDOA 1NRWA 2ZBFA 3L7YA 3NAMA 5ALUA 2C8KA 3U7HB 1YS9A 5IS2A 3I1YA 3WK9A 3QGMA 1RLTA 3N5KA 2OA0A 2GO7A 1Z88A 2RB5A 4UMDA 4JDPA 2HO4A 1ZRMA 4FFDA 4NWIA 4ZEVA 1T5SA 1S8OA 5AIAA 5ALOA 1AQ6A 5AKLA 5AKJA 4CE6A 3ZU6A 4O8CA 4Y2TA 3A1EA 3QXGA 3SLRA 3S6JA 5AKKA 2Q5EA 3QU5A 4YCNA 1Q91A 5ALRA 2QYHA 2C9MA 3WK8A 4OD0A 3RF6A 1LVHA 3NIWA 4JB3A 5AI4A 2YMQA 1J8DA 3L1UA 3U13A 2MSNA 1RQLA 3M1YA 5ALLA 2IOHA 3UMGA 1RMYA 3WKBA 4KN8A 2W43A 2WF6A 2G1AA 1L7PA 3EF0A 5AW9A 5FP0A 1Q92A 2JGAA 2WHEA 2G80A 5ALSA 1Z5UA 3OCZA
chains in the Genus database with same CATH superfamily
3DV2A 2NZVG 1EVQA 2AG1A 3R9KA 2ZT6A 2XLBA 4IHJB 1LGYA 2E87A 1PU2A 3WIVA 4J32B 1MJGA 3I6IA 1I0ZA 5JWHA 3OFNA 3A1NA 1MVLA 4RW0A 5KOJA 4NJMA 3E9CA 2QDKA 3AEUA 1I4YA 3WGVA 4UMFA 4DDTA 3WKEA 5ALNA 3CLUD 2HZ7A 4J3NA 4D3ZA 2DJIA 3U4IA 5K0IA 3EZNA 3L1IA 2Z2XA 1VBFA 3F8WA 5KYUA 4AKSA 4PFPA 4YQYA 2R8EA 3KV1A 2AXPA 4PN3A 5L7TA 4PG6A 2C5GA 4GKVA 3JQGA 1FZTA 4HJRA 1OJLA 1W49A 2CK3D 4S2UA 3NNSA 1YQTA 2E1PA 3OZVA 2A86A 2EIMC 3KLPX 1ZMOA 1V0JA 5FLEX 3RYFA 1W36D 3K0SA 1V8DA 1BCRA 1OI2A 1GPH1 1US8A 2YN4A 3B70A 3GAFA 1MRSA 3WWCA 4FXOA 4HWRA 4QNRA 4BTVA 5I6DA 3I6ZA 3DT6A 4JCCA 1OW3B 1T6BY 1H2XA 1HTTA 4AKEA 4UHCA 2WAAA 3PQ5A 1LK5A 2A2ZA 3FG9A 1UZAA 3PT9A 4W9NC 5FYQA 4ZCPA 3HI4A 3ESXA 4A6DA 3E9QA 1FB5A 4U2BA 4DA9A 4EKDA 4KRXA 3C8UA 3ROQA 1RYDA 4JTAB 2G0AA 3GCXA 1YBAA 5LQSA 1OI7A 3L04A 1P6UA 2FYTA 5BVGA 4KCGA 1R0YA 5JSHA 3IKTA 1TEHA 1VXOA 3T3NA 5IFLA 4JIOA 3KVOA 1LDYA 1L7NA 2ECOA 2NXEA 2EJCA 2B0CA 5GIPE 3RC7A 5A1JA 2VDKB 3I3SR 4CGYA 3OX1A 4G23A 3TZBA 5LQNA 1MG0A 4DWVA 4OBWA 2PUJA 2HPAA 5CM2Z 3VC1A 1KSGA 3CPJB 1K4KA 1GZ4A 3PEYA 5DFAA 3W2VA 1SVWA 3G49A 1KARA 4RD1A 4OBBA 2QQ0A 2G8LA 3KQOA 3C43A 5CH3A 5IC6A 4Y1FA 1EXMA 2Q4BA 3I9JA 4NZZA 3A6DA 3LX8A 4DXAA 4RQUA 3T1NA 4MVJH 2JVJA 3PIIA 4ZXFA 4DFDA 2QY6A 3ZZTA 4HX2A 4M0KA 1YZKA 3FOEC 4QOJA 2QXTA 3K92A 1GT6A 1XRSB 5E3AA 1H4TA 1EFRD 2GBGA 2NO5A 4G8CA 2YL0A 3I37X 1VLQA 4QUHA 4ZHSA 5L0JA 4ND2A 3OZEA 4MCIA 3H6GA 2A4KA 5EIBD 4EPWA 1EX9A 3W2WA 3F6YA 1GFSA 3G8AA 2E6UX 3ANYB 3H2SA 2YICA 5CB6A 1E0JA 2EJWA 5DK4A 3JR3A 2BEVB 3NFYA 4QAQA 1QIMA 1NN3A 4V0KA 4QDJA 3LF2A 2V1UA 3BQNB 3U4AA 3EDOA 1UBGA 1UMKA 4GICA 4X85A 4N9QA 1FVXA 2H08A 2C9CA 5B3KA 3ZW9A 4BC1A 2ECPA 1UJ4A 3W5JA 2YV4A 1EFLA 4JVOA 1ZUD1 1EWTA 4L0QA 1PFQA 3VMMA 2FGKA 1NXVA 4YCNA 4XGKA 4KXQA 5GJBA 1JALA 3WK8A 2M64A 2WP0A 1JVNA 3A0UA 5CD1A 3HB1A 1THTA 4P80A 3SM3A 5E9WA 4QG7A 1OXBA 5D85A 4MUXA 1GRQA 4P3XA 3M49A 4UM8B 2EBHX 2BMFA 2PX5A 4H77A 2UYOA 3W3AA 3SHTA 1WWKA 5L4NA 1DBIA 1EDOA 3KKLA 4FNGA 4B6SA 2LQGA 2BR5A 3W5DA 4EW2A 1CY1A 3R20A 1K7FB 4JLVA 3KTOA 5K3OA 4FLEA 4RMJA 2PS1A 1Q0GA 2HHJA 3ESCA 4KO1S 1YNOA 4HH4A 2FMFA 2H59A 2IZ7A 5T57A 3EF1A 4EF4A 2D62A 2FOLA 3HDVA 1UJ6A 4I1VA 1QP4A 1FFDA 1D07A 5IHXA 1FZQA 2IYSA 2FUKA 4G4SO 5DW0A 4EF5A 1DIRA 1F6DA 3JQEA 3D1VA 4Z4QA 4HDSA 1VIDA 3PDIA 4HX5A 4I50B 4QDOA 1Z47A 1E1QD 2EU8A 2XBLA 1BKSB 1TJ4A 4A36A 3T4EA 4OHFA 4CMEC 3LMKA 3WKDA 4YNBA 5DXFA 2W90A 2ZB8A 3KAPA 2P3LA 1J56A 4F6CA 2PSSA 3JVUA 1YE3A 4CDAA 2W71A 3AL2A 5BT8A 2FX5A 4DADA 4QJ4A 2HUPA 3KWFA 4DSTA 2Q3JA 5HZGA 5DCLA 2I6XA 3FZQA 2HBZA 1IE3A 1QB7A 5DEOA 3ABSB 4GUAA 4Z9IA 4IARA 2D2EA 4WY8A 3I9OA 1ZD3A 4EWLA 2VDPB 3RQIA 1L1QA 2WE8A 1Y34E 1S2GA 1D6JA 4ETMA 4PFSA 3B3GA 3HJNA 2WJYA 1JIXA 3E1KA 4Q0MA 3D8SA 3MMNA 2DY1A 1SXJC 3IALA 4FKBA 3BJRA 4KDFA 1U9IA 3FPFA 4M1YA 2CT8A 3LZDA 1X77A 4I3FA 3AERB 1UJ5A 3IIEA 4H6VA 3FBWA 4EA7A 3CZ9A 5B2FA 5FB3A 4WX2B 1R6XA 3PWTA 2UUIA 3GBSA 1KAHA 5DLYA 1CJTC 3H2HA 4M9ZA 1L5SA 3A7DA 4I9GA 3MD0A 2ONKA 1V9SA 1LLFA 3IVCA 3V8BA 3EVAA 2ACWA 1E66A 5GINE 4M88A 3EH2A 1XZEA 2A69F 4Y30A 5C1BA 1I1QB 3Q3IA 4YT2A 5AK4A 3LKBA 4UCWA 1SVLA 1YMQA 3ICEA 3RWBA 2ATCA 2QTZA 2WMOB 5B1HA 4RNDB 3WQQA 1QHEA 3DCNA 4N5HX 1E2BA 1ZL2A 3B1JA 4V0QA 2QN3A 4KIFA 5FL7A 3C39A 4EEKA 2WSYB 1MNDA 1GOTA 4TN5A 4D4IA 1YJ5A 1E3JA 3QBTA 3LESA 2EHDA 3KOZA 1A7JA 4HGZA 3V5YA 1T0IA 2DWUA 2ZUWA 2C4UA 3ERCA 3ITEA 4ZYZA 1CEYA 4NU8X 7ADHA 3UUGA 4YUZA 2O2YA 3ESAA 3BK2A 3U62A 4ESHA 1JQ5A 1LBEA 2R8XA 3L8DA 3LVBA 5E3HA 1M2NA 1IVNA 3BMNB 4N5NA 4HADA 8MHTA 2OWEA 2GD6A 4RK4A 1WKCA 4AUMA 4JC7A 5HPYB 1TCBA 3KV3O 2GT1A 2YYYA 5ALOA 2CHQA 5K2OA 4GOMD 2DTXA 5K8CA 3OECA 4KUEA 3MBIA 2C9BA 5J1SB 4N6GA 1SQFA 1RWMA 3C87A 4P5EA 2ZJBA 4IMRA 4AUEA 2QAGA 4MTGA 4HUTA 1WWPA 3DBHA 3L1UA 2C7RA 2PKQP 3VF0A 3BFPA 3IUMA 4RD0A 4YT4A 4JOQA 2GF9A 3W2IA 1R4NA 1K0UA 3IIJA 1X80B 4MEAA 3R7WA 2EBFX 1L4KA 3R3VA 3OE4A 1NT2A 4K0RA 3AUUA 4RDCA 2GN6A 2P5TB 4OFXA 2EATA 2CDNA 1M73E 3B0PA 4DLYA 2BFMA 3RJ9A 3OUUA 4JY7A 2C2XA 3NTOA 3I1IA 4IOJA 2VCYA 4DNXA 4ZGBA 4L6AA 1VL8A 3VA7A 2WTAA 3PC6A 1GDHA 2XYQA 4Z7NB 1E6MA 4B3DA 1VXRA 2ZYAA 3VI4B 3F67A 2JAHA 3JWIA 4P08A 3U48A 1KO7A 5KNCH 1CGNA 5ALHA 3ET4A 4IZOA 1FIUA 2ENWA 5H70A 5AVYA 3M1IA 3SKXA 2VRBA 3RKRA 4ZZ0A 1P1CA 3L4BA 3DLTA 4RKFA 1L8LA 4KLCA 1F2TB 5HCUA 2G63A 1KYYA 1XAHA 3S1AB 4A91A 5G0UA 4DJJA 2WNSA 1H3EA 2FPMA 2YUTA 3AHGA 1NRJB 3N87A 1KHHA 4MI6A 1SKUA 1SUPA 1BH2A 2HYIC 2B1GA 2Z30A 2EGUA 4UBJA 1RPJA 3MLAA 4OAPA 1FXWA 2EF0A 2ZJ2A 4H0FA 4WL0A 3KLBA 3L43A 4Z4HA 3TQIA 2H7OA 5CYPA 5KOYA 1I14A 4F4JA 2B4YA 3FIJA 5KVSA 2AC2A 5I4IA 2FZLA 4H59A 4NCNA 1R4AA 1FFHA 1TYCA 2PRJA 5C5IA 5DTMA 1GPKA 3F3YA 1ZHXA 1SF8A 1KPIA 1PKXA 4FI3F 4IUCS 1IB0A 4GZ5A 1GCIA 2OHGA 4IDHA 2W2KA 1XMVA 1E9EA 1G19A 1R8YA 5TC4A 4AI6A 3ZE1B 1LWNA 2AZMA 1P7YA 4FZVA 4NBNA 1XCOA 4NABA 4TTIA 1RSZA 4FMCB 1NL3A 2UUOA 2NUPB 2J7PA 1WP4A 1Z39A 3PFWO 5JCPA 2EPKX 2PAFA 4LMRA 5SY4A 4WESA 4O7GA 3HYSA 4TROA 2GPSA 4WINA 4CMCA 1L7RA 3OQMA 2AYXA 1P2TA 5C7YA 1ZD2P 1T01A 2N9UA 2Z6VA 2IHKA 4DNPA 5G53C 4O79A 1E1NA 3GLFB 2H16A 1U5BA 3GYBA 5M04A 2X8LA 3LJBA 3T38A 1Z5GA 4X45A 4YTEA 1VG9B 2VB6A 4Q1DA 1PBNA 4DMLA 1DP4A 3B1ZA 2AXEA 1QR2A 2O5RA 5B4UA 5H7XA 1ZIDA 4TRJA 1MAHA 4ZMSA 3GM1A 2OO5A 3I34X 4GP7A 2VR1A 5BMVB 2ZZMA 1Q6ZA 2P4EA 2AC4A 2ZCJA 1M6VA 2HMSA 3DD1A 1DKNA 1OA0A 4BBPA 2ACKA 4FOOA 3Q7IA 5LYJF 2ZJ4A 4F2HA 4AJEA 4JS0A 1MQSA 3ASNC 1OZ0A 2FLWA 4ER0A 4CETA 3EGDB 2KSQA 5KC8A 4RFVA 2JGNA 1L7MA 3M4NA 3UMHA 2JBHA 5FRDA 3L07A 3RS3A 5CRIA 3HNPA 3AL0C 3K70D 4DCMA 3I1YA 5IVPA 3GT4A 1GG8A 4CMKA 2JJYA 3ZWMA 2DBVO 1F7VA 3AUAA 4Y2TA 4PHTA 3SLRA 2IZ5A 5AKKA 3C5WP 4XARA 3SS8A 1LXCA 3HH8A 2XUIA 3PYLA 1VQ1A 4DZTA 3RWOA 3RD5A 1X2BA 5FIUA 1ZD9A 3SR0A 4NICA 5JSQA 1NU8A 1ORIA 3L02A 5EKUA 2YZ2A 1OFIA 4K7JA 2Q99A 2DFTA 1XEXA 1DDGA 2D5CA 3B6EA 4MWDA 3IURA 4F56A 1RKBA 1AS2A 1QC5A 5FLKA 3CNOA 4HFJA 1VC2A 4Z0PA 2REOA 2I4MA 5ENZA 2VSNA 4HC4A 1T1EA 4XEHA 2I1WA 3AJDA 1AD2A 3QI2A 3FMGA 2CJXA 4NOMA 5IXSA 1OTYA 2HJMA 2KPOA 2F2TA 1G0NA 2ORED 2X77A 4MUGA 4HLNA 3UWPA 2BY4A 3UVEA 2CL5A 3KYDA 2OV4A 4TQ9A 4BPBA 2VJDA 4WKBA 3NM5A 4ID9A 2HSBA 3MYRA 3RADC 3FVWA 2BL2A 1T4CB 1AA9A 4IIVA 3PNBA 2CWWA 4WZ6A 3V4PB 2J9BA 1HYEA 1DAMA 3VDMA 2QRUA 1A9YA 4CS8A 2W2VA 3WGNA 2VHJA 4GBMA 1XUOA 1N2OA 3S29A 1XZAA 3K3PA 1K27A 3SNHA 3LJKA 4F06A 1ZC4A 2P3QA 4C9BA 5JAOA 3SXJA 2A68F 2ZM6B 4V0NA 1RPTA 1RIFA 4O4JF 1ORJA 1PWEA 4LGMA 5JAZA 2HCBA 2Q5CA 1JU9A 2VK1A 4PRYA 1PQ4A 2XSZD 3I5UA 3OVMA 3G0HA 1HDOA 4Y7DA 3BMCB 3WL8A 5EWMB 4UCFA 4I4LA 2IUFA 1GGEA 4PC3A 3L7DA 2AVNA 3RBVA 3T7CA 1ZKDA 4DSZA 4OH1A 5HF8A 2BL4A 3BYZA 2YZMA 3LG2A 2PF4E 3AC0A 3I1JA 3O2QB 4HD8A 1E1CA 1U11A 3B52X 1TNDA 3JQDA 3Q98A 1JG2A 4C0AC 4EHDA 3VR5H 5DM2A 1T2AA 4EFNA 1XZ8A 3ME5A 3NAZA 1ULTA 4UATA 4O5AA 4EX6A 4P83A 3BC1A 4X64B 3FCYA 2CNBA 2GN8A 4E5DA 1EDBA 4ZT6A 2H3HA 4LLCA 1JQ3A 5GZ3A 4UW9A 1NZJA 4YQFA 3DQQA 2F3SA 3VU3A 1U7OA 5C53B 2XVXA 3NGMA 3H4TA 4MH0R 1BEEA 3DW1X 4QTZA 3IS3A 6YASA 4R83A 4DBVO 4K0DA 4YY3B 3SEOA 4BJ5A 3D8RA 4BN0A 3PFKA 1TO2E 4MARA 3MIIA 2HB6A 5FPHA 3P4UA 2C2OA 3IXQA 1XU4A 4G37A 1QMPA 2QVZX 4J0CA 3UCFA 1K3TA 2AN3A 2VNHA 4ESVA 2CLEB 3D6MA 2R68A 4AF6A 1P9WA 2CD7A 4BX8A 2XEDA 5CVDA 1SD1A 3IT3A 1TO6A 1SBTA 3FLEA 3PZBA 3TTYA 2PA3A 1XXLA 3IVGA 5A6VA 4ZT2A 4TWRA 4EGFA 2WYOA 2B8JA 2IX3A 2NQ8A 5LZ8A 5KX5F 4C2UA 3HDGA 3GFTA 1HNNA 2PD3A 1SCDA 4YMWA 1USVA 4OQLA 3DHEA 2R9RB 4AIIA 1YS9A 3HA3A 4EZBA 1SXQA 2QHXA 2JAXA 4DJAA 1YCFA 1SU8A 1JBQA 2OV6A 4FZ3A 5BSGA 1J0CA 4DRZA 5JCOC 1AB5A 4OLAA 2I4IA 4MGIR 3U13A 4Q34A 5LP6A 3CEXA 1OB5A 1LS6A 3AONB 3B1VA 1AS3A 1J0BA 3QEAZ 3SXUB 5KSWB 4YMHA 4HZUB 4WACA 3EIWA 3OCZA 4ACBA 1W4BA 1OZFA 3ELDA 4C6SA 4BL5A 1Z4QA 5IKOA 4EOGA 2PKYX 1RM0A 4PO3X 3R9XB 3B82A 2BUAA 3PF8A 1VHDA 3DGEC 1H6CA 5AKEA 4BMSA 4JC0A 3IPXA 1HY5A 3UMJA 4XTRA 4FLFA 4FCVA 2BRUA 4BY9E 1ZD1A 1C41A 1SCAA 2IPAB 1QE0A 4ZAXA 5E6RA 1IWBB 3L7MA 4I1PA 5IMSA 4FYHA 4KKVA 3UWSA 2ZTVA 4F3RA 2VAMA 5CEEA 5M7EA 1RI4A 4OHUA 3QEMA 3HXKA 2WUWE 2Q3MA 1Y6JA 1QXSA 3TRKA 5C8ZA 4ZHQB 3TD6A 1IK4A 1E7QA 1F2VA 3U81A 4L15A 3VR4A 2H2WA 1I3KA 3FHCB 4H4DA 4JVNA 4L4ZA 3M15A 1Q0KA 4M7WA 4GKKB 4BE7B 3PXUA 4C5AA 5B1AC 3U0VA 3JRMO 4CM9A 3UPUA 5AKZA 4UHJA 5JCJA 4ZOEA 4L3VA 2PU7A 4RO0A 2OOKA 2YQ5A 2MSWA 4MR7A 5ILQA 2O8FA 1OZHA 3BH6A 5FA8A 2PM8A 3IP7A 1CY7A 2FSIA 3HEAA 3QV2A 1WQ1R 2WWXA 4UVHA 2XL6A 3AEKB 1UQTA 5K01A 2Y92A 4PVDA 1G38A 2JZNA 1BR4A 1ZHZA 1U0SY 1CY2A 2FGJA 3D1LA 1XC7A 2XTMA 5GVSA 2ZE6A 2AN1A 3X1XA 4NV1A 2E9SA 4DR7B 3GNTA 2O59A 5L9AA 5A6AA 2CY0A 1YVDA 2B25A 3IXLA 4A0QA 3VU1A 4ZU1X 3C3JA 4CLOA 2PLWA 3UMVA 1ZIXA 4ZQCB 1TD1A 4JR0A 2NYAA 4LJ5A 2BP7B 2XUKA 4KTTE 1OLSA 4IIHA 1E92A 2SCUA 2VPWA 5DVWA 2BE7A 1CZLA 2V7QA 2VPIA 5DSZA 4PU0A 3M4ZA 2BYTA 3EIHA 4BX9A 3LGSA 4JE9A 1L6RA 4OO3A 3DA8A 3HJAA 2GAAA 3FNIA 3WIDA 3K6BA 5REQB 1QQAA 2C04A 4U6QA 5ICEA 2W11A 1C81A 1YO6A 3L6CA 1A9OA 1ISSA 1MHPA 4K05A 2DZDA 4P38A 4Q3DA 4HXFB 3P0EA 5BR1A 5BSFA 1U0EA 5LNK6 1G9XA 2OCGA 1ONSA 2LFFA 1TM5E 1VKNA 5C0OE 3YASA 3O2SB 4Y2QA 2A0KA 4AN1A 3DFIA 5BUOA 5IY5C 1PJZA 3K96A 4REQB 1Z5NA 1N8NA 3OHPA 4DVJA 3D1JA 3Q7LA 4ZLDA 5CHEA 3HO8A 1DAFA 3QLVC 1Z83A 3K0CC 1GKKA 3LT5A 4FR2A 4FQ8A 3O4RA 4OXKA 4M8IA 4HWSA 2PXCA 4Z9XA 3DM9B 4Z3KA 4DAEA 3DBLA 4NBKA 5JI2E 3TAXA 4CIDA 3P9PA 1HH4A 2GZDA 5CEJA 1EWVA 4CL3A 3VU0A 2ROQA 2UU9B 3LSTA 3RS5A 5GP1A 2CW5A 5F9HA 3AHIA 2ECKA 3K1AA 1UFQA 2BKVA 1U8CB 3Q9UA 2BGTA 1NW3A 1I8TA 2ODAA 1E5LA 2FSVC 2J4DA 2BGUA 4ENPA 3UYLA 2OZKA 4UU0A 2XIQA 4EG7A 4WBNF 1GFZA 3WGYA 3IQWA 1PHPA 3NTRA 5G0VA 2B4TO 1RZVA 2VP2A 5CB4B 1XV5A 1Y6ZA 1QGUB 5T8KC 3QHPA 4MP3A 2N46A 4PX9A 4LRSB 1S8OA 3QF7A 2PH5A 4P0PB 2NU7A 3A4YA 4HV4A 3PJRA 3DAFA 4JLJA 5JTTA 2QRNA 4BWVA 4ARZA 1SXJB 2HW8A 2QX4A 4G7ZF 4YGXB 2J48A 1IHYA 4YI5A 4Z1MD 4TTVA 3T9OA 4OD4A 1WJGA 1O3UA 2GA8A 1MF7A 5KMGB 3JQPA 3IOEA 4GM0A 5BXQC 4PZYA 5ITSA 2IDKA 4XFJA 2UYHA 1G8AA 1W73A 3L8IA 1PV1A 4UOZA 5CMLA 3DEZA 1DBVO 1TEXA 4HS4A 2HMVA 4LDJA 1MPXA 1PQUA 1WCV1 3UFXB 4DPLA 1Q22A 3ONEA 3ZXIA 2WDPA 3DZCA 2BCGY 1VBKA 2J3JA 4D9CA 1UINA 4D42A 5JD5A 1T8RA 4JBXA 4BO7A 1ZQ9A 1SB9A 1T3LA 2JKVA 3K4PA 2HSWA 3ZXSA 3VR6A 1BWPA 2OGWA 4ZAGA 2FSGA 3A1FA 5JECA 1U8YA 4WN9B 3NANA 1NP3A 3FPAA 4DJDC 3HKCB 2D7CA 1MT3A 4Z49A 1M2FA 3IRUA 5HJEA 2FKNA 4C6RA 4OHZA 2RONA 3V42A 4ZQIA 1KYZA 1YQQA 1P8JA 5FTNA 5LOVB 1CNMA 5JQGA 2YWEA 2P61A 3IUYA 3JQ8B 2PTGA 4KMMA 2JGDA 3GROA 4J7XA 3US6A 4MVWA 2XXBA 1ENPA 4ZJZA 4JU9A 4YWHA 1G1MA 4DRXB 1AUEA 2A8YA 4BO0A 3U3OA 2CJWB 1G8MA 4ZVPA 4ZKEA 2PX8A 2KYRA 1XDWA 1Y1RA 2REXB 4W99A 2OC9A 2EFCB 3LFTA 3EY4A 5AOVA 2AFIA 4J49A 3TECE 4Y2SA 1DQZA 2P2SA 2O2JA 1H1LB 5F33A 4NSNA 4LE2A 4R9UC 1CC1S 3KKEA 4G6ZA 3JARA 2VHZA 4I5DA 4FWBA 3G2JA 3FDQA 2XKAA 1RMQA 1FF9A 2Y9MB 3KZKA 5KTYA 3AP2A 3DPSA 2OXEA 1YVEI 2QMUA 4R2KA 1AE1A 3O38A 4O4HA 1VZ3A 2OG2A 4MRMB 2JAPA 2R4QA 3RV3A 4PM4A 1EUDB 1PQYA 3KQVA 2W0SA 2C95A 4MVJA 1P5ZB 2DHCA 2VLIA 2FUEA 4GXTA 3V5NA 1U8UA 5EJ4A 3PGVA 3FZYA 1I5NA 2FW7A 3MG9A 3JQFC 2PFDA 4S24A 3QQ5A 1QGZA 5LQKA 1AGNA 5CUQA 2BSQA 3N8KA 2HREA 6REQA 2HQ1A 2FPXA 5G0WA 1NKVA 1CNEA 1SMKA 1C7QA 4X6LA 3PS9A 2X0RA 2CHFA 4KVFA 3KPVA 1DEXA 1VJ1A 2ZB2A 3UJ6A 3COWA 1AA6A 4CEHA 4MRAA 1M8FA 1JOGA 3LUDA 2IE8A 3QXHA 4ZDIA 3IESA 3K8OE 4C0HA 4MWOA 3MWGA 1Y8QB 4UZSA 2Y0EA 2ZVQX 3I42A 4JROA 3GDFA 4S35A 5TVGA 4PRKA 1I7DA 1QTIA 2VOEA 3U3ZA 1Q77A 3N8NA 4E5SA 1XEWX 4CDVA 3AETA 3IA2A 5TQ0A 3H8VA 3UYKA 1DADA 3AF2A 2IPNA 3Q85A 3KWJA 4D3DA 2UUBB 5F2OA 2BFOA 4F60A 5LC1A 2ZXOA 4BDTA 1JG6A 2AE2A 1BDIA 4BNKA 4JGBA 4DRHB 3DAYA 1N2XA 4HGPA 4HZGA 2Z1DA 2D6FA 2MMCA 4BNGA 4UREA 1Z56C 2FQ1A 4LA4A 3DEIA 3ETLA 5BR4A 3RVQA 2IBTA 4R69A 3K5WA 4GQBA 1TFOB 3V4LA 4HTFA 2QN1A 5JZBA 2GASA 4BIMA 3QOXA 3DCJA 4NMMA 3RTCA 1LPSA 2A30A 3FOBA 5F23A 3HU2A 1P3DA 4DRJB 1Q3KA 1U8EA 1ZEJA 2VXBA 2Q5HA 3E7DA 2DKFA 3AYXB 1Q91A 4X6XA 4N6CA 3TS1A 3ZY3A 1XK7A 4DMKA 4MDYA 3IILA 4JB3A 3C98A 2XVAA 2C0PA 3ZIBA 1UT6A 3UTCA 4AICA 2A9JA 4Q5SF 3HVIA 5AUPB 1PR0A 1JQEA 3AWDA 4DARA 1HPLA 3BHJA 3UKDA 1M2OA 3ZQYA 2DYSC 3EB9A 3GM2A 3HDYA 4IZIA 3GXOA 4W5JA 2ZUCA 3DAGA 1QTRA 4Q16A 4CL0A 3U17A 1U0FA 3A6ZA 2D1RA 4XWYA 3AR5A 4RV4A 3T7TA 3CEJA 3GV0A 3NBXX 5EHQA 3UA4A 2Q9BA 2W5UA 1NPDA 2ZSAA 4RCZA 1TCVA 3UXMA 3BD9A 1C30A 4Q4LA 1QIGA 3Q9SA 3LP5A 2JEOA 3F3MA 5MN4A 4KK3A 4ZT4A 4EL0A 3HMKA 5K9ZA 4JLDA 1EK6A 1GNSA 4BVLA 4XM0A 3NHLA 1RW4A 2IYWA 1HR0B 2APJA 1RBYA 5AVQA 1MIHA 1BWQA 1U0NA 2R8YA 2FJ0A 1V41E 3N2ZB 3GP3A 4A8JC 5ANRB 2ZT8A 5FBKA 1XCLA 5TMEA 5K0SA 3IEXA 2QW0X 1NIJA 1FUIA 2WMNB 3H5RA 4H15A 4JT8A 4PANA 2YWGA 4B73A 1IN8A 3ZQVA 3OTQA 3M33A 5LWQA 5JZMA 1X8KA 4YPOA 3EWSA 1XJCA 4IAOA 1Q14A 5KAMA 1YQWA 1CF2O 2C96A 4W5OA 1PFKA 2PZAA 4QI2A 3GFBA 4ZCTA 4KLAA 5J23A 4UNSA 1SB8A 1P7PA 2FN3A 4D8WA 5J2UA 3C8GB 1KBOA 4BNUA 2ZYIA 2NN3C 3A14A 3R5TA 4L8WB 1V54C 1NN1A 3JZIA 5DT9A 5B64A 1QDUA 2Z6UA 4GH5A 2R6HA 5K3DA 5B58C 1RLMA 1ZNQO 3OESA 4MQFB 3KOWA 2F9MA 4ZJPA 4TMFA 3NX4A 3OFKA 5LQAA 3GBPA 5EQJB 1S3FA 3NWJA 2EKDA 1LZLA 5CBKA 1UWKA 2HPHA 3HVHA 1B0PA 1KE2A 1QO0A 3UB4A 3JX9A 3SS9X 1ELOA 2BISA 5DP1A 3UIEA 3BIXA 4TVSA 1IEQA 1L4MA 4ARSA 3N8IA 4DCUA 2W4BA 2YIJA 4YASA 1TFUA 3N75A 1IUKA 3N0XA 1S9HA 4BVEA 3G17A 1Z29A 3QFSA 3AG1C 3EMVA 4MV8A 4N48A 2PKCA 3EFOA 1J2RA 2ZE5A 2WWTA 3ZU4A 1LV8A 2H9IA 5KB3A 5KKAA 1KDOA 1ZM3A 3ILXA 1RJ9A 4N7JA 5CNJA 3TCNA 2GZ2A 1GXSA 3N2KB 1WD7A 1DIAA 2NTVA 1M2WA 4CTMA 2FSPA 4KO2S 2DBRA 4R0NA 4M99A 4F4FA 3GG2A 4M60A 1KP3A 2H1RA 4L78A 4M1ZA 1Y4DE 1E3MA 2Q0QA 1ZJJA 1TZJA 4ZIRA 3R6DA 2HD4A 1IBMB 2ZVDA 1D7OA 5L0FA 5KJCA 1QHGA 5A6SB 3KHUA 3A05A 4Q4CA 5EXEA 4QU8A 3LV8A 2RD9A 1XTIA 4R9SA 1LW7A 2PE5A 4YCBA 4JB8A 4PTYA 1WB4A 4YPVA 3UKOA 4E0HA 5F5FA 1KJYA 5DHRA 4BG0A 4RJIA 3HO6A 2WOOA 2YIVX 4BOYA 3UW3A 4JLBA 1W48A 1HDEA 4H35A 5FX2A 3A32A 2CZQA 2QR5A 3ZJUA 1RCFA 1D09A 5BWCA 1WLSA 1M2JA 3H6HA 1J5XA 5KNCA 1KI7A 3IAM6 4OA5A 1NDUA 2AZ4A 1WDWB 1U4OA 4HYQA 1J1ZA 3KEOA 1ZMRA 1ZW6A 4Q4HA 5DHPA 4LXYA 1C17M 1JXMA 2XVMA 1O7JA 1A95A 2X5JO 1A7DA 1UQUA 5K20A 5A69A 3WISA 4Y9TA 4Z7JA 4C14A 2FFAA 3EARA 1D2GA 1PR3A 4UM9B 3O10A 2XS8A 2QZJA 5BYKA 3WADA 1K6IA 4Y9UA 3DDNA 4DQ0A 1E0AA 1LB1B 4QT0A 4U63A 2NT3A 1F12A 1QAOA 4XWGA 3EE6A 1UP4A 2BMDA 4DMCA 2XNJA 1UXGA 3O8QA 2NU8A 5GONB 5CXXA 3PVZA 4ADSG 4RAQA 3OZ7A 3ZV4A 4OMDA 3G5LA 4IF4A 1E5QA 5DIZA 3VV3A 4F9FA 3SJZA 4UULA 3NOQA 1VLLA 3HNLA 3EULA 4PQEA 4MUBA 1WHTB 2O8VA 3HXQA 3V4ZA 1L5VA 3OZDA 2ZQ5A 2B7CA 2A5FA 2DR0A 4C0BA 2ZR9A 3OZCA 2NO1A 1S8NA 3I0NA 4CI9A 1FA9A 4N49A 4KRYA 2HNKA 4IDNA 2MINA 3G59A 4NECA 1FRNA 5LZ2A 3OT1A 1GAWA 5H0IA 3R5KA 1JH9A 1XNJA 3GW8A 1UOQA 3JQ9A 5AOBA 1UP7A 5DWDA 4MWTA 5TX7A 4J03A 2WWRA 4NOJA 4OUKX 2NAPA 4K0KB 2QIOA 3R7LA 3SE0A 2G4CA 1ZBDA 5BVHA 1IJFA 4TL7A 3PIRA 1OQCA 4B35A 3L6BA 1AUOA 1PI3A 3LDAA 4OK3A 5EIWA 1FTSA 2C2MA 2V6MA 4EHLA 1W4ZA 3PGMA 3I6QA 4PC2A 1IHXA 1H9TA 5L3QB 2JIRA 5MF6A 3TLMA 1B0UA 4XGIA 2CVFA 4ZC8A 3OO1A 3EZFA 2IUSA 2IEGA 4LQDA 1JB9A 3T3IA 1NGSA 1KO1A 4TX1A 2PKQO 1INLA 3I0MA 3CTMA 3JASA 4JYZA 4KN5A 5J4VA 2O5EA 1KXZA 1OXVA 2R87A 3MFQA 1JLSA 2SKDA 1JRLA 4ZJYA 1YAUO 3Q3EA 4ALNA 1EWQA 4F4CA 5FOWA 4OA8A 5HF5A 3QUCA 1U4NA 3H11B 4P84A 5FUVA 1DC8A 2VHXA 1FL9A 2X0CA 4RFLA 3C3CA 4RKEA 2OLEA 5AVTA 5E95A 1TYDE 2C03A 3WNCA 3M6VA 1B14A 2BF4A 1K8RA 1EUCA 1NF2A 3PXEA 2BFDA 1TD9A 4G25A 4RUKA 3N07A 2PQ6A 4MVJM 4EPRA 2H1LA 3ZN2A 2E48A 1V6AA 1E3LA 2J3KA 2L17A 3BWXA 4N0QA 3OE7A 2FWJA 4GG1A 3TE7A 3LDUA 3RSLA 2HY7A 5EE3A 3B9RA 2GB4A 2QRMA 1DAGA 7REQB 1ORDA 4HFMA 3TTXA 1NBBA 3V9PA 2C8LA 3R5SA 3DDCA 4RE6A 2VDLB 3LDGA 1LSJA 3A36A 1PRYA 1L4YA 2VF5X 1D4ZA 1CF4A 1WMBA 2R79A 2CHEA 1SBQA 3OLVA 4QFMA 4G0ZA 1KMIY 3B20A 3OWTA 3KUUA 4M53A 5ADHA 2GM9A 3H2GA 4UVGA 1KJ8A 2C2GA 3MM4A 1V8OA 1XXHA 1PT5A 3OX2A 3RAGA 2R47A 4HNHA 4GBJA 4E7OA 2OOCA 1MORA 1MRNA 4RK6A 1JILA 3N8HA 4CLEA 1NURA 4IGKA 4BQOA 4ZYYA 2BD0A 4DWJA 4EY8A 2OCLA 1L1RA 4URXR 4OJTA 1NR5A 1ZM4A 1GT91 4Q3KA 4AKHA 4C6TB 1I6WA 5T1DB 3UB3A 3RUFA 4EKGA 3VDXA 1XZKA 4NI5A 4OY3A 1A69A 5JNTA 4FLMA 2ZSFA 4W6ZA 1LV7A 1XX6A 1HC7A 4E33A 1WUTA 3N8GA 1W75A 1YZLA 1GQAA 5HGXA 2QIPA 2VJBA 2BR3A 2FZ5A 1KQNA 3RSFA 3PPXA 1XF9A 1SVNA 2ZANA 4AZSA 2QF7A 4XVHA 1FFAA 1E2NA 4JTCB 2XB4A 3T61A 1WTCA 1KAOA 1E5VA 3G7NA 1EHIA 1PJTA 4R6WA 4D41A 1EFAA 3TZQA 2NUTB 3OBIA 4HRVA 3MGAA 3OQPA 5J4HA 5K8UA 2NSDA 3EC7A 2E5FA 3WHPA 3FYTA 1WU8A 1HSZA 3LWNA 1ZL0A 4FGJA 2XXJA 3V4VB 3UT5A 1F8FA 3DZJA 4LZAA 2X2FA 4LGVA 3B29A 1IZ8A 1U0GA 2C88A 1H6BA 1HM5A 1P39A 1UDBA 1GO2A 3S5UA 3HC7A 5EGNA 1M3SA 1UBOS 5CIWA 4YRQA 1IEXA 4I1UA 4EQZA 2H18A 2HF2A 4EW3A 2X86A 3VR5A 2IE0A 3TI9A 1Z6QA 1KJJA 3GFVA 4JHLA 3JQAA 4QU0A 3SYKA 2VUHB 2EZ9A 2PFSA 1OHHD 3EEOA 4C7OB 2H63A 3K0AB 1Y3AA 4LN1A 1AMNA 1N9KA 1NC1A 4MI9A 4P4NA 4LXXA 2WNIA 1IONA 4IZ6A 4G8DA 4HATA 1NW5A 1XHFA 1RZRD 1QZ3A 1KBZA 3WGIA 1N4DA 3UG7A 3GZNB 3TKLA 3UEOA 1ZUHA 2EZ4A 3AGPA 2WG0A 4OI1A 2IKSA 2AQIA 2XNCA 3VRHA 2O8DA 3W2HA 4XYGA 4HCJA 1ID8A 4L9SA 2XMRA 4NYMR 2DFPA 2YBEA 2D0DA 4QDKA 3QENA 4COOA 1DPGA 1O03A 3CC8A 2D5LA 3SF8A 1CR1A 1AUXA 1U28C 3ASOC 4JLMA 5MHTA 2XQFA 1U3FA 2R00A 3X44A 2R0QC 5SZJA 2KLHA 2HIMA 4IWYA 1HFJA 1WTAA 3IJPA 3UMCA 3WBJA 4L8VA 5ICCA 3PFNA 1T36A 2BZGA 1N75A 3U4QB 2CJYA 3ZBQA 1ZJ5A 1UBFA 1U99A 3NRHA 1P73A 3ABIA 3BE6A 1L8XA 4G81A 2R751 3U16A 4S1WA 5JAHA 4KMRA 3NXSA 2XMPA 2FZEA 4I7EA 3A9WA 3MJCA 5AM5A 3E05A 2WFLA 2OBMA 5EXXA 3OQOA 4G41A 3POVA 1DQRA 3GA7A 221PA 3M4YA 1IG3A 2VCCA 1QV7A 2C2ZA 2HJ9A 2FG5A 2O6HA 2XLDA 4ZQFA 3U0CA 1E1DA 4O6MA 1VYIA 5B6IA 3GRCA 5FBVB 2XITA 4D4HA 4DDVA 2FEOA 5LQJA 3COVA 5BP7A 2ZI4A 4HDNA 3KQYA 3EDMA 4L5IA 1YKGA 1DRWA 3V6LA 3QOWA 4DCPA 2J9FA 4A3SA 4F6LA 4EFLA 2ZWPA 3N39C 1C1XB 4NYJR 2GA0A 1PGOA 4WJLA 5CFPA 3LDHA 4KR9A 2BC9A 3LY5A 4MPDA 1VHWA 3HY4A 3WQSB 4RKQA 3FB4A 3DBIA 3DZGA 4FZJA 1GUZA 1MG5A 4GRAA 4L2IB 4HNVA 1KDPA 4BZZA 3QVWA 1EM8B 3OP4A 3V32A 3ZJYA 3U7QA 3C1AA 4X6YA 1VPWA 3QSYA 1EK2A 3H1PA 1D5CA 5JSKA 1GKYA 3WICA 1LM3B 2AK2A 2FPGA 4BJHB 2DSNA 3PFCA 3B60A 1TMYA 4DSAA 5SYMA 1TZKA 1DAEA 2GGSA 2JGFA 1Y9EA 4DVGA 1P0QA 1UOEA 1I33A 4I36A 1RRGA 1CHNA 3UAXA 2ZJ0A 3U0BA 4LDAA 3HZHA 3QLJA 5C4MA 3CPEA 2PHZA 4DIDA 3JVVA 4I99A 2MWMA 5K0CA 1QRSA 2BI4A 4PCAA 5EPUA 1W4AA 2WICA 2WSSA 1ZUNA 4DIUA 1Y0BA 4YCJA 4AB1A 4RF3A 3MWFA 3T94A 4PVCA 4B7CA 5B37A 1HLPA 4D3FA 1OBHA 5EUQB 3QA3E 5HIIA 4EMUA 3D2AA 1D1QA 4HWOA 1LKXA 4LZWA 2O0LA 1UODA 4OHXA 4XJXA 4XX0A 3ZHBA 3O9MA 1QWSA 3R2PA 3IB6A 4Q19A 1I4DD 1PN3A 3WYCA 1JDZA 3MUNA 3JWPA 2FV8A 3MSXA 1LD3A 1A5SB 2BKLA 2IVFA 2F43B 4J2OA 3NIFB 1GM5A 4ED9A 1L7QA 9MHTA 1R37A 4MUMA 5FUMA 4CS7A 3SVZA 2XF8A 4DTCA 1X1DA 4OLHA 3DDZX 1I3NA 3AO0B 4IJKA 2D54A 3KLOA 1Z5ZA 4XD7A 4AG5A 3B5IA 3CWCA 1J2TA 4IJVA 3KNZA 2Q9CA 4JYPA 2Q4DA 1M5TA 5BW5A 2CBZA 1DZ3A 2XLWA 3OKCA 3BXEA 4F0JA 1S2LA 2B2NA 2A5JA 4IQGA 4LHYA 3L8ZA 2XB9A 4XWWA 1VDZA 4EBJA 5TQJA 3VAAA 2K7FA 1COWA 4BE4A 2V9CA 4FFBB 3U7RA 2AT1A 5JC1A 4JV5B 1MT0A 3OJLA 2YV5A 2FG7C 5GTDA 3L7OA 3CISA 3G5AA 4R16A 3JATA 2QD3A 2W6IA 2CNKA 1QZXA 1HV8A 3TINA 3E2MA 2IY9A 1QLWA 3ZLJA 3W8DA 2X41A 3SDBA 3WIUA 4HHEA 4BZPA 4EA9A 4A0RA 2ZRBA 5CDSA 4E18A 4LZPA 4YPFA 3FCOA 4LYHA 4GPAA 1KXJA 1ODJA 2GJ4A 4YJGA 4KOEC 3P2IA 2DH6A 4XIFA 1UJNA 3EUFA 1X7XB 4S12A 3PCVA 2CGEA 3IQCA 4UU7A 2WWYA 4A8JB 1LPAB 3KTDA 3R40A 4CKWB 2F9LA 3H9BA 4QDTA 3BWEA 2YFYA 1FFWA 4XPYA 3G4XA 3BJMA 2YIDA 3WAQA 3LAWA 1MO4A 4QUIA 1OASA 4MVJG 5ICSA 5JS5A 4LGCA 2XDQB 4ON9A 4ARVA 1P61B 2VHQA 4ULVA 3LKVA 3WX0A 2OEVA 2A0WA 4MTLA 1K92A 2GVZC 5C8DA 3L01A 2A1UA 3ICPA 2G17A 2GD1O 3ZJVA 3FVYA 2YHIB 3K0FA 5HMLA 2YJ4A 2R5WA 2Q8PA 4GBGA 4H3VA 3BFVA 4LW8A 5JNRA 1RPZA 4IMJB 4B74A 2QTWB 2AB0A 1E2FA 1Z7YA 1BD3A 5J2TF 3HA5A 1SHKA 2C97A 4RY2A 1VLSA 1GPYA 2K6GA 3EHEA 4UFNA 2AW5A 4F5YA 3I3OA 2VP3A 4ZRMA 3BEDA 2LZ0A 2FR8C 3GGGA 3RUAA 4P81A 3O7MA 4Z0NA 5DNWA 1U5AA 2H1SA 2WT9A 1QE3A 3JAKA 2YW9A 3GLHA 3EEBA 4AT1A 4G5FA 2OK8A 1TKRA 1N6RA 1WXXA 2BBWA 1ZXBA 1R2QA 3WYBA 4OHCA 1CRQA 3EPHA 2NUAB 1V11B 3M6AA 1EAMA 5K4HA 3CCCA 4YDRA 4NBLA 3KOXA 3GJ5A 2YWRA 1E9FA 1GR0A 2Y3DA 4ZVOA 1VP3A 4YLGA 3A28A 1PQPA 3FMSA 5IJ0B 1IBSA 3RRJA 5LR6A 3SJUA 2DUNA 3ZV6A 2VSXA 1GTVA 4JB0A 4QTTB 2QZPA 1NPYA 3R0VA 2GRAA 1V95A 3TLEA 3NHSA 5ALYA 3GT3A 3G50A 1KKMA 1G5HA 3E3OA 3FHDA 2WM8A 3ACCA 3T7DA 5JFOA 5ISMA 4FK8A 3ESDA 5JXJA 3CZ6A 3L82B 1XCPA 3IPCA 2OAP1 4P4UA 5CH5A 3WK5A 3G9XA 4XEVA 4ZANA 1QIEA 4ZOBA 5D8DA 1N1GA 1K8QA 1J49A 1A8HA 4MR9A 5BYJA 3ORQA 1OVMA 2YLIA 4JYAB 2BMAA 4GUDA 1CETA 5DGDA 3ISVA 3E03A 4GM4A 3OD5A 2H9YA 3PNLA 3UCEA 1Z12A 5BQPA 3GZ4A 4BUJA 4TXJA 4P6IC 3EEIA 3MAJA 3SYTA 4L07A 2NO7A 1IOLA 3W5AA 3SQMA 3X2QC 1KZ4A 1R88A 5H9WA 2B3DA 1DFGA 3WFJA 2W7TA 3LC2O 2C84A 1B8NA 4E94A 4B8WA 3ZQ4A 3KR9A 2E85A 1Z13A 4MAFA 1U2DC 1OBVA 4A73A 3QPVA 2ALJA 3PNPA 3OOEA 4B3MB 3S2ZA 1N6KA 2J7KA 3GLKA 2JIZD 2NV6A 4M2LA 4YONB 3GLIB 1JPVA 5CD9A 1ZIOA 3L3BA 1ABFA 2NADA 1EP3B 2C29D 3EIUA 5AJUA 5IKPA 1Y4SA 2XTJA 1WKBA 3HJHA 2IQ5A 1YA4A 1O9GA 5LIRA 4JFRA 3QMPA 5FI3A 4QUBA 3NHMA 1QK3A 3VGPA 2EINC 1K05A 2SKCA 2MU1A 1JW9B 2FY8A 2QE7D 2ADFA 3X2FA 1AG9A 2VC9A 4LYAA 2DHRA 5AW7A 5HP4A 3JD2A 3FRJA 4D3SA 1JHOA 1IQPA 1Z2EA 2JASA 2HMYB 1QH8A 1H93A 3KAJA 3B9QA 4Y98A 2P79A 3K9CA 1GPNA 2BAGA 1WOMA 4DNFA 3K1HA 1FMTA 3GEGA 2COKA 2FHPA 1TM3E 3IJEB 2J5QA 5C7LO 3E6AA 5GADl 1YQXA 3IIIA 4YBRA 2H48A 2V03A 3UJHA 5B7NA 2H7BA 4IJQA 4XCQA 1P75A 4AL1A 4G4JA 1PNOA 1VJGA 3OOJA 4X95A 4LSGA 2OLKA 4ILEA 3O6VA 1FR0A 3C41J 1AQNA 2ZJZA 1Z7WA 3G5MA 4RJTA 3MGCA 1MDBA 4GGPA 3ZYZA 1PG2A 4ZI7B 4QPPA 4JZKA 1TAHA 4HEA1 1IUNA 5HUQA 1A9SA 3K8ZA 4C20A 1G5IA 1R5BA 1I4ZA 1EUZA 2BBTA 5DNUA 2BGMA 4KKXB 4MO2A 2PNFA 1V8BA 4OVKA 3GLGA 2W8BB 1SBNE 2R6AA 3MTAA 1H2WA 4EO4A 3HYRA 3PPVA 5EN4A 2Z2IA 1BZYA 4EKEA 1W8DA 1KJIA 1EIWA 3AM1A 4RXUA 3T0IA 4I55A 2IP1A 4P32A 2F8LA 4EDFA 3MWYW 2EJVA 3ZU6A 4K6KA 3LE8A 1K2WA 2YN0A 3ZS9A 3GJ3A 4YV7A 4ECEA 4YJDA 1NKSA 2WIGA 4RORA 3HTKC 4PG5A 2VHCA 2GUWA 4Q7QA 5HKAA 4IUDS 1Z0SA 4G5XA 4U8HA 4EG3A 1SQ0A 1GN9A 3RTGA 1QRAA 4RA6B 3LXXA 1ORYA 1II8A 4MS4A 2QVGA 3V55A 2Y3GA 3R6LA 5ER6A 2XXAB 3JVDA 1I4WA 1TYBE 2PUCA 4R6XA 5EOVA 4N3AA 3FJYA 1Y3HA 3Q5EA 1Z06A 4GECA 2Y4NA 5FNVF 5BN3A 2YMPA 1Z4LA 3HWSA 4MA5A 4BP8A 5JSLA 2EIJC 1O57A 4NOLA 5SICE 5EJGA 1UZLA 4FDUA 1XZDA 1EK1A 3LZ6A 3CKKA 4ZEOA 5P21A 2REQB 5IVIA 1GUYA 4IB4A 3LLMA 4BNIA 1P29A 1Z9BA 2RCNA 2ETSA 2P62A 4P2BA 4AZTA 3GEHA 2W6CX 4YRJA 4D8TA 3GODA 4FE7A 3PPWA 5T7BA 3KIPA 5EP3A 3G88A 4KR7A 1Z75A 1KEUA 1KZYC 3HFGA 3EVTA 2MSCB 2W2OA 3QUAA 3AL3A 5T4FA 4KQEA 2Q28A 2XLVA 4WFKA 4NNPA 1Z4IA 1NNEA 4QM6A 2HV7A 3QH4A 3O91A 4MNDA 1P4AA 3TLGA 2XLCA 4FBGA 3U1TA 1QF9A 4M6WA 2GPJA 2V96A 4RGVA 4P86A 3KQMA 1TVMA 1Z0KA 5DBFA 3OU7A 4KRFA 1U1EA 5JVDF 2NP7A 3TSWA 2DBQA 3PA8A 2QOEA 4UFPA 3O8RA 1N6LA 2V5AA 3UMFA 1SEVA 1ARZA 3C1TA 4DF3A 5KYWA 4ND8A 3QX7A 2XCTB 5TS2A 5BQHA 4FYIA 4RSGA 2CNOA 1FNDA 5DEIA 1Q1GA 1ZISA 3RFCA 4DXDA 3JYNA 4OB6A 1HDGO 2CLFB 4TKZA 1ENOA 4RTRA 4A92A 1EEXB 4AQDA 1P19A 2ID4A 4U5EE 3HSKA 2B1RA 3S70A 2V6JA 4WBSA 3CX7A 3JQ6A 2XA9A 3PXAA 3AIOA 2XWSA 3RRNA 2DTEA 4AO6A 1RTTA 4TKUA 2C9YA 1OIWA 3RRMA 1A71A 3KHTA 1X74A 1YB1A 4QARA 1ZOLA 3FUUA 2CVHA 2KBFA 2H00A 1YCGA 1YA7O 4CCSA 1EVLA 1J21A 4UMVA 2Q41A 3B3AA 3VKWA 3EPRA 2G0TA 4BAGA 1ECPA 1WO8A 3DM5A 5I9MA 1E3TA 3RVYA 3SJ7A 4B7XA 2ZI6A 1P17A 2WIFA 3HZOA 2QT9A 3L0IA 4L5JA 3SYMA 1HY3A 4X1IA 3NIBA 3QPCA 2F90A 3FROA 4UKDA 3EQ6A 3DXJF 3H2VA 2NVUB 4IDPA 2D1SA 2B4AA 2VSOA 1WXEA 3PDHA 4QVIA 3U7IA 3RVZA 3IE1A 2AFHE 4HQRA 1UK8A 5CFMA 3OLQA 4I3GA 3NH6A 4ZGWA 4ZO8A 3PHBE 3T9FA 4J4BA 4HAIA 3OUZA 3C1UA 1T10A 4D4NA 4J2HA 4TKVB 2HSJA 3DJNB 1Z4KA 1BJTA 3ZDLA 2ZRCA 3N5CA 1E8DA 3OOHA 3ROFA 1YQ9A 2CDBA 2DVMA 5FOTA 4NQZA 4QJ5A 1N2IA 1ND6A 2PT9A 3ZHSA 1CDOA 4H0CA 3U7HB 2XTNA 1E6WA 4RFSB 2B4QA 1Z2OX 4NWIA 2IM8A 3HFSA 4BN4A 4YJ3B 1ECJA 4MB6A 3H19A 5KAPA 1GP2A 1ORWA 3TRHA 4FYKA 3NOVA 3OLZA 5JH7F 2WNHA 1JHMA 1Z37A 2R3SA 5DHSA 1X6VA 1SZDA 1KERA 1PTJA 1NQVA 4LYGA 3HN2A 3UMGA 4DR2B 1G8HA 2OZEA 4YCSA 1CJKC 2UZIR 3O4FA 4UPDA 4BB0A 5CAEB 4PBRA 4R0VA 3D59A 1E79D 4Q9HA 3A4MA 4BNTA 2QUHA 3RYHA 2DGDA 1Z15A 1USWA 2EX1A 4KI2A 1U7HA 1L5HB 3FUWA 4MKXA 4LRUA 3KZXA 5HHTA 1YRLA 3QLTA 1EEHA 4WSOA 4OHRA 1T5TA 2X8JB 2JAQA 2Q07A 4AZ3A 1EQUA 2PAAA 2B8EA 5DT2A 5DRYA 3D8BA 4N01A 2BCEA 4UHHA 2ZRPA 4TKMA 2Y0BA 1SZCA 5EIHA 4H08A 1Q1BA 2J6CA 4J9VA 4YJFB 3DC7A 1EA7A 1KHTA 4EQ6B 4WOCA 3EGXB 4H31A 4NBTA 2ZXFA 2Q7DA 1OW7A 1SH7A 3DTVD 3TBFA 4AS1A 1IN6A 7AT1A 4WV3A 1AJEA 2F67A 2P4QA 2WWGA 3U3MA 2BM9A 2QQFA 3AG5A 4AS2A 3K1JA 1SUWA 4OYYA 1QM5A 2AGVA 4LMPA 2IHNA 1Y8ZA 3WA7A 3K6SB 1RYEA 4YN3A 4NJEB 4O4LB 4HEAJ 2W98A 4BNDA 1GKIA 3CLUC 3KKMA 5COAA 3HGMA 1NXPA 3TTTA 5TDHA 2AOVA 4GEHA 5IC4A 3MT8A 3AFNA 4D82A 2VVTA 4D0SA 3E8SA 4Q9IA 4UU8A 2ORIA 4PPNA 5IASA 4KMSA 1MO2A 2K7ZA 2VDRB 1Y8CA 2HGSA 1VCIA 3V8EA 1TK9A 1QFXA 4WUVA 2PU5A 2I6UA 3NM6B 5FUWA 1NULA 1X7DA 2DFVA 3CQZA 1OIXA 2GXQA 2Z8YA 4KAAA 3JCZA 3EG9A 1WZCA 1W36C 1YMVA 4YROA 1FS4A 1FP4A 5CHYA 1PNRA 2Z4RA 3G79A 1R4TA 1VOMA 1C14A 3AVQA 3PD7A 2C7BA 2WJJA 4DNOA 3KVYA 4XGRA 4ZVLA 2HWUA 1IM2A 3NNNA 1A1SA 1CR0A 1Z4OA 5HMMA 5FFFA 1Z16A 2CL7X 2ZIAA 1QYXA 3ABKC 5IYZF 1D1CA 4ZOLA 3F8SA 4R1LA 2XRFA 1P1KA 2RIPA 4YJHB 1WUHS 4RVOA 3SXPA 3CM0A 3AHHA 1IY9A 4EA8A 1EX1A 2Q3CA 3EBLA 1TK3A 1E7SA 2B61A 4M1EA 1AK1A 1ODCA 4GPD1 1KAQA 2AG5A 1WBDA 1SOAA 2CLMB 1V5WA 4RGYA 4QI0A 1NVUQ 1W2HA 3GDGA 3HJFA 1V45E 2FMKA 2BH2A 3UHAA 1YMUA 1MFZA 3PEVA 2H3EA 3MJHA 4GVXA 4OIPF 4EYGA 3H9EO 1MMNA 1MMGA 1YTUA 3BCSA 1J42A 3C7DB 2H7YA 3HACA 2WU0A 4BFVA 3IBCA 1A9RA 3GP5A 3E9ZA 4L16A 4FC7A 1OCCC 5G1NA 4PGGA 3RKSA 1T26A 1QGOA 1EP2B 4XQCA 3QE4A 2E1RA 4LZZA 3NC4A 4R7TA 2IUTA 4FGKA 2QJOA 1C7FA 2PKEA 3VZCA 1QIKA 3DF9A 3P2OA 5EESA 1M6TA 4M9UA 1GTG1 2OGSA 4F4HA 2FE1A 1G4UR 3JAMA 4HTAA 3HZZA 4YJ2B 3U1BA 4IO1A 2RGEA 5CX4A 2WWWA 4HVCA 3QGMA 3N5KA 3SDSA 4RANA 1V7PC 5DSTA 2CHGA 5TRTA 1TVEA 1FDWA 5F35A 1Z3IX 2FKAA 1DCFA 1XKXA 2HZBA 1XZHA 3CRW1 5E7JA 4O2AF 4DBQA 3WTCA 3PSAA 1THZA 1TIBA 2DUMA 3CONA 1IXRC 2P67A 4JLKA 5K7SA 3WYGA 3I12A 4DQVA 2WINI 1GQYA 4DOZA 5A05A 1M2EA 2L7AA 5EK0A 3GWLA 2P4SA 3TH5A 1JFSA 1AF4A 4ODIA 3PXCX 2H4ZA 2ISCA 2EPNA 1L3CA 4A5SA 1N1EA 4CCAA 3LSYA 3IOCA 1Z18A 1GRRA 4E3ZA 3ZTMA 4KUGA 4WY2A 2XODA 2MDTA 4G1BA 1RXQA 5KHLB 2O06A 2XDYA 2GM3A 2GFIA 3H42B 5PNTA 2BE5F 2BJWA 3H9UA 2DPMA 1BVYF 2P9CA 3MAGA 1DCKA 1RAAA 2C54A 1SIBE 5DGHA 2FEAA 2I2BA 3L8YA 4YJWA 1JAIA 1LBIA 2PL9A 5JYEA 5TY0A 3UFBA 2FPSA 2OZLB 2Q1TA 3ROXA 1F48A 2HK6A 1O4WA 4I66A 3VYSB 2ONZA 5C8XA 3OM9A 4XX1A 3K9BA 5D3KA 4EI8A 4MHSA 3PVSA 3U4GA 1JHAA 1MEEA 2DOKA 2R03A 3LGXA 3KJXA 2RFLA 3BDAA 4P9NA 4Y0NA 5IZCC 4RMHA 2YEVA 3FKSA 2ANCA 3D7LA 1I5RA 4IG4A 4UVIA 1RHMA 2NX2A 3HYLA 2BN4A 4KFUA 3FUTA 4CW7A 4QICA 1EGQA 1Z35A 5J59A 3OEEA 2C1EA 3ILYA 2RJOA 3UXEA 1RD4A 4F97A 5AJXA 2G9QA 1U04A 1DKUA 1IW7F 1WV1A 3ZE9A 4WCVA 2R7KA 1JEYB 1Q44A 3PXDA 2RGUA 4TWZA 1YR3A 5DJ5A 5ECDA 4C0JA 2P78A 1B26A 5G02A 2MSEB 4KQ9A 3D3WA 2PZMA 3A2NA 3N2EA 5ALVA 3WQRA 2PFKA 2FX3A 5IXJA 3E0QA 2QY9A 1KYQA 4RD3A 5FBHA 3D8UA 4EY5A 5P8WA 2BFCB 3KUXA 2H1VA 4CEJB 3BGVA 1OZAA 2JFXA 2G9VA 5BV8A 3PSHA 4C4AA 4P3YA 3A6GA 4ZOCA 5TVKA 1O6BA 3U61B 1G21E 3CH7A 4HH0A 5NLLA 1T5HX 4IRXA 2NLOA 3QE3A 5ADWA 4IIXA 2QW1A 4TWBA 1ZAKA 3D4NA 4GLBA 5JAPA 5C5EA 3H1FA 5T64A 2FMIA 4H0NA 2ZJAA 3WOHA 2JLWA 3TVTA 4V1CI 5HUJA 4XYBA 3JV7A 2RMKA 1LEHA 1YZCA 3I2HA 4BBJA 4Q4JA 4QVGA 1U8FO 1VCNA 2OO7A 3WHNA 1CZOA 3PE3A 1OT5A 3WY9A 1MV8A 3VR3D 2WABA 2HOQA 3I83A 1F3OA 1ZK0A 2RCYA 1DHRA 1FNBA 1VPEA 1UMBB 1V3QE 3TQFA 1MBZA 1MB2A 4PJNA 3U1VA 3T4XA 1DLJA 1IM5A 3DAHA 5EI5A 2PT5A 3UMMA 3EDRA 1OR8A 4CTJA 1ZHFA 4INJA 2CVQA 1F60A 1HL3A 2IC5A 4F6RA 4YXWA 4QOEA 1APBA 1F9AA 4I1OB 4WNAA 1GZUA 1CS0A 5CLIA 1Q12A 4W9MC 5K8TA 2VRNA 4PLCA 2JW5A 1UBJS 3RREA 1DRJA 1GSHA 1GTSA 1WHSA 2EFYA 3WL5A 2Y66A 4PAGA 2RJNA 2RD2A 3EW7A 1N2CB 4I1RA 3MA0A 4FBMA 3RVRA 1M0TA 1BD4A 3C3MA 5ALLA 1ZZPA 1SURA 3HWRA 1XL1A 3TK0A 3WNBA 2MOKA 3EIOA 4IR7A 3G82C 4UVDA 10MHA 1E32A 2O2CA 2O8EB 3IEVA 1NXQA 1L7VC 2ZQZA 4RF4A 1PSZA 4UHBA 2FP4A 2YXDA 1YFJA 1A9ZA 3PPIA 5I8WA 1RHRA 5A5EA 5I9TA 1GYPA 1FFXA 3ND9A 1TX4B 2AJ8A 2C5SA 3RQEA 4DV6B 4RL6A 3ESZA 5CEFA 3KJGA 4CQMB 4D9GA 4BJ1A 3F4KA 3DE6X 2C92A 3VAYA 4CWAA 1OW6A 1T5BA 2VWHA 4DM7A 2GHTA 2FZGA 5KWJA 3I6MA 2CBGA 2YOHA 3GEBA 5KVCA 3C18A 3ATPA 1FJXA 1U89A 2XGOA 4B7UA 1A4XA 5KNDH 4LNHA 4IIUA 1SD5A 3D43A 1ZA1A 4YC7A 1JI3A 2ATXA 5AICA 2PBEA 5CT4A 2HKVA 2Z56A 3Q72A 3NQ41 3AJ8A 2FR1A 1LW6E 2OQIA 1NJFA 1EI9A 3M5PA 3HJBA 1DOZA 1A0OA 3SQLA 1JDJA 2GVNA 1B00A 1BMFA 1KFCB 4FEGA 3UXHA 1EU1A 3OPXA 4DLLA 4EHHA 5A5GA 4X1KB 1L1EA 1ULSA 4CN8A 2FB9A 1J90A 2HLHA 3LBNA 3TPFA 1X8JA 3FLAA 5DNAA 1K6MA 1OKKD 5I9NA 3SZOA 1XZJA 3VZQA 3L05A 1R0LA 1KR2A 1J8MF 3QBJA 1QB8A 5EZSA 3WLTA 3ZI0A 4HLUA 5CX1B 1DJNA 4KBFA 4X84A 3I52A 1J24A 2PH1A 4BO8A 3LGAA 2VDMB 3W6OA 2JJMA 3AW9A 3AESB 5IP5A 3CN9A 4WZBA 4PLHA 3WK4A 3ECSA 1E2JA 2XECA 1P81A 1SC4A 2RHJA 1XRRA 4LPKA 3PCRB 2VYND 2ZRDA 1L5ZA 2VNJA 1UK9A 4KQFA 4URHA 4IIYA 4BEWA 3CEHA 1BCSA 1UEXC 1XTUA 4BP9A 1D0XA 4B3CA 2JG3A 5BOSB 4GPIB 1CRZA 1QP8A 5IBPA 9ABPA 2Z8YM 4E2ZA 4GOKA 3IQ5A 2B30A 1KOLA 2J85A 1M76A 3L5OA 5DKFA 3UT6A 4A16A 3N86A 4C22A 1KC1A 3RYCA 2C7OA 3HSYA 2YRWA 1H66A 3QU4A 3VQTA 3T7EA 3BEHA 2L18A 3IEPA 2GEFA 3HU1A 2O2HA 4DV0B 4LKOA 1TUGA 4LZOA 1Y1KE 3AQBA 3JYHA 4O8ZA 3W8HA 1QCYA 3U19A 3EBOA 3QU7A 1PT8A 4FX2A 4X24A 3GJRA 3OFSA 1R64A 1XZPA 3DKPA 1KPHA 4WE3A 2XNDD 4DLRA 4CMIA 1M75A 3ZD8A 1SZPA 3V7NA 3WMGA 2RHLA 1KYIA 1ZSVA 4CU2A 1Y1LA 2Y6UA 2XAAA 3W6NA 4QWMA 2ZBFA 2WA2A 1AGXA 4ZCMA 3CX8A 3ZGXA 3C16C 4MQ4A 3LTNC 4QXAA 4NU5A 3V1YA 3Q8MA 4TSFD 1NDQA 3BT7A 2RH5A 5EP4A 4UE2A 3B7GA 3L6UA 2FXIA 3HRHA 4OJKA 2UDPA 4MR8B 4Z4IA 4W7IA 4FDTA 1S3IA 2CMHA 3CR3C 4IDDA 3NCTA 4KN8A 2WF6A 5IEBA 4JENA 1M2KA 1FLDA 4DG9A 1M8JA 3MQ2A 4EF6A 1J07A 1G7SA 4J4HA 1FDVA 4HQLA 3PNSA 3S7ZA 3HCDA 3K70C 4D92A 4OK5A 5AVKA 3LUKA 5EHHA 4IMIB 4N5DA 1QBKC 1G20E 4PWYA 1YCDA 3KPHA 3GPBA 2YOGA 2BGGA 3LS1A 4YREA 3TKAA 1HF3A 4XE5A 2XKJE 2D5RB 3I72A 4COKA 2KX7A 1XMOB 2QYTA 1RP1A 5E9QA 3IHKA 1A77A 3BTVA 4DEVA 2YHSA 1IZ7A 4C3UA 1EZ4A 5E2QA 4U2GA 4ZDKA 3DCIA 1KA9H 4ANFA 1O6ZA 3IR7A 5F4BA 2C4WA 4BMYA 3LIPA 3LT4A 3TD7A 4MEJA 3SSOA 3GELA 3GFGA 4OG2A 5KEIA 4MA0A 2O8BB 1FVFA 4J94A 5AKYA 2YWHA 1ZR4A 1F7UA 2J59A 4WOPA 1OILA 3SC2B 3T5TA 2PH3A 3K33A 2Y68A 1LJUA 4G0WA 4DCOA 4EAQA 2PYZA 2UUCB 2QSZA 2AWOA 2Q0XA 5HQJA 4GMKA 4BNNA 3OCVA 1KVTA 4LTNA 4BWFB 3MINB 5EXSA 4HKTA 3A04A 1VKHA 3U44A 1TF5A 3M5WA 1YZ3A 5HCNA 1PW7A 2Q2VA 1DRUA 1YZGA 2Q2WA 1JIKA 1QVVA 2XL4A 3E7PA 3GRVA 3RCBA 3LY9A 4K87A 1UR5A 4EHFA 4Y6RA 2JF0A 2NXNA 2VC2B 2JK0A 3W8FA 4TTSA 3PGKA 1EJBA 4F1KA 4LHZA 1YHZA 1IZZA 1WOLA 4PJJA 3LQFA 3QBVA 4TV8F 4C2AA 1A50B 1D8AA 3TOVA 5JALA 3U9TA 1YBMA 4AY4A 2FW9A 3ZTWA 3MB5A 4WKCA 4B5KA 3ETHA 2YY7A 5ESWA 4LYYA 4YYEA 1K88A 5KWSA 3AMVA 1G8GA 3OU6A 2KE5A 3NPMA 3MHPA 3EXEB 1Q3HA 3IVAA 2WF7A 2XCUA 3KOOA 4AX8A 3L9WA 3X1KA 1RVV1 3FR7A 2BEVA 5F3WB 3LBHA 3AKZA 3EZHA 1V8FA 2Z1NA 3IUSA 1POWA 3IGFA 4XAQA 3WLJA 3QELB 2CJPA 1YDFA 2AN5A 3IOMA 3LX6A 1RM3A 2Y1DA 3PEEA 4G84A 1CJSA 4PBSA 3LEOA 1FXWF 2XQGA 3N7UA 1CK4A 3D8HA 3K15A 3Q0IA 2ERCA 5KTMA 1T0HB 2YR0A 2J3EA 2FWBA 3TSOA 4GDFA 5CLHA 4C3ZA 1K86A 4EUHA 3MTGA 4KLZA 1VZ2A 3FPLA 4JNCA 5F73A 2IYAA 1ZM9A 3TAUA 3DKAA 2NAFA 4EUSA 1VG1A 2QRVA 4WLVA 2QXYA 2Y3HA 1H4QA 3N70A 1ACJA 3FI9A 4DAOA 4A2CA 1JKIA 4CIVA 4LWPA 4XWKA 3OCCA 2Z2ZA 4EMSA 4D8XA 1M2GA 1I13A 2I3AA 3CRNA 3TLYA 3LBIA 1VIAA 3U7JA 1FTNA 2IUUA 2RGNA 4PG8A 4YA6A 4X91A 3JRNA 1EGHA 4EMBA 3AM4A 2KWIA 3FMVA 4RVGA 4DMFA 1MJ5A 4CMGA 1A2OA 5E4YA 1BJKA 5HOEA 3H1GA 4IV0A 1BROA 5DX8A 4H6XA 1U1CA 2O2ZA 4B48A 3K2IA 5COGA 2ISSD 1HURA 1W36B 3AUKA 4H3SA 2NV2B 1AN9A 1CZUA 1NLMA 3EFHA 2XF2A 2F8SA 4QGGA 3CVJA 1PK7A 4RTJA 5FP0A 4FFMA 4I50A 4KE9A 1K40A 1T0JB 4B33A 3FKJA 3NC1C 4QXOA 2IXAA 1DC7A 2QN6A 4IX1A 4A1FA 1O96B 3TAHA 2PSEA 4C6HA 4DZRA 5LBUA 1CQIB 2EZTA 1PDVA 1CUZA 1CB7A 2FOIA 2XMBA 3PNVA 5AW1A 2IU3A 1RCTE 1C2YA 4HF7A 2FDCA 3OLWA 2AR9A 4EB0A 3PTLA 1P62B 1UBMS 2P7IA 3MILA 5AJHA 1NX6A 3CCBA 3R7CA 2ZAIA 2VYFA 3D2LA 5E7MA 2WWVD 5F3DA 1XZMA 5AJTA 4HQOA 3QJ5A 3FNRA 1SK9A 5LXTA 1U9JA 3I9V6 1VB3A 1PJ4A 2A6HF 5C8VA 3EJ6A 4LBZA 3KU1A 4DLVA 1RXVA 3U4CA 2YYSA 3VKHA 5L45A 1UMDB 3QVGA 1SD2A 2DFDA 5EL0A 1M8PA 3KDPA 4MJLA 2JH9A 2P2LA 5IJ9B 3TQOA 4J16A 4IEIA 1TB4A 5J3JA 2D4AA 4DZZA 3D9QX 3G0IA 4HMPA 1QO9A 3C6KA 4XUEA 3QSGA 1UM9B 4IJUA 1W7AA 1XZLA 3KYBA 3RLFA 1PVOA 1E85A 1ZH8A 1XTRA 1WE2A 1C29B 1XRLA 1FLNA 3W06A 4BO5A 2CV2A 3E0XA 2YW2A 3T5GA 4IDBA 1F4VA 2UXBB 4C87A 3NCHA 3K1TA 1P2FA 1ZG3A 2Q50A 4N8EA 2GPTA 2KI5A 1IATA 2BWJA 2RGDA 5CT5A 4Y1GA 4NCBA 5KVAA 2QP9X 4DCNA 5EJ2A 1MXFA 3L7AA 3L84A 1H5NA 1XWJA 4F2PA 4JR2A 2AXQA 5GWXA 1WASA 1IWPB 1M1UA 5T41A 1KZ7B 1N3YA 1YUMA 5CFOA 4GT1A 4MGZR 4NMLA 4NULA 4N03A 4G0OA 1ZJZA 3DVQX 3RIXA 4R2HA 1UXOA 3EXIB 2ZBEA 3G5TA 4U8GA 1PTKA 3F97A 1G2OA 4S05A 2OCAA 4BLOA 4TTQA 2VPZA 2FUG6 4DMMA 4OJQA 4L8GA 1RIIA 5EHIA 5DI3A 1NZEA 1FJGB 5KWIA 1ZGAA 3I76A 4HDAA 3NYJA 4E46A 4G09A 4YMGA 3EVCA 3QA9A 3BSFA 1UPCA 2O05A 3K09C 3RIHA 3NIGB 2M9MA 2HV9A 3OQVA 1TJNA 3AUJB 5D3ZA 4OX9B 3BZBA 4PLYA 2ZREA 1EDZA 1XRQA 3DE8A 1AGPA 1BXKA 1T8TA 2XPCA 5BNZA 3G0CA 2RGAA 9GPBA 1H42A 4NX2A 1A7AA 5EJFA 4DPMA 2VHEA 4X3CA 2OCKA 1ZRSA 5T3TA 2G83A 1FY2A 2JFGA 4UUAA 4CBVA 1MB4A 2PD6A 1KK2A 2D4UA 1X80A 1W5BA 5TPZD 1YYJA 5LIPA 2PVPA 3LDFA 1U4SA 4MICA 1W93A 2Q1WA 3OZGA 4M0UA 3WGGA 3BCHA 4RM2A 4N82A 3AFIA 3ZDDA 4L9RA 3TJRA 3I39X 4O08A 1TQ6A 3VC2A 2R1VA 2HHHB 2GPBA 3WHKA 5IS2A 4JMPA 2BONA 2ZJ7A 1NG1A 3WRVA 5HTOA 4TUYB 2V98A 3LFHA 3RSZA 9LDBA 4KWEA 3OPMA 4U2CA 1GN8A 2I91A 2HIAA 3EVBA 3HI6A 3V7UA 2WP8J 1LDMA 3JT1A 1I80A 4TXMA 1RU3A 3IBGA 5BURA 2WU8A 2W2NA 4E5VA 3S1SA 2RKWA 3M1YA 5CLGA 2QGZA 3CNEA 1PZGA 1MIOB 2GJ8A 4NOKA 4GDMA 1F2TA 3S1AA 3OOSA 4G0XA 4FJ0A 3JSXA 5LJIA 5KVQA 3QPDA 3SN6A 3HBAA 1JKJB 1P4RA 3FUXA 5IC5A 1DELA 1DIBA 2HNAA 4E5NA 4YEDA 3GDWA 3P9ZA 4RZ2A 1XZQA 4Z9YA 3NR2A 5FBRB 3R7BA 5G3ZA 3GEPA 3NLLA 2EDAA 2QTLA 1HE4A 3SC6A 1UPFA 2CDRA 3FGPA 3P96A 4TV9B 2MJLA 3KQQA 4DOMA 1KVQA 2O4CA 1NATA 4DV4B 3O4GA 2V4UA 4PZAA 2YWAA 1O4VA 3DMPA 4YT8A 3O4HA 1M72A 2ZRIA 3O73A 4BNMA 3CLTD 4J0QA 3TM4A 2HXYA 3KBBA 3T3PB 1FDOA 3BH0A 2WHPB 3ZNQA 1V48A 1KNXA 3UAGA 3FCCA 4JEUA 5DMHA 3MMZA 5A9SB 1TVCA 4INZA 3G2MA 3GRZA 3W05A 2L19A 1LC0A 3WLPA 4YP5A 1U6JA 3KWMA 3P32A 4DUGD 3TI7A 4FZ5A 2NUPA 1T8PA 4QQ8A 2RI0A 1NE7A 1Z6AA 3BK1A 3S0JA 3O4IA 1XKLA 1VE3A 3LRTA 1TA9A 1I7SB 3TRJA 1M1YE 1FFTC 2CMFA 4G1MB 1A7KA 1UMCA 5B53A 4Y2JA 5L6MB 1XYYA 2HDHA 4YR7A 1T8YA 3AEXA 3LP8A 5EY5B 5BSEA 1Z6TA 3G02A 5DLPA 2N75A 5LP6F 2HU8A 3DFZA 3H5NA 5IBRA 2OCXA 3HJTA 3FPSA 1USKA 2CD9A 4R8LA 5A03A 4UBOA 2NYVA 4KE7A 1GDTA 4ASUA 1KJ9A 1F5SA 4LJ9A 1U7UA 2ZJOA 1JFVA 2V7PA 1JAFA 4YGYA 3RYIB 1PL8A 1IHUA 1EXNA 5BW4A 4MPJA 5BW6B 2VJMA 5F2KA 4R1OA 1D4FA 5KTRA 5T4BA 3AF6A 4X61A 2C8JA 2CNWA 1O97D 1UKAA 1H3NA 3BE8A 5BMVA 4Q39A 4LRQA 3VJMA 3QBDA 1ZIPA 3U8PA 1CDZA 3I45A 4J0KA 2C0QA 4TS9A 2J4FA 2J33A 3DFKA 3ENZA 1XB2A 3DZIA 4K6OA 1ST6A 1KH2A 2GD2A 2YYZA 2ZCUA 2CCKA 2VQEB 4DV5B 3EGDA 4R9VA 3IUBA 5BUCA 5JADA 5BY2A 2WYUA 5IAAA 3MAAC 4AW9A 2XRMA 4R1QA 1RRKA 1UDWA 2J9XB 2QGFA 4K9OA 4LCJA 2GN4A 3O94A 4YL3A 1JJAA 1SG0A 1B68A 3OY2A 4GWLA 1AOXA 3VAZA 1SCJA 2G7MC 5A6JA 5CPFA 1I7QB 2E2WA 2VRCA 1W0KD 2XQIA 2O8CB 3FZEA 1UIRA 1LTHR 5KHAA 5FPKA 1T2FA 3QZCA 4R31A 1MV5A 2WJWA 1NVTA 3CPHA 5DOVA 2NVBA 1YUBA 5LP1A 5EA2A 4LTMA 2WJ6A 3W5CA 4YAIA 2AK3A 2HUJA 1H69A 3WHIA 1QH1B 2YJZA 3MMXA 3EWIA 1A8IA 2ZD9A 1KQPA 3UKJA 3W9UA 1W9MA 4YS6A 3CF6R 4DUZB 2NZ8A 3GLSA 5A5VA 2DFNA 5FWXB 3PYMA 1F5NA 5D7BA 3KQPA 1C7IA 1R5NA 3KLNA 1M0SA 1OAOA 1OBFO 2LW7A 4JVSA 4I5GA 1LF0A 5TEVA 2DLDA 3TB4A 4XFDA 4WVFA 4FW9A 1HDYA 2IH5A 4JT4A 4FWVA 2H4HA 4FFRA 1OLUB 2RSLA 2N47A 5JDCA 3S99A 3FOAA 5F9FA 5FR1A 1S89A 1S7CA 3IPLA 5CDYA 3H4IA 3E23A 1A5AB 4GOJA 3LKZA 1WD5A 4FCCA 1O94A 3BXGA 3KE9A 5F78A 1Y1QA 2C00A 4GYYA 5COBA 3EGEA 3K2EA 4QHYA 3ZVKA 5FADA 1WATA 1EINA 1SRRA 1PS8A 3ZHYA 5CP8A 4Q9LA 2YS7A 5HIKA 2A33A 2H7VA 4LJKA 1ECLA 4DBLE 1ILWA 1Z0ZA 1L0BA 5EZYB 3FF1A 4A2NB 4O63O 1Z3CA 3MFYA 2CZCA 4JI5B 3GDOA 5C37A 2HBRA 4Q9DA 2JCVA 1XKQA 4DIFA 1VHTA 3OTGA 2Q8NA 3SC4A 2OE2A 5C51B 4G0VA 3WL6A 5LB4A 4TXNA 1FMCA 3JYLA 1CGOA 2J0SA 5LUBA 4N0MA 2A5DA 5EJ9A 1D1TA 4MRRA 2XCSB 5BR8B 1T34A 2BGRA