4KNWA

The crystal structure of human hdhd4 in complex with magnesium and the phosphate mimetic vanadate
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
239
structure length
239
Chain Sequence
b'SRVRAVFFDLDNTLIDTAGASRRGMLEVIKLLQSKYHYKEEAEIICDKVQVKLSKECFHPYNTCITDLRTSHWEEAIQETKGGAANRKLAEECYFLWKSTRLQHMTLAEDVKAMLTELRKEVRLLLLTNGDRQTQREKIEACACQSYFDAVVVGGEQREEKPAPSIFYYCCNLLGVQPGDCVMVGDTLETDIQGGLNAGLKATVWINKNGIVPLKSSPVPHYMVSSVLELPALLQSIDC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N-acylneuraminate-9-phosphatase
publication title Design, synthesis, functional and structural characterization of an inhibitor of N-acetylneuraminate-9-phosphate phosphatase: Observation of extensive dynamics in an enzyme/inhibitor complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 84
structure length 239
sequence length 239
chains with identical sequence B, C
ec nomenclature ec 3.1.3.29: N-acylneuraminate-9-phosphatase.
pdb deposition date 2013-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.710 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4knwA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4knwA01
3M1YA 4I9FA 1L6RA 2JAOA 2PQ0A 1U02A 3I28A 2CN1A 3U7HB 5AKYA 1T9ZA 3ZTYA 1YJ5A 5AKIA 2O9JA 5IS2A 4EZEA 3WGVA 2YMMA 5ALXA 4AP9A 3SKYA 5ALKA 1IWOA 5ALLA 1RMTA 2BDEA 2RARA 4RETA 5AI8A 3TLMA 2WFAA 2ZBFA 3AR7A 3W5BA 5ALDA 3QNMA 4XPZA 3KBBA 4Y2PA 3WK6A 3E84A 1L7MA 2IA5A 1L7PA 4BNDB 5ALGA 4Y2XA 5ALIA 1QQ6A 3R4CA 2I6XA 3BA6A 2RB5A 4E88A 1RMYA 3CNHA 3U7FB 4IG4A 1AQ6A 4EENA 2YFYA 1WPGA 3UMCA 3OCWA 1QH9A 2W4MA 2IOFK 4DWOA 2P69A 2YJ6A 3WKBA 2DQSA 5AKLA 2HF2A 5AKEA 1F5SA 4UMDA 1YNSA 3QUTA 2ZBGA 1Z4IA 2WF7A 3QU2A 2D2VA 2Q4RA 5AW3A 2YMLA 3AR2A 2Q5EA 1Z4JA 3E81A 2JAUA 2FI1A 1Z88A 4I9GA 1NNLA 4UARA 4KX3A 5AK5A 1Y8AA 4HGPA 5ALMA 4HGQA 2FEAA 3VAYA 4B6JA 4UU0A 2GHQA 3ZW7A 4C4TA 3W5CA 1CQZA 5IT4A 2MSNA 4YCNA 3SKXA 2BDUA 4BYGA 3GYGA 3RFUA 2YJ3A 1RDFA 3QX7A 3OCZA 2GHTA 1MH9A 4XE5A 3L8HA 4YIHA 3R09A 1U2SA 3MN1A 2CFRA 3FPBA 2I33A 3EF1A 1Z5UA 3WGUA 3NUQA 4L6CA 5AVSA 2YMQA 4UAUA 1ZJJA 2AMYA 1J97A 2WF6A 2OA0A 2YBDA 3QXGA 2YJ5A 1U7OA 1L8OA 1SWVA 3DNPA 3ZVMA 3UM9A 2BY4A 4GXTA 5ALFA 5ALSA 2EARA 3QU5A 3NASA 2EAUA 4JDPA 3SF0A 5AW8A 3ZVNA 4UATA 3OPXA 3FM9A 3MMZA 5AVUA 3UMGA 1ZD4A 3AR6A 2WF9A 1QYIA 2NO5A 1RQLA 3QGMA 4HYTA 1Z4LA 2IYEA 3NALA 4L6AA 5AKZA 3I76A 2HX1A 2G80A 4F71A 4Y3UA 4NWIA 5AM5A 2B1QA 2JARA 4FYPA 3A1DA 2G1AA 5AW2A 3R9KA 2IOHA 2I34A 1LTQA 2QLTA 5AVWA 3WKDA 4OCZA 2GO7A 5ALZA 4EELA 5AKHA 2YN4A 1RRCA 2VKQA 3OCYA 2W43A 4NV0A 4DCCA 5AKGA 4BEWA 3U26A 1RKVA 3ESRA 3ZX5A 4Y2UA 1FEZA 3F9RA 3KDPA 2HF7A 4JB3A 2B30A 4UMVA 2G07A 2B0CA 3AR8A 2R8XA 3ESQA 2YMPA 5AKKA 2B82A 5FP0A 5AHXA 2RAVA 3N1UA 3WK9A 4G63A 4BBJA 2YJ4A 2ZBEA 5AESA 3A3YA 4CNQA 1TE2A 2FDRA 1XPJA 3DV9A 3ED5A 4ZEVA 1XVIA 1TJ3A 5AKJA 5AW7A 3D6JA 1LVHA 2C9MA 5A3SA 4CF3A 3CZ4A 2FPXA 3WKEA 3ZVLA 4F72A 4QQFA 4UMFA 4BEVA 1N9KA 2YY6A 2I54A 4CF5A 5AI9A 3L0BA 1Z5GA 2FPRA 4HAIA 1RQNA 4Y2YA 5AM3A 1Z4MA 2JGAA 1K1EA 4ZEWA 5AVQA 2HO4A 1TJ4A 5AVYA 3I6BA 3FVVA 2B1RA 1PW5A 1RC8A 1TA0A 3WK8A 2QYHA 1Z4OA 1S8OA 4UM7A 1YMQA 1TJ5A 2ZBDA 1WR8A 3NRJA 4C4RA 1O08A 1SU4A 1N8NA 3NANA 3W5AA 3ZI4A 1RLMA 1Q91A 2AGVA 5AM1A 3B9RA 4PNHA 1YS9A 3AR9A 1RLTA 4G9BA 4UU1A 5ALNA 2C8KA 3WKCA 1Z4KA 2WM8A 4AS3A 4DW8A 1L7OA 3MPOA 3PCTA 4NAVA 3ZU6A 4CF4A 2R8ZA 2AUTA 1RLOA 1T5SA 3IJ5A 3PGLA 2I7DA 2P27A 1ZD2P 2HOQA 3BWVA 5IT0A 3L0CA 2GFHA 2FUEA 4UASA 1WVIA 5ALYA 2G08A 4GIBA 5AM2A 2EATA 3E8MA 5AVVA 3U13A 3L8FA 4KNWA 2NYVA 5AVZA 1CR6A 1RKQA 1ZOLA 3QUCA 2MU1A 3M9LA 3AR3A 5AW9A 1YV9A 2P11A 3KD3A 4BNDA 5ALJA 4FE3A 4FFDA 2AH5A 2Q4TA 1VJ5A 1T5TA 1SWWA 2OBBA 3ZWDA 4YCMA 3RF6A 3PDWA 3QUQA 4MWOA 4BX3A 4OD0A 2R8YA 5ALQA 1ZS9A 3L8GA 4HGRA 3MC1A 4CE6A 2I55A 3FGOA 5AKXA 5ALOA 2PR7A 2HEGA 2WHEA 5AVXA 3SD7A 4ZEXA 3WK7A 3L7YA 1ZD3A 3A1EA 2ZOSA 5AIAA 3UMBA 5ALEA 2P9JA 3U7EB 5E0OA 4MUMA 4QJBA 1Z4QA 4BKMA 5AW0A 3NAMA 2OYCA 4KYTA 2CFSA 4NFLA 4Y2JA 2FUCA 1U7PA 3EWIA 3ZUPA 3AR5A 2OM6A 4UM5A 3SLRA 4EX6A 1RPZA 1YDFA 4Y2VA 1J8DA 2PKEA 5AI4A 4NABA 3SHQA 2C4NA 1O03A 3KC2A 3FPSA 2RBKA 3N07A 3U7GA 5ALHA 3EF0A 4KNVA 4KX5A 4UMEA 1U2TA 1VFPA 1EK1A 1ZRNA 3QLEA 1S2OA 4HGNA 4YCLA 3QU4A 4KN8A 2HI0A 1RMQA 2ZG6A 5AVRA 1NRWA 5ALUA 4IFTA 2FPUA 3B8EA 3DAOA 3HLTA 4Y2QA 4UAVA 3AR4A 2G09A 3S6JA 1RKUA 2B8JA 4OFZA 3ONNA 5AM4A 5AW1A 5AIBA 4YH1A 5ALVA 4DFDA 3B9BA 1Z4PX 3QU7A 2NO4A 3IRUA 5AW4A 3KOOA 1ZRMA 3OCXA 1X42A 2JAWA 3ZWKA 4J2TA 4O8CA 4BX2A 5JJBA 3J7TA 3KZXA 3OTQA 3QU9A 5AVTA 3U19A 4L57A 4YIKA 5AW6A 4XOUA 4EX7A 1VJRA 1QQ5A 3FZQA 3ET4A 2W11A 3L1UA 3L8EA 4XQ0A 1L8LA 3QUBA 5ALRA 3OCUA 1L7NA 1Z4NA 1NF2A 5AM0A 3NIWA 5AI0A 2B8EA 3N8GA 2GMWA 5AI5A 5AW5A 2HSZA 3N28A 4Y2TA 2CFTA 5ALWA 2ZXEA 5A3RA 5AI6A 1QQ7A 3SMVA 3OCVA 1EK2A 3ZTWA 4HGOA 2X4DA 2FPWA 5AK4A 2HHLA 3ET5A 4EEKA 2C88A 2WF5A 3L5KA 3E58A 5AK6A 3ZX4A 2G06A 4YGYA 2ODAA 3IB6A 4RESA 4BX0A 2C8LA 1ZD5A 4H1WA 3DDHA 3EPRA 1KYTA 2HDOA 4OHFA 4AS2A 2O2XA 3L0YA 5AK3A 4C4SA 5ALPA 2WF8A 3L1VA 3W5DA 3K1ZA 4Y2SA 3I1YA 3P96A 5ALTA 3WK4A 1WZCA 2R8EA 3A1CA 5A3QA 4UW9A 5T41A 3WKAA 4J03A 3WK5A 2G0AA 2HCFA 3HYCA 1XP5A 5AICA 2FPSA 3PGVA 1Q92A 1JUDA 4Y2RA 3N5KA 3QYPA 2IOFA
chains in the Genus database with same CATH superfamily
2VUHB 2R7NA 5EPOA 2OCIA 3GM2A 3H5NA 3Q0EA 4UHFA 1X92A 1Z15A 2FEXA 3ZNOA 1UBGA 3O3OB 1M1XB 4IDNA 4KV7A 5C81A 4WXHA 4DQUA 2F8MA 1I3NA 5I3ZA 1IWOA 2VDQB 4LAFA 1RMTA 4WDRA 4BASA 1R9JA 3C6XA 4WZBB 4LRYA 5CNKA 4E21A 1E3SA 4Q39A 3URMA 3T4UA 4S24A 4N3NA 5JZOA 1UPTA 2Y4OA 4X8MA 1XZIA 3L46A 4LK3A 4MV6A 3DE5X 4PHTA 4E88A 4HNUA 2PQ2A 4IQFA 2PH7A 2G77B 3RS5A 4UMDA 4B3TB 4EHKA 3GEMA 4RIIA 1A27A 3TNYA 2Q4RA 3ZOKA 5FPTA 2KSQA 4DCNA 2Q5FA 3GA7A 3C3WA 4KPGA 721PA 1B8NA 1C1XB 3RVNA 3BN3A 4JWKA 1I24A 5JROA 1YDIA 4G89A 3SKXA 2VCEA 4ZIRA 1CWUA 1ZA1A 4A8PA 4F9FA 2R60A 3PC4A 3IQHX 3D8UA 1PDOA 4QECA 1V11B 3W2FA 3DP7A 2YJ5A 3KS9A 4YNBA 3L0IA 2ETSA 3AHJA 2ZRCA 3V4OA 3VR1A 5LQJA 4YRNA 3LW7A 2NWQA 4UDXX 2ZVQX 2RHOA 2CHVA 1ZCZA 2HO5A 3PA8A 4ZANA 9LDBA 3C1TA 1UADA 4TGLA 5AKZA 1N3LA 4YHBA 4IDEA 3FKQA 3THSA 3N7UA 3PT5A 4OOEA 5FT9A 4IRMA 2VI5A 1E2HA 4XPIB 1G20B 2B1IA 5LD2B 2NZYA 5CX4A 2YZMA 2FP3A 1YA9A 4E18A 2BP7B 1FQKA 3O73A 3THXA 1J0BA 3H9EO 4IP0A 4NVRA 1ODCA 1Y3CE 3KYIA 1YZCA 2AJ8A 1FUKA 3G88A 2ZFUA 4TTVA 5C7YA 3A14A 4W63A 5FL7A 5DNYB 1P1IA 4OOFA 1S8NA 2JGAA 4LZLA 5PGMA 1G7CA 2V3VA 4OM7A 1W4BA 1M0SA 3C3KA 5D5QA 3F6EX 3QMMA 2XE7A 5HIMA 1Y89A 4ER6A 3I04M 4WADA 2SBTA 5DMHA 3NKEA 5CGZA 2GTIA 3FJOA 3GQBA 1KYYA 4D96A 3ZGNA 5ISMA 1YBAA 3FCOA 1GPMA 3ASNC 4XXHA 3T35A 4C6SA 3K33A 2G71A 3R8CA 3IHWA 2YXDA 4N0MA 4M8NE 3IEVA 3LI2A 2VRCD 1YQQA 1T6BY 5A5DA 2PD3A 2VTEA 1CDZA 2JD2A 1KEEA 3E5HA 1WETA 4GYKA 4KXMA 4YJ2B 3MXTA 3F3SA 5L3QA 1R0CA 3KZMA 3A4MA 1CUWA 1LF5A 2CCGA 4Z0NA 3M70A 4KNYA 3PQEA 2YNMA 4I9UA 4MUMA 4MW8A 5DV9A 2VDWA 3BCHA 2YIDA 4IY1A 2Y1LA 2OBMA 4K7JA 1Q0HA 2AZTA 2UYHA 2BZSA 4KIUA 1IEXA 1Z25A 2WFMA 1UP6A 1R6XA 1P3Y1 1CR0A 4IFTA 1MMNA 3DAOA 4I66A 4JGGA 4LZPA 1A8QA 2WQZA 4C04A 1W19A 2VHVA 5DJ5A 1VYHA 4BLOA 1XUOA 2MWMA 3QW0A 1BVHA 1G0NA 3KSRA 4ZQHA 4MV1A 1WZ2A 4IBOA 4J32B 4LYHA 4DPMA 1GTL1 4XB1A 3GEDA 3ZWNA 2XJ9A 1Y4ZA 1XCPA 3KTOA 3CQZA 3HJFA 4MR8B 5FBWB 4N7MA 4ZJPA 4E5NA 2HSWA 1A88A 1ABEA 1LKZA 1IWPB 2GN2A 3DDHA 1FYFA 3RC2A 3W1EA 2C96A 4JLMA 1JFFA 3UB2A 3DW1X 4CIXA 3DL0A 3M89A 1XJWA 4IJKA 1QPZA 2O2CA 3GAAA 1CJKC 3FAJA 4II7A 1T2CA 1LA2A 1ZCJA 3RADC 5BN1A 3A6DA 3WAJA 1GU7A 4KDEA 1N36B 3TSZA 1UC8A 5ESWA 3DBOB 5BPHA 3D3NA 5FTWA 3G2PA 1GKYA 4DR1B 3TPCA 4YQFA 3ECCA 5CDFE 5G2OA 1P9LA 4X1YB 1B3RA 2CLSA 2X3UA 4OA8A 3UHJA 1Z39A 2LDXA 2EVWX 3UQYS 4YRFA 3E84A 3PRKE 1ID8A 5G4KB 5HGJA 2IOQA 2ZRKA 3TFOA 1YZUA 1K3FA 2DTXA 4L85A 3L0SA 1C30B 2HGZA 3EEFA 5JNSA 2F90A 2H2GA 3F6CA 5I8PA 1E0DA 2O2ZA 4X1KA 1LW6E 2VRWA 4JA2A 5EPUA 3VPDA 4J7YA 2QUHA 4QEKA 4S05A 1JQJC 2F6RA 2O3RA 2ZS7A 2OBYA 1NLYA 4TXLA 4BFZA 3H9BA 2RC6A 3TLKA 4YCNA 2BEUA 5DM1A 2K7ZA 4HPWA 2DCUA 4P93A 2DP4E 3SSOA 1KBOA 1SC6A 3L84A 3WZ2A 4EO4A 2VN8A 3JD4A 4ZLCA 2Q3EA 5EQFA 1Q0QA 4JYZA 4FS8A 3VZDA 4XYGA 5JOQA 3FKSA 5KDLA 1OJLA 3MBOA 1F0NA 4ZC8A 5EIBD 4Q9DA 2ZPTX 1I4ZA 4ZA2A 4NZZA 4O4JB 4TL8A 4HAWA 2CW5A 2L2QA 3KQLA 3ICQB 2X9VA 3OHPA 4I1IA 3R7FA 3ZXYA 4TWBA 1NW8A 2YQYA 2PUVA 2NYRA 3LXUX 3VHRA 2RAVA 3N1UA 3K9FC 1KDZA 5AESA 3SN6A 3KELA 4J16A 1ISRA 1V3QE 2CBXA 2D7JA 3L7OA 4UPEA 1ZIXA 1Z18A 1SO8A 5IDWA 1YJBA 5KOJA 3CUKA 2JCGA 5EWLB 3IQWA 1DJMA 2FPMA 3T41A 3MMNA 4S0XA 3N2YA 8ATCA 4UTPA 3VV2A 4A4DA 1NDHA 4P9FA 1DFHA 1DJOA 3FLEA 5L0CA 1RLTA 1GPWB 4FGZA 3GLFA 3KZNA 3C7DB 2P1ZA 3PCTA 2IPOA 4TMYA 4FFVA 1G8YA 1HOTA 2DY0A 2JFXA 4FFBA 2RD9A 3NP7A 4L7QA 5LKRA 3QE0A 3HVIA 2SICE 4LDQA 2IELA 3TXYA 4HV4A 2F3PA 3DDNA 3PBKA 3L7KA 1HW1A 4BWFB 5U4XA 3SXYA 3VVBA 2ZRAA 2OQRA 1PJAA 2HMUA 4BV8A 1QHGA 4C0SA 2G8NA 2YWAA 1SAYA 3TW4A 2YEVA 1RLUA 2VHJA 4I4TA 4RTPA 2PMDA 4BE4A 2O5EA 3P9NA 2PFDA 2IU0A 4B4WA 3LD9A 4AKSA 2DKNA 4GYWA 5CXUA 3IAM6 3LLKA 2XCOA 1CUSA 1WXIA 3MD0A 3AVYA 2AC2A 1T0PA 3TQRA 3E2PA 4B3SB 3RF3A 2YLIA 2VR1A 1XZKA 2HA2A 4OIFA 5CD1A 3C48A 3UGQA 2EQBA 4FI3C 1BDIA 1VI2A 3AG5A 1RBQA 3DKAA 3BG5A 2GVNA 3FNBA 3HCRA 1P0QA 3D5QA 2X3FA 3F6SA 5A2QA 4MV4A 5G02A 1R5NA 2C97A 5ITSA 4AG6A 3PZBA 4J76A 3T5BA 3E05A 3BTUA 3Q98A 3LUFA 4M7WA 3I92A 1WATA 3B82A 3OCCA 5A0TA 3UNXA 3VR2D 2NSYA 5L53A 2RGAA 3DQZA 4P4SA 1PT7A 3PKZA 2DR0A 1RM3A 5GQSA 5AICA 1G19A 2BMEA 4OLFA 4NFSA 5EJ6A 1R50A 4RFVA 4JSTA 3U4CA 3ORYA 1TFOB 3G4XA 2LIGA 2IBMA 1YZQA 1ZJYA 1MMDA 4US1R 3QTLA 1JHZA 2RHGB 1Z6PA 1REQB 3MZ0A 2AVNA 5TPZA 1UFBA 3T7JA 5IM5A 5KYVA 1LBIA 4FYXA 5ENZA 5IZCC 4UBNA 1E0JA 3T5GA 3NT4A 4S04A 5E6SA 1H9GA 3LNRA 2AE1A 2RDMA 2ZJ8A 1IU9A 3UMKA 1NMEA 4W5QA 5CIWA 1MEEA 1NMZA 4OXYA 2D1RA 2RG1A 3R9XB 4YVFA 2C7QA 2DBYA 1UXKA 1XFDA 3VC2A 4XUDA 4B6FA 2JBAB 2X9NA 1TM3E 3TLGA 4O3FA 4JTDB 4JEAA 2RHJA 2PX6A 1RZRA 4D3YA 2IHTA 4IVPA 2VYNA 3VNSA 1J8FA 3CN7A 3SU8A 3CNEA 1DE0A 4OQNA 3G2OA 4KFSA 1VM6A 2TYSB 5F3RA 1EEXB 2PVPA 4PY2A 3G0BA 4EMBA 1H0KA 2YYAA 5KVVA 1AZLA 2DG2A 3R6DA 2J9UA 2PIDA 3FMSA 4PCUA 2WIGA 3PK0A 4XM2A 1EUZA 5CW1A 3TDMA 4CM7A 1JR4A 3OCYA 2ID7A 4GQBA 2YYYA 2D4HA 1QF9A 3G6WA 2GTPA 4HDSB 1MR3F 1FXWF 2ACVA 4TKUB 3U4MA 1Q7TA 2CEAA 2O8EA 3JVUA 2ZSAA 2QX4A 3JXEA 3PEWA 1ZVQA 4GKKB 4RVUA 4Q3BA 1EDDA 4RTQA 4P31A 1TKAA 2NSFA 1KTVA 4KVZA 4ZLDA 2HCRA 1T1SA 2FPRA 3HK2A 1SOAA 4C6TA 4RTOA 4IDGA 3SYMA 4Z7JA 4FFWA 3RRMA 1SB8A 2AU5A 1ZK3A 2PRIA 1GR1A 2H92A 2C07A 1KAOA 2JA2A 1P0MA 2NUPB 5I7EA 4EG3A 4H35A 4YT5A 4XPXA 4V39A 3C5EA 1T9AA 3RHTA 3GF4A 4UUBA 1KVUA 1KEVA 1VMEA 3W4YA 4LSGA 5JNVA 1E8NA 1R74A 3JS5A 2WDPA 5LMZA 3CN9A 5KOIA 4GVPA 3IAM1 1RKQA 4CF6A 4CLXA 2O3UA 1XZJA 1RPAA 3KSBC 1JLHA 1CJVC 3ZJYA 5TR9A 5TNXA 5DSTA 1SXQA 2IY8A 4FOLA 1U0RA 3DLIA 2FN3A 4YMWA 4TS1A 3ZHSA 5C2JB 4G0ZA 4QYSA 3K0CC 4B6IA 4DMUB 4RVHA 1Z4QA 3EXHA 1PEYA 4DM3A 1H5QA 1SR8A 2VDKB 2OUKA 3C97A 4F2GA 3OJCA 2PKEA 1R88A 4NABA 1SU7A 2D13A 1Z0DA 1NG1A 4U9EA 3MWKA 1JFLA 1GKIA 4PHCA 3ZJ5A 1MQSA 4O0LA 1FLNA 3LF1A 1BVUA 1Q0UA 1SBTA 1OI4A 4TQUS 5CDUA 3R0ZA 1CX9B 2OL4A 2EPMX 1KZ1A 4GI3A 1NVKA 1KQFA 3L4SO 2PXXA 2GVDC 2ZYVX 1QOZA 3R3ZA 4NXMB 2P6NA 4X93A 1MU0A 3GVHA 3C98A 4O8ZA 1PR4A 4JJKA 3RAFC 1Q2XA 4IWYA 3BKXA 5CVJA 3HDVA 4X8OA 2WQ6A 3HA2A 1ZGZA 1CTQA 1SOMA 4CT5A 1ZUD1 3WGLA 1EVZA 1ADJA 4C87A 4HAYA 3QFRA 4UHBA 4R05A 4R7ZA 3KQWA 2WZGA 4GM4A 3T9CA 2VUTA 2QTRA 1YNOA 3CCBA 4G4JA 3HCWA 2O3TA 3CY6A 1UPAA 3LWNA 5K3FB 2ECQA 2I0FA 1ECBA 4JJ4A 4JSRA 4OHYA 2ZTMA 1R6TA 2CNDA 3RS7A 3BXEA 4B3BA 4QICA 1OAOA 3MSCA 1E83A 1T5BA 4F21A 4NBTA 5KHOC 2C7PA 3M1YA 4Z9IA 2GN8A 2FETA 1V8DA 5IJWA 2Q29A 3V6LA 1Z8HA 3PUYA 4M36A 5AJZA 4HUQA 3HFGA 2WHRA 3RE1A 1VPEA 2XUOA 3OESA 1YONA 1ZQ9A 3TINA 4LF6B 1OROA 2WVGA 4EHHA 3VPSA 2I80A 1LSUA 3MELA 4EI2A 1FRZA 3EFOB 4B1FA 3OOWA 3MCAA 2ZAYA 4I9HA 1TL7C 1HE4A 3LBYA 3R3XA 5C34B 2H1HA 3RVBA 2P69A 3AUUA 5LA6F 3TTTA 3WI7A 1YQTA 3OX2A 4GQAA 1CDDA 3HU3A 2PLWA 4QI2A 3BH0A 4RV5A 3ZR4B 4Z1OA 1Z07A 2R8OA 1TPYA 1T01A 1YHZA 1R12A 2O2DA 3EGDA 2NXCA 4F6LA 2QXTA 4U2DA 3Q7PA 2P3OA 1FRVA 1IBRA 5LLSA 1E2IA 2G83A 1TYDE 3ZDAA 2FPOA 3L79A 2E18A 2VSXA 2HJ9A 1P2TA 1CF9A 1K7FB 1YOVA 4HADA 5IABA 4S2UA 4OKNA 4YMLA 3VMMA 2ZCUA 3KAPA 2J3QA 5JCOC 2ATEA 4EO9A 2UZAA 3LWBA 5LNK6 1T4DA 3A1WA 2A14A 2O2EA 5DX8A 4AF6A 4Y3UA 4FYPA 1JAFA 1N3IA 3DQPA 4OYRA 5C7LO 2YVQA 3JYPA 2AI1A 2YWCA 5J9FA 4J7AA 1O1YA 4E03A 4QBGB 3G7UA 1FA9A 1O9GA 1SUWA 1JR6A 1RXVA 5FPQA 4QOIA 4FS3A 2JC3A 4N5DA 4MAMA 3EW9A 4LZWA 4M0DA 5IW8A 2ILTA 2P9GA 2UZIR 4QU8A 1UWKA 3R20A 1RYBA 4I4IA 2DF8A 2H29A 2CL5A 5DNEA 4GWKA 3KQHA 2YKZA 3RK0A 1FE8A 4UNNA 4YRKA 2C77A 5M29A 3VH2A 3ZI0A 2I6FA 1YMQA 1SKQA 3L92A 4J0GA 1C29B 3PHCA 1F51E 4K3UA 1HFWA 1LTKA 4G4SO 6REQB 4W6QA 2Z3WA 3GFFA 3H6GA 2H59A 2ET6A 4BRUA 5E33A 3WNVA 4V0KA 3LOQA 1WDTA 2R86A 1FNTc 3W06A 3MT8A 1G4UR 3K6SB 4M0MA 4A6PA 4F1WA 1A8PA 4JVOA 4WE3A 2MMGA 2OM2A 5CDYA 1GG2A 3L8MA 2LZ0A 1T5TA 4U5GA 4YCMA 3DS8A 3MWLA 1E32A 3KCNA 2JGFA 3B60A 3W04A 1N2CA 4UHEA 3K09A 2AC4A 4HGZA 3WDKA 4CM3A 3A7EA 2P6RA 1BA2A 1C5KA 1M1YE 1V8OA 3GHHA 1C4KA 2G70A 2IC5A 2C4NA 3ANTA 3Q3HA 4RKWA 1B2LA 2R7UA 1OBFO 3HKEB 2QR5A 4L15A 3NTQA 1EM8A 3W78A 4M60A 3TX2A 5HJ2A 1AZSC 2G72A 2ORYA 1FP1D 2WUGA 4NHOA 5EHHA 2PX0A 3IQCA 5CJ2A 2GYVA 1Q3TA 1O96A 2CFIA 1NOJA 4P0QB 3QVVA 1GSHA 3W1WA 1RHKA 2XZDA 2JFQA 5B1DA 3R5TA 1A95A 5IAKA 3W3AA 5JLJA 1IE3A 3SOPA 2GKGA 1IFXA 2JVIA 3TQQA 3VNQA 3AF6A 4QBFA 3C85A 4E46A 3TRHA 3KOMA 3EVAA 4W8KA 4JYBA 2LGJA 3NYLA 3KT6A 3DYVA 4UNSA 3OQJA 4ZV4A 3R5JA 3U4IA 4R31A 4EB8A 4ARZB 4CLRA 2TMGA 1WMDA 1WP4A 4Q7EA 4TS3A 1PV4A 5FWXA 1U28C 3A7DA 4ZRMA 2IOFA 3RQFA 2GZAA 3VYVA 4XGRA 1BC5A 1XAIA 2Y4NA 4NYJQ 1I9GA 1N2IA 4XTCS 3ACCA 2BBTA 4MV0A 3FKJA 3RW9A 5CBPB 5F7JA 1CFJA 4A8HA 3WRYC 4NIMA 3N8HA 3HGTA 1W29A 4RFSB 5KYTA 2Y3IA 3M2TA 1CE8B 2W58A 3MYYA 4M76B 5EUCA 4UHCA 1LCIA 3VTFA 3KT0A 5LNK1 2WD7A 3IS3A 3LKBA 1SQ0A 4MWGA 4WWHA 3TD7A 2P6OA 1FIUA 1YMUA 3JYQA 4Z1MA 2WMNB 3RU2A 4J1TA 3KSMA 4EWLA 4QDOA 1KMHA 5E1BA 1TDJA 3HYTA 4IB4A 3L7LA 4RHCA 4P5PA 4BNZA 1N5MA 5B53A 2FQQA 3GRKA 4BQOA 4EA9A 4LNUB 5JZVA 1I4EB 5DLQC 3OTIA 4M7RA 4JP1A 3UJDA 4EHAA 3G0DA 2NO5A 3FPFA 1Z22A 5KJFA 4YXFA 2Z9BA 5K0BA 4L6AA 4DCOA 1CZHA 4A3SA 4LV5B 2A0BA 4F71A 3SHFA 1JDUA 5K01A 2UZ1B 2X5JO 1MO4A 3P5SA 4GMDA 4M8IA 4WLEA 4DCCA 1D9XA 1UG7A 1NE2A 3UATA 3PU6A 3DVAB 1LSOA 2UYOA 4K0KB 3KDPA 1JWAB 5FXMA 1CU1A 3DLTA 3AR8A 3SOZA 9GPBA 4E2YA 2PGIA 2W6ID 2K5UA 2IXNA 4DJEC 3HRIA 3FG9A 3QG5A 1LWOA 3B1KA 1QYDA 4HKTA 4A5OA 3TL6A 1OFIA 2YV5A 4OMFG 2OZEA 4P82A 2Q0SA 1H4VB 4ENWA 4GEKA 2AFIA 2OBFA 2AIRA 4U5HA 2DBRA 3RGGA 4BIIA 1RM0A 3T4PA 3F74A 1BRMA 1ZVJA 3D7NA 5CI9A 1J5PA 4B4OA 3OAAA 4G9BA 1TO6A 3CH6A 1FK8A 3TZKA 5K3CA 2WJAA 3UT5A 3URKA 2Z6QA 1BEZA 2PU5A 1PD0A 5JFOA 5JWRA 1GFWA 1P39A 1V35A 3IURA 2XGOA 4RK0A 4TV8B 2P79A 3SJBA 2CSUA 5ITZB 1W35A 4N18A 4CEJB 2D6FA 4CWAA 1ONSA 3S2EA 1R4MA 4WVFA 4GXRA 4UZSA 5LKAA 1KEPA 1APBA 1PSZA 4HQRA 2XM0A 3LUKA 1E4YA 1Q7GA 5B2EA 1LK5A 1RPJA 5COMA 2ZOSA 4UEOA 4JEMA 4I5EA 1BCRA 3EVEA 2DAPA 4KP7A 4G8CA 4KUEA 3MVEA 3PVCA 5GJVC 1R1DA 1IEWA 2IIBA 2CVZA 3KYDB 1XK7A 4FEEA 1JKFA 1B3BA 2EP8A 4LYDA 4AP5A 1VLQA 3ZE9A 2IHZA 3OEHD 1VMKA 2Q1TA 4OF4A 3V4LA 1E6WA 4MAFA 5IDVA 1P3JA 4Q4HA 3EZGA 3WQSB 1NVWQ 3JR3A 4IAQA 5GZ1A 1EM6A 5C4GB 1OLOA 1SPBS 3F7TA 2QM0A 2KK1A 2B61A 4BE9A 1XVTA 3TIVA 3P9RA 1SCNE 5T4EA 2IPXA 2NV0A 2H7CA 5AC5A 2FWBA 3PGMA 3V2GA 4KQGA 4KRXA 4N5LA 4PQGA 2QZ9A 1ZR2A 5AK3A 2F48A 2HV9A 4YK5A 3VX3A 2BAGA 4JJZA 5BQFA 3A4VA 3WKAA 3O90A 5KAMA 3LJBA 1AQUA 3EIQA 1NN5A 1V6AA 5DT9A 3PC7A 1O9HA 3OZ7A 5EJIA 4B7XA 2HGSA 2ESRA 5CG2A 1ECPA 1K6IA 4RMJA 2PKQO 4WRRA 1F2TB 2HLHA 4A23A 1VP3A 2ZIXA 5EWMB 4BQQA 1F4LA 4QUDA 2PAFA 2MMCA 1NURA 1RMYA 2IUFA 4FFSA 3NIBA 3W8IA 1IRIA 4Q18A 4FONA 2OTCA 2X13A 1EIZA 2OOSA 5FJJA 2F00A 1G17A 2NQ2C 1V7CA 2ECKA 2GZ2A 1GZ3A 1EWYA 3JSEO 2HQSA 2F17A 1V1RB 3LT4A 4JELA 4HFRA 5DYGA 5K45A 3OC0A 1X1RA 4MTGA 1DX6A 1QC5B 1BWSA 3ZE8A 3K70B 1V5IA 1ZY2A 4JY7A 1RC0A 3TIGA 4MDEA 1C4XA 4GMGA 1LPEA 3BE4A 1Q84A 3BXXA 3I5QA 1ONBA 2QMUA 3KV1A 3ASVA 3CAXA 3WDSA 1ZD4A 1T8UA 4MA4A 2AQ8A 3TF5A 2RAUA 3PR1A 3OEYA 4TYYA 2NVWA 3AWDA 1NW5A 3JZ0A 2NZ8A 2QZ4A 1XZCA 2IXEA 2VH2A 3ZH9B 1NBWB 4BNWA 2JJ2A 3K6JA 3A4TA 1O0SA 5AKGA 3EY4A 4D74A 2H1FA 1ISIA 1GSIA 1VJ0A 3T7TA 1ZM7A 2FN7A 3UH0A 2EV9A 1OWNA 2HU7A 2O19A 2FX2A 1K8XB 1D2HA 1PTKA 3IJPA 1Y1KE 3A04A 4XDGA 2WLTA 4P32A 5DM4A 1LRJA 3H2SA 4EUKA 1B26A 4J0DA 1E2UA 4YUWA 2ZDQA 2XS1A 3OWTA 3AGUA 2NQTA 3I61A 4YTEA 1GPLA 1NPTO 4Z7NB 4JNCA 2INGX 1IUNA 2IFTA 2Q9AA 3LEVA 1G7RA 4E3ZA 4I1PA 1SBIA 1CEEA 4ASUD 3ZY4A 1H0RA 1GGNA 1OXBB 1XZEA 1JQEA 4MQMA 4G65A 1KFEB 3O5AA 3DE6X 4L0CA 4PFSA 3MAAC 3F2IA 1TJNA 3DXJF 3IQIX 5K6RA 4EECA 4L78A 3AF2A 1CJBA 2CY0A 3L93A 4HRXA 2R66A 1YS1X 4YRPA 3WZMA 3PUJA 3IUSA 2Q8PA 5CIVA 5L4LA 1RR6A 1NYQA 3KWFA 2DI3A 4O63O 1C14A 4RZSA 5KYWA 1UK6A 1T3TA 1UPXA 2ZSUA 4R2XA 3UMBA 1IN1A 3FGPA 5FPHA 3I6IA 4HAXA 3UK6A 2PSJA 1WCIB 3CEPB 5ARDA 1K5GA 3U5ZB 4WAUA 1M1UA 2FTKE 1DGQA 5CLQA 3PNKA 4XEVA 1SVOA 3NC1C 1VSQA 3CBQA 4DJJA 1MJGM 1QTIA 1MAVA 4YR7A 4EL5A 1ELOA 5I9SA 5LBUA 1HLPA 4ILEA 2D7DA 5DHTA 4F1JA 3OM9A 3BJRA 3QIAA 1JIVA 5DM70 2DWUA 4GZ6A 3EULA 4INAA 3TSOA 2ODWA 2WSIA 2WMDA 2XYQA 5AJXA 4DA7A 1TCCA 2QRHA 3A9RA 4R2IA 2VPXA 4AURA 3AG3C 1VZ2A 4FNAA 2Q45A 1L4KA 3ULKA 2JI6A 2IH5A 3O6VA 4K3VA 1V7ZA 4NCNA 4C1BA 4F3NA 1RHUA 4K0DA 3UWSA 4GLFA 2HYDA 5HS4A 4HLUA 1Y34E 2HCFA 3BM5A 2A3RA 2H17A 2MINA 4BV2A 3ZDEA 4CV1A 4GR4A 3I28A 1MVLA 4NBNA 4LACB 2ORIA 1EGQA 4HYEA 4WLFA 3MWDA 5A0FA 5KYGA 1MNDA 4GOLD 3IE0A 3KIPA 3BIOA 2GWHA 2ZJ2A 3ZCTA 1BOFA 3NJRA 3OPVA 1MC4A 5F1YA 2GCGA 4NZNA 1I7LA 1F2UB 4NYIQ 1JBQA 4MPTA 5ALIA 4KO1S 1P8AA 2Z2YA 4E6PA 2EFCB 3JRWA 2YJ6A 1C81A 2WQ7A 3H9QA 3IUYA 3RASA 4D25A 1P4GA 4TXNA 1TLTA 3OY7A 5KI6A 3OUTA 2ONJA 1M83A 5LQUA 1O8BA 4LWZA 4DMHA 1JEYB 4QUKA 3O7WA 4UTXA 3W2EA 4ZYLA 3WP0A 1A3CA 3LCUA 3EIUA 2BDUA 3GPBA 1QNFA 4DDHA 1T1EA 3JALB 2GI4A 3MN1A 4WKPA 4G41A 1DI0A 2XD9A 3S2YA 4B33A 2IH4A 3FM9A 3T1OA 4DTIA 2XLWA 3VPGA 2RB4A 3NVAA 3LECA 5CD9A 2ZM6B 4UUAA 5E3IA 4LC0A 2DHEA 1R66A 4B7CA 5AW2A 1XMPA 2OZLA 4JQYA 1DIAA 3ND6A 4UUOA 5B6JA 1ZAKA 3DV0B 1YQEA 3AESA 2NX2A 2PZJA 4KZPA 1XLTC 4PO1A 1Z45A 1ZNZA 3WO0A 3IEKA 5AO9A 2H2WA 4IGAA 2PBRA 1VLZA 3G0GA 1THTA 4LMBA 3G8AA 4U7JA 5JR3A 2PX8A 4G6ZA 3ZSUA 5KU1A 3EBOA 3JAKB 5AW7A 1B0PA 1P9OA 5DLPA 2J6HA 5FQNA 5K0FA 3VU3A 3U40A 1YJAA 2HADA 2HRRA 3MOGA 2W5UA 4WFIA 3BH6A 1G21E 4HEHA 1QQ3A 4Q9AA 2I2XB 4A2NB 4EHLA 1ZC4A 3FHCB 4PCLA 4Z4QA 2REXB 1U0TA 2IS1A 3C3CA 1Z0SA 4LQCA 3HBNA 4AJJA 5EESA 4BECA 1PS9A 1TAUA 3O8RA 4F3RA 2PGDA 1EFRA 1XP8A 2P27A 1K27A 1Y7PA 1ZL2A 1A9QA 3FYSA 3BF8A 2XXAA 4R01A 1U7UA 2DFVA 3X44A 4KLAA 4WV3A 1MX9A 3QF4B 3B1YA 4MQUA 3F49S 4JMLA 2ZKIA 2ISCA 2ZJFA 2QWXA 1G5FA 1D07A 2EJWA 1Y98A 4HJXA 2XADA 2HRDA 1R0BA 4D8XA 4JHLA 1TF5A 5B64A 1U8XX 4FWTA 5ER9A 3G4ZA 4LNHA 3G3EA 2ZUSA 1R8SA 4R2MA 3LYAA 3U9LA 1PLJA 4FFNA 1LS4A 2RBGA 5J63A 4HLDA 1SVLA 2GFQA 5D3QA 1USGA 4UEQA 2D00A 3OMWA 3TRFA 1W4ZA 3JY6A 2XV1A 2FPUA 3CZPA 3EB9A 3D1LA 2G09A 4XKJA 2O2SA 3ANMA 2B92A 3W8FA 5DN6D 5FUYA 3TWOA 2V5VA 2ZJ7A 5LC1A 2O52A 1L8XA 3ORFA 4NV3A 1T9GR 3AV3A 4N7BA 1RACA 2YCBA 2O8CA 2YDXA 4AE4B 2C3PA 4IJWA 5J4YA 3UFBA 1D09A 2ZSEA 3CUWA 3SXJA 4IQGA 1F9AA 5AI6A 1E9BA 3A6HA 4X65B 3WDLA 4K88A 1RQGA 3V7OA 4YPVA 2W2XA 1HK7A 3K31A 2XCLA 3H2BA 5DGCA 3VA7A 3GLSA 1U2DA 1PL6A 3AG1C 4KHZA 3BMOA 1VJ1A 3U8VA 2V6JA 2QTGA 1PZNA 4YXWA 2R6ZA 3ELDA 1JE0A 2XQVA 1LRKA 1M34B 3EXHC 4O1MA 1P4JA 2I8BA 3F7NA 4RPIA 3BVPA 2CLLB 2WTBA 3NDBB 4RYLA 4Z4FA 1K5HA 1U0BB 2XRYA 5CK5A 1IXZA 2QPAA 4K2AA 1RXWA 1NQ5A 4IOLA 3SFVA 3LWDA 2HS5A 3T4XA 1ZZEA 2ZYAA 5AJWA 1YQXA 2YOFA 1AXRA 3LP5A 5IHPA 1HG0A 4NDNE 4LDJA 3HY3A 4UXJA 5A4MS 2CVOA 4QBHA 3AFOA 1MFPA 1TU3A 4KK3A 5L0IA 3X1OA 3B9QA 3A3KA 1YJCA 3R7AA 1U4OA 1UR5A 5KVCA 2CXSA 2H7OA 2CNWD 1Y80A 1RD4A 2HHHB 2MSNA 3M4XA 3FXAA 4DM4A 1EBUA 3C6BA 4WESA 3SX2A 5BV7A 1XEXA 4OMUA 3WC4A 4YIHA 1DJPA 3QNWA 3JQAA 4LIPD 1FFAA 2VDLB 2VRNA 1OAOC 3OPXA 1XKXA 2WE7A 3K6RA 5T3UA 1PK9A 5K4GA 4WKOA 2GK6A 2PH1A 4YBZA 3UCFA 1XCOA 4FX5A 4ZT4A 3WX0A 4FC7A 1A7AA 4RTRA 3O8DA 1X39A 1VL8A 2PT9A 4U5QA 2QXUA 1NWCA 3L7DA 2Q2WA 2XDWA 3IL2A 1AGRA 1U0EA 3ANXA 4IZHA 2IPAB 3IX7A 4UUPA 3B7GA 1C9KA 2B69A 2A9KA 3IUQA 3ENNA 4GAEA 2CBZA 3RVJA 2FMXA 2WAMA 2FUNB 1EK5A 1MPTA 3F6RA 1C7ZA 1ZLXA 1TGVA 1ZUIA 2D1FA 5C53B 5DRTA 2XUQA 4L4SA 1VE7A 4G0UA 5HF5A 1Q0RA 2VPQA 4MICA 1U9IA 1P1JA 3L4BA 1KMMA 3TLXA 2E6KA 2J9BA 5E7MA 1LPMA 2NG1A 3F4BA 4GPIB 4F3KA 2EBWA 4PPYA 4PLTA 2CDBA 16PKA 1Y3BE 2C54A 1NVGA 1ZA2A 3RSCA 4MKZA 4DPLA 5LUBA 2AX4A 2ZT7A 2FYTA 3PVZA 4LRUA 4OI1A 2XNHA 1VC2A 5CFRA 2Y05A 1HQCA 1Z29A 4LJSA 2OQMA 3AMVA 4RDAA 3GO4A 1JOGA 3CWQA 3FRJA 4I1MA 3IDFA 4JMPA 2A0YA 5DT2A 4ESOA 4HDCA 3PDWA 1SEPA 1I30A 1EUYA 3BDIA 2PSEA 4PX9A 3KZOA 1GO2A 3FWYA 4FE4A 2X2PA 4KI0A 4O25A 4CR8A 1WMEA 4JUDX 3TVDA 2Y71A 3NJ4A 4BPMA 4C05A 4AQ7A 2W4BA 4RQUA 3TKLA 4UMEA 3R3SA 4K9SA 1OYYA 4P5EA 4N39A 4AZ3B 3GA0A 4BXOB 3IEXA 3EISA 4C7OB 1N0UA 3S6JA 3HKBB 3FNFA 3UW3A 4CMBA 3HC7A 3VDQA 4JVLA 2B7LA 2H85A 4CMKA 3CLTD 4WFKA 2DTDA 3LKZA 3KQVA 2BFPA 3EG9B 3BWDD 3LSTA 4X7PA 2DE0X 4R4JA 1FZTA 3TGWA 2X8JA 1UMDA 1I7DA 1T3SA 2RGDA 2OD2A 1LBEA 1K8QA 4BMDA 1RI3A 1QKIA 3GI1A 4RMHA 2CFTA 4NCAA 3IPLA 3PQ6A 3EQ2A 2AN5A 5DBOA 1SCAA 3CVXA 3ZWMA 4Y9UA 1PWEA 3ZX4A 2ZUWA 4HNVA 1CSEE 3PUZA 1JG4A 2QGZA 3MYFA 2G17A 4ZVKA 4H1WA 2C3MA 1NM5A 3TZCA 4KQEA 4OJYA 2R6R1 1PGNA 4MA0A 4C4SA 3CV3A 5BXQC 1E2NA 3INRA 2P9YA 3ZHZA 4FLFA 3MCZA 5IDYA 3E7FA 5HKKD 1YB7A 1L4BA 5JXWA 3LPLA 1SC9A 3MJCA 4JLAA 2CBGA 3K9QO 2FPPA 5ALXA 3OPMA 1NQUA 4AG5A 3EH2A 2YV2A 1OV6A 1FBTA 1DKNA 4NOMA 2BHNA 2PKXA 3HI6A 2QMHA 1DAPA 4CMAA 3D9QX 3HA3A 5THQA 1AUOA 5KSYA 2HRQA 2FF7A 3WGYA 2AOUB 2BFOA 4YJ2F 4H7KA 2ODBA 3LS1A 1AUQA 5JO0A 4Q16A 3PYLA 4YAFA 4E2FA 3EPVA 1TCBA 3CW2A 4WGGA 1QH1B 3LUJA 1ZO8A 2QSZA 3DO5A 1YDEA 3SF8A 4H31A 3R3YA 1JXOA 3VM6A 1Q0FA 1W0JA 5JLAA 3S4YA 4AAYA 4CDVA 4XE5A 4EOGA 3I4LA 2OCYC 4YMGA 3EVTA 3QENA 2PEYA 4UTOA 2YMQA 5IM4F 3M2PA 5BQGA 5G1NA 1URPA 1WRBA 1S7CA 5EGYA 4LJ7A 3FBWA 2P5TB 2QL6A 3IAXA 3VISA 2ZUCA 4C3ZA 2VAPA 2Y68A 3F5MA 4G24A 2C98A 3U1TA 4K81B 3R75A 4H1UA 4FBMA 3FFBA 4N12A 2QVGA 1I1OA 2QQFA 3GEIA 2W2OA 4BEWA 4YDSA 4OB7A 1H85A 2N46A 1LUAA 1G3MA 2GLUA 4WLVA 1T2AA 2YHSA 4KV9A 3FDJA 4ZCIA 3NUGA 3VPXA 3TQIA 3ZJTA 1G8PA 2YHBA 4KO4S 1JA1A 2AXNA 2Z09A 3QJYA 3DV9A 3ETEA 4YAKA 1NFFA 3CBGA 1YBMA 2AP3A 3WE7A 5DYNA 1TWHA 5IKEA 1II0A 3EQLF 3V7UA 5A2GA 4JT8A 3HLZA 4BVKA 3DM5A 3VJMA 4DVZA 4D4HA 1R8XA 1CZKA 4BC1A 5J1TB 2OSVA 4ZKEA 3N0WA 4C4RA 2Q28A 1W85A 2X8LA 5J2TA 1X94A 3RRBA 3HXOA 4DW8A 1QYWA 3U4QB 1W2WB 3OX1A 3QWFA 2CJWB 4BFWA 1XRJA 4ZHQB 1O97D 2B9VA 3QMPA 2CGEA 3DT9A 1N2JA 3KLPX 5A9RA 5CT4A 4JROA 2O3QA 3REQA 2H5IA 2Z98A 1G9XA 1OLXA 1UBRS 3T5AA 2A68F 3RAJA 3SD7A 4L76A 3QPCA 4N7RA 5EUMA 1GKKA 4GR5A 2Z5FA 1Q83A 1CKEA 3PKIA 3FZYA 3KJEA 5I4CA 1O94C 4EJSA 3EQ8A 3D2LA 4S2EA 5E3HA 2JLVA 3CSSA 3BE5A 1L7BA 2D2XA 2WJYA 3CKKA 4BP8A 1AA9A 2NOAA 1OXUA 3ONNA 4ENQA 5EYPB 1EJ6A 3B0PA 3N2KB 4TL9A 3UJPA 3P27A 3DG9A 2OORA 3QU9A 1M6EX 3MQ4A 4H1VA 4PNEA 1KH2A 4F5ZA 3O8LA 4FGSA 3DBHB 3PPYA 3E3AA 3LBNA 1R4TA 2JKYA 2B8EA 4OX9Y 3ND9A 5KQSA 3V7YA 2W9YA 4EI7A 5D85A 4O4JF 2QQ0A 5FUQA 2CD9A 1DXOA 2D62A 1WSBA 4DY6A 4EEKA 1J2EA 2XKAA 3RT7A 5CLGA 3TFQA 2BFNA 2A0XA 3A6PC 5REQB 4DRYA 4N8DA 3KMIA 4AQDA 2R6DA 2HK7A 2I6UA 4B31A 1OYWA 3WGMA 3BZBA 5JAHA 3F5DA 5K4HA 4Z4HA 3BMCA 4BUZA 3GFSA 2VAMA 3B53X 4XX0A 4QBIA 2RFLA 1FTSA 2JI7A 3MTEA 4XWOA 1OD6A 3QOYA 1BVRA 4JT9A 5AUOB 2OHXA 5FA6A 1QV9A 5ES3A 5G41A 2BTQB 3ESXA 1WNFA 1J9ZA 1IHOA 1YBHA 3ZTMA 3HCDA 3A1SA 4F12A 3GVPA 1FP4B 4PGHA 3T3IA 3FI0A 2QL7A 1UBTS 3TQOA 3AEYA 8ABPA 3U7FB 4Q1DA 2OO5C 3ZWOA 2O23A 1U80A 4GP7A 4DWOA 4ZI2A 4D43A 4EABA 3RHZA 1NBMA 4BN4A 4EA7A 2IP4A 1EESA 1AK2A 1VBKA 1N1CA 3I34X 2NQ8A 3GLHA 1EXMA 4HDNA 2Q3DA 1SR2A 4X61A 2L18A 5BNFA 3DR5A 1NULA 5LMCA 1ID1A 1QX4A 3NHMA 4I55B 3N0VA 2WW8A 1ZW1A 2XT9A 3GK3A 3X1XA 1YJQA 2WU0A 3ETJA 2OGUA 1S2MA 2VJMB 2EGHA 2KWIA 3GU3A 2C78A 3CX6A 3C6QA 3EF3A 1ONNA 4Q9NA 1J42A 3ZDRA 3MWYW 3HKCB 2C2KA 3DE1X 3PSHA 1G4US 3K0AB 1E5LA 5EXXA 5E6UA 1R6BX 2IYQA 4LJ8A 5FWYA 2Y1CA 3N7AA 2RD2A 4O6NA 3KPJA 1J6UA 5IVIA 1LPSA 3K0EA 1LPOA 4OUDB 3FPAA 1ZOPA 5I4IA 4IIBA 1FFTC 1YZAA 3T7AA 3NO4A 4C3BA 4PFPA 3ZBUA 2UXCB 2GA0A 3HGQA 1U7TA 2OYSA 5ICEA 2C58A 3KSDO 3ZV6A 2EJUA 1SZJG 2YZGA 5JQGB 4CETA 1FS6A 2VPPA 1M2OB 1A9YA 3EAQA 2Q0QA 4L5BA 1E1RA 1EUQA 5GV7A 2BD0A 3KDSE 4JKOA 3I9KA 1TYBE 4OBBA 3B9RA 1BX0A 1QK3A 4FK8A 2QHXA 2ZWIA 4YMTA 2UUOA 1R4NA 4HGYA 1YQUA 5MFPA 2XKJE 1XBTA 2QUAA 3E9RA 5CM9C 5EIAA 3N74A 4FNOA 3O8OA 2WTAA 1ZESA 4MVJM 3TYXA 1K68A 3RVSA 2QX6A 1VJ5A 2WL8A 3SSMA 4BHTA 4HNAA 4TWZA 3OURA 3H6HA 4UNIA 3GLIB 1T5DX 3DCJA 3TW0A 3AGPA 2PRZA 4LLCA 1RXUA 3AY0A 1J8DA 1T4BA 1PNVA 3DCYA 2P4HX 3Q41A 2A7QA 3MJ4A 3WGZA 4JN6B 5CFZA 3QU4A 3QP9A 4ZPJA 3F78A 3O84A 4UZFA 4HQ0A 3CRRA 4TWIA 1QG6A 3HB7A 4J3NA 3WLFA 1E1DA 4EQ6A 4MNTA 5LBTA 1BX3A 2V7QD 3D5TA 2QJOA 5AW6A 5FBZA 1P2GA 1OB5A 1TD1A 4DA6A 2F1JA 4RA9A 1PRYA 3KKEA 1E77A 5A6VA 2I66A 4DBLE 4NG4A 3VKWA 4BB6A 4ZQIA 3DE7X 4RA6B 1UKZA 4GW3A 1YS4A 1ZK2A 2QVXX 2HT6A 2MSDB 3LPAA 2I15A 3AEUB 4UOEA 1JL3A 1KEUA 5HSWA 3P32A 3BF7A 4GRDA 2Y3BA 4KI2A 2H8KA 3B8HA 1UL1X 3PE6A 1W47A 1DKOA 4F3TA 4X3PA 4AW9A 4RTLA 4BNIA 2R7QA 5KU7A 3SQDA 2YIJA 3PXUA 1K08A 4M8LA 1B93A 3TOZA 3AU9A 4MVJP 1GAJA 1E2LA 4IIJB 4YYEA 4ITVA 3Q5GA 1F3OA 2OO3A 1S9DA 3WGQA 3D6UA 1J4AA 4MQ6A 2PX4A 3MWEA 1JX6A 5EI5A 2ONYA 2IYYA 5AI8A 3PF9A 1VDZA 3AR7A 1PQYA 3ZNNA 1XDGA 1FSFA 2VZ9A 4RWZA 2R7VA 5TQ0A 2VCAA 4AZ0A 1U1IA 1GIAA 3RT1A 4Z4CA 3R5KA 4YK7A 1N2SA 2FN9A 4A5SA 1G1AA 4RELA 2EBUA 5BV0A 3NWBA 4DMCA 5JECA 3GP5A 2NP7A 4RGVA 1V1MA 4LFBB 3NKLA 2QUIA 5JXIA 1SZPA 3OCZA 1AA6A 4E0BA 3R09A 2I6QA 2FE1A 1Y1RA 2BY4A 2EAUA 4WABA 1FAPB 3D6AA 3UT6A 4R8LA 2A5YB 5JI2E 4KE8A 1SVUA 3IQZA 3JPYA 5ED4A 2VP9A 1UMBB 5TSDA 4QFDA 1MPXA 3VKGA 5GMOA 5CCXA 2IOHA 2G3KA 4LI0A 4CCWA 2ZR9A 3UHAA 3WMXA 2HYIC 1GNTA 5E1OA 4PFJA 1CIPA 4U8GA 3ANNA 1YQDA 4JGBA 2JLBA 3TJMA 3DO6A 3W6OA 2SKCA 4IJUA 3L4EA 1I94B 4EAAA 3MWGA 4PYJA 1W5BA 4YJWA 1KBQA 1FU4A 1V7PC 4ZRDA 2O8BA 4QQFA 1L7XA 5FNVB 4I81A 5DWVA 3C4VA 3O95A 1H9BA 3M5WA 1OPXA 5GINE 2GCNA 1T43A 1T5OA 5H68A 4W9NA 5LZ5A 3M4ZA 2Y99A 1JG2A 4RDXA 2ECFA 1E64A 3VU0A 2OBXA 1A77A 5JHHB 4Q66C 3T7IA 3ZWAA 4ZU3A 1H9AA 3UG7A 4MUNA 4XDHA 2CFCA 1YTLA 2HA0A 2P2SA 1RLIA 3ESCA 2I22A 3IAEA 4RTJA 2BCGY 1H7IA 1G8JA 4P53A 2JH8A 2NO1A 3IPAA 3PHLA 5CEJA 2ZU6A 2WU3A 1ZK4A 2POQX 2JIMA 2ZVPX 3FLMA 1FNDA 4BNHA 4LTNA 4MX8A 1D5WA 4K8OA 3UJ7A 1FDIA 2VF7A 3OPYB 3E1SA 2R8YA 3AEQA 3IBSA 3HJNA 3U16A 1XCBA 3E61A 4GMXA 2PMKA 3KG2A 2VQ6A 3Q7QA 5GIOE 1EQUA 2YWBA 3DZCA 4Y2JA 3C8GA 3ES9A 1AGXA 5AI4A 4RENA 3V1MA 2GD2A 3EPHA 2D0IA 4OHCA 5DK6A 4HDKA 3ZLVA 5A6BA 2EGUA 3LUGA 2J3IA 1CY0A 4N6OA 1HI9A 2AW3A 1DBIA 2ZPUA 3UFXA 3KU1A 3M0EA 4R9NA 4IM7A 5JSZA 4D4MA 4MS3B 1IEQA 2H1WA 1EFLA 4HI0E 4QYIA 2VJDA 3OQ1A 1F12A 3DOHA 2CCKA 1ZHOA 1Z06A 5JRZA 3NDPA 1R6UA 1U8YA 2QTCA 5C80A 1YOBA 2JIRA 2OXIA 3DM9B 1NYRA 4EZBA 4C0KA 2V0CA 4EB0A 3EH1A 3J7AC 3HXPA 4E07A 4WDQA 4GVLA 1I6KA 4Q7KA 5I48A 1MXHA 4QG7A 3ZD6A 4OXIA 3AKDA 2M6KA 3U39A 4WBSA 3CNQS 2AQHA 2QVZX 1TM7E 3RIPA 4QKQA 2QJWA 4PSKA 3WWEA 4F0JA 4YYZA 3CTMA 3CH7A 1QK5A 1R3DA 3QYPA 2ZIWB 3J81A 4OLBA 3LA6A 1UK8A 1WIWA 3B48A 2QTLA 2IHBA 1P91A 5B4TA 4OQ4A 7YASA 4HQNA 2OQIA 5HM6A 2XAUA 5KNCA 1BKSB 3H65A 1P62B 3QPBA 1ZM3A 2FFBA 2NUAB 3DEIA 1A7KA 1YE5A 5J40A 3FOWA 4MJ3A 1R9NA 3WYGA 4HP8A 1HLDA 1Z5ZA 4B75A 1WXWA 1JHMA 3WLEA 4PVDA 3D3KA 1BE1A 3IBGA 4YEDA 2JFPA 3R4VA 2EG5A 4FUTA 5IJAA 1H5UA 1MOSA 3RU7A 3LIIA 1Q50A 2VC9A 3IQ6A 5TMDA 1VXRA 3UC5A 4KXWA 5F2KA 1P31A 2QE9A 4OK5A 1SXJD 2QTZA 1V1JA 5B1IA 4TV9B 1U2DC 3KYIB 1W36D 2LQGA 4FZVA 4Q3AA 2GHTA 3HPQA 3VAZA 4E32A 3PGA1 2PJZA 3Q1KA 1ICEA 3OQBA 2ZI5A 3HBFA 1YFJA 5JAOA 3K4QA 3QLVA 4HSGA 1N4DA 4CTJA 5LWHA 1BXGB 4IIVA 5HEKA 4U7WA 3OZAA 1BJTA 2QBYA 4RK1A 1SVSA 1F7VA 3GQBB 1Y5NA 2GEKA 3N2GB 1PFGA 1VKOA 4EW2A 1RRCA 1HQDA 3ZEAA 1LX6A 4R1PA 2WKWA 1RRVA 2P9ZA 1KEEB 2VDJA 4KR2A 2QLLA 4M1OA 1V48A 3BXGA 3C3BA 1EX9A 4ZCMA 2XCSB 5KTPA 4DUGA 2L9JA 3KL2A 3MTIA 4ZAWA 1UC4B 1Q3KA 5L45A 3Q9NA 4NEGA 2PRYA 3KO8A 4V0QA 3PQCA 1JA9A 3PSAA 3CZ4A 1N9KA 3RHSA 2FK7A 2PUDA 4YECA 2RGNA 4F91B 2VP6A 1PL8A 1SQSA 2KHZA 2WSBA 4L22A 4FFLA 1UMKA 4DQKA 1SA0A 1KSFX 5DGHA 4YT4A 2V6BA 3EDYA 2M6RA 1G2PA 3ZI4A 5LCXA 1OT5A 621PA 2V97A 1H3EA 3WGKA 5JD5A 2R8ZA 2W0SA 3FSJX 3L6BA 1UEJA 1QB7A 4A2QA 1G4HA 4DG9A 4WJ0A 3F8SA 4KMOA 4MWTA 1X8LA 4GC5A 3WHNA 5IJ9A 4L75A 1DS6A 5T3WA 4C03A 3W2GA 5DBFA 2DERA 4J6EA 1M6NA 4GBJA 4L6IA 2Z6VA 2V9CA 2ZS8A 1ESEA 1KAQA 4DDKA 4YV7A 2V9ZA 4JLDA 3THRA 2X8WA 3FCCA 1EXNA 1E9CA 3MA0A 2YNMC 1OWOA 4QC2A 3UK0A 1GPDG 5K7SA 3QH4A 3QLUA 1JFFB 3IMCA 3OF5A 2AN3A 1QF6A 4RL4A 2O14A 4QGSA 1UMCB 4JJ6A 4JXJA 4DSZA 3UJNA 3L49A 1CXZA 3CVVA 5LYJF 4YRBA 5CDSA 2PK3A 2HI0A 3K5IA 4EMUA 4Y2QA 3RWOA 4LFAB 1U9IC 2IYOA 1UFKA 4IH4A 3KQMA 5CLJA 3V1YA 4G26A 2Q50A 3IJEB 1RWMA 4PSAA 3FF4A 4RADA 5DEIA 3TSAA 3MG9A 2AMLA 2EJCA 5AVTA 5FOUA 4BRWA 2GAFA 2NSGA 4MWZA 2P2DA 2O05A 3STWA 3JSXA 2W93A 1U4SA 2AR0A 4HPXB 2YWDA 5COGA 2FX5A 4W5TA 1DUVG 4L4YA 1QQ7A 4CN9A 3L0ZA 3OD5A 2IZZA 3QVOA 4BFXA 2D5IA 4XDYA 4L8YA 1UK9A 5FCLA 5HZHA 1GZHB 4XYBA 4RY8A 1XZQA 2ZREA 3IO3A 2DHQA 2IWHA 1BH2A 1PG0A 3ND5A 2BMJA 3NH6A 3VNBA 3CUVA 4V2IA 2WF8A 3REGA 4XIYA 2WILA 3EJ6A 4IJ5A 2X9QA 1V5GA 5SY4A 4PIVA 2BEUB 2OC9A 5LOVA 1A9XA 5H80A 1DLJA 3GJRA 3Q12A 3IVCA 1T2UA 4JR0A 2C4VA 1PHRA 1NGSA 1QHSA 3U4DA 1YI8A 1DT3A 3DR3A 4H16A 4D92A 4B4VA 1KY2A 3HTKC 2PHZA 3LUHA 1PT5A 1MHTA 2AKYA 3KEMA 1SH7A 1Q77A 3KQPA 1U3GA 4KG7A 2IA5A 5J23A 1GRNA 4O2AB 2FR0A 3JATA 1OTXA 2HJRA 2HJHA 2PS9A 3RUFA 3HV2A 3I62A 3AEXA 3WB2A 2Z8XA 3NIFB 4KE6A 3UH1A 2GYUA 3U37A 5FOSA 3ZD7A 4Q1VA 2ZJ4A 5KB3A 1JVSA 4TV8F 4CG2A 1JAZA 4RJIA 3D3EA 1PDVA 3EZYA 4RTSA 4Q1BA 3OEOA 4KIJA 1NTOA 2JEZA 1R9GA 4Z7QB 2GB4A 2VJOA 1A5BB 5FLYA 5KOJB 4RGQA 3G8YA 2YUIA 1Z5WA 2OB1A 3C1AA 4MPJA 5EZYA 3LHFA 4BNTA 1IUKA 1MF7A 5JXGA 1VKHA 3TEMA 4AJ1A 1MX1A 3UMVA 2O0KA 3IEIA 1VI6A 3WRWA 4LXUA 1SHKA 1EUCA 4NV1A 3MHTA 2YN4A 6NULA 5JSFA 1L5MA 4FFBB 2R44A 2RJ3A 1ZINA 4OQZA 3O92A 1JEAA 4J16C 1VYTA 4QPNA 2C61A 3SR4A 1JECA 1S2GA 2HQOA 4QUIA 2I6GA 3JCZA 1UJ4A 3MJDA 5BUQA 2J5QA 2OFPA 3A1UA 2DTEA 1MMAA 2ZPAA 1S0UA 1AH2A 4K1XA 1UCFA 4LF9B 2BZGA 1N57A 3NOQA 5AKJA 4D8YA 3STXA 5HSGA 3U6BA 5KYYA 1X77A 3HJHA 4EY8A 3QFFA 1F4VA 3CISA 1L6IA 5FOTA 5CPFA 4DVJA 1Z4MA 4PYQA 1XD8A 1YS6A 4UDNA 2LD4A 4XCVA 2XWPA 1RZ3A 4ZAVA 2VQ3A 1IZYA 1LTHR 3P8ZA 3OZGA 5K6TA 2HA3A 4WA8A 4LHEA 4I44A 2AGVA 5ALNA 3A2KA 3UGTA 5A1TA 2RKBA 4O2BB 1D8TA 1JT9A 4TRMA 2VKTA 2QLAA 2OILA 2X0CA 5JNRA 4X44A 3WMGA 3ZTZA 5EWJB 3KVRA 4LZOA 3G9ZA 2N0SA 4FFDA 2I2AA 1NV8A 5MN4A 2EKZA 4ZQCB 1X9HA 1QZTA 1Z13A 4Y98A 3KM0A 2NZVG 2ZJAA 4J0JA 4LA4A 5DHSA 2VOJA 3UO8B 1E9AA 1H2AS 2Y2UA 4RK6A 1T6YA 3JQRA 3SHQA 1X38A 2GBGA 5ENDA 5EVJA 3IHUA 2V3CC 4CMHA 5IT9A 3OFSA 3BFJA 5HNKA 4P4SB 3QUAA 2NN3C 1Q1QA 2NU8A 3QLEA 1VLSA 2HSBA 4WMLA 3K53A 4GUAA 1N0IA 4ZI7B 2B8JA 3IE1A 1Y7LA 1PJBA 3WOHA 3LTNC 2UKDA 2NTEA 2NZWA 3A31A 5FI0B 4G86A 1N75A 3ML1A 4FZRA 4TYQA 3DEHA 1DP4A 5LP6F 1S1CA 4A0FA 5HW0A 3BHNA 3LZ6A 3RO7A 3BOSA 3DBRA 3AXSA 2Q1WA 4FMPA 3DWEX 4HMQA 4UHHA 1DAIA 1OT3A 2GJ9A 1DWQA 4QOFA 1E9VA 3RJZA 4MQ5A 4ZCSA 4UBMA 3ZCXA 5F73A 4B5LA 3M34A 4TSFD 2OFOA 3KKNA 1O95D 4FQ8A 3PRHA 1TI7A 3L1KA 2Q6LA 4WZZA 2VOEA 5LQDA 3KOZA 2IT1A 4JW1A 5IAJA 3S27A 2IPMA 2OK7A 2XGSA 3VSBA 2YZ7A 3AUKA 3U3MA 4JE9A 5JTUA 3ZHCA 5SYNA 2VHUA 2ZI7A 1YL5A 4I9FA 4YLEA 3EVBA 5K2OA 3HN6A 2ZUFA 3JYOA 2BEKA 4HH1A 4EJSC 3JRNA 4TKVB 3ADBA 2ZUDA 3RKOF 5DLJA 1JQ3A 2HLDD 3N86A 4YP0A 3VZRA 4AN0A 4IIYA 1G2IA 2UUPA 1Z5PA 2ZXPA 3FZEA 1RCTE 3CLUD 3LY5A 4IHJA 1ZKDA 4Y6PA 1UQTA 3K2QA 3THOA 2GS9A 5B3JA 4R2KA 4JSYA 4QAJA 5JW6A 4N4WA 2HF2A 4YRLA 1K3UB 4MVJI 1KFKB 5K8CA 5LM3A 2R7XA 4ZQBA 1K5DA 3Q7LA 2C3YA 4UARA 1DC5A 3IV7A 3W5CA 1YR8A 2NTYC 2N3ZA 2ATCA 4KXFB 1SXHA 4LYJA 3LXXA 1RCPA 4OFXA 4HNQA 1GAQA 3W7BA 2OCXA 3FPBA 1G5RA 4KO2S 5CB6A 3H2JA 2AMYA 3RAPR 2R9RB 1R8QA 4CRWB 2WJPA 3IA7A 4N48A 4ZDIA 3KAKA 4DV0B 1X19A 4MJXA 4TTIA 3DEFA 1NMYA 4OL9A 1N3YA 3JCUQ 1VL0A 5K0NA 2JFNA 2W8ZA 2ODNA 4KBFA 2SNIE 2Z1MA 2JJ1D 4U5BE 2DFDA 1LWNA 3U4HA 3R7CA 1MN6A 3KNZA 3E7XA 3T3GA 3ESQA 2O7RA 5KJCA 2R5WA 4AO7A 3QEKA 4AJKA 4DG8A 3LMKA 4D1YA 4CL0A 4OQFA 4C89A 5IMBA 4MB2A 3FMPB 1BD4A 1EZZA 4XQCA 3R3JA 3N39C 1XALA 3QSYA 1COWA 3EXHB 1KR2A 3WMRA 4DC1A 4EKWA 5FI3A 1XTSA 2CVPA 5A4DA 3DEYX 4X94A 2YIVX 1LBQA 1N2ZA 5EXTA 4Y2GA 1G3IA 3GRRA 1TQ8A 4A6XA 3HQ4O 3MBGA 4RAQA 2OXTA 2OB2A 3SIXA 2BISA 1ESNA 3ZGZA 4TN5A 4TLDA 3EZHA 3WLSA 4ZYZA 1IPHA 3C8ZA 1PJ3A 4CQLB 2VPWA 3QVGA 1AHIA 4BL5A 3S7ZA 2YJNA 4P6IC 3ODGA 5FB3A 3IT2A 1YV9A 1OCZC 1UZUA 4HRVA 1RWXA 4QTYA 7MDHA 3UR3C 3S44A 4CQMD 4BZZA 4BRSA 4MA5A 4BBAA 2WKPA 5LQCA 1D4OA 1JU9A 1GAEO 3TJ6A 2VSQA 1JE1A 2DT8A 2Y66A 1TYZA 3I9NA 1TM5E 3E8XA 4AUMA 1I5EA 2R1VA 1Q17A 4NCBA 2H1RA 3SEQA 1IJBA 4D9EA 4I50A 5TT1A 2KB0A 2BFEB 3QU7A 1CP2A 1RE0A 5B2FA 4XRRA 1UT5A 3NRBA 4HUQB 3JZIA 3V8NA 5BN4A 1QFZA 2HLPA 1EVIA 5B1BC 2DWQA 1N3BA 1NF2A 4ZAXA 3L6UA 4ZTZB 3MCUA 1Y5LA 2O0HA 1QQTA 3AVPA 2VC2B 1DG9A 1GUYA 3OPYI 1ZSNA 1U99A 1SKMA 2NT3A 2COKA 3O3NB 1FSGA 1R37A 1QGZA 4ER9A 3AEKA 3KOYA 2TMYA 4IQ0A 3EPRA 2DJIA 4F92B 4WASA 2G0NA 4E09A 4KSCA 1K8ZB 1QIKA 1ZOIA 1FX0B 4NTBA 5IAOA 2A9FA 2O50A 2OXCA 2WWFA 5DNVA 1A2KC 4QSMA 4UHKA 2FZ5A 3C4QA 1XA3A 1E2BA 1N32B 1QLWA 1WBDA 2P1DA 2NZUG 3O93A 2VLBA 4BB9A 4LMAA 1HZZA 2X2FA 4IVRA 3LIPA 1NQOA 3GNTA 2VDMB 5BWOA 1KS9A 3OA0A 1TZBA 5L7WA 2VXYA 3BRWD 4R3NA 1JHAA 2D3TA 1THMA 3NTUA 1UBJS 1GGMA 3LHKA 3IP8A 5KVQA 4QULA 2WUVA 3SM3A 3PJGA 2HLNA 3DTVD 3HDJA 3JQFA 3ZWQA 1M1NA 1VI5A 1SMKA 2ZBGA 1USWA 4NE7A 2QYSA 4WINA 3D3WB 1QGUA 1WDWB 1XKQA 3LQFA 1RRFA 3DCIA 1LNQA 5C31A 1A76A 4BZQA 3ENKA 2ZRGA 1CJCA 3R9IA 4R8SA 4DL9A 1SD1A 3Q9UA 2IH2A 4XFDA 4R7GA 1QO9A 2QG9A 3PDMP 3E9MA 5IULC 3NU1A 1WVGA 4D9FA 2F55A 4C14A 4LBWA 5BSUA 2IHVA 5K3BA 3GLTA 5D86A 1KU6A 3VU9A 2EWMA 4DLRA 4HAVA 2WR8A 2F67A 3KFLA 1DLIA 4RGBA 2OV4A 3UVEA 5FHRA 4H7HA 4CLOA 3AHHA 2JGDB 4N06A 5E4JA 5BSFA 2VSOA 3DFMA 1N2GA 4ALKA 3K9LA 5L8VA 2JHFA 5JO9A 2ZYWX 2WZLA 2AMFA 4DJAA 3WAKA 4MVJH 2XNDD 5AVWA 1IQPA 1E61A 1PDWA 3CGGA 4RK7A 1NI3A 2R84A 4QYMA 3RT9A 4D4IA 5JCJA 3CRZA 3M4CA 2HQRA 4YRDA 3FVTA 3TRJA 2OD7A 4J07A 4KW7A 4W9MC 1D3AA 2B4KA 1ORYA 4NY1A 1BG6A 3ZVLA 4EKDA 2YV1A 3GCZA 2WSSD 1HEUA 3OY2A 1B2RA 4NMXB 3QPDA 3ZHOA 3GPLA 1N9GA 2XUJA 3UJ3X 5BN5B 4QFCA 4IJJA 4UE6A 4LOIA 1LC0A 1ULUA 3SIPA 5L6MB 1IYZA 3RS4A 3G2KA 5FUXA 1Z2DA 1EM8B 2H4ZA 1SHUX 2B4RO 5B7QA 3USCS 1RJFA 3NPMA 4M0KA 1NV9A 4G1CA 3M1AA 3NYQA 3VNAA 2WVAA 1NBOA 2RC5A 4TKLA 4DLXA 1O0BA 3QUCA 1IM5A 4O4IB 4BNNA 4JWTA 3KQSA 3UBMA 5ELLA 2ZJYA 2VJCA 4JCHA 2IP1A 4I1VA 1WKBA 3K09C 4EYSA 3CR7A 3G13A 1X7WB 1P4RA 2ZB2A 3TECE 1XT6A 1WA5A 4D8WA 3ZS8A 4ZJUA 1NL3A 1E7WA 3MBKA 3NAMA 1TZ2A 3B5IA 1KQ3A 5CIYA 4CKCB 4DSUA 2ZB8A 3VVCA 4ACAA 1P7ZA 1NW6A 2KYRA 4D44A 5HZGA 1YD7A 4HXFB 1Q57A 4GOKA 5FWXB 4QI0A 2EPNA 4WY5A 3V4FA 1TO1E 2FWIA 1QUEA 2P9EA 5E6RA 4NMWA 1DO0A 1C0KA 3CVYA 4M54A 2NTVA 1DKRA 2VH1A 1LS6A 1WKVA 2W00A 1VJRA 1QQ5A 5K2MA 4R8KA 5D00A 1HRKA 1QE0A 1CLEA 1QYXA 3VOBA 3GM3A 3W8EA 4DRXA 3HO8A 3LPMA 5TMBA 1NR1A 3BBLA 1U3UA 1O77A 1QANA 2IS6A 3ZDXB 1P5HA 1GQRA 4A2CA 1KOGA 1Y8QA 2PZKA 4YRGA 1GNRA 4BX0A 2P68A 3JX9A 4KQKA 2HJVA 1OXTA 3PRJA 1UP4A 1VLHA 3ZV4A 4U3JB 3KLOA 1R0SA 3LUDA 4EDFA 1KMHB 3A1CA 2ZTSA 2VNSA 4KFUA 1AGPA 2ZULA 4LF4B 2IQ5A 1X3SA 5LLDA 2QE7A 2KMLA 4B2IA 4AXBA 1ZNQO 1RLJA 3O2NA 3VR3D 2A67A 4Y6SA 1IW7F 3ED1A 4CODB 3WLAA 5AKIA 3GNLA 3WGVA 2SECE 3P7MA 3V4VB 2W9XA 4UREA 4N8SA 4MGHA 3ZQUA 5A6SA 4RD1A 4MAAA 2VYVD 4IX9A 3NRCA 1BN6A 4C43A 4LY9A 4NI5A 4BNXA 3CNHA 4J6FA 3E2MA 2HH9A 4BP3A 4W6ZA 3LU1A 4M1MA 1ODSA 2CF5A 1KMIY 3A2LA 3L1IA 4U0KA 4J1TC 5K3SA 2PNFA 4A1OA 3CRNA 4WCDA 1XEWX 2DECA 1QONA 1M1YA 2Q8QA 5A04A 1Y8AA 3L7JA 1NU8A 1ZAYA 3D6TB 2BMWA 4Q9KA 1ZH0A 1RWOA 3FD8A 1Z2PX 3QX7A 3CZ5A 3AW9A 2HDNB 1QG2A 1Z47A 3E9EA 3P0JA 2YHUA 4YCJA 3Q8WA 4LGMA 1GPYA 3X1JA 5M04A 1ZN2A 1CIJA 3OO0A 3E9VA 2YBDA 4R3UC 2V6MA 1SIOA 3KTAA 4GYJA 1U5AA 3KHSA 5J4LA 5LB2A 2VNKA 4YO7A 2G28A 3ROGA 3UT5B 1N6LA 4ZT2A 5TT0A 1N7JA 1V5FA 3NHYA 3UB4A 1SC4A 2DQKA 3OM0A 3CYFA 4P9NA 4M9XA 5EMKA 3GJXC 3ZPXA 3N8DA 2CDAA 3DQQA 3L3BA 3PV0A 2PNJA 4Z2AA 5BNIA 1UJCA 1BIFA 1UBOS 4LY3A 5CVTA 4OI0A 3QX9A 3U44A 1EK6A 4LCEA 2GDZA 4C7BA 5JPDA 4YAUA 3RRZA 3SZUA 4E51A 4BGUA 4H77A 1Z23A 4BGEA 3RRYA 1E6MA 3M5DA 4MIYA 2XA9A 3UB3A 2XRMA 4NBUA 5C35A 5JVDA 5JBNA 3EEOA 1PFKA 4HQFA 4C7VA 2JFUA 4MROA 4X95A 4XH9B 4DVGA 4IH9A 4RKRA 2VA8A 3GZJA 4F06A 1EI7A 4P4NA 3PL1A 3TZLA 1QORA 3UEOA 1PEDA 3A4YA 5JCXA 2DQZA 1G66A 4KJXA 3QLVC 3GMDA 2XDQA 3UK7A 3RODA 3DKKA 1PUJA 2ZIAA 1B1AA 3N70A 4JZYA 2JI8A 2XD4A 1U2EA 2VSFA 3DC7A 4Q4HB 3CNLA 2ZRJA 1N2XA 4B3DA 2WAXA 3MERA 5BW4A 2WWIA 4QGFA 1PV3A 1GG9A 5HRAA 2QEQA 3GBSA 3ZH2A 2DBQA 5FIUA 1D0IA 3PEFA 1LLDA 1XQ6A 3HVJA 3VH1A 2QF7A 1Z5VA 2VUIB 1AMOA 3CUYA 2KPOA 4JP2A 2J09A 4JNKA 5AUQA 1JI3A 2IDMA 5C3UA 2DGJA 2A1DD 1D0XA 2DR3A 4FWIB 4RZUA 2EP5A 4IILA 4PTLA 5HGXA 5JEDA 4QXPA 4CEIA 1Y7HA 1TX4B 4MEJA 4ZJZA 2WG1A 1JJIA 2IYWA 4L9SA 4QTUB 4RKEA 1T0UA 2Q5HA 1NVFA 1X8KA 1BU8A 4M98A 3EXG1 2ACWA 4DCSA 5D84A 4FYMA 2WJ3A 4UC0A 1Q1EA 4G25A 1ORRA 1SIWA 3LFHA 1XTVA 3O3MB 1CZLA 3HP1A 3EZ2A 4FI3F 3ZU5A 2XL4A 4I36A 1W0CA 5DLDA 4LOKA 3H3FA 4BTLA 1QCCA 5LMUB 1OREA 2BYTA 4DG5A 3BWBA 1OLUB 1W52X 5GAJA 2O8FB 1HDIA 1UZLA 1TADA 3ZBTA 2WWWA 4E12A 1K4KA 3N0RA 4DIKA 2VHWA 2CKDA 2KE5A 3IPXA 3EHDA 2HWYA 2G3YA 2R8EA 1GTZA 5GY7A 5F7ZA 5DCWA 2N42A 3H3JA 2QE6A 2WYWA 1CVIA 3NEAA 5KYUB 5F77A 1UBEA 1T9ZA 1SK9A 2BMFA 2IXGA 2BGUA 1KDRA 4GNRA 1HDZA 2CLHB 3K5HA 4I8XA 3BGSA 1E3MA 1GTJ1 1G8HA 1UUFA 3QNUA 3TLMA 5KSPA 3SZRA 3SE0A 5ALDA 3MILA 3KBBA 1QP7A 4URVR 2KBEA 4B3GA 5JVEA 3AQBA 2XBMA 1VA4A 3RROA 4MQEB 2OFWA 4JU8A 4IYRA 1Z37A 2NMVA 1DIRA 3FSRA 2OBNA 3EDCA 3CVJA 4OHXA 1H6CA 5HZKA 1ZIYA 2LTAA 3E81A 4X1OA 2QP9X 3T9DA 2JB9A 3AL0C 1WL8A 4UU0A 5D2CA 5ECYA 3RTCA 3EVZA 5K0ZA 5K0EA 1M2WA 1JKJA 1DRUA 4M9RA 3PENA 3FHTA 3LUTB 3QE3A 2BTEA 2A8YA 4OYYA 2HB6A 4OSEA 1BCSA 3AOEA 4DLWA 2D1QA 3ASZA 4XI9A 4HDAA 4UUNA 2PWAA 3CG4A 4PNZA 4TMFA 3AVTA 2YW9A 1S05A 3IKVA 1UT6A 3B6IA 2FSHA 1OC2A 2BE7A 4FE7A 1GG8A 3RVYA 4QT0A 4AF8A 3QWAA 2AF4C 1OLSA 5BWMA 3OZIA 4QQRA 1L9XA 3JTEA 4TWJA 3KR1A 3JTMA 2PQMA 1B15A 2GNOA 3IIMA 1QMPA 4DIEA 4G63A 1GTSA 4F2DA 1A04A 1QRRA 3GFVA 5KYWB 1W44A 5CU7A 1G16A 2EFJA 3KWLA 2P4SA 3WKEA 4FZJA 2X5XA 2IE8A 5EHZA 4FSXA 1NFOA 4OM8A 4YCSA 4JXXA 2IUYA 2CNNA 2RKOA 1AO0A 1NATA 3A9UA 3P2MA 4A0RA 4OHVA 3JWHA 5I45A 3GHYA 3LX6A 4JP8A 1HETA 3MS7A 5UKDA 2HPZA 4FEGA 1BXZA 3B3AA 2OCGA 1NPYA 1FP7A 1MNEA 1BD3A 1X7ZA 2J3KA 2IYSA 4HWGA 2HOQA 3ZK7A 1JTEA 2NXNA 3Q7RA 3H0KA 4P1ZA 1F8YA 2WJ6A 3LRXA 2BBSA 5AVZA 1OASA 2EZUA 1SHZA 3HUDA 3FCEA 2ZITA 1I4TD 1WZEA 1I36A 2J3LA 4R1TA 2Q9UA 5ALQA 2QPTA 2QN6A 3HNRA 3PKJA 1S89A 3K9WA 3D6NB 1VB3A 1W0KD 2WTXA 3LCCA 2FEMA 4NBWA 1OBVA 2FW7A 3NBQA 4EB6B 4PN3A 4M38A 1QF7A 4KYUA 5KKNB 3BD9A 1UPFA 3U7GA 2PGOA 4D4LA 1SBNE 5ESRA 1WW8A 2QM7A 1L5FA 2VHZA 1OFVA 5AK0A 1OAKA 1YB1A 2W6JD 2I91A 2Q3FA 4IO1A 3DGFC 3ADCA 4G4SP 1Y9AA 1Q0MA 3GDHA 2ZW9A 2O7QA 1IN6A 1HQKA 4BX2A 5KMGB 2RI0A 1E3QA 1XZLA 1Z7WA 3ECAA 3HY4A 4EKYA 4NCXA 2R4TA 2QG4A 1U9YA 3BRCA 1DOHA 3AKCA 4J0FA 1FFHA 1JBEA 2V8BA 2OCAA 2Q7OE 1EFKA 3GRUA 3GELA 3QELB 3DFFA 2Q99A 3OP1A 3IT3A 1N5IA 2BE9A 1OGIA 3DAPA 4FNMA 1Z6ZA 1P33A 3BIJA 4JLBA 5GVRA 3IHTA 2WUFA 2BFDA 2R7SA 2XI4A 4HLUC 2B7CA 4ZCRA 4CM9A 4TRRA 1KI2A 3M6WA 2F62A 4CVNA 5C8DA 3JU3A 4EBJA 2G9NA 4W7SA 1L5HA 2C2ZA 1MIOA 4X84A 3WBFA 4EUSA 2ZWOA 4YCCA 5CI8A 2C2XA 4BCBA 2YMMA 5GPBA 2YQZA 1AF4A 3L1JA 1YKGA 3TTWA 3SS8A 2JIZD 2DEUA 2R03A 5CYOA 1K9SA 4XIIA 5H9VA 4N6CA 4BO7A 3SR0A 1KAMA 1GKLA 3RRNA 1PVOA 1Q11A 2FHSA 3DZFA 1QBGA 3CPJB 1T34A 2JD0A 5JALA 3I9JA 1G8MA 1C3JA 3QWBA 3F9CA 1YL6A 1IZ0A 1NKSA 2IY9A 2GH1A 4I9GA 1GRRA 4DEYA 4B3RB 1M76A 1FL9A 3IQGX 2Q6IA 2IUSA 1DVRA 4Q21A 2VBIA 5H5JA 3Q2OA 3L82B 1KRHA 2B2XA 4KWCA 4F2HA 1LDEA 5A7FA 3TL2A 4IWNA 2HWUA 3GFPA 2OA0A 1AZTA 3DNPA 3E9QA 3U1VA 1B6TA 3VJLA 3WVNA 3V8BA 4U5DE 3S2FA 3L18A 1PBNA 4Z49A 2HMWA 1JYSA 2ZQ5A 3H8VA 3DE3X 5KSWB 3N9IA 3SDSA 3UPDA 1NRIA 4I99A 1V0JA 1GDHA 4GRAA 4DDUA 5BSKA 2G36A 4GEGA 3NS7A 2DBZA 3OHSX 1U8ZA 2VJBA 5C4MA 1U7WA 5IDQA 2XXAB 3D8RA 4YB8A 4ZN6A 2OWEA 1K7CA 1YU9A 5B3JC 2J9RA 2PBFA 4FDAA 4PYOA 2PDAA 4PS0A 4QPJC 3IOMA 1FFXB 4MVJF 3MTAA 3RJ5A 4MKIA 2AG5A 1JI0A 2GZMA 1PG5A 5JUWA 4WZAE 1P81A 4DLVA 4GLLA 4TMWA 3WADA 3TVYA 3VR4A 3VYTB 4HWKA 2XR1A 1V96A 4YRCA 2GEFA 1WOLA 1U0FA 1OX5A 3DKIA 1HYHA 1JEOA 2D5AA 1A96A 2YX1A 4TTQA 3ITNA 2CHEA 4QUBA 1O6CA 3O0TA 4G7ZF 2D59A 4JIMA 5IT0A 2GFHA 5KDDA 1H6BA 4O1HA 2Q07A 1KDOA 3E8MA 3AGTA 3WYCA 1JV2B 3BPSA 4IX1A 2ZXFA 4URWR 4DNPA 4YAEA 2O8CB 2YVLA 4L16A 4MTFA 1XU7A 3FGNA 2XLVA 4CUJA 4ONEA 4ZIRB 2OY0A 2O06A 2IEYA 5C4IA 1HG1A 2ABWA 2QP4A 4K2HA 3W7VA 1MHPA 5KVAA 1DAKA 3L0IB 5K99A 4JI7B 1ECGA 3EPPA 4OL0A 1BJKA 3QFTA 5C37A 1O7JA 2CJPA 1JA0A 2J4CA 2VUUA 4Z51A 2PUGA 3FPEA 1GA4A 1RKUA 4RNCA 5IKXA 1MC8A 2KW5A 3S29A 1XQVA 3U62A 3RYFA 1FRNA 3FYUA 2Q9CA 5HIJA 1G8FA 4URYR 1LE4A 5L7YA 3QOWA 4WUTA 4MW9A 1MDFA 1L8LA 2OSBA 3C3EA 1LSJA 4Z5XA 4IGEA 4WA7A 3N8GA 2GMWA 2NPFA 1EQAA 2E21A 4N65A 5B3IA 2VCCA 3THXB 1Q95A 4UAJA 3LBHA 1FVXA 2WPDA 2HNAA 3EOBI 2C03A 1PNRA 3REFA 2QGFA 5DN9A 4MKGA 3W6UA 5F3WB 2FE4A 1SRQA 3GT0A