4KNWA

The crystal structure of human hdhd4 in complex with magnesium and the phosphate mimetic vanadate
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
239
structure length
239
Chain Sequence
SRVRAVFFDLDNTLIDTAGASRRGMLEVIKLLQSKYHYKEEAEIICDKVQVKLSKECFHPYNTCITDLRTSHWEEAIQETKGGAANRKLAEECYFLWKSTRLQHMTLAEDVKAMLTELRKEVRLLLLTNGDRQTQREKIEACACQSYFDAVVVGGEQREEKPAPSIFYYCCNLLGVQPGDCVMVGDTLETDIQGGLNAGLKATVWINKNGIVPLKSSPVPHYMVSSVLELPALLQSIDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N-acylneuraminate-9-phosphatase
publication title Design, synthesis, functional and structural characterization of an inhibitor of N-acetylneuraminate-9-phosphate phosphatase: Observation of extensive dynamics in an enzyme/inhibitor complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 84
structure length 239
sequence length 239
chains with identical sequence B, C
ec nomenclature ec 3.1.3.29: N-acylneuraminate-9-phosphatase.
pdb deposition date 2013-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.710 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4knwA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4knwA01
3QU4A 1CQZA 5ALRA 3R9KA 1VFPA 3OCWA 1Q92A 1RMQA 1YDFA 3SMVA 4G9BA 1L7MA 3NRJA 1U2TA 1L7NA 2WF9A 3ZTYA 1RRCA 5ALXA 2O2XA 4UASA 4O8CA 1U2SA 1WZCA 3KBBA 2EARA 4JB3A 4UMFA 3SLRA 3I76A 4KN8A 4AS2A 2GFHA 1TJ3A 1L7OA 4YGYA 5ALWA 3I1YA 2RB5A 4XOUA 4UAVA 2RARA 2JAOA 2HI0A 5AK5A 1RDFA 4Y2UA 1NRWA 1Z4LA 1RKVA 4CNQA 1TA0A 2W4MA 3DAOA 3VAYA 3OCXA 4UMDA 1MH9A 2AGVA 2CFTA 4GXTA 1JUDA 2QLTA 4BX0A 2ZBFA 1QYIA 1U02A 5IT0A 3AR6A 1T9ZA 4BNDA 2HSZA 3E81A 2HO4A 3SKYA 3ZI4A 4YCLA 1ZJJA 1Z4NA 3EF1A 4NWIA 1RKQA 5ALQA 4F72A 2IA5A 5AW3A 1K1EA 4Y2QA 1Y8AA 4UMVA 5AI6A 4UW9A 5E0OA 3DDHA 5AVZA 2FPXA 2YJ3A 3RF6A 4AS3A 5ALOA 3E84A 2JAUA 4BBJA 5JJBA 4BEVA 4J2TA 1ZS9A 2P27A 4Y2JA 5AKJA 3QUTA 2C8KA 2RAVA 3L8GA 1XPJA 5AM1A 2G09A 3FM9A 3ZU6A 4HYTA 3M9LA 4HGOA 5AKGA 3FZQA 5ALVA 3UM9A 3U13A 3OCZA 1Z4QA 1TJ4A 4Y2SA 1T5TA 3U7GA 1RLOA 4OFZA 2YBDA 1TJ5A 3A3YA 1LVHA 3ZTWA 1XVIA 3WK5A 3ZUPA 3U7FB 2ZXEA 3UMBA 4ZEVA 2HEGA 3W5AA 4BX3A 3HYCA 3MMZA 2AUTA 3OPXA 5AVTA 4UM7A 1O08A 2B1RA 2O9JA 2QYHA 1SWVA 2MSNA 5AW1A 3CZ4A 5AVUA 2I7DA 4EX6A 3P96A 3U7HB 2I34A 5AIBA 3WGUA 2Q4TA 2YJ6A 2YMQA 3WKAA 2OA0A 2FI1A 2R8EA 2C8LA 3SD7A 5AM0A 5ALIA 3KZXA 3U19A 3ZW7A 2YJ4A 4I9GA 1N9KA 5AIAA 5AVVA 4BEWA 1O03A 2ZG6A 4Y3UA 1WPGA 3GYGA 5AKKA 3ZWDA 3B9BA 3N07A 5AVYA 4KNWA 4Y2RA 5AI5A 1VJ5A 4UU1A 4ZEXA 1RLMA 5AVSA 4Y2VA 3W5CA 1YMQA 5ALLA 1RPZA 3WGVA 4BKMA 1CR6A 2RBKA 5ALPA 4CF5A 2WF5A 4NABA 2WFAA 3ZX4A 2HX1A 3AR8A 2B0CA 4EENA 2G0AA 5AK6A 1QH9A 5A3RA 3N5KA 3J7TA 1ZOLA 1F5SA 3L8EA 3U7EB 2ODAA 2HDOA 3MPOA 1Z88A 2OBBA 3QUBA 3D6JA 4B6JA 2X4DA 2YMLA 3PCTA 1NNLA 5AHXA 4YCNA 1LTQA 2FUEA 3QUCA 5ALKA 5AW4A 2FPSA 4KNVA 2G07A 1RQLA 1YNSA 4CE6A 4DWOA 1S2OA 4C4RA 4YIKA 4YIHA 2WF8A 5A3SA 3ZX5A 3L1UA 1RKUA 2NO4A 3NANA 2B82A 5AI9A 3EF0A 2PKEA 5AI0A 2CFSA 3NALA 2Q4RA 4KX5A 1L8LA 3ZWKA 3CNHA 4CF4A 4GIBA 2HF7A 3M1YA 2AH5A 1Z4IA 5AM4A 2G1AA 4EZEA 3N28A 4UM5A 3KD3A 3QYPA 5AW6A 4KX3A 3A1DA 4C4TA 1TE2A 2GMWA 2JARA 2W43A 3WKEA 3AR3A 4YH1A 2WF6A 3E8MA 2B8JA 3OTQA 3FPBA 2YN4A 3EPRA 2YJ5A 3QXGA 2Q5EA 5AESA 4Y2YA 5AKYA 4BNDB 4L6AA 2ZBDA 2NO5A 5AKHA 1YV9A 2BDEA 3PGVA 3I28A 3QGMA 2G80A 3L7YA 2I55A 4FE3A 5T41A 3AR5A 3ESRA 3ZVMA 3R09A 1Z5GA 4JDPA 4L57A 4I9FA 3WKDA 3F9RA 2JGAA 4NAVA 1Z4MA 3BWVA 5AM5A 3WK6A 1EK2A 4PNHA 1WR8A 4DCCA 3PGLA 2YMMA 2NYVA 1U7OA 5AVXA 4MUMA 1AQ6A 2G06A 5AI8A 1L7PA 4UARA 4HGQA 5ALHA 3AR2A 2IOFK 2JAWA 5ALTA 1S8OA 3AR4A 4L6CA 4EELA 1SWWA 3QU9A 1QQ5A 3L1VA 5AVRA 2HF2A 2OM6A 5AKLA 3IJ5A 5ALZA 3ONNA 5AW0A 3FVVA 5IS2A 1RC8A 4KYTA 4YCMA 3NIWA 4FYPA 2G08A 3ESQA 4XQ0A 3L0YA 5AW2A 4RETA 4OHFA 1L8OA 1YJ5A 2ZBGA 4UU0A 4H1WA 4UAUA 4ZEWA 1Q91A 2EAUA 5A3QA 3OCYA 3E58A 5AVWA 3PDWA 5AK3A 1FEZA 5ALNA 4HGPA 4IFTA 2GO7A 3SF0A 3WKCA 3WK8A 1X42A 1Z4JA 2ZBEA 5AKEA 1Z4KA 2IOFA 2IOHA 2YY6A 3OCVA 1L6RA 3UMGA 2OYCA 3WK7A 2YMPA 3EWIA 4CF3A 3UMCA 2EATA 3FGOA 4NV0A 5IT4A 1PW5A 4EEKA 1ZD4A 2R8YA 3QU5A 5AICA 3IRUA 5AW5A 2FPWA 1ZRNA 3WK9A 5AKZA 3B9RA 5ALMA 4J03A 1T5SA 1IWOA 1EK1A 3KOOA 2HOQA 4IG4A 1YS9A 1RLTA 4HGRA 4C4SA 1RMTA 3TLMA 3ET4A 3ZVLA 1WVIA 3QLEA 4QQFA 3KDPA 3ZVNA 1ZD2P 4UMEA 2MU1A 3DNPA 2B8EA 4UATA 3SKXA 3ET5A 2BDUA 3K1ZA 2VKQA 3FPSA 4F71A 3L8FA 2PR7A 4RESA 1RMYA 3I6BA 4BYGA 5AW8A 2I54A 2D2VA 2R8XA 3L5KA 3B8EA 1ZD3A 3SHQA 1Z4PX 4QJBA 3NAMA 3N1UA 4EX7A 3BA6A 2YFYA 3QU7A 1NF2A 1J97A 5ALUA 2I6XA 1N8NA 2GHQA 2CFRA 5AM2A 3MN1A 5ALDA 2IYEA 4FFDA 1J8DA 2WHEA 2B1QA 3L0CA 4Y2PA 4XPZA 5AKXA 5ALGA 3A1EA 2PQ0A 5ALSA 4HGNA 4Y2TA 1ZD5A 2P11A 3QNMA 1Z4OA 3MC1A 5AK4A 3U26A 3AR7A 4AP9A 3N8GA 2P9JA 4BX2A 1KYTA 3AR9A 2FPRA 2BY4A 5AW7A 3QUQA 1XP5A 2AMYA 3WKBA 5ALYA 2FPUA 2C9MA 1RQNA 2W11A 1SU4A 1Z5UA 2CN1A 5AW9A 3ED5A 2FEAA 4HAIA 2C4NA 3DV9A 1QQ7A 3A1CA 5ALJA 3NUQA 2ZOSA 2WM8A 2DQSA 3W5DA 5AI4A 5AM3A 2HHLA 1U7PA 4OD0A 3WK4A 5FP0A 1QQ6A 2P69A 3RFUA 4Y2XA 4XE5A 1VJRA 5ALFA 2FDRA 3L0BA 4NFLA 3NASA 3L8HA 4G63A 3S6JA 3KC2A 2HCFA 2C88A 3HLTA 1ZRMA 5AVQA 2B30A 2WF7A 4DFDA 4MWOA 3QX7A 5ALEA 5AKIA 2R8ZA 4OCZA 4E88A 3IB6A 2FUCA 3R4CA 3W5BA 4DW8A 2I33A 3QU2A 3OCUA 2GHTA
chains in the Genus database with same CATH superfamily
4MIKA 3IOEA 5AGFA 1KMQA 3OJ0A 2L6GA 5EIOA 2DR2A 1AHHA 3O95A 3UJ6A 3M89A 2VYVA 1OH8A 4WVFA 3NMUF 2BKAA 4BZQA 1L7OA 4NDAA 1XDDA 4EHIA 1JMYA 1QC5A 3ENZA 1J5EB 5JSHA 1ENPA 2C1EA 2N0SA 4CNQA 3AILA 1UADA 3ABIA 3C3EA 3FFBA 1KOFA 5LJIA 5LQDA 4EB8A 4DZTA 1H8ED 2GYWA 1QYIA 5HM6A 1IEVA 5DM4A 1D03A 3GRVA 3RYCB 4AKGA 5DBHX 1K1EA 4NCXA 4BDSA 5D3MB 1WABA 4BN5A 4ZGGA 2OPHA 4EHDA 4G7ZF 2BZGA 4R5HA 3OIVA 1ZNYA 4RWZA 1WKVA 1M5UA 2XUGA 4YCDA 4U5CE 3V34A 2DX7A 1GLVA 1S2LA 3KYCB 5AHOA 5FQNA 1LFDB 3R7DA 4U5BE 1WG8A 4GMGA 4FZVA 2ANBA 2Z3VA 2ZT6A 3WK5A 1LLDA 1QKIA 4BX3A 4H7EA 3M6VA 5EHQA 1BS1A 5JRAA 1WZ2A 4CL0A 5KKAA 4S35A 5BMVB 4WLUA 3FGPA 1E3EA 5C31A 4EYSA 2V7QA 1HE1A 4KNWA 2BF4A 5ALLA 2G40A 1H8HD 4WZAE 2DKOA 4EL5A 4BGDA 2PDAA 3MCAA 3UAGA 3LSTA 4LDKA 5KSWB 3NHUA 1N9ZA 2A57A 5DP2A 1YMUA 2E4WA 2ZI7A 1LNQA 2XUZA 4HGYA 3I34X 4Z49A 1SKQA 4BZXA 1SCKA 3AHDA 1H0KA 1XRNA 1XFDA 5DI3B 2MSLA 3VH4A 3SC3A 4IM7A 5K8VA 4CF4A 1CQPA 4C5AA 4HQRA 1I1NA 1BXRB 1U2QA 4KXNA 3VFDA 3I5AA 4WWHA 3M15A 3FCYA 1OA0A 4FNAA 3E8MA 1U8XX 3BH6A 1MB3A 2B8NA 3DG9A 4NXNB 1JSCA 1N2XA 3EIFA 4Q47A 1E9SA 1DRWA 3MILA 1QLJA 4ZIRB 2ZTLA 4GPBA 2PFDA 1J7KA 1KO8A 4N3NA 4DCOA 4G9GA 3G02A 1F6WA 4YDHB 3PNPA 1BYUA 1XB2A 3V5XA 2FK8A 4F9GA 5ALHA 3Q12A 1G2OA 3ZI7A 4OGKA 4TWZA 4MVJD 1CUVA 1J25A 1RAFA 1P8AA 3QW2A 1OXUA 4IHJF 3WRYA 3OM9A 5HSGA 1PFWA 5DHUA 1UC9A 2TMYA 3FZEA 5LLTA 2DERA 4HWPA 3T1HB 5COMA 3P97A 2LKDA 3HHEA 3P94A 5EIFA 1QYDA 4EJSC 1P18A 1YUBA 1RMTA 2QGNA 5JIBA 5D92A 1NWCA 5CK4A 2WC1A 2ZAIA 4IX9A 1E2LA 2PR7A 4Q93A 4CODB 5DHFA 3NAMA 3CBQA 2YZKA 1XEAA 4D8YA 3LMKA 1COWA 1D0SA 1BH6A 2JFOA 2OEPA 3MT9A 4I1SA 2Q0HA 5H4HA 3OF3A 3I9LA 2OO7A 1HKUA 4KC0A 3OIGA 2FHPA 2XE6A 3DL7A 2ZXWC 3NCHA 3EFOA 2CDRA 2DRIA 1QYCA 1X1TA 4FGKA 3IUSA 1A2OA 1JEQA 4OXQA 4JEBA 4YJFA 3TG8A 2R6CA 1GGJA 1P0CA 3HMKA 1PJBA 2QTAA 5MGBA 2NZYA 2NO1A 3FWZA 4NFLA 1GG8A 2FSSA 5DNWA 4QBHA 4DEXA 5A02A 3K7DA 4TTJA 3ANYB 4F86A 3CRVA 2Q3LA 2WI8A 1NBEA 5HMLA 5TGDA 3QFFA 5HOEA 4S2UA 3CVUA 3TZBA 2RH9B 4GL2A 2CXTA 1VPLA 1CE8B 3O91A 4YP1A 4LWPA 1O95D 1OXBA 4ZDWA 1OOEA 3WGMA 2OGZA 3TBFA 4E7SA 4PLFA 2Z43A 4LJ5A 3A70A 3U1BA 1OW7A 1YBFA 2JLXA 2SBTA 2K6GA 2LXNA 2NUAA 2XE7A 4QOIA 4O79A 1NJ1A 2QN7A 3PFNA 5G02A 1EFTA 1IY0A 1M0SA 4QOEA 3TGLA 3AKEA 5EGSA 3RRNA 1O0SA 1A9XB 2B0JA 4BLSA 8GPBA 1ESNA 3OMLA 4XWGA 3F74A 4W8OA 1A72A 3AJDA 3MS2A 3QXCA 1H2XA 1EHCA 4PEVA 3D8BA 1VSTA 5HK8A 4UJ3A 1P2GA 1KS9A 1W0CA 4ZEOA 1I3MA 4Z2AA 1KZ6A 2WKSA 4KQWA 4EUNA 3N3BC 1J21A 1ZGHA 1P81A 1JYSA 4X3OA 2QLJA 4X1IA 2HSEA 2QX4A 4RM3A 1LX7A 1QUEA 4AF8A 5AXAA 4PYRA 2AMFA 4IXMA 2LPMA 1ZESA 2QE7D 2IWRA 4JH0A 1WVGA 2P2CA 4N3AA 1RXQA 1LJUA 1V26A 1JIKA 2L42A 3R3SA 1L3CA 1R27A 4K28A 4C88A 1Y34E 3O5AA 2TS1A 2NAFA 5E6UA 3GF4A 3GM3A 1Y1QA 4MRSA 3NHSA 1P80A 4JLMA 5BV0A 1CEQA 2Q4RA 4IQ8A 1N75A 2OXFA 2GUGA 1NBWB 3D5TA 3H5OA 2AH5A 5HKAA 3L4SO 3ECAA 3FUWA 1QS0A 3RGGA 3DHNA 4MIEA 3NWJA 4U5EE 2QRPA 2Z57A 2OKGA 1FRFS 3OOHA 4KQIA 3CW8X 4DR6B 4WY5A 3S70A 3MSXA 4NOLA 1QGAA 4L9AA 2RGEA 4P31A 1JEYB 5AI8A 4ER7A 3SVTA 2Y1LA 1FDOA 1QIEA 1IEQA 2BGGA 4RTSA 3C14C 5JDCA 4JQCA 4NYJQ 4NCIA 5CYPA 1PR9A 1J9ZA 2OCGA 1ZH6A 1XWIA 4BS9A 1UCFA 1VKHA 1GVHA 3JQAB 1OD6A 1CLEA 4AL0A 3JARA 4DT1A 4LQCA 4Y9SA 2JHAA 4QASA 4YLGA 3V48A 3QPDA 5FAKA 5FX2A 4GAEA 2WY2D 3FPLA 1E4EA 2G04A 2R5WA 3RSSA 2TMKA 4BTLA 2HBQA 1XLTC 1B8UA 4LY0A 4B4VA 4J03A 1RVV1 4XTRA 5TVGA 3SSOA 5JAZA 1FMLA 4FGLA 1IWBB 4BQRA 4RTPA 1CUAA 1UC4B 2DBRA 3NKVA 4QVIA 4U9IS 3RU9A 4QRHA 2BFNA 2A67A 1ZEJA 2AOVA 4J07A 1E2MA 5L51A 5KWJA 4YALA 4IPTA 1BWPA 2R7NA 5BSMA 3WRVA 3KKLA 2CUZA 4D4IA 2HXGA 3LY5A 5HF9A 3VOAA 4MVJM 1LPBB 4FW9A 1QO0D 4KIUA 4P53A 4AZ3B 2H5JA 3QMKA 1L5KA 5FOXA 4ZVSA 2HLDA 4D1YA 5IYZA 1QH8B 4HEA1 4M46A 4BRSA 3JCUQ 4X6XA 3UY4A 4DV7B 1ZH0A 4RK7A 2LCQA 4D6PA 4QE3A 1DL5A 3NYLA 2X58A 1NRXA 2HRDA 3B12A 3OCUA 3QU4A 1MPXA 4ZDJA 4MPPA 4B71A 1Q92A 4KWEA 5FTLA 1AK9A 1RRCA 2BGRA 4R7GA 4IIJA 1G8AA 1S05A 1Q2XA 3OPYA 2EW8A 2V6BA 5LD2B 1FJXA 4AJJA 1GKYA 1V1MB 4F8JA 1AKYA 4OLHA 1E6EA 4Z1MD 2CZCA 3W5HA 1GGEA 4JC5A 2JFFA 2XA9A 2G3KA 4G1MB 3GJTA 3V4RA 1WBBA 4PLGA 4OU4A 1J39A 1ODIA 4EGFA 1XOIA 4IZ6A 4F4FA 3QF4B 1U7HA 4FGSA 4YL1A 2X0DA 4AS3A 3DKRA 4ZRNA 3I3OA 1N4DA 1DAMA 4MPRA 4GUAA 2R00A 1K6MA 1ZK1A 2X0KA 4XSHA 3ZBTA 1WMFA 2PUBA 2OCBA 4G0ZA 3R0VA 3KSMA 5FQOA 1N2ZA 1TD1A 2Z2ZA 3REFA 3QMMA 4MTCA 1PWEA 1U0BB 3QY0A 2I7VA 3OF2A 1I4OA 3GCDA 4RJTA 3ZWNA 4FSDA 2AX3A 1TI7A 4ECAA 4PSUA 1N6RA 1XEXB 2V26A 2QT9A 2WD9A 5JS2A 1I4DD 2R8EA 1E2IA 4JA0A 2E6KA 5H7XA 4UHFA 4OHKA 5BUOA 2GEKA 2RK3A 4M7OA 3IAS1 3WGIA 2I65A 1UODA 2B5VA 1R6UA 1Q7EA 3Q7GA 1IUPA 1VJ5A 1E2XA 4WLNA 4BRZA 5I7UA 3C1OA 4BCBA 1YZGA 4BMDA 3HWSA 4AJ4A 4Y1RA 4K9SA 1ZGAA 5IZCA 3K72B 1C80A 4E13A 2O9XA 4NE2A 1E2PA 3IOCA 2PKWA 4KI7A 3ZTTA 2CHEA 2W9XA 1MO2A 1YJCA 1TKNA 3OETA 2MYTA 1KMHB 2RHOA 2H48A 2AJCA 1Z34A 2WUGA 3EXHA 1Y4AE 1KXZA 2VATA 2LIGA 4JL6A 2Z98A 3HV2A 3KPJA 2XKJE 5AESA 4OINF 3TRIA 4DZZA 5FPPA 3KTDA 4KQGA 2OFXA 4TKUA 2IE8A 4JBIA 1FQKA 1UT5A 2JCGA 1TMKA 2IPNA 1X8XA 1G63A 1P9OA 5TMBA 4RPKA 1EVKA 5K51A 2G5CA 2QNRA 3EZFA 3PTZA 1E1NA 4OHUA 1LIHA 1SXJA 2OUKA 3K9QO 2JCYA 1ZP6A 2Q4DA 4OI2A 1FYEA 2NOAA 2BW0A 1A98A 3GGGA 5DV9A 4QT4A 1N8SA 5ECWA 1UEIA 4E0HA 5ELMA 5G40A 5DGDA 5A3QA 1YUMA 5ANRB 2HCRA 3MMXA 4Q3EA 1VCIA 3LGAA 4A2NB 3WK8A 4Y18A 4HEQA 3S8EA 1Z2PX 1B0AA 4GWKA 2GYUA 3SJZA 4B3RB 3PSAA 1U81A 4A8TA 4WRRA 3O73A 5K8JB 1OBFO 2G62A 1LPPA 5EJ7A 1MO3A 4KPYA 4XB2A 1Y6DA 1SHUX 2IOYA 1EUCB 5B7NA 2WU8A 3PDMP 1CJMA 2HA7A 1LI7A 3PRHA 2WSMA 1R6XA 5K7SA 4KYIB 3WYGA 2ODPA 3RFYA 1VGRA 3I1JA 3HCWA 5FNVF 4P83A 3D3EA 2L19A 2Q5HA 5BUCA 3RVKA 4DY6A 1R66A 1IBMB 3WQSB 1RHJA 2CV0A 3A9SA 1IZ0A 1VXRA 4KNYA 3O9MA 2DR3A 3T4EA 3WQHA 3OH8A 2Y0EA 2AF3C 1X9HA 2WJGA 1P9RA 2VJNA 3NC0C 4KR7A 3EWSA 3FOZA 4P5EA 4U39A 3TR6A 3B2EA 4H6PA 4QIHA 3SYRA 4MRVA 1AIPA 5TRTA 4NCBA 4E21A 1X80A 2PXCA 1TYZA 1YULA 1QZTA 5GONF 2K2WA 1OH7A 3UIEA 2WDZA 4RVHA 2OFFA 1CUFA 2WZBA 3FDXA 2JD1A 3WGQA 3EIXA 2VYCA 3COWA 3D3NA 4ZVUA 3DDNA 4ON9A 3LZ6A 1HYEA 3GLGA 4MDYA 3O4RA 4UUQA 1CERA 3TO5A 4R2MA 1HRKA 5BW8A 1Y1KE 3TLYA 4A0HA 3E81A 1E4VA 1AO0A 2QTMA 1S8NA 1Q0UA 5DXAA 4KO4S 4N6HA 2DPXA 3PE6A 3W0LB 1AUPA 1NLUA 2ERXA 2B5OA 1DMSA 5DN6A 1OHHD 2PS1A 3HGQA 3LVFO 4U9HS 3NDRA 3N3AC 1KWKA 1TM2A 4LMBA 4A4AA 1KU6A 3JVEA 1WUTA 2ZJZA 4P2GA 4C3EA 2PJUA 3JQDA 2XMPA 3SSMA 3NCTA 4CQLA 1XMQB 4V0SA 2BE5F 4QYTA 2ROQA 3E9DA 3FPHA 4M7WA 3FOPA 1P1HA 4YP6A 1YJAA 3TCKA 5IJWA 2OK8A 1PJQA 1AUEA 2ZIVB 3MPUA 5AC5A 1W0KA 3GQBB 1EX6A 1I4TD 3HFSA 4BMSA 1UQTA 3AHCA 1Y5LA 2GH1A 1T13A 5ICCA 3KETA 3CTPA 3P32A 2O57A 1UXIA 3N0RA 1XX6A 1WTAA 3VU8A 1M8JA 3WGVA 4R8KA 1H2HA 5DNAA 2R9VA 4CFSA 5A3RA 1B8NA 2XLEA 4MV8A 3DOJA 3X2SA 2LZ0A 1C2YA 3CW9A 4B2PA 3JSXA 1YTUA 3AEQA 1M6YA 3RVZA 4K8OA 3W2VA 3L6OO 1TA9A 2YINC 2RI6A 3QW0A 4KGVA 3AG2C 2I8CA 3HBFA 1VCHA 3LA6A 4P3KA 5CA0B 3HRHA 3FTNA 5BSEA 3CN7A 2HSDA 4DLPA 4CG2A 1XJWA 4O0LA 4MHTA 3R0ZA 1Y5MA 2H6EA 3KTAB 1XJ0A 4XEKA 3T5PA 3M1LA 1PR2A 5I7FA 1X0VA 3W8IA 1X7ZA 1AZTA 1WPXA 5HV9A 5BR8B 4GD3Q 4BNDB 4A1OA 4C3VA 3QGMA 2PNFA 2OY0A 1NMQA 1T0HB 1J0XO 1ODKA 3LSYA 3F4BA 1GPKA 3H7IA 2A9PA 4GXNA 5EY5B 3RK0A 3AF2A 1DARA 1L7PA 2ICWG 1XWFA 3ZIAD 1QTNA 3VI4B 2B8WA 2UXCB 1QHEA 1L2TA 2HJ9A 2VJMB 2G0NA 1GHTA 4W6ZA 2RJNA 4AWXA 2C61A 4MVXA 3I12A 2JS7A 4LA4A 3PUIA 1W76A 3HBNA 1EWKA 3T5CA 3F5MA 3R76A 1L6RA 4DILA 3OP4A 3AFMA 4Q37A 1GS9A 1YE3A 2DG2A 2C20A 3UMHA 1WHTB 4EHLA 3ZE6A 4P84A 3ABSB 2IIQA 3QLEA 3THWB 3DMDA 2MU1A 4IMIB 5TY0A 5CDUA 1E9BA 3AW9A 1JEAA 3BFJA 2CMGA 1QFSA 3L5KA 3UQZA 1ZGGA 1ULZA 3N1UA 2A9JA 1IG0A 1IOVA 4YRJA 5BR4A 2WG2A 1D1AA 2RDMA 5D7NA 2DQKA 2CUTA 1GRQA 3EJNA 1RZVA 4M76B 3KQPA 4N8DA 1ZX1A 2JZOA 4L73A 4OYYA 2X4LA 3C5EA 4FFOA 5JS7A 5T5QA 1PV1A 2QR5A 3U2MA 3KVRA 1A27A 3AP3A 3KPUA 3WSTA 2XODA 1Z28A 3TR5A 3IERA 3HI6A 2I3GA 2P1DA 1PVOA 1OJ7A 5HUQA 4HRVA 5FYQA 1A7EA 1Z0FA 4E2ZA 3A37A 2HSGA 2DTXA 3AUSA 2PZFA 2VSOA 2HZBA 2IXBA 3SN6A 4C08A 3VTFA 2DJIA 4ENSA 4CN9A 2ZUTA 4FW8A 4R98A 5I4IA 5HZHA 2OVBA 3CUWA 3LBYA 1OXMA 2YZGA 1T36B 2X7XA 3PVSA 2VDLB 1RZ3A 2HMTA 3R0XA 1RKVA 4KKVA 3W8HA 5H3LA 2DU8A 2CE7A 4OQXA 3VGJA 2R2GA 3M6AA 3CE6A 3B52X 2BHRA 3D0QA 2GT1A 5H5JA 1L5GB 4F9FA 3W6OA 4ZZ0A 3AONB 1YF3A 3HUFA 3TIXB 4X20B 1NC1A 1C3EA 2Y1WA 3PEVA 2FPLA 2GZHA 3W8NA 3A4NA 1UQUA 1FE8A 2NTJA 2AHRA 3P2MA 3URMA 3ZDAA 1V5WA 1KVSA 2FVYA 3U5ZB 2YYAA 4O33A 1RM0A 4CEIA 2CXHA 3I92A 3W2EA 4FMBB 1ZHYA 1UOOA 5I7AA 1M5RA 1TK9A 1FF9A 4M38A 4JP2A 3U3JA 2FWJA 2R86A 4GPTA 2Q4EA 2YVUA 2D4HA 3B53X 4BV3A 3D9QX 4LHXA 3BHMA 3K33A 3N2EA 1G4WR 5AVTA 3K6JA 3PGMA 1A9PA 2I3AA 4P7JA 2JI6A 2X1LA 5E6SA 3DBOB 3NUZA 3SD7A 3KALA 1T91A 3DZAA 3QVWA 3GYGA 2RH4A 1RLMA 2VLBA 4L6RA 4B75A 3HR8A 3B9QA 2DPHA 4RS3A 3ELUA 2P65A 2F8TA 4B3XA 4FS8A 3CXRA 5FL7D 5JBIA 2UYOA 1XKXA 2A6PA 2FUEA 2MWQA 2G67A 3EWNA 3GGPA 4QNMA 2O8FA 4XA8A 1MABA 4M0UA 1S2OA 5LP6B 3STTA 3RRZA 3KB8A 4ZOAA 1QUFA 3G0BA 2JIZA 3AY3A 2SHKA 4ZXFA 4CWAA 4WA7A 3HDHA 3N28A 1JGTA 4ESVA 2IS2A 3M5PA 4TMXA 3KYJB 4Q9JA 4YH1A 1QH1A 1OLOA 1OILA 1U1EA 2QM3A 2CHGA 4IRUB 1W2WA 4C3ZA 5JD3A 2ZBUA 4TSRA 1NFFA 1NAIA 3WFIA 4UOZA 3ONVA 5EOVA 1R0CA 1VYKA 1ZEMA 4TYMA 1ENZA 1Z4MA 4DLSA 1Q22A 4XIYA 1CUZA 4YRPA 2YC2C 4HWKA 2GBPA 5DXJA 3X3HA 4W5OA 3G9ZA 5I01A 3HABA 1R12A 2P3LA 3T99A 3UV7A 1WW3A 4J3FA 4XQ0A 4JUBA 5HGJA 3D8TA 3FAKA 5IC4A 4M9XA 1XDUA 4YFVA 4IIUA 5AUQA 2R6GA 1VI2A 3AGUA 2YY6A 5EMMA 4UBNA 1CQIB 1XHEA 3FGOA 3OFVA 1DBVO 5HUJA 3SQXA 3CUYA 4KCGA 2FK7A 2Y1XA 3LQKA 4CMEC 1MXHA 3ZU5A 1QFZA 3INYA 1JKFA 1NVXQ 1CRZA 4BJ6A 4G8CA 5JWOA 3H42B 2D0OB 2R7QA 5A62A 4RZQA 3C87A 4I2NA 1IOWA 1W5TA 2EWMA 4Y6GB 4D9HA 3SBOA 2R5FA 2ZB7A 4N0QA 1KFBB 1ZAYA 4EGJA 4UFNA 2FW1A 2GAIA 4JU8A 4LQ4A 2XQKA 3A6HA 2IM8A 3GOHA 4DJ5X 3QUAA 4K87A 2QPOA 2PGAA 1NUTA 1LKZA 3HKCB 1XP5A 4KOEC 1EG2A 1K7FB 2A5FA 4HN9A 2ZXPA 4WK0B 3BFPA 3TLKA 3GA0A 5EZ6B 1LDYA 3EQ2A 3P19A 1CR4A 4TYYA 4TSFD 5L0JA 4MX8A 4ZOBA 2AOWA 3AJEA 2OFWA 2ZK7A 3A25A 5AKIA 1OU0A 2X8AA 3BL6A 1DEHA 3VJKA 4IEEA 3KOZA 1CVLA 4BAUA 2EW1A 3F8SA 5ALRA 4ZRDA 2D3WA 3JRNA 1JVNA 3HNJA 4MTLA 1L7MA 3P0RA 4C1NA 1VLHA 1OR3A 2ZDGA 4G01B 4W1RA 1N0HA 1HETA 1KJNA 4IGKA 3R1IA 2EARA 4CKXA 1F1BA 1P1JA 4N3GA 1YZFA 1PQPA 4FQ5A 5D5HA 1OREA 1LE2A 3ZCXA 3QBJA 1Z6ZA 4YV0A 5GWXA 3KELA 3ZCPA 2VP9A 1PAUA 1JYEA 1MC4A 1XZ8A 4BQOA 2GCIA 1BA3A 5KYGA 5F73A 1X74A 4DLUA 5T4EA 2COUA 1U6KA 3VR3D 1YQDA 2B2XA 1KP3A 4RQUA 1PX0A 1SUBA 5H70A 4AAYA 4I9NA 1M1NB 3ZHSA 3QPBA 3GM2A 2Y2VA 3OWXA 3ZDYB 3UWDA 1RXSA 5AKJA 1BKYA 3HKBA 5CDHA 3LX5A 5ESXA 1NU8A 1D2MA 1I9GA 2HQBA 3K9LA 4BV9A 4WOPA 4AN0A 3AJMA 3U3FA 4BJ5C 3AF1A 1NF9A 4MWEA 4IDPA 4MJ3A 1I4WA 4EFNA 1W34A 1QHSA 2HU8A 2BHTA 1J1IA 5HRCA 2FX3A 4HPXB 2JANA 3X1YA 2VJDA 3MMNA 2LE0A 2EF1A 1T9AA 4Y6QA 1NL3A 4OGGA 2BGMA 4Y3UA 5U1PA 4UU1A 4PFQA 3NXSA 3A58B 2CBXA 2XB4A 1O97D 3D7NA 2XB6A 1KAQA 1USUA 4YLEA 4Z7NB 3PE4A 2PX4A 2OBBA 5I9BA 3BZUA 4QA9A 4E5PA 4P3NA 2P75A 1TRHA 1ENOA 5KQRA 1ESEA 5JFTA 3BGVA 3CONA 4KLAA 1RQ2A 1M6WA 5CCDA 1J24A 5AMXA 2H18A 3HCDA 2XTMA 2J1LA 3KD3A 4R0VA 1DKLA 3EPJA 4IUCS 1XRSB 3FOCA 3AR3A 1OLUB 4L6IA 4QDXA 3QOXA 1U2GA 1XXHE 4AYWA 5BW4A 3PXCX 4FYIA 2FZEA 1MJ5A 4GP6A 5CB4B 1L3BA 3LDAA 3HJUA 4ZCRA 3DDCA 2A84A 1UMDB 3LJKA 5EG5A 5AM5A 2W83A 1VQ1A 5EJGA 3U62A 3CH4B 3DQPA 1IDOA 3SJAA 4IJ5A 3TNDA 2LCHA 2MDTA 2QVLA 3TZLA 4LXTA 4PTYA 3HY6A 3U40A 3UHPA 3F2VA 3KPYA 3IXMA 5CCEA 2CNOA 3L0YA 1L8OA 1RYBA 2QVXX 1RPTA 4LRQA 1EXMA 3OMWA 4LRYA 1HI9A 3VR2D 3NM4A 1KEKA 3Q7QA 1XMJA 4EKWA 3HMQA 5DOZA 1DT3A 4OYHA 4S1TA 2C4TA 5C1OA 4UZEA 3GEBA 1GUZA 4PYJA 3CZAA 1EWRA 3CVOA 1XTJA 4LF9B 2YOHA 3UA4A 3U44B 3B7WA 3UJ9A 1M3SA 4BFCA 1DWUA 3QKIA 3HSSA 4MR9B 1N0UA 3PUZA 1V4BA 4KW7A 2ZR7A 1KARA 1PU2A 2QUJA 3ASYA 2GEUA 1BW9A 3A6EA 4HYYA 3CYFA 3NETA 4EW6A 3LQ4A 5CT8A 1J9EA 2SCUA 1H9TA 4CCYA 3QWHA 4G5RA 2ZTVA 2BFBB 3TD7A 1PGJA 4Q9IA 4CSAC 3AR7A 2O3JA 3IMEA 4M6WA 2ZRLA 3VDRA 4XWWA 4MLDA 1B8OA 3NKEA 4D43A 5LA6F 1NW3A 1WJGA 4AFNA 3K5HA 1LB1B 1FW8A 4WN9B 1DKMA 1RD4A 1TEVA 4MWOA 4CIDA 2D0IA 1RM4A 1Z5PA 3UPUA 2W2PA 3FKQA 4Z8YA 4WESA 5HE8A 4NCNA 2CVOA 3ETDA 2N47A 4OQMA 1UDCA 4LN1A 1VIAA 4CT0A 1OXXK 4F85A 1IYZA 3L2OB 3K05A 1MRSA 2LRHA 4JRZA 1EFVB 2GAFA 1ONBA 5TVKA 1IULA 3PFIA 1IRXA 4BWFB 4WXRA 4QPJC 1YH3A 2BGLA 4LJAA 3J81A 1U5CA 4IDCA 3TRJA 2XLHA 4RPLA 3FTEA 1IY9A 1T3TA 4FCCA 1R8QA 2ZSBA 3L05A 3O3CA 4AZWA 1G21B 3Q9NA 1CVRA 4AZTA 1H6CA 3TTYA 2C4HA 2D54A 1NULA 4D92A 4X24A 1G8HA 5IKOA 3AO0B 4JW1A 3O8RA 4OX9Y 5DLPA 3TFQA 4M1KA 4YUYA 3ZHUA 2B36A 4QWWA 1Z4QA 5C34B 1JR3D 2PL3A 3E7DA 3OJFA 4NP6A 1NZFA 4XIGS 3NTLA 1WCV1 4EB0A 3AT1A 4JJFA 2PWZA 3ZCUA 4TKLA 4Z9AA 5TV2A 2VPQA 1BDBA 3TLEA 1AQYA 2BBWA 4EG7A 3BMNB 3SFVA 1YCFA 2HBYA 2LFDA 1P7ZA 4Y2RA 3CZ6A 5C5EA 2VP4A 2B0CA 1OZAA 4KIWA 1AQLA 2Q9UA 1ZA2A 2FHSA 1JSXA 5LWHA 4B6JA 1QQAA 4C21A 5FBLB 5L3SB 3LUBA 2XMBA 3Q4GA 2RIPA 1EFLA 2J4DA 3UMMA 1ZIPA 4GR9A 4MW5A 4JI1B 3EAGA 5I4KA 4LDAA 3E9EA 2OVFA 4W5JA 4JVSA 4L4SA 3AVQA 1RJ9B 1RQXA 4ZPXA 1AUXA 1Z0SA 3CX4A 3CG4A 4I1IA 2HQ1A 2R5NA 2B25A 1A8UA 1AH2A 5F5XA 3MQFA 1QWSA 2JI7A 3BRJA 4F9EA 3FGZA 1SOMA 4QWMA 1BR4A 2PX5A 2VUIB 1NYRA 4D9JA 1K7SN 4NENB 4CMBA 3LFHA 1ZK0A 1XV5A 2O3QA 1PUIA 3IVCA 1KEPA 4LWQA 2AQHA 1CY6A 2GM9A 4MV7A 1AX9A 2QT0A 4X54A 4AF6A 3GQVA 3C8MA 4CUKA 1QV7A 1RC8A 3LOQA 4YUZA 1Q12A 2Q2VA 3EVZA 5AW2A 4D41A 5HF8A 2P62A 1FYWA 2AVDA 1MG0A 1GITA 2JJ1D 3PUKA 4QYWA 1LTKA 3GJQA 4EBKA 5J59A 5G1NA 2KHZA 4WK4B 4I3GA 3ZG1A 4EABA 5AHKA 2A33A 2AQKA 5DNEA 4E07A 1WETA 4P08A 2WIGA 1QX4A 1X7XA 4UVIA 2PZLA 2ZCVA 1P1RA 3OOEA 2Q0QA 4DG9A 3L06A 3C3DA 2BCGY 4XDHA 2NVWA 3N53A 4JBNA 2PMEA 4AG5A 2VKQA 5CFOA 1MOZA 3A6JA 4HX2A 1QIMA 1GQFA 1D2CA 1V6SA 2Q5FA 3M4CA 2H7VA 1DAOA 2J30A 4Q4DA 1E89A 2OZLB 2CV1A 5L53A 3TL6A 4CM9A 1JHXA 1JHPA 1J0EA 2WVQA 3EMBA 3DR5A 3G1TA 1J7JA 4A03A 1LBEA 4A0FA 3QITA 1V1RB 4E1VA 2O0LA 2FLKA 1Z4OA 3K6KA 1MHTA 1EFDN 1HQCA 1QDEA 5IH7A 1P4SA 5AT1A 1ZI8A 1W52X 2XUDA 3BTSA 3NUGA 4OD0A 5CH5A 3GLFB 5K8CA 1JPUA 3G89A 1ULSA 4F4CA 3R7CA 2ZWVA 1Z22A 2WT8A 3GX1A 4CLRB 2KSFA 5HVNA 3BILA 3SG0A 3RVSA 1CBUA 1MUUA 3C3BA 1R8SA 4U5DE 1RNLA 1UWKA 3TIFA 1P1IA 3R6LA 3IBGA 1SN7A 2XGJA 5L40A 3PLRA 3I45A 1QF7A 4QEDA 2QLNA 1HNWB 1H42A 2CUKA 1QOQB 2HI0A 5EUCA 2Y66A 3CEMA 4EPTA 221PA 3LXMA 3ZNQA 1ZN9A 1RJFA 3EVNA 4M87A 5KTSA 4L78A 4Y1FA 2WLSA 4EYEA 1BRMA 1FFGA 1GILA 3FMVA 4QC2A 4B6GA 1F3OA 4B31A 2I91A 3GFFA 2YXPX 4MVUA 3QXJA 4C4YA 2FPXA 1W85A 5K0TA 5K6AA 4BBJA 2OHOA 1E5QA 5H4GA 3LS0A 5BN3B 2ID4A 1JYFA 3TJ5A 1KHTA 1WO8A 5BQXA 2W48A 3EF3A 3P0FA 4P7FA 4F56A 2YWJA 2J8WA 3ZXYA 2VAPA 2XB9A 2WIBA 5BSRA 3ZVRA 3N7UA 5HIAA 2FJUA 1X1EA 1SJ9A 4BZPA 4FBGA 1KRHA 3CZ4A 3FG9A 2W6ID 3FLEA 5CPFA 4Y1GA 4JXXA 3FN4A 1K2WA 3DF7A 1FQOA 1P4AA 2XTZA 3N07A 2G5PA 1EP1B 3LDGA 5KO2A 3W5CA 3CX3A 3RH0A 3TM5A 2R8BA 1IBCA 2B7BA 2M6LA 4AO7A 4K1XA 4DQ0A 4YWQA 3SZMA 2YWEA 2X41A 3SFZA 3L1HA 2ZR8A 3L4KA 1E0JA 2YQZA 4CLXA 3GPIA 5I4CA 1SULA 3JQ8B 1PTJC 4BBPA 1XTZA 3CO0S 3WDSA 5F5LA 1J99A 3ABZA 4YPFA 1T2DA 5BSGA 1V16B 4WAUA 1GARA 3QYPA 4HLCA 4P0TA 4RF2A 4ZCIA 3OM0A 1ULBA 2W2MA 4J0GA 3UNGC 1YKSA 1YIDA 1DLJA 1T0BA 2J8ZA 4C07A 2FR8A 1OLSB 1OIVA 1Y48E 2KYRA 2ZIEA 4Q4CA 1XO1A 2ZWAA 5LOVF 2O3UA 3IQZA 4FXPA 3WK6A 1VE1A 4IIHA 2J9FA 3QKTA 4NNPA 2VH5R 1TKRA 4O2AB 1B6SA 2NZUG 4N48A 2AR0A 2FMHA 3WYDA 4NZ9A 5CUQA 2IHVA 3VTAA 4RV9A 5A7HA 2QIPA 4RY9A 2R6ZA 5DNUA 3L7DA 4Q3OA 3DE9A 2PKRA 4Z3KA 3LOUA 2NV6A 5G1OA 1A9YA 5BWCA 3K1TA 3VPSA 2NIPA 5MN5A 4ZO4A 1PNRA 3K92A 3A2KA 1QONA 2BR4A 1IWOA 1XQXA 1KOJA 3ET4A 3ZVLA 4HL6A 1JQAA 1R16A 1G2IA 5EJFA 1G5HA 2B4TO 1A9QA 1Y80A 4DDKA 1Y89A 1WDKA 3Q6NA 1I10A 3HYRA 4ZREA 4QZVA 1XNRB 2CFOA 4ZVVA 4EJSB 3NV7A 4DMLA 2DF8A 3ABKC 1HA3A 1CJVC 4TXMA 2CB0A 2RCNA 1KJWA 2FFHA 3A1EA 2E5FA 4BNGA 5ER9A 2XADA 2ONJA 2FPIB 4WKNA 1ODCA 3WRXC 5B58T 1GPJA 4WEQA 4OQLA 4DZRA 5EKDA 5DPMA 1LI4A 1CRQA 5FOVA 3OI7A 1G16A 4E1BA 3QMWA 5DH9A 3GNSA 4JT9A 3EA4A 4TV8F 1E4OA 4JKVA 3DDOA 4E3ZA 1FS4A 4JJKA 3NHPA 1JMKC 3V32A 3CWZA 1HDZA 3S8MA 4EJ2A 3H1AA 2VZ0A 3HEMA 5JSZB 3GIWA 3ATPA 5FV7A 4KGZA 3ISTA 2WKWA 3N7TA 1ECPA 4UNQA 1XVUA 4CR7A 2IF0A 2WLTA 2VWGA 3DZBA 4QXQA 3H8WA 4MWTA 1PS8A 1HDCA 4P4LA 4BLRA 1R9MA 2QX7A 3H4TA 3LL4A 3TLCA 5FWYA 2PSDA 3T9EA 1TCAA 4DV4B 1BDJA 5AYVA 2HHAA 1MMNA 2Q8QA 2G71A 5KJCA 1FUUA 4IDNA 2OAGA 2Z56A 4AG6A 3KJQA 2NU8B 3HB0A 3HXTA 1YI8A 4BNIA 4UU8A 2VWPA 3QYAA 2UUAB 1RBQA 2QX8A 1VJ0A 3U13A 3OCZA 2JLBA 1RJWA 3DE2X 1KVQA 1NVVR 1CDZA 1ODSA 4MHSA 1QCCA 2YKZA 2BFMA 2ZAMA 2J0XA 3SSAA 1XC7A 2J08A 4ZV7A 1EXVA 3DULA 3K9CA 3F47A 1S2GA 1ONNA 2PCJA 4PJLA 1V8PA 4NC3A 3GWLA 4UM9B 1N9KA 3K70C 1NY6A 4GOXA 3V1YA 2JIQA 3HO8A 4ZEXA 4EGAA 5G3YA 3UXHA 5JUAA 3MUFA 2X0EA 3EOAI 4B3FX 1EB9A 4TL7A 3N2YA 3QEAZ 1S9DA 4K46A 4JYAB 4KODA 1L4YA 4NK5A 2CNNA 1B26A 2OPBA 5C1BA 7REQA 3KQSA 3A9CA 4DR1B 2PZAA 1X9GA 1ZM9A 5A6SB 4TVOA 1DBQA 2NO4A 3UWOA 5JWHA 3I4UA 2QUZA 1L8LA 1HE8B 3ZH9B 2ZBQA 3CEPB 3WG9A 4YJ3B 4GX5A 3N7AA 2MOKA 3DPIA 2VQSA 5CB8A 1F2UA 3KB1A 1GPH1 4Z4IA 2F8SA 1BO6A 4MVJP 2HPZA 1KJYA 3EXEA 5M34A 2PUWA 5K3AA 2L7AA 4J0IA 2VH1A 3KEQA 3W9YA 2P8SA 5A06A 3WJ1A 4BLVA 1JJFA 3SE7A 3LZDA 3TJ6A 1X7WA 3DEAA 4YAWA 4DNQA 5E6RB 2XNCA 4MUMA 3KE9A 3VU3A 1USWA 2BGIA 3WWEA 2Y92A 3BPSA 4A5SA 4O4IA 3RS2A 1AKMA 3DZJA 3V46A 2OM6A 3LFTA 2W2LD 3NPAA 4IWBA 4JEUA 3W9BA 2JGDA 1OI7A 2ECKA 1M2KA 3FPGA 3T6JA 4MKHA 3KZKA 1QYWA 2ZSHA 1ULHA 1YBAA 4X64B 4MWSA 2UYGA 4J3NA 1KF0A 3QI2A 2ZS8A 1IEXA 4W9RA 5FB3A 1LRKA 4GP9A 3OZVA 2CUNA 3PDCA 2IOFA 3DSRA 3ZZ0A 4CFZA 2ON6A 1YDMA 2EQBA 1VKNA 2ZJ0A 4QPCA 1JBQA 1CHNA 4TMKA 4L50A 3VBEA 3X1KA 3K0CA 1W581 1WD7A 4Q7MB 1GNVA 3GXBA 2PQ6A 2KBEA 4Y6RA 4O1IA 1ZCBA 4JFRA 1D5CA 1AQNA 1S01A 2WAXA 3EIWA 1GG9A 4CEHA 1OF1A 2CW0F 4QJBA 1RAEA 5KWSA 1ZGZA 2YFYA 5HHTA 1D7AA 2FSHA 2NACA 1J97A 3LT0A 5T64A 5K3BA 1G5TA 1N1EA 3K1JA 3SC2A 1SC4A 4YASA 5EWMB 2PX0A 1E1MA 4MW0A 5CLJA 4YY3B 4R2LA 2DAPA 3QNMA 1JXMA 4FP9A 2YDXA 4P7GA 3AR9A 2A0KA 3JAKB 5BSTA 4X1OA 1EE2A 3DMTC 5KC9A 4D4XA 1B16A 2Q8PA 3CSUA 1CRPA 3OQJA 2HPVA 4PRZA 2JCVA 1QX3A 1N0IA 1I30A 1PFUA 5F33A 4QOGA 4ZO9A 2OZEA 1MC5A 1RP1A 4O2BA 4EMUA 3DVRX 2FUCA 3AWIA 3JSEO 2CK3D 4NCQA 4UM7A 4XM0A 4LC0A 3S1AB 1AOXA 2HSJA 2XYQA 2NAPA 3UMSA 3RFFA 1CZLA 3GFVA 1T8PA 4J1NA 3KOUA 2Z6AA 1NTRA 2XTAA 1TPYA 3KM0A 4BFTA 3TGPA 1A76A 2PBEA 4QTZA 1YKFA 4O3FA 5K8UA 4Q82A 1X1AA 5DLYA 2D5AA 1IN1A 2EGUA 4DADA 2GNOA 4LF8B 2X8JB 3DT9A 4V1CB 1QQ3A 1FNNA 4LZPA 2CFTA 2JLVA 4X1YA 3LYAA 5IMBA 1W4RA 2ZT7A 3TYXA 3ZGYA 6GPBA 3RIGA 2PTHA 3GI1A 4ZVLA 3UWPA 5DS5A 2RHWA 1CU1A 2XLMA 1H6GA 2QJWA 4B0OA 4U6SA 2FSFA 1DC5A 3FLBA 2IUEA 4UHCA 2JKZA 3HI4A 1T24A 2AS0A 4DKXA 4KR0A 3LS1A 3HVKA 3TQSA 1JLLA 3AF0A 3OQNA 3O82A 2E6UX 3BQNB 5JNRA 1HE5A 3W90A 4G4SP 1RHKA 1DWQA 4KFTA 2UVQA 4YRKA 4UHBA 4DC1A 1JECA 3M82A 4XGIA 2CVQA 5IXSA 3HTKC 2JFNA 3CUUA 1E6UA 3HEAA 3IUJA 2ZXOA 1E1QA 3A6FA 2V59A 1UKCA 5IJ9A 2Q0SA 3DBIA 3RTGA 3TNJA 4Z54A 3DJYA 4A26A 1ZNQO 1OA1A 4HQNA 3RUPA 4Y2VA 3MT7A 4LVUA 5T3WA 1MA0A 1SEVA 2IP2A 4L4RA 1P6QA 3QPVA 4L2IB 2J32A 3IR6A 3KQKA 1P73A 1I24A 2W6NA 3B2NA 3JASB 3CFYA 4ZJUA 4EO9A 2E1PA 4YXWA 4MRMA 1WCYA 1RIFA 3G2NA 2IT1A 3H1FA 5HM8A 2A5YB 1JIUA 3ESDA 5A03A 2XXAB 4BJ1A 1T6NA 2MCFA 3IP5A 2M64A 2Y39A 3I0ZA 4JSTA 3IX7A 2Z5FA 4GSKA 3RC2A 1XCJA 1DG3A 5JCOC 2GOYA 4ZO8A 4H35A 4UDXX 2XSZA 3ELDA 1Y6ZA 2HWKA 4JLOA 3N0XA 5DXFA 4WA8A 3F5QA 1L5OA 3IQGX 4GOND 3DBVO 5ENDA 3STYA 2VNHA 1YJ8A 3QVUA 4LBVA 4ZHQF 3H2JA 4QGSA 4PTZA 2PBRA 3HBAA 2GZRA 4Q1BA 9ATCA 3AWDA 2GASA 3GT0A 3GG9A 5ERXA 4TOIA 3WWCA 3ESQA 1K5PA 1K5GA 3O4JA 1A69A 3MWLA 4MLZA 1M33A 3F96A 2GX6A 1KI8A 1QE0A 1WWKA 2YXDA 4F04A 2JATA 1I2DA 4TS9A 2YNMC 4JEIA 3IT3A 1C7EA 4R1TA 3HBMA 1P9NA 3R20A 1ZSYA 2HQSA 1ZL0A 3C63A 3WL3A 4Y9TA 2VTDA 4LSGA 1U7WA 3NXKA 4RQTA 4MS1B 3MGGA 5CMLA 6YASA 4IJQA 4BFXA 1WP9A 2VHUA 1YYJA 2Q3EA 4JLSA 1U9ZA 2WUEA 2WJHA 4DIEA 2RGAA 1N1GA 2V7VA 1WUKS 1EH5A 4BQQA 4ERNA 1PQYA 1ID8A 1AGNA 5ALDA 1WATA 2P90A 1EA5A 2H1RA 1HG1A 1R0XA 4N6NA 4HS4A 3TSOA 1JPNA 1E18A 1PGQA 4RY8A 1D8TA 4I55B 1Z2OX 3BG5A 2FSGA 2PGDA 3GFOA 1NBME 1O7JA 4LSMA 1PN3A 4CMGA 1X39A 1HMPA 4Q21A 3DE5X 2AXQA 2RC6A 2M9MA 1PL7A 2JAXA 3FSEA 3CPEA 1TUBA 2WE7A 4HXYA 1LCIA 2OORC 3LHFA 3FF1A 2X77A 1Z45A 3CS3A 4L0CA 4FZRA 6LDHA 2I6QA 2ZRGA 3MK31 4MQ9F 3EZLA 1P3Y1 1C3OB 1RU3A 2CXUA 5TXGA 3IS3A 4Q00A 2ZWMA 5E7IA 3WYAA 4URZR 4YGYA 1CF2O 1D0IA 1ANKA 4FMCF 5K3DA 2D7JA 3PFWO 1GAEO 2P9QA 2HRBA 3RS8A 4BQSA 1C8BA 4HAXA 4EHPA 1HDIA 2PWAA 1MRNA 1U2PA 3ZV6A 1E6KA 1D3AA 2A69F 4YP5A 1Z6PA 2ZEJA 2FN9A 3S29A 3D6FA 2VCEA 2A92A 3K20A 4NESA 3H9JA 1LLUA 1GDDA 2D2EA 2AI2A 3K1AA 3E3NA 5LDGA 3WYNA 2IZZA 4DRXB 1DBWA 2HSWA 4G1CA 3PQFA 4N6GA 1P5HA 3O0DA 1NVBA 5IEBA 4XD2A 1C9KA 4Z2YA 1LLCA 3AGPA 1P5JA 2TRSB 3K4HA 4XDZA 5AVOA 4QUKA 5G0SA 1IJKA 1IFXA 3LCVB 4OJYA 4N76A 3W04A 4FYWA 3IV9A 4DLNA 2IBTA 3DR3A 3QTLA 3J7AC 3WKAA 5C35A 2GWRA 3OBBA 1P0MA 4C6RA 1GRVA 3B5IA 3CZ9A 4RFSA 2GAAA 3K0FA 2K4MA 3AJ9A 1GNQA 1OX5A 4U6NA 4DQLA 1Y5IA 1VJGA 1YGYA 2CSXA 3GZNA 1FB5A 2XX3A 4WECA 1NFRA 2YV4A 3PCTA 3A9RA 3JYPA 4DKJA 1F06A 3BD7A 4EG8A 4NYMQ 1XYVA 2ERCA 1Z5ZA 3Q98A 2AJTA 3ER9A 4JJEA 4EM6A 3H5AA 1Q1AA 3HPQA 1L7XA 2C3PA 2A0XA 3SS7X 2FLWA 4HBGA 2H7OA 2PLFA 1QIFA 2A7QA 3IURA 1T25A 4HEHA 2ZTHA 1AKRA 1Y8QA 1S4QA 1V3QE 2YJ5A 1F20A 5C4GB 4DG8A 2JKYA 3F3KA 3B3QA 5T3YA 3F1KA 4UCWA 1CF9A 1UXOA 5B1YA 1Z5GA 3IDSA 3NBYC 1SQFA 3FIJA 5LZ7A 4B79A 5HWSA 4V1CI 3IDZA 3JALA 2WABA 1YCGA 3DA8A 1LGYA 4YRDA 5FKJA 4QTTB 2XGSA 3C3WA 3ANLA 3OHSX 1ZUHA 1ECFA 1GKLA 5EVJA 2HM7A 3LJBA 1C14A 1LBTA 1G5ZA 1Y9JA 2XJ9A 4O4HA 4D96A 2P1ZA 2NU9B 3D4IA 4REMA 2B92A 1TK2A 1Y4ZA 3DC2A 1E6WA 1JRAA 3JATA 1XNQB 3OZWA 1XK7A 4GUDA 1Z4KA 1H85A 3NH9A 1RTTA 1NZDA 1ZJYA 1DC3A 4TV9F 1W19A 2VCAA 3W79A 1W49A 3HKDB 3G82C 3GU3A 3ZOKA 1QRDA 3TLGB 1NSYA 2ZUVA 4QTXA 3JTEA 4K03A 4R9RA 4RD2A 2QAGC 2Z5VA 3AG6A 3ONWA 2AWCA 1SVUA 2X3UA 4QYIA 4ZJPA 1G3IA 4LDJA 1Z82A 2H2HA 1Q2UA 1VDZA 4WUTA 2VYQA 3FTCA 3E9RA 3SHFA 4KPGA 1XROA 1A5AB 3K2QA 3HWX1 1UFVA 5LZ2A 1U5AA 3ENNA 2XY4A 4AYTA 5DK6A 3QVGB 3EODA 3ZHXA 2C9OA 3UJ7A 3LYLA 2CN1A 3K5WA 4K1LA 4YI5A 3BBPA 3AETA 1EFAA 3FB1A 1XALA 5IXYA 4A3SA 3B3FA 1FX0B 1HZZA 4H1VA 2PRYA 4GVXA 1WZIA 3IMGA 4XE5A 3QI7A 4IKEA 3KVOA 5MHTA 5THKA 4G0WA 3D4BA 1DO0A 3EW9A 1GAJA 3NC4A 5KWEA 3F0TA 2C54A 2AFIE 2F43A 4PJJA 3FVTA 3M33A 1R64A 2IZ7A 2CW5A 4AY3A 4CS7A 5LC1A 2GFHA 2WYWA 1X8KA 3OZUA 1YVPA 4G0NA 3SZRA 4EA7A 3KUUA 2BFCB 3OCJA 3TQQA 1A5ZA 1REQB 1T29A 1ZQ1A 1M0EA 4MCHA 3ZI4A 2EIXA 5H02A 3ZCSA 1J8MF 3RQFA 4PSVA 4EYOA 2NSJA 1C4OA 3NOOA 1HTTA 1SHTX 4YJ2B 1L8QA 4PSKA 1PT5A 1YZVA 1C3JA 3CB2A 2WT9A 3JWJA 4GPIB 1UINA 3KKQA 2O8CB 4DJEC 1VPTA 4JJ4A 4N7BA 4QHSA 3V4ZA 3AEKB 2ZREA 3BMQB 3PPIA 4EYGA 2VDNB 3C3CA 3G2HA 1DFGA 1QM5A 2WTUA 2OD2A 1GAQA 4JC7A 4GYKA 4ISBA 2QK4A 4IOJA 3ZZMA 2OG1A 5CFZA 6NULA 5G0TA 1M34E 3FCOA 4PZLA 2B35A 4K3VA 4MUHA 1Y1SA 1JU3A 4FHFA 3C98A 3PT9A 3HUDA 4U2BA 1IAVA 5FUQA 5AI5A 1F60A 5F2NA 4IWXA 1T3LA 4HN4B 4Y7CA 2GBIA 4DA7A 1X87A 4JVOA 3W06A 1LEHA 2H4XA 2X1VA 1JI0A 2JL1A 2H1VA 1VCOA 3AOGA 3WB0A 3IKVA 4N82A 1XEWY 1GCOA 4PX3A 5DYWA 3N2GB 4IDDA 5JNWA 4YV2A 1EBFA 2WYIA 4L07A 4GMHA 1XI2A 4J1QA 2FMXA 2H11A 3CH6A 4HDAA 2UUCB 2KX7A 5A4AA 4KRYA 3QKSA 3I83A 3SXZA 1F14A 2OO5C 3OTQA 5JD6A 1NU6A 4CIAA 2QMEA 4CM7A 1Z5WA 2O2CA 1USIA 2FWAA 2CBZA 2XF8A 3F4KA 3AEUB 2ST1A 2GCOA 2P0YA 2ZTUA 4ZZ1A 4B6QA 2PA0A 4EHAA 3KQOA 4LEIA 1UWCA 4MQFB 3O9VA 9LDBA 1ZYRF 2HJHA 2C4KA 3EHNA 2GARA 2IUYA 1EXNA 4HQKA 3LS2A 3DHEA 4G0XA 2MSKA 3IPLA 2C95A 3IEEA 2IELA 1GNSA 2D0DA 3ONNA 4ZEMA 4ZVOA 4FLEA 1G2QA 3ASZA 3V2IA 4WUVA 4UAUA 2H1SA 4B33A 5GZ3A 3KKPA 3AINA 3T3NA 3VVMA 1O94D 1N36B 1E2GA 1I94B 1FYVA 1L4UA 4RTOA 3AP1A 1CX9B 5DM60 3RYCA 4KZPA 5JBNA 1VE3A 4CDVA 5C7OO 1E6CA 3X1ZA 4FFPA 4LX8A 2Z9BA 3GT3A 5ILQA 4TYNA 3NFRA 1ORSC 4OL0A 2PP4A 4U5QA 2L9JA 1LSJA 4FONA 1JDSA 3KYCA 2VDMB 2VKTA 1ES9A 2EU8A 1R0WA 3THOA 2D13A 4HYQA 3IQHX 4CM1A 2DUMA 2IYEA 4EGQA 5EP4A 3LLMA 3BRCA 2JVKA 2HA5A 4HSGA 1ZIOA 3PJDA 2A5DA 3NHYA 1JXQA 1T0PA 3CX7A 2GLUA 3WLSA 1SR8A 4W8KA 3MHTA 2JGFA 3LX4A 5BMVA 4L0DA 1YRBA 4LBYA 1Q7CA 1NT2A 3EIEA 4ZHSA 3A2MA 4B47A 3H3XA 2C9DA 2LWIA 4W5NA 3K16A 2P2DA 5I9SA 3L8HA 1TLLA 3S90A 2VH3A 2P7VA 3ZG6A 3QBEA 4DABA 3HH8A 4O25A 2R7KA 4V2IA 4B6EA 2WRZA 4OBEA 5KTRA 1ZHFA 5T6MA 1W5AA 1XBTA 2WP8J 1YB6A 4FSXA 3W2IA 2IBFA 1OWLA 3PZRA 5JVDB 2WKPA 3G8AA 3S0XA 5DI3A 4DANA 3SLRA 2W2TA 3I76A 1WSDA 2AN9A 3VA7A 4LJSA 1G5FA 3L43A 3QTHA 3JWGA 3FPAA 1BXRA 5T8KC 3F97A 1YVEI 3IEMA 1ZK3A 2J09A 3RROA 2XYRA 3JD1A 3D81A 1XD9A 1IE3A 4M4SA 1T4DA 4LZOA 2PG3A 4FDUA 2F2TA 5JAPA 1RPJA 1ZNXA 2DGDA 2Z1MA 1YZYA 1FUIA 5AVZA 3BHIA 4ZIRA 5DGCA 1VOTA 2HGZA 2HA2A 1VTKA 4ZI5A 1GTVA 1G4US 1CUXA 4J76A 1A8SA 2WA1A 4LIPD 5EQJB 3OO1A 2VI5A 1SB8A 1RT9A 4C3OB 1M9NA 4PXAA 5I48A 2JFXA 4RYLA 2YL2A 4LHZA 1ZPDA 2F3RA 3DE1X 5A4KA 2Q45A 4I3MA 2FUG6 1GCIA 4KMRA 3PEUA 3JQFC 2QZPA 1LFAA 1HK7A 3CR7A 2HU7A 4OQDA 3S8YA 5KYKA 1FPMA 2EKBA 1XTPA 5LYYA 4I5GA 1HF3A 2LNDA 4ZVRA 1FUYB 4DMUB 2EHDA 4HFKB 4WK6A 2VNSA 1GU7A 2JVIA 1TAQA 2XZTA 3H2BA 3A3PA 1JKXA 1P39A 3Q8KA 1U1IA 4BLOA 3OX3A 3ASVA 2VCBA 1HFWA 5AC4A 3EQ9A 4TTAA 4EKGA 4IFIA 1CR1A 5JATA 5I8PA 2Q28A 1W88B 2HCTA 2B6HA 4BKPA 2VT7A 5HE9A 1G7TA 1R00A 1KMNA 3D5QA 1AV7A 1DXQA 2XDQB 5EPEA 2JARA 2Q0XA 1BU8A 3AHHA 1RKEB 3IUBA 4YECA 4LMRA 2GD6A 3RAGA 4Y6SA 5AKYA 4JMLA 2A94A 2GBLC 4DNOA 5DYYA 1BWSA 5DVWA 4YS6A 2DH6A 4FWBA 3TPZA 3N5CA 1E3JA 2NUTB 2NXJA 2HPAA 2A8YA 2VPXA 1JHRA 1NBOA 3ZIBA 4E5UA 3ACCA 1A9RA 4IVQA 3MD9A 3WHNA 1JR4A 1CE8A 3WL5A 3RYLA 2P0EA 2AX4A 2QD4A 3FWPA 2REBA 1T0IA 4HCJA 1XZDA 4NHEA 3IT0A 2JGJA 3HZZA 3I8SA 2XEDA 3TVTA 5U4XA 1V71A 3EUFA 3NV9A 1E79A 3HBLA 4QGFA 4Q34A 3EUEA 3WK7A 1YDGA 4RHXA 2C58A 1HLFA 5TPZD 4K7BA 2NO0A 2R7SA 3RG2A 3T9CA 5D6OA 1GY8A 4PHHA 3PYMA 1KA9H 4X92A 1ZMBA 4EHNA 1SMYF 1A9XA 3M4YA 1Z2NX 2VXBA 4A92A 2B8EA 1G19A 5DISB 3TQHA 1Y4SA 4YI3A 2AEFA 1IHPA 4FMDF 3KZVA 3KKKA 2WB7A 3KQTA 5TT1A 3RKOF 3MCUA 3Q7LA 3AVOA 1NFNA 2G1KA 4WZBB 2XITA 4MGYR 4AJPA 1QFJA 4L72A 1VG8A 3L3BA 4NZOA 2B1QA 3ICPA 1OWNA 4XPZA 2HGSA 2C2KA 2IS4A 4LY3A 4Q9NA 4GFDA 3GD5A 2I03A 2R47A 4ID3A 2VTBB 3OQIB 2R1UA 4GWLA 3QG1A 4FINA 1JLSA 4PQFA 1R18A 2QW0X 4GPZA 1U3WA 4RWEA 2XWJI 3CKYA 3IVMA 4FBMA 1OY1A 4ZYLA 4Q03A 4YN0B 2PKXA 2ZRCA 1LK0A 3H2ZA 4ZZ2A 1RYYA 2IV7A 4XX1A 5JFOA 3CURA 1AF7A 1RAIA 3EHDA 3B1FA 2E5WA 2IXTA 1M54A 4KYUA 4GM4A 1AF4A 3K96A 1DKRA 3T5AA 1B8PA 3B20A 2XUFA 3E53A 4RQBA 2XMDA 4PPGA 5KOJB 5I9MA 3GCWA 1A3CA 3N6XA 2HSZA 3CQZA 4FM9A 3EXG1 3KYDA 2A9KA 3E5MA 4RIIA 3WLAA 1JQ5A 5ALOA 1QG4A 3MXOA 5DM1A 5JV5A 3NYWA 4M53A 4Y7DA 1SZCA 3HYSA 5FRDA 1JEYA 4M1QA 1H9AA 3AJ8A 1LLFA 3A06A 4R3NA 5K0LA 1RJEA 2JLCA 4IINA 3DD7A 4TT8A 1GCGA 2PVSA 1PWHA 4R71A 4OO3A 3G17A 1GUYA 1U0EA 1EA7A 1G66A 4CG0A 2OO3A 4KTTE 4D4KA 3ZWOA 3GJ6A 3NRCA 2G17A 4G4GA 1P9WA 4L08A 5DCLA 4R6XA 4BNXA 4D9NA 2FMIA 5DB4A 1LBIA 1UAYA 1QV9A 5J1TB 4H3HB 5CEJA 4PO1A 3U7HB 3RC1A 1MQAA 5EJMA 2ZAYA 5MDHA 4JVMA 5ERGB 2F00A 4D98A 5BQIA 4XUGB 3OZBA 3KQVA 3ZWPA 2Z58A 5E4TA 3RSGA 2IYPA 2WFAA 1K6JA 5SYAA 3BSYA 3VR5H 2AC2A 4JMPA 4MPTA 3OPNA 1Q7GA 3AUFA 2Z8YM 3CRMA 4J90A 1BMDA 1D2EA 3U5SA 2BKXA 5JEEA 1TJNA 4DWOA 3DDSA 1IUNA 3E0XA 4YYEA 5IK2D 1A96A 3B6ZA 5EZ5A 4AJ9A 1RHUA 4HS9A 5FFNA 3QVZA 3OPQA 3V5YA 2QPAA 2QNIA 3EXIB 1UFOA 2NV0A 3VDNB 3KJGA 2J0WA 4F5YA 3TIIA 2Z9DA 4AZ3A 4B4WA 3RF7A 2YJZA 4R9NA 4D5EA 3QVSA 4J7UA 4LE2A 1P60A 4KR2A 4HQOA 2QLAA 3P9RA 4RHTA 1MTZA 1KYYA 1YVDA 1HEIA 3HJTA 3COPA 2HB6A 2YWGA 1NBMD 4L5BA 2DY1A 2NYVA 5B1BC 3LTNC 4F3KA 3OZ7A 3NTRA 5LQKA 1QIGA 5B2ZA 4DYVA 1TTQB 3VDQA 4H3KB 1VL1A 4JP1A 1DAGA 4OMUA 1KYXA 4EF5A 2AJBA 1V1MA 2Y68A 2ENWA 1B7GO 4MXDA 2J45A 5K0IA 1YR7A 1YR8A 1SXQA 1VYHA 2FWNA 3KAKA 3OLCX 4MQBA 3L4BC 1VBKA 2GO7A 3H5VA 2A78A 1DXYA 3ZCVA 1Z9BA 1N8TA 4L16A 2D2FA 5K3SA 1PIWA 1Y3DE 1KY2A 3MJHA 2MR5A 3QF4A 4LZAA 5DSZA 3U9JA 2HFKA 1K8YB 2VHVA 4CLHA 1AHNA 4KVGA 2XKBA 4QOSA 4O5OA 1NNI1 3OZIA 2VYNA 2DSNA 5JMWA 5ICEA 1J5XA 5A2QA 5BUSA 1JIJA 1CS0B 4G0QA 3L40A 3Q6IA 2BKEA 2QAJA 2MMCA 4DR4B 1N6PA 2P11A 1E3TA 1LH0A 1XEXA 2F7SA 4I5EA 1OYVA 4AP9A 5CXUA 1KZ4A 4OYRA 3JQ7B 4RD6A 4EEXA 1Z2DA 1RQNA 3A4IA 4HGZA 4OHBA 3UVEA 2C4NA 3F3MA 3CKKA 121PA 2UVPB 2R25B 1KO7A 1UWVA 4H27A 3HU5A 1E94E 1N3IA 2PJDA 1CNMA 3OEHA 4CN8A 2R1ZA 1JAHA 3TKAA 3MAJA 2V96A 2YN2A 3KXPA 3IB6A 3W5BA 8ABPA 5B55A 3BHJA 1FQWA 1DJMA 3DT6A 4RKRA 4E12A 2CMFA 1IHDA 4QGBA 3QXHA 2D1QA 2AKAB 1Z5NA 2CJPA 2ECQA 4RGBA 1XMOB 3GYBA 2G82A 4IWNA 2VZLA 1I7DA 2LBPA 4RANA 1TECE 3AI7A 2FFJA 5LYJF 1ZZPA 3NEAA 2CF5A 2IHYA 3W2WA 1KVTA 2MHCA 2FN3A 3ZQ6A 2YYSA 5A4MS 1G5QA 3UMFA 3H8VA 3JD4A 3IDQA 1J90A 2QTZA 3VYWA 2R751 3H9EO 3WV4A 3LNMB 4X5OA 5FCDA 4QU9A 5AM1A 3DWGA 2I7TA 2G09A 4IYJA 4DTIA 1E3DA 5BUQA 4NG4A 4FXOA 1XAIA 4YGXB 2GPYA 4KU4A 2REQB 5FOUA 4QFMA 2DWPA 1CRLA 1UKZA 3GJZA 3PHLA 1VYUA 1VSBA 2COKA 1MJFA 4PAGA 3AFOA 1QP7A 2CEAA 2P41A 4MUFA 3AIMA 4V0RA 3MWFA 4S24A 5AM0A 3O1IC 1JQDA 3VVCA 1F8YA 1LPNA 5H3HA 3ROKA 5AVYA 3U37A 4RKFA 3F5SA 1JZSA 1OC2A 2PZJA 2OBMA 4UREA 4R1QA 4I1VA 1OZGA 4V3BA 3U09A 1EUCA 1A9SA 4CKBB 4ZOQI 2OLJA 4OH7A 5T4BA 3BWEA 3DM9B 2FX5A 1C7RA 4N12A 2X4IA 1JMWA 5ITWA 4P32A 4TGLA 1K8QA 1BXGB 2M6SA 3N0VA 3CSSA 1YACA 2YQ5A 4TMYA 3R8FA 3JU3A 3G68A 1UMBB 4D9KA 2R4UA 2JAQA 1RI3A 5JJ5A 1Q15A 1EP2B 4M0CA 4TL6A 5HZGA 1GZ7A 1ETHA 4WMLA 1YS2X 3GEHA 3GNQA 3Q3VA 4IXDA 1L7RA 2W6MA 3S2FA 1XFAA 5GGYA 4ZCPA 5D86A 4F2HA 2X3FA 1HDOA 2HJRA 4IHKA 2H2GA 4PX2A 2YCBA 3ONEA 4BBZA 4RD0A 4AY4A 2ZI5A 1B14A 1B76A 1I6KA 4RSRA 3DVSX 1ADFA 2CD7A 3K0SA 1EJ6A 3RAFC 3L1VA 1V55C 3K15A 1O9BA 4PYOA 1IZ7A 1THGA 1EA8A 3QJGA 3K6BA 2F3UA 1UMCB 3VOTA 1WULS 1EJ0A 2I6UA 1O5TA 3E9ZA 1GN8A 3MA0A 4PYIA 4WKOA 5DT2A 2D62A 3RRMA 1OQCA 4B3HA 1SCBA 1DKOA 5ALMA 4IG4A 3MRTA 5CA1B 1SD1A 4LJ8A 2AJ8A 1RIIA 3RYIB 3IBCA 3UTCA 1N2BA 4G4SO 3ITEA 2PMCA 4KTVE 4P54A 3CLUC 4WLVA 4TLMB 2JEOA 4PVCA 2GN0A 4RZHA 2IYYA 3TFOA 3SX4A 4HBZA 4R68A 3G59A 5I9TA 1Y81A 2ATCA 2VOJA 1TCBA 4XW2A 4MW6A 1XLVA 3PHJA 1D4FA 4GOMD 5ALSA 4LGYA 5HR5A 1BA2A 4D7AA 3K1HA 4PPFA 3P2EA 1JDTA 2O7NA 4JLPA 1PYOA 3UJ3X 3WIDA 5CT5A 3SZUA 2I0FA 4DRIB 3C6QA 2C3YA 4MYRA 2EJTA 2H00A 3L8MA 1SXHA 5CM2Z 5JU6A 3LKBA 3M0EA 5P21A 4DPKA 4W82A 5IBPA 3C45A 3L5OA 2VT3A 4E7PA 3S2IA 4KUHA 1KI6A 1RTKA 2I8AA 4KDFA 5CA0A 2PO5A 5CJJA 3LIIA 3AQCA 5EXSA 4RTMA 3A14A 3FXHA 1H9GA 3KTAA 2QJOA 3T3IA 1JHOA 3Q40A 1RDFA 1CF4A 2SECE 2BUAA 4ULWA 4FDTA 2IYAA 4R1NA 3CHYA 1K8XB 1FS6A 2VQFB 3G8BA 4R1OA 3D1JA 5KQLA 4E33A 5JYBA 3UK1A 4NZYA 4BNDA 2R65A 4RZXA 2FQYA 4P7BA 3ROMA 2QRUA 1E1KA 2C4MA 2DQ4A 1ZGCA 4FFRA 3KKMA 2VRCA 5KYXB 4MR7B 1SF8A 5EINA 3LCUA 3QYFA 4N47A 3EPPA 4HWSA 2PMDA 4ACAA 3ZVKA 3LXRA 1VLTA 1T6UA 2HAEA 1BEUB 3O31A 1T5HX 1LBSA 2IK8A 2R7MA 3UMBA 2I4RA 3PPXA 2A1UB 2O7SA 3MMZA 2IPXA 1H69A 5BNTA 1SWVA 4I19A 5AVUA 3IP9A 4FJ1A 3C6YA 1XLUA 5H80A 4EATA 5LQJA 4W7HA 1H6BA 2FZGA 4CIWA 1TKAA 3W4KA 1WHTA 3CC8A 3CUSA 2V3WA 3VZBA 4H7JA 3JYNA 3LT2A 1RCTE 2WSSD 3F6RA 2W7TA 1E6LA 1IOZA 4BNUA 4F60A 3DJFA 2XVZA 4RH3A 1RWQA 5KX5A 3E18A 4MMYB 4OGWA 2V7EA 3O8CA 1I4LD 2PZMA 1AZSC 1LVKA 2A30A 4XEHA 2E4UA 4OP3A 1A04A 1G3RA 3LT1A 1VMIA 4EZEA 2DEUA 1K97A 5GJWC 4ARBA 1P33A 2EINC 3T5BA 5GTDA 3JRWA 2EW2A 1HC7A 4NHOA 2GD2A 2GETA 3WGYA 3HB4X 3KJEA 2I2DA 1AZLA 4HSEA 1JG6A 3I5QA 2GI4A 1NLXA 3AZQA 4M0PA 1H2RS 4O0MA 4GX0A 4WKCA 2P2SA 1EK2A 2VHJA 4RLQA 2VT6A 3T34A 2HRCA 5CTAA 3HADA 1ZDMA 1DIBA 5A6BA 4CBVA 2RHRA 2P4QA 1PBTA 1XAJA 5JISA 2R79A 5EHIA 1YQUA 5L0FA 4AZ0B 4RY2A 4YRTA 2EAUA 1UUFA 4US1R 3HDGA 4CMKA 1Q1EA 2HTEA 2IVZA 4HP8A 3W2FA 4IO0A 2HNBA 4FB4A 1YS7A 5JYDA 4RXMA 4OD5A 3THSA 4HH0A 4KAXA 1C0PA 2QZ9A 1ZRNA 1EK1A 1PWYE 1BE8A 1T9GS 1L4NA 3G2IA 1L4KA 3KUDA 1M7BA 2PE5A 1ZCAA 2GKGA 5JPIA 3LI2A 1DQYA 5F3RA 2GZ1A 2VJYA 3PDHA 4R2WA 4AE4B 3GVPA 5I8WA 3ZQJA 4R32A 3MW8A 3SQDA 4CQMD 1BVYF 2X7HA 2ZAGA 3EQ8A 2PUGA 3WDKA 1NZEA 3QSYA 1EB8A 4P36A 1E7RA 1WWPA 4FAPB 5J5VA 3QLVC 4JBXA 4I9HA 4BO4A 1PBNA 1YR3A 3AZPA 2H06A 4JI0B 3LBIA 5JNUA 4YUXA 3Q41A 2AN3A 3S6JA 3MS4A 4RIGA 4LHSA 4QXRA 3QX7A 3H4VA 2WUDA 1YE5A 1W75A 3C8GB 1V8BA 2ZJOA 3NORA 3OSUA 1YONA 4DIFA 1QSPA 4AMGA 5LP6A 3DOIA 2QN6A 4MQ5A 1THMA 4B40A 3AV3A 4NI5A 3PI7A 4UMFA 4HF7A 4CT5A 4B4UA 5FPYA 1GTSA 3QEJA 1QZUA 1NSTA 4E2WA 1QLEC 5ED0A 3KYJA 1HWYA 2OT3B 1N2EA 2EHJA 2PYIA 4QQRA 1Z5VA 4IMPA 2QORA 2V7WA 2ZYWX 3EVGA 3NM5A 1K04A 3E7PA 1TF7A 2JDID 2VZ8A 4C43A 3OE7D 2AQ8A 4GLLA 2OEVA 1KWGA 1PS9A 1T2FA 3ODGA 2CWDA 2XNDD 1A5TA 5FOSA 2BLNA 1L5WA 3V3KA 4M0EA 4C76A 3H2VA 4FNOA 4TLEA 3ZUGA 4LZJA 4LHYA 2PSFA 4I4TB 2NPFA 4BC1A 1J20A 2B3TA 1DXOA 3W8DA 2HTFA 3QMPA 1ISRA 5ILGA 3P0HA 2BMJA 2H8KA 1NF3A 2A68F 3LDHA 3OEOA 2QP9X 4ZLDA 4TL8A 5BQOA 4GF5A 1N34B 1T35A 4D9MA 2BHSA 5L0DA 4FDVA 1UPFA 4XR9A 2VSQA 3GHHA 2Y93A 3TMKA 4CE6A 3LUGA 1HR0B 5CNIA 1E96A 4Q9DA 1FMFA 3P2KA 3OT5A 1PJ2A 2DKNA 4RA6B 5B30A 1UP7A 3PQDA 1RACA 3WQQA 4D9GA 3ED1A 3ZWQA 2YVLA 3RWBA 5EESA 5CD1A 2CXOA 3C3MA 2GN2A 5F78A 2DFDA 3HKCA 5A4DA 1FSPA 4DDWA 1YRAA 3U0BA 2XUOA 4YAEA 1EPUA 1MKYA 2WU3A 4CDRA 1CZKA 1Z62A 3E5NA 2QL9A 4K9PA 2EYQA 4LV6A 3RKUA 2PR2A 3I4CA 1NN0A 5ADVA 5F28E 2YOGA 4UQOA 1VYTA 4ND4A 1CUHA 1A7AA 1SQSA 2PTGA 3GLHB 3VVBA 1L5YA 4BMVA 4HAWA 1MC8A 2M4EA 5K99A 2ZP1A 3CEHA 5A6AA 1H5UA 3C5HA 3IJPA 4CETA 5KB3A 2ZBGA 2PVPA 4Q18A 1PZNA 1ZR2A 3WLOA 1XU4A 4MUJA 1XQ9A 3BVPA 4N18A 2C00A 1VL0A 2H2IA 3ZIDA 3ZE2B 1JHQA 4MHOA 3SOPA 2EGGA 5AUNB 4DCJA 3LD9A 1M1NA 2NT4A 1J06A 1U8FO 3KLPX 3MRVA 4MI1A 1E20A 5D2CA 2YZMA 1DRVA 3YASA 2FRDC 5JSKA 4JX8A 3SR0A 2Q7OE 2G4VA 3GUUA 4RVUA 4EGSA 3EG9B 2UUOA 4YC7A 2YL7A 1QYRA 3ZQKA 4N9QA 1SG0A 1Z83A 4UEJA 3L0CA 4MB0A 3DHYA 3I58A 4KREA 3FUCA 1TGYA 2BGJA 5F76A 4Q3BA 4G26A 3WYBA 2PSSA 2GYYA 3S2ZA 1XQ1A 3T7IA 4DLWA 4BP9A 1KOGA 1E1YA 1DSSG 4M99A 4MA4A 1JDJA 5CDSA 4E6EA 1G38A 1YAHA 4GZLA 3V7UA 4C29A 3THXB 5IC5A 3NASA 4QBGB 1WSWA 4H15A 1UBOS 3RKRA 1BVUA 3ICOA 3V33A 4L22A 2I33A 3VVLA 2OCAA 3OIDA 1JAXA 4Y6OA 5BO5A 2SKDA 1Z73A 3EXAA 4JK3A 4FIZA 5C5DA 2I6GA 1XZMA 2FOIA 4BFWA 1MX3A 3D6UA 3ME5A 1QG2A 1HQDA 2EFYA 4DM7A 2OR3A 3QE0A 1DP4A 1ULUA 2ZITA 3C3YA 2QLTA 1Q7BA 3CRZA 5CB4A 2Q07A 3PC2A 2YV1A 3RWMB 1YKGA 5EWLA 4IDQA 2W8BB 1UMDA 3I04M 1YDIA 2Q9AA 4PZCA 4ENPA 2PJRA 3OZTA 3L7KA 5JH7B 1AURA 1HBJA 1BGWA 1KJJA 3ODPA 5EPUA 2FMFA 4JJ8A 4F8YA 4KLCA 4B6IA 3U7GA 1FFCA 2O7VA 1W87A 4I1RA 3HCPA 5L95A 3NGMA 3MTDA 2Y3GA 4JP5A 1POXA 4U2FA 3P96A 5KNDH 3OLXA 1AD2A 2BTQB 2IUUA 4Z0PA 2PLWA 4BRUA 2A35A 1EVIA 1F5NA 3NTOA 3UMKA 4QFDA 4MB2A 5C1IA 1F6BA 3J80A 5FWAA 4OQNA 3U44A 1R5JA 3VR6D 4XFKA 4PXSA 2JIOA 4KIFA 3UENA 2PLRA 3WB2A 5FHQA 1ORDA 4C3DA 4LFCB 1LD3A 3IULA 2E21A 3X1XA 2V0CA 3L7CA 1NWHA 2DWOA 2CFSA 3GWGA 3F6YA 4FYVA 2MSCB 3PR3A 2WMDA 2BFBA 5IULC 1RBMA 1HT0A 4MP8A 3ESYA 2JFVA 4DRYA 1I4YA 5CYGA 3PG5A 4L6AA 2XMCA 5AHWA 4O59O 5IP5A 1TZJA 2GAJA 1ISGA 1O6CA 3E7XA 3H11B 1ZQ9A 4R83A 4WN9A 2QW1A 2X4GA 1EM8B 3L7JA 1U2RA 4Z9JA 3STUA 1WBJB 3W6NA 2G06A 1B00A 2ISCA 3VKGA 4G25A 3ZNPA 3GRKA 2I4LA 4X45A 4A2PA 2V8BA 3QMVA 2IZ6A 1EFVA 4CDYA 1N5IA 3UEOA 2LCFA 5C8YB 2QM8A 10MHA 2IPAB 1WV0A 3KPVA 2O2JA 3ZXIA 1KQOA 1L7AA 3UK0A 1NVWQ 2OZKA 3IL2A 4G86A 2ENUA 1G21A 3QBDA 1NYTA 4EBBA 5H9VA 2KSQA 4NV0A 1P2FA 5JCPA 1Y6FA 5I7WA 1HQYE 1RLTA 1O3UA 1JWBB 4DGSA 1ADBA 3RFXA 4HVTA 1Y7LA 3RS5A 1YDEA 1VM6A 2HT1A 3ZHZA 3L8FA 4RESA 1RMYA 5KYNA 2KJQA 1N1CA 3TB6A 4D25A 4P92A 4AG3A 1G5PA 3E05A 3OLQA 3ADBA 2Q7RA 1N8NA 2FLVA 2VDUE 4LNUB 3ZBQA 4EJ0A 2OMEA 1M75A 2VDKB 1JDUA 2W6PA 2QAGB 2JPUA 3LEVA 1NM5C 3G79A 5DBIA 1TYCA 2HUJA 5DF1A 1H2YA 1AGRA 1FQJA 3AF4A 4NFYA 3GANA 5KVCA 3MM4A 3BMNA 2I6FA 2QI9F 2YXLA 1FMVA 3AL3A 5GOZA 4EPRA 5IFKA 4JLKA 5K0NA 1VIDA 2YV5A 2LGJA 4HDRB 4XIFA 2ZUDA 1SM4A 4O4JB 4HLQB 3JD3A 3VZPA 3A7DA 1HOXA 2ZRFA 2DTDA 2Q62A 2X3YA 2TMDA 4JP3A 1RMQA 2WVGA 3OUTA 4G8JA 1TA4A 4WGZA 2RONA 4FB5A 5BN5B 2AJLI 4P3YA 3IKJA 1LK5A 2X23A 3LC2O 2PU5A 1YK1A 1R4TA 4I1UA 1NW5A 4JI5B 1YQQA 4JQOA 821PA 3VRHA 4A6PA 1KVRA 1W6UA 2FN4A 4UXJA 3ASNC 4PE5B 3Q2IA 2JFZA 3H7AA 4XB6B 3IOYA 3VPDA 3H5RA 3NIBA 5EZSA 2ZRBA 4J4TA 2CY0A 5JDIA 1I2CA 1NY5A 3K66A 2Q6TA 2P9HA 2FEXA 2P27A 5CT6A 2EDCA 3LVQE 4RGYA 3VXKA 1XKLA 4YRSA 3PJEA 5I5GA 3IGFA 4IOKA 4D81A 5TMPA 2XTJA 1NSFA 1JLMA 2IYVA 2PUVA 4LE0A 2FUG1 2F9FA 1TX4B 5JNTA 2TYSB 1Y4DE 4NJOA 2AXPA 1PZXA 4RJIA 2CZGA 2MSNA 2DBQA 2ZXFA 4WOCA 4PYKA 3QPUA 2PH1A 3TZQA