4KNWA

The crystal structure of human hdhd4 in complex with magnesium and the phosphate mimetic vanadate
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
239
structure length
239
Chain Sequence
SRVRAVFFDLDNTLIDTAGASRRGMLEVIKLLQSKYHYKEEAEIICDKVQVKLSKECFHPYNTCITDLRTSHWEEAIQETKGGAANRKLAEECYFLWKSTRLQHMTLAEDVKAMLTELRKEVRLLLLTNGDRQTQREKIEACACQSYFDAVVVGGEQREEKPAPSIFYYCCNLLGVQPGDCVMVGDTLETDIQGGLNAGLKATVWINKNGIVPLKSSPVPHYMVSSVLELPALLQSIDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N-acylneuraminate-9-phosphatase
publication title Design, synthesis, functional and structural characterization of an inhibitor of N-acetylneuraminate-9-phosphate phosphatase: Observation of extensive dynamics in an enzyme/inhibitor complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 84
structure length 239
sequence length 239
chains with identical sequence B, C
ec nomenclature ec 3.1.3.29: N-acylneuraminate-9-phosphatase.
pdb deposition date 2013-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.710 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4knwA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4knwA01
5AVVA 5AVXA 3QYPA 4HYTA 1YDFA 4HGOA 3WGVA 4C4TA 4C4RA 5AKGA 5ALEA 2HX1A 2PKEA 3B8EA 3SF0A 3WK6A 1ZD2P 2B8JA 2B0CA 4I9GA 5ALZA 1Z4QA 3QXGA 2GHTA 3B9RA 3WGUA 1IWOA 3QU2A 5IT4A 4IFTA 1ZRNA 4UAUA 2PQ0A 4BX0A 3OCVA 3AR2A 5JJBA 2I54A 3NANA 4UARA 1Y8AA 3CZ4A 2HI0A 5AM0A 4G9BA 4Y2YA 4BX2A 3ED5A 2C8KA 5ALSA 1YJ5A 5AK6A 5ALDA 1YS9A 4JB3A 4BNDB 1S8OA 4BEWA 2RAVA 2HF2A 1Z88A 2YBDA 2WHEA 5AM4A 1ZD3A 3R09A 3L8GA 3A1EA 5AESA 3HYCA 4KYTA 4I9FA 3CNHA 2MU1A 5AVZA 1Z5UA 5ALYA 5ALHA 3U7EB 5AVQA 3KDPA 5AM5A 5AVTA 2CFSA 4FE3A 1Z4PX 4ZEVA 3QNMA 4IG4A 2ZG6A 1RQLA 4OHFA 5IS2A 3N8GA 1TE2A 1CR6A 5AI9A 4QQFA 1L7PA 2X4DA 1U02A 1XP5A 3QLEA 2B82A 3QUBA 2G06A 3UMGA 3K1ZA 1RC8A 4H1WA 5IT0A 3AR7A 4Y2PA 1YV9A 3SMVA 1ZD5A 3IRUA 3EWIA 2HEGA 4YIHA 4UU0A 2WF9A 1TA0A 5AVSA 1YMQA 2HCFA 1Z4JA 5AK4A 5AVWA 3ET5A 4OCZA 3DAOA 5FP0A 3E8MA 3KC2A 2I34A 2FPUA 3NALA 3I28A 5AW0A 1L6RA 3SLRA 5AVYA 4UATA 3U7HB 3WKBA 2ODAA 3PGVA 2WF6A 2ZOSA 2W43A 3KZXA 3OCYA 3FGOA 5A3QA 3FPBA 2AGVA 3ZTWA 3EPRA 1TJ5A 3MPOA 1CQZA 1U2TA 2RBKA 1L8LA 2YJ5A 2MSNA 1XPJA 1ZD4A 4UM7A 5AW8A 4GIBA 5AKXA 3B9BA 4FFDA 2I6XA 4G63A 3E58A 3A1CA 2VKQA 2B1QA 4UM5A 2EATA 3AR5A 3NUQA 4UU1A 3ONNA 4BX3A 4MWOA 5ALFA 4NV0A 2I55A 3L0BA 1RQNA 3R4CA 3AR4A 3M1YA 3VAYA 2G0AA 4YIKA 5AI6A 3EF1A 5A3SA 1WVIA 3R9KA 2PR7A 3WK5A 3E84A 1LVHA 4QJBA 4BKMA 2RARA 3ESRA 4ZEWA 1WZCA 1Z4OA 5ALRA 1S2OA 4KNWA 2WF5A 4PNHA 1QH9A 2P9JA 4XE5A 3OTQA 1LTQA 1O03A 3J7TA 3KD3A 3WKDA 3U7GA 5AVUA 1RKQA 3QX7A 5AW2A 2HDOA 4F72A 4RETA 3ZUPA 4CF5A 2I7DA 2B8EA 1YNSA 4DFDA 1VJ5A 3L8EA 1Z4IA 5ALIA 3AR8A 4EENA 3AR6A 3QU5A 4UMDA 2AMYA 2YMMA 2YFYA 5T41A 3F9RA 4NAVA 5AKKA 1PW5A 3I76A 3DNPA 1J97A 4KX3A 3BA6A 1SWWA 2NO4A 4YCMA 4YGYA 3PDWA 3QUTA 3WK7A 3SD7A 3AR9A 2GFHA 4AS3A 2YMLA 3D6JA 3OCUA 5AK5A 3N5KA 4L6AA 3WKEA 4ZEXA 4J03A 1EK2A 1SWVA 1Z4MA 5ALMA 4BNDA 1L8OA 2ZBEA 3SKXA 4NABA 1Z4KA 1AQ6A 3L5KA 4EZEA 2Q4TA 2FDRA 3L1VA 1L7MA 2IOHA 4CF3A 4CF4A 3ET4A 3ZX4A 5AW5A 4HGQA 1N9KA 2FI1A 3QU7A 1ZRMA 2G80A 4YCLA 3PCTA 4BYGA 3AR3A 2R8XA 5E0OA 4BEVA 2WF7A 3MN1A 4E88A 3A1DA 2IA5A 4UMVA 3KOOA 3N1UA 3QUCA 3UMCA 1T9ZA 3ZVLA 2FUEA 1WR8A 5A3RA 2O2XA 3MMZA 5ALQA 2R8ZA 1NF2A 3ESQA 2Q4RA 2YJ4A 4HGRA 5AHXA 3SHQA 5ALUA 1QQ6A 4EX6A 4RESA 3FVVA 2B30A 4J2TA 3FZQA 4EELA 1NNLA 1O08A 5AI4A 2GMWA 4HGNA 2HHLA 2HO4A 2YY6A 4YH1A 1N8NA 4XOUA 5AW3A 1F5SA 2ZBGA 3U26A 5AKZA 3ZX5A 1NRWA 2G08A 3P96A 3WK9A 3W5AA 3S6JA 4KX5A 3WK4A 2ZBDA 1RPZA 4XPZA 3MC1A 3QU9A 1RMYA 4CE6A 1RRCA 4O8CA 2YMPA 3L0CA 3ZI4A 3GYGA 2DQSA 2YN4A 3ZU6A 3SKYA 2JARA 1MH9A 3OPXA 3NIWA 3U7FB 2C88A 4NWIA 1Z4LA 3ZW7A 3ZWDA 1ZJJA 2G07A 3EF0A 4Y2JA 2AH5A 1Z5GA 2W4MA 5AKIA 5AM1A 1VJRA 4AP9A 5AI5A 2ZXEA 2R8YA 1U7OA 5ALXA 2FUCA 2O9JA 1L7NA 5AK3A 3ZVMA 4MUMA 3FPSA 4F71A 1Q91A 1EK1A 4Y2TA 1ZS9A 5AM2A 5ALKA 3E81A 5AW4A 1FEZA 3QGMA 2BDUA 2IOFK 2WFAA 3L8HA 5ALGA 4BBJA 2IOFA 4AS2A 4HAIA 3W5DA 4Y2XA 2BY4A 2R8EA 1RKUA 2W11A 3I6BA 2GO7A 5AW6A 2WM8A 2OA0A 2BDEA 2OBBA 3ZWKA 3OCXA 5AICA 2G09A 4Y2UA 5ALVA 4OFZA 2FPWA 3BWVA 3PGLA 2OYCA 4L57A 1RDFA 2G1AA 2Q5EA 1VFPA 2HOQA 1TJ3A 2FPXA 2I33A 4FYPA 1WPGA 4UMEA 2CFTA 1RMQA 4Y2RA 2YJ6A 2WF8A 2QLTA 4Y2VA 3WK8A 3M9LA 3RF6A 4C4SA 5AIBA 3OCZA 4KNVA 1QQ5A 1U2SA 3W5CA 2HF7A 3L0YA 4YCNA 4CNQA 5ALNA 3HLTA 3L7YA 5AI0A 4XQ0A 5AI8A 4B6JA 3A3YA 2JAWA 5AW1A 2C4NA 4DCCA 2EARA 2NYVA 3IJ5A 2AUTA 1KYTA 3DV9A 4KN8A 2QYHA 2YJ3A 4GXTA 1QQ7A 3WKCA 3QUQA 3UM9A 2CN1A 5AM3A 3U19A 1J8DA 3DDHA 2IYEA 1T5SA 1Z4NA 2FPRA 5AKHA 3U13A 2ZBFA 3NRJA 1RLMA 1RLTA 2FPSA 4OD0A 2P69A 5AKYA 1U7PA 3TLMA 5AVRA 2OM6A 4Y3UA 4UMFA 5ALLA 3KBBA 5ALTA 5ALWA 4EX7A 4NFLA 3WKAA 2FEAA 4Y2SA 2B1RA 2JAUA 3L8FA 4EEKA 1SU4A 5ALPA 2C9MA 2P27A 3RFUA 3W5BA 1QYIA 3UMBA 2D2VA 3ZTYA 3FM9A 5ALJA 1K1EA 2JGAA 1Q92A 1JUDA 5AW9A 2P11A 4DWOA 3NAMA 3NASA 4UASA 4L6CA 4Y2QA 4JDPA 1ZOLA 1X42A 3IB6A 3I1YA 5AKEA 2YMQA 1T5TA 3L1UA 3N28A 3N07A 1TJ4A 2RB5A 5ALOA 5AW7A 2EAUA 5AKLA 3QU4A 4UAVA 5AKJA 1RLOA 1RMTA 2HSZA 2NO5A 2GHQA 1XVIA 1L7OA 2CFRA 2C8LA 4UW9A 4DW8A 3ZVNA 2JAOA 3OCWA 1RKVA 4HGPA 5AIAA
chains in the Genus database with same CATH superfamily
1M6TA 1P4HA 4C4TA 3CW8X 4WPGA 1SXPA 2HMUA 3HZRA 1CJMA 4W9MC 1EM6A 2WB2A 4FDVA 1NMYA 3H4MA 3HRKA 3PQEA 3CLUD 4RDHA 4E2ZA 1PR2A 1AUEA 1MB4A 2IU0A 2V98A 2Q1UA 1KO8A 4TYMA 1RXWA 2JVIA 1YJ5A 1X1SA 2C4KA 4IHJB 4MROA 1H9BA 1YJCA 4AJOA 2FR0A 2JX0A 4JURI 2PWZA 2QR3A 3GEPA 1QHSA 3LW7A 1IWPB 2PEYA 3ND6A 5GONA 4AIIA 4JEMA 4X0EA 5AVZA 5AVQA 1E1QD 4GDFA 1V0JA 3A6KA 1C17M 4XM1A 1U02A 1IZ8A 3KQUA 3GVIA 2QLAA 3IV7A 3O7MA 1GPLA 1ECPA 3W4JA 1YV9A 4PEVA 1ZHHA 4EGJA 1QX4A 2ZSUA 2IPAB 1IOVA 2W6NA 1RJGA 1UK9A 1GDDA 1A5AB 1Z0IA 2CDCA 2KM1A 3ZWCA 4LI3X 4KLCA 3VZRA 1LGYA 4IVPA 4GWGA 1FE8A 2QT1A 1A5SB 4WASA 5H68A 3MWJA 2AJTA 4CR7A 4KXFB 3ONNA 1GFZA 3OOEA 3S9OA 5LUAA 2O0HA 2H1FA 2ENUA 3HCWA 2OZLA 4JA0A 2G0AA 2JB9A 1RU3A 3THYB 3NHYA 3OLVA 4HPWA 2E4YA 1O4VA 3RV3A 3BIXA 4XIIA 2PD3A 1YZHA 1SCQA 3MTEA 2FKAA 2WIGA 4Z6KA 1DMRA 1BRMA 2DM6A 2YKZA 3GJTA 3KYDB 5EEGA 4CMCA 1ESNA 2F3RA 2R1VA 5JT4A 2E4VA 3VBCA 3X1MA 1W52X 3ONEA 4B6EA 2J4FA 2DP4E 1EK2A 2VJNA 1N4DA 1BEEA 1KVTA 2X8AA 2O0LA 4MEBA 4CS9A 4LY0A 3FBTA 1E9FA 3GCZA 4TQAA 3S5JA 3WLPA 4L4ZA 1U0LA 1D8TA 2XBMA 1P61B 2YNMD 3R0ZA 1T9ZA 2G17A 1X0VA 5JNUA 3FCUB 1PLJA 4CM7A 4G4SP 3W3AH 1JFVA 3P19A 3FMFA 4R0MA 4BVKA 1QZZA 3RRFA 1SOVA 5DSTA 1MG5A 4C7OA 5MN6A 4JJFA 4R98A 4FINA 4R40A 1IVYA 1CP2A 4XPZA 2ZU6A 3FSRA 3QU9A 2HJSA 1SCAA 3FUTA 3NIWA 3ILYA 4OXRA 4FC6A 1ADBA 1YULA 4A2CA 2Q6LA 5CG2A 4HB2A 3HN7A 2PGLA 3F2IA 3AV3A 3BK7A 1FZTA 4BUJA 4QOGA 2FZKA 4ZWNA 3SR3A 5H5JA 4HQ6A 3PQ7A 3SJBA 2WYUA 1FP1D 2J3LA 4M8KA 1YK1A 4NF2A 8LDHA 2P65A 1R6DA 1P0CA 2IU4A 4JMPA 1JPUA 4HDNB 2JVKA 1LBTA 1Z2NX 4XUDA 2A4KA 3LLCA 2BBSA 3K20A 1U4NA 1R8YA 4MAAA 5F77A 1HPLA 4JGBA 5K8LA 1E77A 1TPZA 3D1VA 4YUWA 3DZIA 4OL0A 3FDIA 4O5AA 2BUCA 2FPSA 2P69A 2LKDA 5FR1A 4R41A 2BKAA 4RPCA 4DPLA 5DYTA 3DR3A 1CKEA 1EE9A 1L7RA 4IRXA 4IH9A 2B1RA 1YZYA 1KP2A 5DQTA 2XKAA 3PXGA 4KRFA 2B1JA 1YL6A 3ZHSA 1JKJA 2PS1A 3ZLUA 4DWOA 4BTLA 4EDFA 1GPWB 3H0KA 1R37A 2D3WA 1CZRA 4FR2A 4IPTA 4CEIB 4X7MA 2BFMA 5HKKA 5IUNC 2F1RA 4HEJA 2HRQA 2JW5A 5CT8A 5J2UF 1FNNA 2JI4A 3DUFB 2EBFX 2WEKA 3WLFA 3VKFA 1F0NA 1I2BA 4G0XA 1CUBA 3BX1A 1ZAYA 1CY6A 3QKRA 2XQJA 3G9XA 1NHWA 3Q3CA 5ECDA 2I54A 4IWNA 5F1OA 5K6AA 5BQGA 3SSMA 2E5LB 3QW2A 2W90A 1UBMS 1K5PA 4LF9B 1WE2A 1C8VB 4JA2A 4ZQBA 2VC9A 2P1RA 1BTOA 4HNVA 3CZ6A 1WBBA 3QNMA 2R6JA 2JA1A 3LYLA 4IGIA 4QQFA 1H3NA 2KLHA 1ZN2A 2WYWA 5IXYA 4I50F 2WVAA 4QDTA 1G6Q1 3AFOA 4YHHB 1TUBA 5DNAA 3AERB 3QITA 2WF9A 2J0UB 1GA1A 3EISA 4WZBB 4NBKA 3RBVA 2F8TA 3OIYA 2Y1OA 4E5YA 4HH3C 5DQZA 1P5ZB 3M79A 1GPYA 1RKCA 4WXMA 3EVZA 2ATVA 1T36B 4QPPA 3D43A 1A8QA 3OT4A 3OQHA 5LQRA 2ADOA 3F67A 9LDBA 4PC7A 4R9RA 1TEZA 1XP8A 3FX2A 5JASA 3V46A 4XR9A 4QREA 2ZYRA 3CUYA 1GNQA 1H0KA 5HJ7A 1MP0A 2Z1DA 3S28A 4CM1A 4RQUA 1IBSA 5FNZA 4OGWA 1K8XB 3WWPA 1LBSA 5HKAA 1UPAA 1LSUA 2IEBA 4BJ6C 3N8NA 1RXUA 1XEXA 4PAOA 3EBPA 1J97A 3NIGB 5HVNA 3CT4A 1H7IA 4KQXA 4P0TA 4L6RA 4RFVA 5LKRA 4O7GA 1A9YA 3NDBB 5IY5C 3GHHA 1RM5A 3K09A 1VJGA 4BL5A 4LYEA 1WOLA 4RM3A 1IY8A 1NRIA 2JFPA 4O4HA 1FRFS 3NHPA 1ZI6A 4ND4A 5CG1A 3EZLA 4RK5A 1BZ4A 4ZVUA 5IDQA 1GKYA 2W4QA 4QHSA 3C8MA 3L04A 4PR0A 5REQB 1XPOA 1QAMA 1FYWA 4CFSA 2HJWA 5A9SA 5D6OA 2PMFA 3OCJA 1KKLA 3JQQA 4IJVA 1UADA 2WYVA 2ZYIA 2A5JA 3GPIA 2QOEA 1YWGO 4A0RA 1OILA 4GZ3A 5AM1A 2P79A 4C0KA 1B0PA 4RC9A 4CDMA 2P2LA 4J0QA 3DLPX 3X1KA 3WBFA 5EGSA 1KZ6A 1ZZGA 3D3WA 3DBVO 2XKBA 1DKMA 5E8RA 5BQPA 2E82A 2ZT6A 4X6YA 3ZNQA 4RH0A 4TYNA 2ZBPA 1ZIDA 5CPFA 3EHNA 2JRLA 4YI3A 1XPRA 2VHUA 4RVFA 3UKJA 2H2IA 2R7TA 3DI5A 4UNNA 3UT5B 1QZUA 1XG5A 5AHRA 3FNFA 3ORRA 4C4AA 5DEIA 4QVGA 1BFDA 2XDAA 4HQRA 3EULA 5IT9A 1B0AA 2XMPA 1ECBA 1XKTA 1GPMA 2JAUA 5KSOA 2P27A 3VZBA 5TQ0B 1Q0GA 5ALJA 3CZPA 4IJQA 3SYNA 4CBEA 1NONA 1NFRA 2A0BA 2AYXA 1T3SA 5F2OA 3I6ZA 1PE0A 3K15A 1K0FA 1IAQA 4NEQA 3P27A 4I99A 3JV7A 5JCJD 4PZDA 4YL0A 3F78A 3T15A 4HUQA 3HCBA 3FOEC 2Q1SA 1ZC3A 2J7PA 4YRIA 1FOEB 3O4HA 1O96B 4GF5A 3N53A 1QHFA 3TSYA 3AJMA 1IY9A 2IYRA 4WGYA 2R00A 5FAKA 4G9BA 2Y4NA 1BE0A 1OR8A 4KZKA 5HMLA 1NNEA 3UXHA 4JB3A 2DHCA 2UVPB 4NE9A 3K05A 4MTOA 4WXHA 5CGZA 4L7VA 5AYVA 1ORDA 1KJQA 2X8LA 4ZI7B 8AT1A 4X7PA 5HZGA 1ZMTA 2UKDA 3O4IA 4H77A 2BCEA 1K7FB 1JQKA 1PL7A 3U9TA 2WHRA 3RFTA 2QRHA 2KW3C 3MWLA 3OX1A 2H31A 1CRZA 4RA9A 3RUPA 4ACAA 3AKEA 3N8DA 4BUZA 4ETIA 4MCAA 3JT1A 4FAPB 3ZI7A 1TYDE 1YE3A 5CNJA 1G42A 2O50A 1GD1O 5LMUB 4CLXA 3FTPA 3V2HA 5K0TA 3ABIA 1P5JA 1OT3A 5EJ9A 1X15A 2DU8A 5CCDA 1E2IA 1Q14A 4V1CI 1KKUA 5IYZB 2MYTA 1CZHA 3WJ7A 3RT1A 2PJZA 2QP9X 4TKLA 5FWYB 1K7XB 1OV6A 3QP9A 4YLYA 3TGLA 3VTFA 4AMYA 1TWAA 1CSEE 3LDFA 5FQOA 5IBCA 2GKSA 3E15A 1T5HX 4HYQA 1WB6A 5GAJA 3A1FA 2UZ4A 3D0QA 1ZGJA 2BD0A 2NVUB 4F92B 3E2IA 4NCBA 1NWHA 2QW1A 2C7QA 3MIIA 3C2QA 2CVZA 3IAAA 3GWZA 4C4XA 1SUWA 4Z9XA 3LA6A 3CM0A 1SGWA 3D8BA 1YI1A 2QTRA 5JD4A 1L7CA 3MJRA 2QQEA 2AFHB 2E4UA 3QW4B 1G5QA 4LYAA 2JGRA 1U0FA 2R7KA 4PJNA 1XXLA 3QVLA 4QUKA 2WZFA 4W5TA 1FFSA 2C7OA 5HIKA 1WW3A 1WCWA 3D4IA 4HDMB 1W4LA 3CR8A 1VRWA 5A6JA 1SFRA 4KKXB 1VLJA 5DHFA 4ZT3A 3P1JA 4CJXA 4OLBA 2K7FA 1QQ6A 3O8LA 2ZJAA 1DIHA 2JFQA 4WOCA 1FMVA 1EE1A 2BZSA 3STTA 4E1VA 3FYUB 4IVNA 4BKPA 2NSGA 1EJBA 2GXSA 4HK4A 4A6PA 4NTBA 3RJ9A 3B12A 4P93A 2OV6A 5AXDA 2XCIA 3FPEA 4E13A 1CRPA 1XLUA 1IUPA 3WGIA 2VJCA 3ZWDA 5KKCA 1XF1A 2O3SA 1R0XA 1W5EA 1ZN8A 2V55B 2AC2A 1OR2A 2ZXEA 2CSXA 1HG0A 1IJFA 2PUVA 3FDXA 4Q93A 4R2IA 3PI7A 1I7PA 4YN3A 3THYA 4O29A 5JSFA 5E9JA 2BDEA 4HUTA 5EJEA 1SIWA 4WBNA 5HYVA 1GYRA 1D6SA 2VK1A 3QQPA 4Y2VA 3WK8A 2ZK7A 1YC5A 5F9HA 1E69A 3RVMA 1F9EA 3MJEA 3G1TA 1EB8A 4KTVE 4U2GA 3QEJA 2LGJA 1ULAA 4QPJC 2Y4OA 3O03A 1Z28A 3KYDA 1EE2A 3P2EA 4ER5A 4JHLA 4MWZA 4ZYVA 4X8LA 5HZMA 2O54A 4UM9B 5AM3A 1EEXB 2IF2A 4II7A 4UC0A 1GFSA 1OLSB 1XDDA 3OZCA 3OKFA 3F71A 1TYCA 5H81A 1HNZB 3RKSA 3G49A 4YA6A 4BGUA 4PYMA 4HDAA 2M98A 1NULA 4W82A 1TVKB 1ZH0A 4EHFA 4REQA 4PZCA 2RGNC 2XMBA 3SR4A 2ZCUA 4B4UA 1FXWF 5AUNB 3RUDA 3IB6A 3QHQA 2WT9A 1N7HA 4BZQA 1O5IA 4Q05A 3D8UA 5B4TA 4MS4B 4EGSA 3WA7A 4R51A 1N2CA 2ZYGA 2NT4A 3RRZA 1N2XA 3HSSA 3IVAA 1ZY2A 1XL0A 1BO6A 4EGCB 4DVZA 2LIVA 4J6FA 2Z8YM 2R7SA 3I0NA 4GC5A 1N5RA 5TRTA 1F1MA 4BX0A 5JJBA 4UARA 5F33A 5AM0A 2XB8A 2X5JO 3GLHE 1MJFA 5DO9A 2PNOA 2N46A 3LLSA 4JWTA 1N5IA 1QPBA 2ADMA 4NXNB 3Q3JB 4B74A 3IGFA 2VH3A 5THKA 3VR5H 1PVDA 3SZMA 5E9WA 2AOTA 4ZJUA 4LJRA 4YJGA 4PBRA 3EA4A 4J3NA 2QD2A 4GS5A 3CT6A 1N34B 3PDCA 1N2SA 4H7KA 3T1HB 1G18A 3KPYA 2PUCA 4HDNA 1A7EA 3BTUA 3LAYA 1ML3A 3H8JA 1L4UA 5CJ2A 2YRWA 3R3YA 4PZEA 2QTVA 5K0CA 1RM3A 3PFWO 4JJGA 4Y18A 4RVSA 4YV1A 2FCAA 3FPBA 4RK0A 3GF4A 1J8MF 4WK6A 1FDOA 3Q8WA 3VNAA 1H22A 1XPJA 1U99A 5AKXA 3AHJA 3C5VA 2I6FA 4UM5A 2YZ7A 3NUQA 1F17A 2R6FA 4OQZA 2QZ9A 3HCFA 5G02A 1ZOPA 3IIEA 2AD5A 2ODNA 3EDMA 3VC1A 1IUNA 2F43B 1FDSA 1TM5E 5K3DA 1C7IA 2EPLX 1EM8B 5T4FA 3B48A 4DDWA 2D2FA 3JAWA 1R2QA 3EEFA 5CI8A 4LERA 3QY9A 4MKFA 3P5BA 1O03A 3UMMA 3B82A 2H5EA 3NATA 2I9KA 1HRDA 5K8IA 3KKPA 3D4PA 5TQVA 3LQQA 5GZ1A 4MQBA 3U37A 4LRQA 4URWR 3O3NB 1P3Y1 2D59A 3EPVA 4OYRA 1SVMA 3UB3A 1IRIA 2AYYA 1ZHTA 1H2XA 4CM4B 2WAYA 4GQIA 2Q49A 1MHTA 4RENA 1N9KA 1PDOA 1Q3KA 1NOKA 3ETNA 2J9FB 4BYGA 1GR0A 3VVLA 5GJBA 1C7ZA 4R68A 3PZRA 5FZTA 2M6LA 4L4SA 2SBTA 2XGOA 1AVOB 3ROQA 1E3WB 3V7WA 5EP4A 3AERA 2RH9B 5HBGA 3TQFA 4B71A 2WHQA 1SHLA 4UREA 4DLSA 3LOPA 3D5QA 4WZBA 1IK4A 1T3LA 1UDRA 1IB6A 2POCA 2ZI3A 4O4JF 3OLZA 1RPZA 2E5FA 3KZOA 4EUNA 2VRNA 2V6GA 3PNPA 1YMVA 3OZFA 1U7DA 1VYUA 4LRUA 2ZRFA 4FZ3A 1T36A 4FDLA 2CL6X 4B3HA 4XD2A 1BGXT 3OF2A 4Q1DA 2XUGA 3KBOA 2IOFK 4FZVA 4TTIA 2AWOA 3CUTA 1UC4B 2HSJA 4TLDA 5K8VA 2GO7A 4I36A 5DBHX 1UFKA 4YRFA 4JI8B 2DWCA 4JW1A 4X3PA 4LPKA 1WB5A 4FZJA 3KQPA 1Z74A 3ZCVA 3LC7O 2GPYA 1RPAA 1RSZA 2PM8A 2WICA 1R0KA 1BVUA 6GPBA 3JATB 2VDWB 3H17A 2Q9UA 5J63A 3QVJA 4LY3A 3UMFA 3VZQA 2C77A 3QXHA 1HURA 3HACA 1QP8A 2CLEB 4ESVA 2ZTHA 1Y7TA 2A5LA 1SMYF 1J0DA 1OREA 4NDNE 1UC8A 5DSZA 3FHTA 1I1QB 1N5OX 4HQKA 4FWTA 1OZ0A 1HG1A 1V7CA 3JRMO 5FFMA 2VO1A 2PX8A 3AIMA 1WTCA 4G41A 2PGIA 5K7SA 3CSSA 3JD2A 1Z39A 3F7TA 3GH3A 4HX9A 3OE1A 5IP5A 2XCUA 3H83A 2FP3A 4C0HA 1JHUA 1A5ZA 1JIUA 4N6HA 3HEAA 1ZD9A 4CV0A 4OG2A 2BLLA 2QN2A 2IBSA 4M60A 3VH2A 2QW8A 2A88A 4GH5A 3THXB 3ER6A 1WDMA 4NS1A 1L4GA 3LLMA 2AX3A 3H9GA 4EHAA 2BZ1A 2OCAA 1AKRA 1Z08A 3RQSA 2CCGA 4LFAB 4Q7CA 3R7FA 5B6PA 1JFLA 1M7HA 3TL3A 4NCKA 4BWFB 3BN3A 4TZ6A 1YK0A 3AOEA 1XF9A 4A8JA 4WY5A 3E9EA 1IZ9A 2ZI9A 1Q50A 4UTOA 4PLZA 5FDFA 2OGTA 4OLAA 1I3KA 2XRFA 4INZA 3WJAA 3KKMA 4UE3S 1RPTA 3Q3IA 1RWKA 4IIJB 5CXUA 5FKJA 3L7BA 2DEUA 1EVEA 2JI7A 5AK4A 3DKAA 3ET5A 2ZSEA 3V8EA 2QVXX 3PKIA 4QOFA 2QN6A 4FOOA 1V1RB 1AA6A 1HYEA 4G5YA 1MVOA 4FOSA 4NPHA 5AW8A 1EG7A 2WM3A 4IUBS 1YF3A 1F12A 2W2LA 3AILA 4B7UA 5I7SA 4UDYX 4D41A 4Q7MB 4U5DE 1W1UA 2WJAA 3WWZA 4RIEA 4JFAA 1QKKA 4HC4A 2ADFA 1OE0A 3WC4A 3CEJA 2VNIA 5IBQA 3VU9A 1YDWA 2AI2A 4NK4A 3WOHA 2ZAMA 2XYPA 4QRIA 3OFND 5DF1A 4HPXB 5EE3A 2WVJA 3KQOA 3ZHCA 3WGKA 4D3YA 1NLUA 2J31A 5L0HA 3SHVA 1NATA 4X64B 3ESAA 4EKDA 2K7ZA 2EKDA 4O2AB 1NQ5A 4KQWA 2ID4A 1MGPA 2VDVE 4LXTA 1E9DA 1QPUA 3G4XA 4NMMA 3LECA 1UEIA 3PLNA 1E2LA 3ZYCA 2UVPA 4ZTZB 4DB4A 4RHYA 2J3QA 1ESDA 1BH6A 4XLTA 4ZI7A 5KZMB 3A2KA 4DCUA 3IVCA 2QN9A 4KQIA 2QRGA 4LGVA 1K5HA 1HDEA 3CLVA 1D5CA 2PANA 2R9RB 4DV6B 1YBVA 4MW8A 3WNZA 3P9SA 3KU4A 4KQMA 3EPPA 2C4HA 1Z17A 3UBMA 4NOMA 4TKUA 4NZNA 3I5UA 2DYRC 2P2CA 3CUVA 2OZLB 1SG9A 4LJSA 1K9SA 1Z37A 5JS1A 2QR2A 4EG7A 1VLQA 3ASYA 1G5PA 4MDHA 1NDQA 3VAAA 1N5KA 2REOA 1ZH8A 1IXZA 5ENDA 2HQRA 1P17A 1DO8A 3FNBA 4N03A 3GN1A 5CD1A 1TM3E 3KJQA 4S2EA 4QUIA 3I6YA 4OHMA 1KI9A 5KYYB 3FXAA 1U7UA 5HPYB 3RC2A 4AYWA 3WLMA 4QBFA 3MMXA 2Q4OA 1DHRA 1DBRA 4L3WA 5HKLA 4L9WA 5CB0A 2A6EF 3RJMA 2Y39A 3G2IA 5D2CA 1V6CA 1W8DA 1ZKDA 2ZRCA 3ISTA 3IJ5A 3K5IA 3LUAA 1WB4A 1RQPA 3TK0A 1J8DA 1DAOA 5GGYA 4KR2A 4RK7A 3KWJA 2EKPA 5AKYA 5LJLA 1JDZA 4C7OB 2H07A 2A4MA 3WKAA 1XQXA 2Y0DA 2EW8A 1W4BA 3A4IA 2IEDA 5IUJC 5ICEA 3RW0A 2EJBA 2IY7A 4FOLA 2OCLA 3AJEA 1OAOC 3R8FA 2B20A 2A78A 4AKTA 2GHRA 4MW6A 5ALOA 4DLTA 1FFDA 1WMSA 3O8NA 1VLLA 2I03A 4JI2B 1GKLA 3HXMA 3EY4A 4B47A 3BIFA 4OQFA 1TNDA 3VSDA 1H1TA 2NSJA 3OUUA 1IBKB 1W6RA 3OP4A 3MELA 6AT1A 3ZWIA 1T4DA 3MQFA 3RRXA 1DQPA 2EILC 5JCOA 2QG6A 2OBNA 1IN4A 1TPYA 3X0DA 2CZCA 4Q9DA 3WGOA 3ZWWA 2H57A 4B4OA 2EDCA 3RVLA 2BE7A 2Q2VA 5A6BD 4KO3S 4DM3A 1CYEA 4R3UC 3AP2A 1T8UA 5DT2A 3I3OA 3UTDA 1IK6A 3CF0A 4BQRA 4RA6B 2ERCA 2BSQA 1H3EA 3BDIA 4MVJH 2PFKA 2X86A 3KLPX 1TAHA 4BE7B 5JFTA 4FQ5A 2Y1LA 4HI0E 2ST1A 1E6WA 4G67A 3CXRA 1K5GA 3T5DA 4RH1A 3E6AA 3O2SB 4MRNA 4URFA 1JRLA 1QS0A 4IEFB 3EWSA 1AIPA 3PQ5A 5IU6A 2FE1A 4FYJA 4C0SA 3C3PA 2BI8A 3ASVA 5TGZA 4P0QB 3T95A 4I4TF 1LX6A 3GARA 3HCAA 3FOZA 5DLDA 4MVMA 1WSAA 2HMYB 5CUQA 3NUGA 1ESMA 4Z7JA 1QQ3A 3DQZA 1KK0A 4IOJA 4K88A 621PA 1JG1A 1O6ZA 4Q7JB 3ER8A 3QKRB 1N1GA 4LF6B 1EVIA 2DXIA 1HT0A 1J5XA 5IM4A 4ZMBA 2APJA 3TQTA 5IAAA 3DW1X 3DKIA 2HNKA 2CUNA 4LJ6A 2GCPA 3TMYA 4Q19A 1H23A 1YCFA 3BB1A 3C6MA 3QEBZ 2QRMA 4XKJA 3ZGLA 2R44A 3WWCA 1SN7A 2NO4A 4RHUA 1U5AA 1O6FA 1J25A 3SI7A 2QRVB 3EIWA 2ZJ0A 1NI5A 5FO1A 3ICEA 1BE1A 4MB6A 1WMBA 1Z3IX 4TL7A 1ZVVA 4ZVTA 4LNAA 4BNYA 1L7BA 1SHZA 2J0EA 4P3NA 3L7NA 4Q5IA 2WBLC 3IDSA 5FORA 3G6KA 1QIHA 3SJZA 2YJ4A 1AGNA 3G2PA 4ZO8A 1P7CA 5KWEA 4QXQA 1VL6A 4OJQA 3A6EA 1IMJA 2QVZX 2Y2VA 4QI0A 5GOZA 2GFIA 1GRRA 5FLYA 2C99A 3PE6A 4RZUA 2VUIB 2NG1A 2HLNA 3ZHRA 1Z5GA 2O19A 4H7HA 2HDHA 4AO8A 1ZL2A 4HMPA 1OB5A 5DBGA 2VH1A 1TQHA 4EAAA 1QCCA 2OGZA 2PS3A 3JSAA 3CW9A 1EQ2A 3ZD8A 3I9NA 4TXMA 1PLLA 3L93A 3U7QB 4E5KA 3K5PA 4ETNA 4PAQA 1BHQ1 3WAQA 2KI5A 3GJZA 1D4FA 4H1UA 1Q19A 2EKBA 4MA4A 1A2BA 1ITZA 3A37A 1GL7A 3LHSA 1IIRA 4N8EA 1N3YA 4C3OB 2ZYDA 4R1LA 5JAOA 1DC5A 1FMCA 2V6FA 3CYFA 1NN0A 3H3JA 3RS4A 2RK6A 3HYLA 3H8VA 1XZNA 2QV7A 2OV8A 4YNBA 2YYAA 2OXRA 5A9SB 1EVKA 3G8DA 2WMDA 3O2QB 1RWPA 4HAXA 3ZE9A 4MO9A 4HV4A 1V25A 2HM7A 4H1HA 4I1MA 1AHIA 2O2HA 2OK8A 2F1IA 5CB4B 2J9FA 5DULA 1G5TA 5EMHA 4OINF 1UK8A 3MVEA 4FUQA 4AMZA 4RQBA 3V8BA 1NMEA 3HH8A 3G2LA 3NASA 1ZHXA 4DCJA 5JLIA 1E3WA 3S2ZA 1AKTA 2BIFA 5CU7A 3TDKA 1GZDA 2ZJ3A 2JFFA 5KTRA 4DUPA 1HKUA 1W4ZA 2J5KA 3DEFA 3ADCA 1D7OA 2R7LA 2C9DA 4DLNA 1O95C 3CNEA 2FA9A 3FMIA 3L6UA 1YDGA 3LZCA 4D8TA 5JRDS 5JS6A 3PFBA 1XTSA 3LUJA 2Q9BA 2Q5FA 4QUJA 3STHA 1USKA 3CNQS 4POOA 2ZRHA 2RCNA 2YS6A 2OSBA 5J47A 2GK7A 3FZNA 1FR0A 3D4LA 2KC3A 1FFYA 3N7UA 2OD9A 3K6BA 4IYRA 1JHZA 3JPYA 3UCXA 5HKKD 2I62A 4D02A 2CD7A 1PZXA 4DG8A 1NBEA 3IJEB 3HDTA 3PPWA 1W36B 2P62A 4LSGA 4BEJA 3WLJA 3JATA 2VDWA 3ABZA 1RCFA 4GFDA 4O4LB 4RF5A 4AY4A 1FMFA 4L0CA 2VNJA 2VTDA 2I34A 5A5VA 4LJYA 3NAZA 4M0CA 1NTOA 3DL4A 2SKEA 4NPCA 4HS4A 1C41A 3V1NA 4P92A 1JXMA 4N8DA 3EBLA 4YJDA 5J3JA 4JT9A 3NDPA 3FFBA 1HMYA 1U63A 2OC4A 1JMVA 1V3TA 5CXXA 4B81A 2IXGA 3ECCA 5IX8A 4BLQA 3R5SA 2FVXA 5LQAA 4MW2A 5J43A 1R0RE 1K7SN 4EK9A 4IIBA 5I4CA 5J5AA 4MVYA 2NIPA 4NATA 3W8NA 1RQ7A 2XD4A 1YQGA 2D5CA 4RPLA 5C34B 4YJ3A 1I4YA 5JSZB 1TM1E 4KV9A 2NV0A 1CULC 3W9BA 5IC6A 3SD7A 1T2NA 4MGKR 5YASA 5C4MA 5CDHA 2HWYA 2VDJA 3QLJA 2C92A 4X54A 4NBNA 3JWIA 3DT8A 1YAHA 1BXRB 1CUZA 1M1ZA 4R8RA 3R6LA 4QZVA 3P9YA 3DEIA 1YYXA 4G5QA 4F4CA 1ZVKA 3UJDA 3BFVA 1IY2A 3NFYA 2ZSAA 4F3TA 2IK8A 3K35A 1NNLA 4IIJA 1J1UA 1QV7A 5IASA 2WAOA 3RARA 3THRA 4WXRA 3CURA 3F7NA 4IXWA 1XYGA 3U4DA 4CF7A 3FRJA 4ZVLA 3FUUA 4HY3A 1GUFA 3V3KA 5F5HA 2YZ2A 1XCBA 3EZYA 3KWMA 3UOGA 1CDOA 3AW8A 1RHQA 1V1RA 2NAFA 1JJBA 3WV4A 2GJKA 3U4IA 2AH5A 5AKIA 3KR0A 4D4MA 1AH2A 4YLGA 3OQ1A 4H0FA 2R7QA 1I0IA 4XVHA 4F4FA 1Y82A 4JJ7A 3P2YA 4KVFA 2VLBA 2E7ZA 2NXCA 4QYXA 1YACA 2BJVA 3DEHA 3DP7A 1J9EA 3JYNA 1RXQA 4YWQA 4YXFA 4F21A 5HJEA 2Y68A 4WJ0A 2VXCA 4JR1A 1Z6ZA 1X39A 2PZLA 3M6XA 4GGMX 3ANXA 1W30A 4CHGA 4WINA 1ZXLA 2CE2X 2ZPUA 4V0MA 2IYXA 3DT9A 2XLVA 1MQSA 2QTMA 4I3FA 2R03A 3GVPA 3BZBA 4O2AA 3KQHA 1KYTA 5K3BA 3G88A 1NMXA 4UVDA 1NJ1A 4MLDA 2RHTA 1FSSA 1ZEJA 2YY7A 4HLNA 1NBMA 5CVEA 4G24A 3AVUA 2W2TA 3NRJA 4NMXB 1JTEA 1JIQA 1TZMA 3GODA 1ZI8A 4YMVA 2V97A 5EUMA 2W6OA 3QPWA 3UWDA 3AF3A 5KREA 2PDAA 4Z9YA 4NCXA 1SUAA 2NSDA 4FYWA 4H27A 1M74A 2ZRKA 2X3FA 3BJEA 3TQHA 5PNTA 1E83A 5LB2A 3NHFA 3ODGA 5ALEA 2VDPB 4O08A 5JJKA 1GSOA 4ZOAA 1Q7EA 4EWCA 3BDAA 3BQNB 2BFAA 1OPXA 1A76A 1W36D 4PV7A 1KMQA 3F6CA 3EBOA 1PJTA 5CDUA 2E18A 4WBNB 3AR2A 4G8BA 1VHTA 3VYWA 1Y9JA 1X1TA 4AJ1A 5LXTF 3EVTA 4ZYXA 3R41A 3C70A 5KYYA 3L8GA 4I1PA 2OZEA 4AURA 1EB9A 1QTQA 2XA1A 2RC5A 1UFRA 1S89A 3FOWA 3K94A 3CEXA 4LV6A 1G9TA 1XTRA 2PO5A 5HKOA 2J7PD 3MERA 1M6YA 3RBXA 2V03A 1UMCB 4FLEA 1G64A 3C3EA 4REQB 5ANRB 3FTCA 3SS8A 1ZW6A 1VTMP 3G0OA 2FYTA 2IRWA 3I64A 3CJQA 3OOYA 2Q07A 4AY3A 4MYSA 3WQHA 1JU4A 1TVEA 3HLKA 4R9UC 4LYHA 1N2CB 2VUHB 4N41A 1RYEA 2QZZA 4DZTA 3MMNA 1JR2A 4UBOA 1TZCA 2GVDC 4LRWA 3PRHA 2G3VA 3SMQA 2LDBA 3EEOA 4DLLA 3IT3A 4KRYA 4WJZA 3A36A 4AUMA 5MGNA 4DLAA 1RFLA 3DLAA 1Q5PA 3DTNA 3FOBA 5I9IA 3T1YB 4P3YA 2XH8A 2FPIB 1DEAA 2W6ZA 3QLUC 5IBPA 1OHHA 2R8BA 4D7AA 5FI5A 5T41A 2AOTB 4A2QA 3FNGA 1E96A 4YJGB 3ZG6A 3TL6A 1EU1A 2BRUA 4QOEA 3N5KA 1H2AS 2AG0A 1NQWA 2FKNA 3HNLA 4FTWA 3ZIUA 2P68A 5HK8A 5U9CA 2QTVB 1RKEA 4NULA 2EFYA 2ZUSA 2EIJC 4RA6A 3PHCA 1CX9B 1XZCA 2DI3A 2QI9F 1OGIA 1QFYA 3FWNA 1K2VN 3KO8A 1F1BA 4K9PA 2C9ZA 3B1ZA 2WD8A 1NSTA 4X63A 5J4VA 4M53A 2PZFA 5A06A 1TI7A 4ZKDA 1OIWA 4OP3A 4NOLA 2IEZA 1MQ8B 5L40A 2R3SA 4BNVA 4CMJA 3WIEA 1PK7A 1H69A 2YC4C 1H6GA 4ND2A 3M6WA 4QBTA 5JH7A 1EVYA 3OEWA 1HNWB 4XQEA 1W581 3WLIA 3LPDA 1A9ZA 4YACA 3KZCA 3JAWB 3WMRA 1CJSA 3BK2A 1G9SA 4AG5A 2A6PA 1FRVA 1CRQA 1RI4A 3GLRA 3QEAZ 1WWKA 3SOZA 4NHOA 3AUSA 1FU8A 4P34A 5ALGA 2FMIA 4ECEA 1L5SA 2BY4A 4MVJG 1WS6A 1EP2B 2FMFA 1JKXA 2X22A 3LFHA 2PJRA 1G4AE 2GX6A 4OD5A 1T0IA 3SEZA 1S1CA 4C6TB 1GPJA 5CK4A 3NBZC 3O95A 3STVA 2PUEA 2CLHB 1KZ7B 2HLPA 4ULWA 3VR1A 2HF7A 4BHTA 4NCQA 4WL0A 4BG0A 5LZ5A 2D0DA 3VI4B 2QRVA 1LF5A 4RE6A 3T34A 4B3TB 1V26A 3DXXA 2BDTA 2XAUA 1KAGA 1F5NA 3F3YA 1XU9A 2X8WA 5JMPA 3TLMA 3CMMA 4TTTS 4LG1A 4HXEB 2ZJ8A 1PQUA 4HRVA 1TQ2A 1YJ8A 1QDUA 5KSZA 5TXGA 1PV1A 2PVPA 2AW5A 3MFQA 2WYIA 3P9KA 4G85A 1NNI1 1KP3A 1WO8A 5BWOA 1ATZA 2QAGC 3C8UA 2XECA 4JEUA 1EFKA 3QU4A 2PIDA 3G8AA 4UAGA 2HHCA 3FGNA 1RKVA 2IXMA 1ABEA 3JR7A 4N4AA 5EN4A 4PYRA 3LTEA 3K0AA 3EFBA 4DNPA 4US0R 1SXJE 1JHRA 4CMBA 1UPFA 2A5YB 4K6HA 1VL8A 1W48A 2W5UA 5JJ5A 4XX1A 2Q41A 3RE1A 4XPXA 2VZ9A 2JAHA 5JRJA 4ZCPA 5GJWC 3QSGA 2MU1A 3U7QA 1JNYA 2X4LA 2ZFUA 1C3XA 1V45E 4CUZA 2IIBA 4BEMJ 5A4MS 1T25A 1LBQA 2ZVQX 1OH6A 3QEMB 1P1FA 3WLAA 5CFPA 2BFPA 4C88A 1ZGGA 4YMTA 4GHWA 4B80A 5LBUA 2ACWA 2QN1A 2I7VA 2FX5A 3K3PA 1L6IA 2ZSHA 2PZ8A 5CB4A 2XD9A 1Z47A 2VAPA 1A4IA 1T29A 3BXFA 2GJAA 4UHKA 3CW2A 2VUSA 5BVGB 3RRJA 2FJUA 3MILA 4CL8A 2HH9A 5FD8A 4OMFG 5DS4A 5TDHA 4X90A 1PKXA 4QJBA 3UUWA 4PS1A 1ZNZA 4LGYA 3IQEA 3QMWA 2JKZA 1TECE 1HE5A 1EVJA 3IULA 3TQSA 4DIDA 1HE1A 2Q21A 4A8JB 1XEWX 1YZQA 4OX9B 1WQ3A 4WJKB 3FVWA 2PQ6A 3DOOA 3SBEA 1NF8A 4R5HA 1J0EA 2R48A 4L6AA 4GLLA 3TLKA 2W8ZA 2VF2A 1KNQA 4IRMA 4XX0A 3O6XA 3TSOA 1A5TA 2RGBA 3AKYA 1NYLA 4A36A 3K4QA 4M0EA 3PCTA 2P3SA 5F73A 3WADA 4G78A 3SPXA 1H3FA 1L1RA 4P38A 1Q21A 4YCDA 2QRJA 4Q9NA 3RAGA 5EJ4A 4KIFA 4BP3A 1QR2A 2V0NA 4WNIA 3DT6A 4O4LA 3I2HA 5CXQA 4HXGA 5IK2A 2IP1A 2ZBGA 3NVDA 3S6JA 2CNKA 3BRQA 3RS0A 3A3PA 2OQMA 2XUZA 5U4XA 3M4XA 1GUYA 5JALA 3EZ2A 4HH0A 1MDBA 4HYYA 1RVV1 1E2EA 3VU9B 2CV2A 1QGED 3HKBA 1TJNA 5KTYA 4F9FA 4L50A 4O25A 4G56A 1JDJA 2XIQA 2EDAA 4TV8B 1T5BA 2ZUBA 1XLTA 4WZAA 2B92A 5TV2A 3SQOA 1XIVA 1B73A 2V6BA 4JL6A 3GAAA 4NAHA 5JCPA 4B1FA 3ZV7A 1Y89A 4PSCA 3RQFA 1FX0A 1R9JA 1DZ3A 4FNAA 4PG8A 2XCSB 3WYDA 2PLFA 4MLZA 4J29A 3CWZA 1KO7A 1T4MA 5JSZA 2ZBRA 1G7TA 4ZANA 3QG1A 1G5RA 5HIAA 3PT9A 3VUEA 4RZQA 4EUEA 1L7AA 1M54A 1DUSA 4MYUA 5G53C 4OI4A 1V8OA 4CM9A 3TPFA 1GPBA 3U8PA 4GM4A 4D80A 4TKUB 1CRLA 3ZEIA 1BXRA 1D09A 2M1ZA 4V3BA 4C2TA 4WI1A 3WYBA 4G89A 1Z62A 2I78A 5AW9A 3N39C 4R4JA 2AG1A 2WT4A 1BCSB 1SG0A 1JMWA 4HQFA 1L7DA 4YR9A 2Y3IA 2ZD9A 4KHZA 3M89A 2G9RA 4L72A 1XL1A 1V95A 1W75A 5KYVA 1DG9A 1E0DA 5T64A 3C5WP 3DJUB 3WQRA 4NY3A 4LNHA 2HJHA 3CG0A 3VPGA 4CIVA 5FO0A 3QI2A 1JZSA 1OLXB 3NHSA 4LNUA 1Y81A 4N49A 1SUDA 1M1YE 1YA9A 3LGXA 3PD0A 4DNFA 4TMWA 3WGGA 3NRBA 2HI0A 2WZDA 3ED5A 4YAJA 3CB4A 3Q7GA 2SHKA 1JG4A 3QX8A 4OU5A 4BLUA 5JS8A 1JSRA 2C1ZA 2VNSA 3UJAA 1ZHYA 4D9NA 4RQAA 4O2BA 5JY6A 3PWKA 1XC7A 4UZSA 5A6SB 4BQOA 3EQ7A 4DRXB 5SYNA 2G06A 2FB9A 2CLFB 3RYIB 1TJPB 3VKVA 5DTEA 3JQ6A 4AYTA 3EGVA 1EGHA 1LK7A 3GJ3A 1RWXA 3DVSX 4JYMA 3AL2A 4I55F 1ZH2A 3U4CA 1FNDA 2FWNA 1YDEA 4WA7A 5DXFA 3S55A 1QYVA 1L4HA 3KEFA 3K72B 1Q6ZA 3IMEA 2GLUA 4MUJA 4TZTA 3CCBA 1O1YA 2OHHA 1DTWB 4BGVA 3ZDCA 2B1QA 5HUQA 1MNDA 1ST2A 1U8ZA 5A3SA 3QVZA 1C1DA 3ZDLA 3JRWA 3PK0A 2J8ZA 1WZCA 4CPDA 2ZVDA 3E1GA 5TY0A 3ROZA 3WMEA 4MDEA 4OA8A 1GGMA 4UNSA 3CQ9A 4U2KA 2TMVP 4YRNA 3RC3A 1L5KA 2V4UA 5GADl 3OURA 3I73A 3LDAA 5EZYF 1SQFA 3FUCA 2W2LD 4MR8B 5F2EA 1Q7TA 4OIRF 2JFUA 4YRRA 4U63A 1F8GA 5JI3E 3F73A 2FOLA 4HWGA 2GZ3A 3OPQA 5M04A 3EB9A 4CS8C 1LPBB 4G0NA 4GI3A 3BCSA 1QS0B 3S2SA 3TEFA 2HGZA 3MAAC 2FG6C 3O74A 2JD2A 2H2GA 3EODA 4URYR 1YZKA 1G8JA 1BXKA 3CUUA 4F1WA 1LQ2A 4ESEA 5L45A 3EZHA 4ZZ3A 2C2ZA 4KH0A 3GRFA 3I01M 2LFDA 1KRWA 1RXVA 1FYXA 4MHOA 1DMSA 1UMCA 5CBKA 4UTZA 1VE3A 1R0WA 2B35A 4IH1A 4NK5A 3V4PB 3FZYA 4M9CA 2BEVA 5CYPA 4YRJA 2EW1A 3ZWXA 4WAUA 1XN1A 5DHTA 1T3HA 1PCXA 5GV7A 5KKNB 2O06A 3L9WA 4HNRA 3E8XA 2EJUA 3QY0A 4L8YA 4RPJA 3GAFA 1QG6A 3UAVA 3ZW9A 1I13A 3M6AA 2Z3ZA 2H4FA 3HS3A 4IXTA 2WIKA 1MX1A 2DUNA 1KFKB 2XNDA 2J0QA 1YZCA 2X0IA 4WLVA 2DRIA 2QMEA 3W5HA 4X92A 4EBBA 1BKYA 2FN9A 3W2TA 4G8CA 5ALVA 1XJQA 2OB2A 4TS1A 5UKDA 1RI3A 1WUTA 3WGQA 2EIMC 1JWAB 3L6CA 4F6CA 2FPIA 2ODQA 5F7OA 2HPZA 3QFTA 1ONNA 3KUDA 1D1SA 2VOJA 1U2QA 1RWOA 4D0SA 2GAOA 3C8GB 4CI9A 2W93A 1VJDA 1UBKS 4B5KA 3TNFA 3I2KA 3M4NA 2IYEA 4M0FA 2JD3A 1ZA1A 2QYSA 3DGEC 2Q6KA 1TU3A 2Z2KA 4R5MA 4CKCB 1NU9C 4OD0A 1Y1SA 4J3FA 4Y3UA 1TKAA 2Z4TA 5ALLA 3FCAA 1RHUA 1PWHA 4C1NA 1VCNA 4RLFA 2P0EA 4FSXA 3AWIA 1RLIA 2K4MA 1F06A 4ABTA 3CKKA 3D3QA 4UFOA 4XWKA 2QTWB 4KRGA 1BA2A 2GAJA 4MNTA 2RGYA 3G2JA 3MD0A 3GAZA 2V8OA 1Q7CA 3RVKA 1HFKA 4URZR 3QE4A 4QAJA 2QZJA 3DAPA 2J9ZB 3ZXIA 2I2BA 2O2EA 2I4MA 2YW2A 4ZYUA 4L51A 5TC4A 5DX8A 1P73A 3PUWA 3KE9A 1MV8A 1U98A 3M4CA 2OB1A 4KQHA 3PF9A 3RNLA 3IEMA 1XYYA 2R7WA 3FNHA 2MINA 4KLAA 2IZZA 2JFGA 1ZD3A 3G9UA 4D3SA 4X61A 3K73O 2FCRA 3JS5A 4C6TA 1RQLA 4O3MA 3STYA 1E1DA 4DHEA 4WZ6A 3JVIA 4KFRA 1NIPA 3LKBA 3WB1A 5TIIA 4KR0A 5JDCA 3T0FA 2X2EA 1LVUA 3TN7A 5CJPA 1PEYA 5EUCA 1VHDA 2XLDA 5K0NA 3SYKA 1KYWA 3ZU5A 1QP4A 3SXMA 2W48A 3EFEA 5IZCA 5L6MB 1Y3CE 4DRYA 3LYAA 1T5DX 3GFRA 2Q9AA 2JI8A 1Z82A 1E9CA 2D4AA 3QVUA 3AC0A 1ULBA 4XDZA 1OYWA 1HYQA 3GLIE 2QL9A 3ZZ1A 1PJCA 1XRSB 2D0PB 3Q6IA 1PF7E 1VMEA 3U9LA 4MNDA 2WZGA 2VK4A 3CINA 2CB0A 1KGDA 2WTEA 1R6AA 3R9KA 1LUAA 1E0AA 1EFVA 3HVRA 3RYTC 2XOXA 4MWBA 4BTVA 5I7WA 4ZAVA 5L4SA 5JG7A 2C2KA 5E1DA 4UM9D 2I80A 1O94A 3AYXB 2ZB3A 4BNKA 2ZLBA 1PW5A 4MKIA 2DFDA 5CIVA 4HDSA 5A4KA 2A8YA 3B9QA 2QX6A 2DYSC 2EGHA 4Y6RA 1ZW1A 1R5NA 3BJIC 3JSXA 2CWDA 5FFNA 1K7YA 1ZGZA 3EEQA 3WY9A 2OHXA 4ER6A 4PQEA 1I2ZA 4WE3A 3HY3A 3OM9A 1EQAA 4IGFA 3OFJA 4ZVNA 2P2ZA 3ZS8A 4NG4A 1YFZA 3QEMA 3L82B 1Z5PA 4ZPXA 3M8KA 5IAOA 3K0CC 1KDTA 5I7HA 4DJ9A 1AO0A 3QUAA 4XOUA 1D2NA 4PX9A 3BH0A 1EXWA 3KSRA 5L0DA 3UMVA 2FSFA 4HGYA 4I1OA 3DOIA 2FLKA 5U1PA 1EWKA 1V4VA 1VP3A 3C62A 1KIFA 3QWFA 3AWDA 4B75A 4J32B 3TOMA 3CVUA 5ECWA 1YR7A 4XLPF 4YCCA 4QPZA 5B36A 5AK3A 1BMDA 5BP7A 4G0VA 4LECA 1CIJA 2BEWB 1SK8A 5BVGA 2UXCB 4WECA 4YJ3B 1FLVA 2AC4A 4AMBA 4P6VF 1JI3A 3TIXB 1Q3TA 3H86A 2LSEA 4I6JA 2I65A 3V9PA 2IFTA 4J90A 2FPXA 2I33A 3RGGA 4NFHA 4WADA 3QQ5A 2H48A 1P2FA 2CW5A 1DX6A 1RABA 4X84A 3IX7A 3R8CA 2VP6A 1PV3A 3EGCA 2IU3A 2H3HA 4DCMA 2DBVO 2C4UA 2GH1A 1ISGA 1KFJB 1BSVA 1SD2A 1Q11A 1OC4A 4GYYA 1QUFA 5ITVA 2ORWA 2E49A 2OD7A 4FIZA 2Q28A 2GTIA 2FN3A 1YQQA 3WP1B 5E3HA 4RH3A 1G7RA 1LSSA 1EXVA 4YBRA 1G6HA 3QE0A 1V16A 3W5BA 2PLRA 3M34A 3TR0A 3TLCA 4L6CA 4URUR 1ZQ1A 3GK3A 5JLAA 2ZYTX 3N07A 3JD0A 4UPEA 5I7EA 1AK9A 2R86A 4JUAA 4C0AC 4FWIB 2HSZA 4EBFA 4OIOF 3F98A 3VC2A 4HNTA 2DBZA 1SKUA 2CCJA 2COUA 5DIFA 1BQ3A 2WWRA 4DV1B 1VHQA 4BNMA 4MRRA 4WDRA 1FXSA 1HYBA 3EVEA 2QLFA 5EK0A 3IRVA 1SCDA 4B46A 4XPIB 3FRHA 4D8UA 2FUG6 3HU2A 2CKDA 3I3SR 4QBHA 3RIEA 4TV8A 5A4FS 3PDUA 2GFQA 1X8XA 4NEHB 3ROPA 4B0OA 3MPUA 4PYNA 2ILVA 2CV1A 4JELA 3RVNA 2XTMA 3RJZA 2ZCJA 1RWMA 2RI0A 3AR7A 1O57A 3QXCA 2B2XA 3I04A 4N47A 1HL3A 1CK4A 2G6BA 1SH7A 2UU9B 1RWNA 3GCGA 2ZZNA 1KR2A 2WF6A 4RFSA 2VJYA 2O5RA 1XN4A 1VB3A 4BDTA 3OIVA 4IP0A 1AZSC 3ZKAA 2YL1A 4W8KA 1E9RA 3F4KA 1ND6A 4BQQA 3MHTA 3ACBA 4A3SA 3V5YA 3KVVA 1J24A 5T67A 1M2NA 2G67A 5JSHA 1XNQB 4GLOA 3IUSA 2VLIA 5B1DA 3PXCX 3PQCA 3D9QX 4E14A 3BCUA 1BCSA 2I6SA 3OTIA 5BR7A 3PC7A 2P3QA 3OC6A 1E3MA 2Z2JA 3H5WA 3VPAA 4D9IA 2PN1A 4LE0A 3ORYA 4GMDA 1R64A 1HFEL 4AJNA 4Z54A 3L8EA 1OLXA 1I6LA 2PBFA 3QKSA 4OA5A 3E03A 3TIIA 1RIIA 4MVUA 1R50A 4YGYA 3W7BA 5A6AA 1XYVA 3UC9A 4Q7LA 1Z0DA 2E3JA 3WGLA 2NQ2C 3LV8A 2YINC 1G21B 1YAJA 2O9XA 2ZJ6A 3FE2A 1D0XA 4D74A 3GLFE 3CPSA 2GM9A 5J58A 1GCIA 3S29A 4OYYA 5A6SA 2Q7OE 4HAZA 4DRXA 1CEYA 3RYIA 4PC3A 1RJFA 4GLFA 3S0XA 3RK4A 1FSFA 4YL3A 3IVXA 2X0EA 4A8HA 4GPD1 2OILA 4PRLA 2JLXA 3K9BA 4GX5A 3T9CA 2ZZKA 2D5BA 2E1RA 4LBVA 4P53A 1FDIA 1TMGE 2O5EA 4TT3D 3OSUA 1DTWA 3ZBUA 1ZC4A 2P9GA 4YJ2F 4PIPA 1U7OA 1ZIPA 4ZK6A 4QDZA 3KWLA 1MC5A 5BUSA 3T1VA 5DGHA 3P97A 4HNSA 1S2MA 4Y2XA 3TK1A 5HHTA 3WQQA 1DKNA 1E99A 3FLMA 4B76A 3N0TA 5B53A 2PMKA 2DPMA 3KUKA 1TZ2A 4PSUA 1YL7A 3MWFA 4FYYA 1XRPA 1UKEA 4GECA 1RRMA 1AN9A 2BHTA 1RKEB 2PRKA 1AUXA 1VOTA 3HDYA 4J16A 2VQ6A 3VV3A 3HN2A 4QU8A 3MA0A 4KO8A 4HOYA 2ZUCA 4LGMA 4MR8A 1FC0A 5ERYA 5K1ZA 5CM9C 2QMYA 1Z5NA 4K9KA 2NWQA 5IJZA 3D64A 5G3YA 1PL6A 3SFZA 2C59A 2X9LA 4W6QA 1V5IA 2AV6A 3L0ZA 3TKLA 3FTFA 2IODA 5FUYA 3BTOA 3EA5A 3CN7A 5THXA 1T26A 3CLKA 4OXIA 1K1EA 5JH7B 4YT5A 1QVWA 3IUYA 4LJ7A 4LPSA 5FBZA 3BWYA 2H9IA 2RBGA 5D01A 3C8HA 3TLJA 4CIDA 3QFSA 4UKDA 1D0SA 5GJCA 2VNHA 4CGYA 1NOIA 5AKJA 1HYHA 1CF2O 1UBRS 3HA7A 1WRBA 3CLTC 3DHYA 4K86A 4NBSA 3CY6A 2I1WA 5DYYA 2WPNA 2QIOA 4D46A 1NBMD 3TJ6A 4M1OA 3ONWA 1G8MA 3SWWA 3WOVA 3C4JA 2Q99A 1CWUA 4GBGA 1T6QA 3P2MA 4Q0MA 4BAUA 4BEWA 1S8NA 2QZPA 3KTOA 3DO5A 5GJVC 3EZIA 3U2MA 3SQDA 2H4JA 2AHRA 1DJPA 5JUAA 2GJSA 4NBLA 3AF1A 3Q6NA 3Q1LA 3L05A 3TGPA 4RLHA 3ELUA 2NZ8A 2FSVC 3W4KA 1RI2A 1WLYA 2WR8A 1SXQA 2HRCA 2CEAA 1QU2A 4R9VA 3C8GA 3JQFC 2QENA 5CT6A 4JYZA 4YVFA 2XLEA 5H8WA 1E2FA 2POQX 4CKCA 5F28E 1RC1A 2C31A 4YRQA 3FB1A 4Z0PA 5JNSA 4HLDA 3LRPA 3NTVA 4JKOA 4ZEMA 4WOBA 3S2IA 1AXGA 4QJIA 4KL8S 1UJBA 3WAJA 1X0XA 3K0AB 1KTIA 2G25A 4L73A 3KKNA 4DSNA 5JY1A 3L46A 3NT5A 4G09A 2OORC 5BN3B 4D4NA 1QK4A 2XYVA 2UZ3A 1I4LD 3T9AA 4Q1CA 4RJIA 1MJHA 5J4YA 2QT9A 1DL5A 3EQ2A 2AWCA 1T4BA 3L7LA 4JI3B 1JG3A 2CVQA 1PVVA 2EC5A 1SUCA 2NZWA 4CKYA 4RS3A 3EXG2 5FBQB 5LQUA 1W49A 1OZAA 3K70C 2P4HX 2EGUA 2B36A 3HXQA 4COOA 2I3DA 4KR9A 2XI4A 4EYOA 3OOSA 6Q21A 1FW6A 1G4UR 5BUQA 1F4LA 3MUFA 3QWHA 1KJJA 3I4LA 1NBIA 3UJBA 2FF5A 1UFOA 2FW8A 3QFCA 3VHRA 2F1JA 1TEXA 3ZC3A 1PUIA 2IA5A 1Q6YA 4NESA 3NVKI 3ESQA 1O5HA 1NZEA 2HRBA 1NPYA 3RWBA 1GWNA 4EELA 1OHHD 1XFAA 4FI3F 5AJWA 3UJ8A 1FFEA 5ITSA 3DTYA 2BBWA 4NYMQ 3EDRA 4GI2A 1IH8A 6YASA 2EBHX 2GD6A 2B83A 4KNYA 1RRCA 1R0LA 4A0HA 2VHCA 1MRNA 4KE9A 1JBKA 2JGIA 3HCOA 4HNHA 2XGSA 4RVOA 1Z4LA 3ZW7A 4ND1A 4NBWA 2FFHA 3ZXYA 1ST3A 3F5FA 5KPJA 2FUCA 3NIFB 4MV1A 5JYBA 1L4YA 4BBJA 1FS4A 3BHIA 1XCPA 1MEEA 1JHYA 2P2SA 3PEUA 4ZTUB 3HR7A 2WTXA 2PPVA 1UBEA 4M6WA 4XX0B 1ICIA 1K97A 3FSGA 3L0YA 4F3YA 3H9QA 2BSAA 3CISA 4MTFA 3HC7A 2RHDA 4A92A 1GILA 8ADHA 1IZYA 4QYSA 1PS9A 5BO5A 1DTEA 4ZRMA 4X9XA 2OU6A 2WOJA 1JIJA 2X8JB 2Z3WA 5LWQA 4YRZA 1ZMXA 2NSFA 3A4TA 3KD2A 5CT4A 1NTRA 3HXLA 2BUBA 3LBNA 2BMDA 3HKBB 4KACA 1NM5C 2RB5A 2IP2A 1VA5A 5KBYA 3KT0A 1DJLA 3EDQA 1ZH4A 1AY0A 4IQ8A 3RC8A 3H2KA 4PPNA 1Q0PA 4CMGA 4WZAB 2A9QA 1QV9A 3B6IA 3JAMA 2KGOA 1HV8A 3UJ7A 1MOQA 5LC1A 4HDKB 3OOHA 1E89A 3X1JA 3A4MA 1TKNA 1FX0B 2J6BA 1G1MA 2ZZMA 1DIRA 1AUVA 3LQ4A 3L7IA 2C0CA 2H06A 2ZAIA 2BEWA 4YRCA 3RQGA 1V43A 3ETGA 2I2AA 1X94A 2GUGA 1Y4AE 1MT0A 3KYBA 1YIAA 2HTFA 3RREA 2O8EB 1XXHB 1SKQA 2OM2A 5A71A 2MHRA 1EYZA 3KS9A 2J5XA 1CGME 2OMKA 5FPKA 5A1TA 3KJEA 2QGNA 1QO0A 1T3GA 4YGXB 5HG0A 1RKXA 3O8DA 1SZIA 3EJ6A 1YA7O 3KC2A 1WV0A 1SU7A 5KQLA 5LQCA 1FNTc 1X1CA 2RHRA 3SLRA 3SICE 2IXFA 1N8KA 4RULA 2AGVA 3LL7A 4NMLA 1QSGA 3C5EA 4O02B 5F1YA 1TVCA 1L3CA 4KOEC 3OPNA 4H59A 2XKJE 2X9QA 4NYIQ 4BX9A 1F0KA 1RQGA 2RD2A 3SN6A 2I2XB 1T6ZA 1T2UA 2CKMA 4AMVA 3I5QA 4LNUB 4YIKA 1W94A 1OD6A 1L4LA 2XWSA 2G83A 3DXZA 2NO7A 3ILSA 4JL5A 1V8BA 2WF5A 2WTNA 1Z8DA 2HJRA 3K9HA 3S27A 1KYIA 5CT9A 3H2JA 1L4EA 4TRMA 3OBBA 4LJ9A 2GZMA 3RTGA 2G5PA 4F91B 4O2BB 1QH0A 1Q22A 3UTCA 1D0VA 3L8YA 4YMSA 4XPIA 3R7SA 5E1MA 2Y0BA 5CBPA 2QMHA 4XSVA 2PL3A 4B6RA 3HRIA 4JCCA 4MW0A 1Z29A 3T1QA 3TQCA 4LC1A 2WDZA 1TYZA 2LW7A 3CIFA 4FOPA 5JE8A 2G80A 1U1EA 4MI9A 4MVJP 4K9QA 3OD1A 1XD2B 4O1HA 5TEWA 4H6VA 5H4HA 5G2OA 4PZPA 1P4AA 3F4LA 1WSDA 3EFHA 1KBQA 2IJGX 1VGQA 3DS8A 2XUJA 3TOZA 4Z8YA 3MFNA 4HLCA 3NGLA 5LYJF 4XARA 3DD5A 3D0OA 3A0RB 5ESDA 1C1DB 2EX1A 2FPGB 4JQYA 2AA3A 3OG9A 2XCOA 3REFA 3TFWA 1UKZA 4W8OA 1Z6PA 4AX8A 1JZQA 4EFLA 1LI5A 3OZTA 4DSOA 1XA3A 2OOCA 4MKHA 4WGFA 3FKJA 3NJ8A 4BUCA 5IK2D 2PZEA 4UHBA 3ZU4A 4ZD6A 5DBOA 1XV5A 3WRYA 2BGUA 5FUBA 1ZMOA 4IFIA 2MYNA 3HI4A 4TZKA 1MN6A 3F2VA 3DV9A 2WA2A 4QPNA 1SBIA 4I46A 3DE3X 4BO6A 4IHKA 2AUNA 3L4KA 3HR8A 1CUGA 4JB8A 4Q9LA 2IIQA 5LN1A 1G21A 5JVEA 5D3KA 5FBLB 1AD2A 3WLKX 1E5LA 2OWDA 2VF5X 2GZDA 1GZ5A 1UANA 2GF0A 4IIHA 4DJDC 3NRCA 3WTBA 2BEVB 4ED9A 4YYZA 4WN9A 1OYOA 4RTPA 1T1EA 2COEA 3K6SA 4ZXFA 3IEKA 2HREA 2Q6OA 1ST6A 4OYLA 4CSAA 2WD7B 5AO9A 3VPBA 4QEDA 3BS4A 3Q15C 5I01A 3H6KA 4P35A 1FW8A 1P2BA 3K0SA 3NOQA 2HC9A 2Q62A 4OFXA 4AJJA 5CDFA 5GWXA 5DVZA 1IN8A 3NKEA 1P81A 4CM9D 1NQUA 4HDRA 4HAVA 4FKBA 1Z5OA 1UQUA 4E2XA 4U7GA 3EXIA 3ZGYA 5B3AA 4ANJA 5J40A 1Y3DE 4V0NA 4J0DA 4F8JA 2G1JA 4O6MA 4ZVQA 2Y1EA 2BFDB 4MEJA 4YPFA 3AVVA 4WH0A 2RAFA 4MHTA 4YFYA 1J4AA 4OP1A 3G4ZA 1YJGA 1O5TA 4U6NA 3K16A 5BN5B 5B58C 3CNHA 4DDVA 2ZI6A 4M37A 5J4KA 2WKWA 3WO0A 3BF8A 2YCBA 4B6FA 3QTLA 4HNAA 2WILA 3AJ9A 1RC8A 2JFYA 3QH4A 1QYRA 3C8ZA 2RJ3A 3T0GA 4FSDA 2O3UA 3RBAA 1DAIA 4LYYA 1Z7EA 1CJTC 1K86A 4IB4A 1VJ1A 3L0OA 3ERCA 3W1EA 2HUPA 4W63A 4WA8A 5A0VA 4MYCA 1LZLA 4HEA6 2ET6A 3W77A 2V7PA 4B3CA 4PC1A 2HV7A 5J23A 4DV5B 3WK5A 2HDNB 1AMNA 2PJDA 3P9QA 3L8ZA 3TTTA 2NYUA 5CLIA 4ZLCA 2M32A 3PU6A 2QNBA 2NUTA 3JY6A 1U3DA 4ZT7A 5DNDA 2MINB 2C7RA 1U2ZA 2JRCA 2WJIA 1L4MA 1OI3A 2Q6IA 1PV2A 4OK3A 4YCMA 1TKCA 3S70A 4QLBA 5EIHA 1EIZA 2BMEA 5DCWA 2P90A 1DRUA 5LMZA 1JILA 4IMIB 1NI3A 3BXZA 3IBTA 4FX5A 3HJAA 3ZWVA 1XTZA 4Q01A 1L7EA 2NZJA 4D9EA 4CM6A 1KAOA 3HVUA 1TK2A 1RRVA 3DD1A 1HDZA 3C5HA 2CEKA 3I09A 4OHCA 4KFUA 1GL6A 4OBXA 2C2GA 4F4UA 4C4OA 2FE4A 5C7IO 1Y6QA 5E95A 2ZAYA 2C2WA 4V03A 3ZGOA 4HBGA 1F60A 1EFVB 4JBLA 1RYYA 4JOBA 4AWXA 3BL6A 1KF0A 3A1SA 2YXNA 2CD9A 1JP7A 1A71A 2AFHE 3TOCA 3ZCQA 2C2YA 1NMZA 4HS9A 4MTCA 4DCVA 3CPHA 1ZEMA 2W2OA 1M57C 3ZVKA 3KX2A 1ACLA 1FEZA 5LD2C 5HSWA 2VRCA 5CDGA 1VK5A 4HDSB 3E7WA 2XUFA 4F38A 4TYPA 1JSXA 5BN3A 1XO1A 2N0SA 4EZBA 2XT6A 5H16A 1Q0SA 1Y37A 4DS3A 2QLTA 2YOFA 1ZSYA 3WX0A 5BPFA 3EUFA 1P31A 2X76A 1NE7A 1DKOA 2ZT5A 2PKWA 4PANA 4LJAA 4H0CA 1VXOA 3UMHA 1I4OA 4QOJA 2ZIZA 1NX6A 4YAWA 3WKCA 2NTEA 4AFNA 3EXHC 4MPJA 4LXYA 1VBMA 1D07A 2A5FA 3SXPA 1RLTA 2XNDD 3HUFA 2JLSA 4ZEOA 2OGSA 4MV3A 4WD3A 2UXBB 4PG6A 3HSYA 3ZE0B 4ZA2A 4I1OB 4OFWA 3ITKA 2C3PA 5LJIA 4KU4A 3K7EA 3BXXA 3GG2A 3ONFA 2HQBA 5I7FA 4YAUA 13PKA 4DQUA 2QI9C 4UVHA 1UPBA 4Y1EA 2HMAA 1HOXA 1KZ1A 2ESRA 4ZCRA 1J5EB 4XWJA 3H19A 1WVGA 3NC4A 1EX9A 5B1SA 3ZH2A 3HV0A 3ZZ0A 2P9BA 3C7KA 3E61A 1YR9A 3FTEA 2PA0A 2Z8ZA 3PHLA 4PLGA 1I0ZA 4GAEA 3UAGA 5HGXA 1IPHA 3PUKA 4S12A 3IEEA 2YWCA 1ZRNA 3ZBTA 2Y66A 1ZP6A 2H9YA 2DULA 2CHUA 2XLBA 4AJKA 1KERA 2FY8A 1ZGBA 3PDJA 3LK7A 3P45A 3FAPB 2JCYA 3F97A 4LTMA 2XYHA 3RH0A 1JR8A 1N2BA 2AYZA 4DMCA 2RAUA 1AJEA 5IPFA 1H2WA 2A3RA 4D4IA 1SCUA 2R6DA 4DEXA 5DTRA 4IO0A 1I4DD 4D92A 4CCYB 2FMKA 4XIGS 3R7LA 2BISA 5JSLA 1ORYA 1TRKA 1Z4JA 5HXAA 2MR5A 5K51A 1V16B 1QF7A 4J8PA 1Q7RA 3VF0A 2JGFA 1XTTA 2HIAA 2ZJ1A 3VR3A 4MWSA 3AJAA 1KU0A 3HNIA 1F2DA 4MVXA 2G4CA 2Q7XA 2W37A 3SXYA 3WNBA 2VHXA 2X8JA 1GG9A 4BFSA 2J0WA 1RE0A 2WE8A 4JB2A 5BNWA 1JDNA 4IICA 3ON5A 1YCGA 4K28A 3WWOA 1IFXA 1MO6A 2DH6A 2QVGA 2C4VA 2H85A 4ARCA 5BSGA 1XMVA 4NVRA 1KO1A 2J48A 2LCFA 4EWLA 3FUVA 5L0FA 1C9EA 5EJAA 2HDOA 3IP6A 2FJPA 3D7SA 2OFPA 1R15A 2RAPA 1JA0A 4TQ9A 2VDQB 1L4FA 2HLDA 2AR0A 4HDKA 4XDHA 2Q6VA 2V65A 3GZJA 4IHJF 3F6YA 2WKRA 4BV8A 3JYOA 4R8MA 5LQDA 2JJ1A 1SF8A 3DTVB 2A33A 2ZWMA 3AR9A 4BATA 2GFHA 3DE7X 2C5AA 4OKSA 3AOUA 1X7XA 1VE7A 1KPGA 5BURA 2QYTA 2JCVA 3ANTA 1ODKA 4N6CA 4LF7B 1ZLYA 4AP6A 3LHKA 4FCVA 1NFNA 2O8EA 1XX6A 1THZA 1Q1NA 1XXHA 4RFSB 3R8XA 1W96A 3NHUA 3FVVA 1O94D 4IJKA 2R6HA 3NOXA 1UP4A 2D1YA 5KU1A 4JP5A 4DCPA 3UK0A 3TXYA 2AXNA 3VBEA 5AVKA 1S0UA 1OX4B 4ZFNA 1FUKA 3D3JA 2WU8A 3JWGA 4Q3BA 3NTOA 1BU5A 5JQGF 3LBIA 4G1MB 3DDNA 2NTYC 4RDXA 4AX2A 2IHYA 5BQXA 3U2QA 1T4GA 3EVCA 1DX9A 4TSRA 2RHLA 4G6ZA 4KN6A 2ETVA 3MWYW 3QKSB 3S2EA 2A14A 4WLUA 1PHRA 2HMTA 4I2VA 2JJ2A 3EZXA 4FYMA 4KHPB 1GS9A 1WN0A 3RSSA 3BSYA 2W2XA 4OXXA 3T5AA 5CH3A 3WYAA 3RF6A 1S05A 1R66A 1QLWA 1D1CA 2XOKA 5LNK6 1VLTA 4DBRA 2C4NA 1E2BA 2AUTA 4GR5A 1I2DA 4RTLA 3VUFA 1I7LA 2GJ4A 4DRIB 1E6EA 1ZHOA 4FGSA 5AVOA 1HT3A 3WBBA 1B76A 2OM6A 2PRJA 1UBOS 3LFTA 5JUWA 1KDYA 4BKQA 1QTNA 2KQUA 1KFEB 2LKCA 1TLTA 2CXOA 3V4SA 1XD2A 1CV2A 4AQYB 1AKYA 1F4VA 4CEJB 2VK8A 3EMBA 3A6GA 1PI3A 5HKBA 1X7GA 2AMFA 1HA3A 3IXMA 3RG8A 4C1BA 1JE0A 1NW4A 1DDIA 5AHKA 3L7MA 4EO4A 3LY8A 3IE1A 3CUSA 4MZXA 3JQEA 2WU3A 4UXJA 2FPGA 3HKDA 4AJ9A 5AC4A 3LD9A 3OCVA 2UDPA 4FLFA 4P4GA 4FMDF 3P9IA 1KC1A 5K20A 1YQUA 5EIBD 2GKGA 2I76A 5KTOA 2CZGA 1OTXA 1K8RA 4AJPA 1RTTA 4EITA 3L4BC 4PVCA 2VH5R 1C3JA 4B3JA 4OPMA 3AQ4A 5SZHB 5KB3A 3L8MA 4JODA 2ZS7A 4GEKA 4BB0A 3ETLA 3U9JA 3ZWOA 4E1AA 2Q2WA 4KQKA 4CX9A 2HMQA 2IYUA 4Y6PA 1DAMA 4C2BA 4DR3B 1ZESA 3BIJA 1X1RA 2WMYA 3OY2A 5AJUA 4G3XA 2YIJA 2GK3A 5C8XA 4WVLA 2R65A 4X6UA 1WZEA 4WCFA 3VVBA 1J39A 1LPSA 1YXMA 2XIJA 4G4GA 2ZS9A 1TJ5A 1DAHA 4D3FA 3LS0A 2GEVA 2O1XA 3K9LA 5B3LA 1ISMA 1ZLXA 4YCBA 5C5IA 5DWQA 3SKVA 3G9QA 4NPAA 1DOZA 2PKQO 2IZ1A 1A7KA 2EHJA 3GGPA 3OH8A 2DGDA 4LVUA 4UFPA 3O4JA 1LWNA 3FFWA 3E84A 1OKKA 1TD9A 2WD7A 2Y67A 3O9ZA 4YRSA 2LDXA 1AM4D 4MWGA 3RCBA 3FD8A 4ZVOA 1D9XA 4N5DA 4XPYA 3GUHA 1NJ5A 4DG5A 3V4OA 4TKVA 2Y1DA 4DRZA 4EENA 1JQBA 1EFDN 2N9UA 3AF5A 3PWSA 4KEAA 3P2KA 1OWMA 3HHEA 3ZHXA 3AJ8A 2BFDA 5KSYA 5EERA 2JS7A 1GUDA 1UC5B 4UCQA 1OW3B 3IUEA 1Y8CA 1NXWA 5HWSA 4BO2A 1RYFA 3E35A 3ELWA 1HNNA 1YHNA 2V26A 3W3AA 5BN5A 2OLEA 5J9FA 3NBYC 3K9QO 3IMFA 3QVMA 2A9OA 3C85A 3C0KA 3CX7A 5BR1A 2HFIA 4TM8A 4N0EA 3MMZA 2RKOA 4L9SA 1J90A 3GPBA 3RKOF 3LWBA 4HGNA 5L4NA 2CXNA 2X7JA 4E51A 3H9EO 4DWJA 3UMKA 1AE1A 4LTDA 4LC9A 1VPVA 5A3VA 2ZRGA 1E6KA 4JCZA 2BMFA 5AUQA 1YIDA 3QBDA 4QOSA 3QIVA 5B2EA 5F4BA 4RAOA 1O9GA 2YIVX 1QZTA 3PC3A 5TARA 4E09A 3ETDA 4C2AA 1I30A 1ZHZA 4F71A 2J30A 2GYWA 3SIWA 1GCAA 1KK1A 5L0CA 3H65A 1D1AA 1YZVA 1E7QA 2NQTA 1R6VA 2Y2UA 3LT2A 2FUNB 4JBWA 3RYCB 4TV9F 3KB1A 3LBHA 3X2QC 1P0PA 3D7LA 2ZRQA 3LDUA 3E9CA 3H3XA 2HSQA 1D4OA 2Q5QA 2YJ6A 1E5VA 3KVNA 3O38A 4C4SA 1SQ6A 5C1DA 1ZI9A 2JGLA 1QRAA 4MB0A 1TCUA 2C97A 4RVUA 2VPIA 2PLAA 3AG4C 2Q29A 1TFUA 4G0HA 2W0MA 4Z0TA 1G8KA 3B20A 4JJ6A 4QM7A 1GYPA 5FUVA 3JVVA 3TXXA 5T57A 3IMKA 2EG9A 3KJGA 2IS6A 3B60A 2D8AA 4I3MA 1WETA 4E5DA 3KHUA 3EFOB 3P26A 3E7PA 1JHOA 3D2AA 1FFAA 1QG2A 1HK7A 4IYJA 4EA7A 4RLSA 5I8ZA 2Z5VA 1WSBA 4CIHA 3NTLA 1YCDA 1JXQA 3S1AB 3EXFA 2J3EA 2J6HA 3NC0C 4QG7A 5HS6A 3PNBA 4JKYA 4DILA 4Z2AA 3A0UA 3A9UA 4LOLA 4WK0B 2X41A 1ILEA 4WERA 1XD9A 4L5CA 4M6WB 4I6GA 1YS1X 2NVWA 4ZYYA 3QKIA 4PTLA 2HA3A 5DX1A 3PIRA 1OAAA 4QSHA 2UUCB 1XWWA 4G0PA 2BKXA 1C9DB 2WJPA 3V8RA 4HX5A 1NDUA 2Q8QA 4MQ5A 5I47A 2DVMA 1GU7A 4UDVA 1T9BA 1TAQA 3Q0EA 4OCZA 4YMHA 3AG5A 4GOND 1F2TA 1ZG3A 2HU5A 4K3UA 4R3NA 4ABYA 4DCTA 3I28A 5BOSB 3PRYA 1EESA 5C3MA 1JJFA 2NXWA 3D5TA 1JR6A 5CLGA 5ICCA 1QC5A 4KO2S 2I2WA 2WWXA 4UM7A 5T4HA 2M4EA 3COZA 5BV7A 2ZB7A 4D6PA 2FR1A 3RAEC 2ZJ2A 1T0HB 2A59A 4URXR 3COYA 4MQUA 3M1YA 1GZ4A 1Y6ZA 1EFAA 3DLIA 1SVOA 3GORA 3F8WA 2A67A 1MFZA 1GNTA 1RBYA 4RD2A 2AKYA 4H1TA 2N3ZA 4U7JA 3C8GD 4Y30A 2CNBA 4EY8A 3OZ7A 2H8AA 4O1IA 2IPLA 4YPVA 3R3UA 5ER6A 1TYBE 3AEKA 2PMBA 5DMXA 1QZXA 1QO7A 5JVDB 3AB7A 1HE3A 4RM2A 2CY0A 3GA0A 4MR7A 3NJ4A 1XMQB 4PAMA 3ME5A 4BWYA 2JF0A 3R7CA 5EHQA 3JD1A 3USCS 4FS3A 4B5LA 2O2ZA 5I9BA 1N2IA 2Z43A 3KOWA 4DR5B 2GS9A 4PGMA 4JZKA 3NIBA 1FTQA 1UFBA 3HBLA 2NUAB 3WYNA 4MK4A 4X94A 3MUNA 3IDQA 4CCYA 2JLCA 1LFDB 2E5WA 3TZ6A 2A30A 5A04A 4BQIA 4YMUA 3PGJA 5BVHA 1ECFA 2OCIA 2GRAA 4B2LA 4FE4A 5IXJA 3I83A 2IEYA 2ID7A 2DECA 3H9JA 3X44A 4F9EA 2KX7A 5GTDA 3KKKA 1SU6A 3FNIA 1E2GA 4CDRA 3KQYA 4JI4B 3M5DA 2JC3A 4U0JA 4ZT4A 4DG9A 3F6BX 1N57A 1W4RA 3LOUA 4WNAB 3DFZA 5ADHA 5LU8A 2OV1A 1H66A 3K8OE 3JRXA 1N2EA 1NR1A 3A1UA 2PUDA 3IODA 1UPUA 2G3YA 1R8XA 1GGEA 2VXBA 3TOSA 5CBPB 3FFXA 1GTJ1 1KY3A 2A68F 3AY3A 3VHLB 1VPTA 1WVMA 5F5NA 4RIGA 2XUKA 4K6KA 3A3YA 4RVDA 4C3EA 2B9VA 1G4HA 3IEPA 1PNOA 5K0FA 1MEJA 4K1OA 3DTVA 1KZ4A 4F85A 1ZGHA 4PF1A 1LRLA 1LQUA 5EINA 4LDPA 4LRXA 3V8QA 3F6EX 1D6NA 5L6LB 1Q83A 4CETA 1TUEA 4FBLA 1J2YA 3IQFA 1NDHA 3F49S 1GQSA 3TVDA 4OUDA 1E7YA 4IV8A 2B2CA 1DAFA 3WWYA 1WX1A 5IT5A 4J4TA 4YV2A 3RI3A 1JPJA 3QZUA 4OLFA 5DGXA 2JH8A 3R7DA 4BASA 4B7ZA 2X7HA 4X20B 4K6GA 1NFFA 4ND7A 3FSGD 5DW0A 2GNPA 3JQAB 2BEUA 2EP7A 3FKQA 1O5OA 2O3RA 1XVIA 5EVJA 1LSOA 2MT9A 3LCMA 4GQBA 2IX9A 2QZSA 3PVSA 3ODPA 3VTZA 1OX4A 3B8EA 3FJYA 3PVZA 1EDDA 2MYSA 1WPRA 3B9RA 3OMWA 2ECKA 3H1AA 2HDWA 4OIMA 3HFJA 4P4TA 2B4KA 1NQTA 2J46A 1XZBA 3ZQKA 5B1AC 4QE3A 4RCYA 3D8NA 4IJJA 3H1PA 1S2DA 2H17A 3GPCA 4OOEA 1RYMA 4BCDA 3T5MA 2XGJA 1UOQA 3V00A 2CB9A 3E2PA 3ZYZA 5LOVF 1TE2A 5AI9A 4U7DA 3OEEA 4RGQA 3DEJA 1R4NB 5AD1A 1MEOA 2JFBA 3B5JA 3SX4A 2C9OA 4RBNA 1QU3A 5JNVA 2PBLA 4LYJA 2HQ1A 1YONA 2XKKA 3T4PA 2FP4A 4WN9B 3DAOA 4RABA 5KNDH 3ZWNA 4XD7A 3K6SB 4EPVA 2BHNA 2NU7A 3H4IA 3WKBA 3BJRA 3QMPA 4QARA 1SRRA 4M0PA 4E0BA 5CVVA 5LIPA 3RU3A 1Y98A 3NHJA 4BLRA 4PBSA 4RF3A 1FDRA 3GU3A 2CJWA 4BVBA 1UT5A 2XMSA 4DLZA 4XYGA 5JO0A 3BB4A 4HDRB 5T8KA 3ENZA