4KNWA

The crystal structure of human hdhd4 in complex with magnesium and the phosphate mimetic vanadate
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
239
structure length
239
Chain Sequence
SRVRAVFFDLDNTLIDTAGASRRGMLEVIKLLQSKYHYKEEAEIICDKVQVKLSKECFHPYNTCITDLRTSHWEEAIQETKGGAANRKLAEECYFLWKSTRLQHMTLAEDVKAMLTELRKEVRLLLLTNGDRQTQREKIEACACQSYFDAVVVGGEQREEKPAPSIFYYCCNLLGVQPGDCVMVGDTLETDIQGGLNAGLKATVWINKNGIVPLKSSPVPHYMVSSVLELPALLQSIDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Design, synthesis, functional and structural characterization of an inhibitor of N-acetylneuraminate-9-phosphate phosphatase: Observation of extensive dynamics in an enzyme/inhibitor complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords N-acylneuraminate-9-phosphatase
total genus 84
structure length 239
sequence length 239
chains with identical sequence B, C
ec nomenclature ec 3.1.3.29: N-acylneuraminate-9-phosphatase.
pdb deposition date 2013-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.710 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4knwA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4knwA01
3QU2A 1Y8AA 2ZXEA 2MSNA 2EAUA 3EPRA 2HSZA 2Q5EA 1Z4MA 4QQFA 2AUTA 4HGOA 3QU7A 3U26A 4UW9A 3WK7A 3A1DA 2B8JA 5AI6A 3UMBA 5AKYA 1YJ5A 4PNHA 3GYGA 2W4MA 3E81A 3N8GA 4Y2JA 1L7MA 3DV9A 2DQSA 1YS9A 2CFRA 2JARA 5AKHA 3KZXA 4Y2QA 3U7FB 3L8HA 4L57A 1S2OA 2I6XA 5IS2A 3QUBA 2FEAA 1WVIA 5AI5A 1EK2A 2OBBA 3FPSA 2C88A 4JB3A 4CF5A 5E0OA 2HEGA 5ALKA 4Y2PA 4C4TA 4C4RA 3WK8A 1U7OA 2B8EA 2CN1A 1RLOA 2GMWA 2PR7A 5AM1A 1L7PA 2OM6A 4CE6A 1U7PA 2P11A 1L8OA 3WK9A 3OCUA 3FPBA 4CNQA 3HLTA 3I1YA 3CNHA 1RPZA 3W5DA 3I28A 3N07A 5AW0A 2HO4A 1WPGA 1ZS9A 1XPJA 1RLTA 4XPZA 3I6BA 3NALA 1NNLA 3L8FA 3NAMA 4GIBA 3IRUA 1VJ5A 2C8KA 1CQZA 3DDHA 3RFUA 1K1EA 4FFDA 5AKIA 3WK6A 4GXTA 2O2XA 3ZU6A 3ZWKA 2I34A 1RQNA 4BX2A 1RRCA 1IWOA 3UMGA 5AKLA 4IFTA 4UMEA 3BA6A 2W11A 3U13A 2WM8A 3WKDA 2AMYA 3A3YA 4YCMA 4FYPA 2D2VA 3I76A 1LTQA 5AW9A 3R4CA 1L7NA 1S8OA 4L6AA 2YMPA 2YJ4A 4QJBA 2EATA 1L8LA 1Z5UA 2B1QA 3QNMA 5ALWA 3AR9A 3AR3A 4IG4A 5AKXA 3CZ4A 4DWOA 2R8ZA 3RF6A 4BX3A 3FGOA 1Z4LA 3SMVA 4J2TA 2FPXA 3WK5A 4UAVA 3KD3A 2P69A 2G06A 3MN1A 3L0CA 4AS2A 1RQLA 2RBKA 3QXGA 4UMDA 1TJ5A 3PGVA 3PCTA 3SKXA 5AVUA 4UM5A 2YMLA 2YMQA 4BBJA 3HYCA 2FUEA 2YFYA 3U7GA 4ZEXA 4DCCA 3B8EA 4OFZA 2I33A 5ALIA 4B6JA 2IOHA 5AIAA 5AVSA 3EF1A 5AKJA 1RDFA 5ALMA 3OCWA 5AK3A 4AS3A 4OD0A 5AHXA 3SHQA 4EENA 4EX7A 4F71A 2HX1A 4BNDA 4DW8A 3AR8A 5ALZA 4BYGA 1L6RA 2B82A 2NO5A 2R8XA 3D6JA 2HI0A 4MUMA 5ALXA 1ZRNA 4ZEVA 2FPWA 5ALNA 2IYEA 2FI1A 1SWVA 3PGLA 5AM2A 5AVZA 1J97A 3ED5A 5ALSA 1ZOLA 1RMTA 2B30A 2WF5A 3ESQA 4Y2VA 2G07A 4RESA 4OHFA 5AM5A 5AVYA 5JJBA 4KN8A 1Z4KA 3VAYA 2CFSA 1WZCA 1U2TA 3W5BA 3N1UA 1J8DA 4XE5A 5IT0A 3MPOA 3IB6A 1Z4IA 3ZI4A 2WFAA 1YMQA 3QGMA 5IT4A 2ODAA 1Z88A 2YJ3A 2ZOSA 4O8CA 3NANA 1YDFA 4I9GA 2ZBFA 3P96A 3AR4A 2QLTA 1U2SA 3NIWA 2RARA 4HGQA 3ZTWA 5AW1A 3SLRA 1L7OA 4ZEWA 1RC8A 3B9BA 1SU4A 3U7EB 2P27A 4J03A 1X42A 1Z4NA 3FVVA 3E8MA 1AQ6A 3OCZA 4BEWA 4UMFA 3UM9A 1Z4OA 2CFTA 5AVWA 1XP5A 5AVTA 3M1YA 2VKQA 2BDEA 2WF9A 3WK4A 3J7TA 3ESRA 2GHTA 4MWOA 5FP0A 4YH1A 3L8GA 4F72A 2G1AA 1PW5A 2BY4A 2YBDA 3KOOA 2I55A 4UU0A 3ZVLA 1QH9A 2IA5A 1CR6A 1SWWA 2OYCA 1QQ6A 2ZBDA 3WKCA 4H1WA 2FPSA 3A1EA 1RLMA 1U02A 1QYIA 2WHEA 4KX3A 4UMVA 5ALFA 5AW3A 3W5AA 4KNWA 5T41A 3L7YA 4EZEA 3ZUPA 2ZBGA 1WR8A 1Q92A 2AH5A 1EK1A 3BWVA 3OCYA 3L8EA 3KDPA 3QU9A 4NFLA 4DFDA 5AI4A 5A3QA 1Z4PX 4C4SA 4CF3A 3UMCA 5ALRA 3AR6A 3N5KA 5ALDA 5ALTA 4YIHA 3IJ5A 4NABA 2WF7A 5A3RA 2C4NA 1ZD3A 1Q91A 2JAOA 4HGNA 2HOQA 3WGUA 1TJ4A 3OCVA 3DNPA 3U7HB 5AVQA 5ALYA 2JAUA 5AIBA 3WGVA 3AR2A 1RKQA 1LVHA 2B0CA 1Z5GA 4BX0A 1F5SA 2GHQA 2G0AA 3WKEA 4Y2TA 2OA0A 2FDRA 3QUCA 3W5CA 3QLEA 4UARA 2HCFA 3OPXA 4UASA 2O9JA 5AK4A 3L1UA 2EARA 1YNSA 4UAUA 2PKEA 2JAWA 2R8YA 2GO7A 3ZVNA 4Y3UA 1ZD5A 4HAIA 2YJ5A 5AM0A 3ONNA 3QU5A 4JDPA 4EEKA 2ZBEA 4HGPA 2FUCA 2G80A 4G9BA 4UU1A 4Y2XA 2BDUA 2YJ6A 2AGVA 5ALGA 2IOFK 1TJ3A 1RMYA 5AM4A 3B9RA 4HYTA 2FPRA 1VFPA 4UATA 4YCLA 3M9LA 3QYPA 5ALHA 3KBBA 1MH9A 4BKMA 1N9KA 1TA0A 1Z4QA 1O03A 1QQ7A 2MU1A 5AK5A 3L0BA 2HF7A 5AI9A 4AP9A 3DAOA 4E88A 5AVRA 5AVVA 1N8NA 2HDOA 4YGYA 2HF2A 4YIKA 3NRJA 2Q4RA 1RKUA 3PDWA 5AKKA 4EELA 4KX5A 5AVXA 3EWIA 5AKZA 3OTQA 5ALUA 1RKVA 4HGRA 3U19A 4CF4A 1O08A 2ZG6A 5AW5A 3QX7A 5AI0A 4Y2SA 3E84A 3AR7A 2P9JA 2R8EA 5AK6A 5AKGA 1XVIA 5ALQA 1FEZA 1T9ZA 4UM7A 2G09A 5AICA 3QUTA 4Y2UA 4BNDB 3NASA 2C8LA 3MMZA 2G08A 3WKBA 2PQ0A 4OCZA 3ZTYA 4XOUA 4YCNA 4EX6A 3SF0A 4NV0A 3FZQA 1ZRMA 2IOFA 3R09A 4L6CA 4KNVA 4Y2YA 5ALEA 5AW8A 3MC1A 3ET4A 3N28A 4Y2RA 3L5KA 3S6JA 5AW6A 1NRWA 3L0YA 2WF6A 2QYHA 2RAVA 3WKAA 3AR5A 5ALJA 5AESA 5AW2A 3F9RA 2W43A 4FE3A 4NAVA 2RB5A 5ALOA 3ZVMA 1QQ5A 1Z4JA 3TLMA 3OCXA 3SKYA 5A3SA 3K1ZA 2C9MA 4I9FA 1ZJJA 5AW7A 3QU4A 3SD7A 2FPUA 1JUDA 3R9KA 4RETA 4XQ0A 3FM9A 1NF2A 5ALVA 3ZW7A 3L1VA 1T5TA 5AM3A 2B1RA 5AKEA 2NYVA 5AI8A 2HHLA 3ZX4A 5ALPA 4NWIA 3E58A 3QUQA 1T5SA 2I7DA 2YN4A 2I54A 3ET5A 3KC2A 1VJRA 5ALLA 2WF8A 1ZD4A 2Q4TA 1RMQA 3ZX5A 4KYTA 2NO4A 2GFHA 1YV9A 4BEVA 4G63A 1ZD2P 2X4DA 5AW4A 3A1CA 2YMMA 3ZWDA 1KYTA 2YY6A 1TE2A 3EF0A 3NUQA 2JGAA
chains in the Genus database with same CATH superfamily
5DI3A 2VYVD 2VZEA 5ARCA 1VTMP 3AVQA 1U9IA 3MIZA 5TVKA 2JJQA 3ETCA 4LRQA 5KWVA 2YL0A 2PZMA 4NTBA 2C82A 5IX8A 4OMCA 1HL3A 5FI5A 1SIBE 3GNQA 3O8QB 1PZHA 1MEOA 2WB7A 1PYDA 1RNLA 1KOFA 1YJ8A 4XB2A 1F3OA 1H9GA 2ZJ8A 4J3JA 1XVLA 4M8LA 1FJGB 2XLMA 1JR2A 3QE2A 3F4LA 2GN0A 1GFZA 4WGGA 1CBUA 1EWVA 3R20A 4MV6A 5EAIA 2OBMA 3EEYA 4AY5A 1N75A 2Q8QA 1DI0A 2JDIA 4LY6A 4KUHA 4Y2JA 1EAMA 2GNPA 5FBWB 1CEEA 4EGJA 2VJLA 2HUNA 1OTYA 1KWKA 1Y9EA 3ND5A 3PXCX 4QUHA 1X8LA 8ADHA 3WZLA 5GTDA 1SC1A 3TEFA 3SZOA 1MO4A 1EUDA 4PFQA 4OIMA 1DQSA 2AN3A 5CM8B 3U7FB 3FRHA 1WWKA 4JLUA 4PX2A 3NI2A 4KQJA 4GWKA 3V1NA 4QUKA 4L1KA 4J9UE 4XPIB 4F6LA 4NZYA 4LN1A 4GZMA 2P0YA 1TFOB 2FK8A 1ENYA 4RSGA 1Y5IA 2P90A 2XYGA 4R1OA 3W2HA 2QRUA 1BD4A 3G9UA 4Q3CA 4BHTA 4KVGA 4QU8A 4WESA 3QLJA 4U63A 2UYGA 1EX7A 2CK3A 4GQAA 2D1FA 3EC2A 4BVEA 4DRHB 1KU2A 1UFKA 4FYHA 4ZV4A 4GAEA 3JYLA 3AL2A 4O02B 4NPHA 4HDRB 4YRGA 3V2GA 5E1DA 1CQWA 3V80A 4IINA 2CXSA 4FC7A 2ZRIA 1LKZA 1LF0A 2QZSA 4FYWA 4WEOA 4YDSA 2JPDA 4W5WA 1F20A 5JVDB 4HNAB 3RVSA 1HETA 3V5YA 2V9CA 5K6AC 2XUJA 2E55A 2VHEA 3IHWA 3FBGA 3DKIA 4HLCA 4JVNA 4XH9B 2Q3LA 3RVRA 3SZ3A 5K0EA 3BRSA 4EPYA 1ZJWA 1WPGA 1DO2A 3I6MA 4B74A 4MS4A 3PQ5A 3OA1A 1JQKA 4DQDA 3P26A 3CE9A 3F6BX 4L0CA 2WY2D 4LDZA 3E9MA 4LS3A 3T5BA 1AHPA 2UZ4A 4IMRA 5A4KA 4JCZA 3E9EA 3QXSA 1DAHA 3EZ9A 3HSSA 4O4LB 2ZRLA 4ZQGA 2NUAB 4CT5A 1SUFA 2KM1A 2D7CA 1DZIA 2AYXA 1QJCA 1RXIA 1V9LA 2VHVA 3ZU6A 4K6MA 2UYCA 3VPFA 1F6WA 4NHOA 1MVLA 2VWPA 4PR0A 2FN9A 2DM6A 3Q8WA 3ACCA 3QZCA 3SIPA 5ITWA 4D42A 1ZIYA 2D74A 2BCGY 2VK1A 1YHNA 2FZ4A 1ZHHA 3U3RA 2ZS7A 1SG0A 1UCFA 1LC0A 2BBSA 2ZITA 1XDBA 4FDAA 4WLUA 1TCVA 1LTKA 2E5LB 1FY2A 1RWNA 3KJGA 4DL9A 3W7VA 3N24A 4KR7A 1T8TA 2J3EA 3RU3A 1CLUA 4RAQA 4ZGWA 3ZJVA 3GGCA 5C8YB 1QK3A 1YIDA 1ZBDA 3M4YA 3L0IB 5KVAA 10MHA 2C9OA 5BVGA 2VTDA 3CO0S 5TQ0A 3V97A 3O8CA 2VQFB 1IHDA 3FWPA 1JXQA 3KJFA 2C83A 2B1QA 1RHKA 3FDQA 4WADA 5HILA 3S1AB 3SMVA 1E7RA 1I6MA 3ZJYA 4BWYA 4BZWA 2F9MA 3Q88A 3R0JA 2C4UA 2DB4A 1HZZA 1TQDA 2HW8A 1N9GA 1UJBA 1ZISA 3Q6NA 4OGFA 3WODF 1JXMA 1JVSA 2VJBA 3P9KA 4MR7A 5YASA 4M54A 5HDBB 3NP7A 1RHRA 3DTYA 4CMIB 2FPXA 2A5LA 3ABKC 3H1FA 5KINB 1ZQ9A 5L7YA 2CJYA 3MLEA 3QY9A 3R23A 4R1PA 2JIDA 1O5OA 5SZJA 1AKYA 2V3VA 1HWYA 4MUXA 5BNFA 5T4HA 3R7WA 3U1VA 1I0IA 3UJ3X 2QTMA 1U4SA 3G89A 3KZ1E 2QZZA 5ITVA 4ZYTA 1KYWA 1N3YA 1EA7A 4CS8A 2P77A 2VT7A 5AVUA 5M34A 4TS4A 3E3NA 4DZTA 1A27A 1PD0A 4KPUA 1GUDA 2ZWPA 4MW3A 1I4WA 1RTTA 2IIBA 4H4CA 1H2AS 5FNVB 4B7ZA 5BSHA 5LWQA 1ZOSA 1U0JA 2AOWA 2FDXA 2X19A 4YR7A 4KDEA 2VIIA 2PH5A 3R6TA 1EK0A 3PUJA 3S55A 3TAUA 4IRUB 1EKXA 1AUVA 1T13A 1A77A 1CULC 2JA2A 3NIDB 3Q1KA 2AE2A 4HQNA 4KRGA 3R76A 1MB9A 3T3DA 4ENTA 4DV1B 2H0RA 4LVNA 5LLDA 4I4TF 1OX6A 5AKJA 2FUKA 1S9HA 3RASA 1DKUA 1CDDA 3UJHA 4IGIA 3TB6A 2AMJA 1VZ2A 3RRNA 4TLLB 4Y6GB 2ORWA 3OE1A 3ZBPA 2F55A 1U7UA 4O2AF 5L7TA 1UOPA 3I1IA 4E14A 4HLDA 2PZFA 2PUBA 2VUUA 1QH1B 3F3SA 5KYGA 4NIMA 1CE8B 4LE2A 2G4LA 1PS0A 3O4GA 1L6RA 2HA5A 5EGNA 1TJNA 2KK1A 3K9FC 2UUAB 1NX9A 1LV7A 4YUZA 1JBKA 2EGHA 3KKMA 5JP7A 2ECFA 3L0OA 1CNMA 2IYEA 5EKDA 3V8EA 4BWFB 4EF6A 3BGWA 5AM2A 1BXGA 1D0XA 4URHA 3QV2A 1AX9A 3W9BA 4GMKA 1D9ZA 2V1UA 4HXYA 1NX6A 4WLEA 1IN1A 4OBEA 1SMYF 1USVA 1SBNE 3VKUA 1E2EA 1JKFA 3NH9A 4MKIA 2C98A 4II3A 3SG0A 1MX9A 2MJLA 3EXHC 5LBTA 1X7XA 3VHLB 4RFSB 4PLTA 3IRVA 1ZP6A 2CYAA 4IZOA 1ID1A 1EQ2A 1YVRA 1NNI1 3L6DA 4S1VA 3UWMA 2YCLA 2SKCA 3IUMA 1C7JA 1YMQA 2YOFA 4JIMA 1LS6A 4RV5A 3VR2A 5U4XA 1E2PA 4G5FA 1SC4A 2R9RB 2MR6A 2SKDA 3IQZA 3KT3A 3O6VA 2E87A 1NRJB 1GZHB 5DBHX 3SF8B 2F3TA 4EWCA 3GAAA 2KMLA 1RQGA 3JASB 4PBRA 5FV4A 2FR0A 1YQ9A 1M1YE 1RPAA 1FBNA 4UCFA 3KTDA 1P2BA 5LYJB 4X65B 2G63A 3T94A 2JH8A 3WG7C 1CUDA 3ESYA 1IK4A 4QUIA 2VJOA 4RDIA 1O89A 3SGLA 3RADC 2X4LA 1Z15A 1Z7Qc 1XXHA 1Y98A 2OT3B 4R3UC 2J7PA 3HJUA 3I04A 4KTTE 5LQAA 3F73A 1SEVA 1Z18A 4UXJA 3UA3A 2HR1A 4DCPA 4XLLA 1J56A 5EMKA 1H2RS 2PUTA 4L5BA 2Q7DA 1F2UB 3IV7A 3OY7A 1G2IA 3RAGA 2YL3A 2G0NA 3DLAA 3NYIA 3PHF2 2QN3A 1UEXC 3U4QB 1BRTA 2D4UA 1P4SA 1TNDA 3FFXA 1XRLA 2Z9DA 2PU7A 4FGJA 1UMCA 2PQ6A 2ZJ2A 1GTMA 3WIOA 3URMA 2XMBA 3RU2A 2EFYA 1FX1A 1MVNA 1V4VA 4DDHA 1DNPA 2I7VA 2YOHA 1NOKA 1BS9A 3ZCVA 4FILA 2EL9A 2CFOA 1XTZA 2DWUA 4FEGA 4YWJA 3RVPA 2ZPTX 3FWNA 3VSAA 2QMUA 1QSGA 1RHMA 3C3MA 5CIQA 1QCZA 1Y1LA 3T9OA 3PX2A 1SC3A 1WE2A 4X64B 3ICWA 4AE4B 4NYIR 3CF0A 4B3CA 1H2XA 2Z5GA 5E2IA 2FQXA 3IOEA 3N6RA 5CDFA 3SSMA 3MD9A 2BE5F 2FOLA 3HNPA 2GM4A 5EQDA 1SB8A 1W8IA 3KSMA 1UBCA 1AY0A 3S5UA 1ZXBA 2XXJA 3AUAA 3KXKA 4G0ZA 1FF9A 2QHXA 3DDWA 4LG1A 3ZWPA 3CLUC 1A71A 3CH7A 4Q1CA 6YASA 2A4KA 2RIRA 1FIUA 1MLDA 2FSFA 2Y6UA 3DBVO 5IBCA 4CIBA 1DKQA 4J7XA 4FLFA 4NENB 2EJVA 2LCFA 3CLSD 2PGAA 3H2YA 1U0SY 1SBHA 4G81A 3SEOA 1BDBA 1H6GA 4M8SA 1QPZA 4PLZA 1UG7A 1KPGA 2GZ1A 1HEYA 4MMZB 3KXIA 1UMKA 3SDBA 1Y7LA 4NBVA 3ZIDA 4HGNA 1GUBA 5HQJA 3H65A 4TV9B 4EJSA 1NATA 2BW0A 1G16A 1QHFA 5FH9A 2OYSA 3LRXA 4YRTA 4E7OA 5DTRA 1IAQA 5JI2E 5CHYA 3TNDA 3BB3A 4BO4A 5GPGB 3CKLA 4QBTA 4F4DA 4ZZ3A 2BR4A 4GM0A 3T99A 3H2JA 3PDHA 3PHIA 1RKQA 7YASA 1JQEA 1WULS 1ZZGA 4BX0A 1P81A 3FOEC 5CNJA 3PX7A 5JI3E 1JA1A 5EPOA 4QUDA 4DREA 2YV3A 5I7FA 1WV1A 2FA9A 2YDXA 5LDDC 3TXXA 2Z3ZA 5AUOB 2FPIB 1NVUQ 2IH5A 4N5IX 1BSVA 3DPIA 3U7QA 4P38A 2X6RA 3RSFA 3VHRA 2ZYVX 2HSBA 5ADVA 5CNMA 2HT1A 2F59A 2RSLA 2NP7A 3PPWA 3L1UA 5IK2A 4BRUA 4EKWA 1QVWA 1S02A 2IX9A 1P75A 2WHPB 3K31A 4HUJA 4RZUA 3RUCA 4KQ9A 5EJIA 3JRWA 3TJZA 3WNBA 2NU8A 1G8PA 3LDUA 2WWYA 4AKEA 5A0VA 1SKQA 5IHPA 1QPBA 4Z2YA 3EIFA 1Z7WA 3N2GA 4WKGA 2ZBEA 4GR9A 1JDPA 1OU0A 3ABMC 1IQ0A 3HR4A 4WCDA 3AQBA 2BTQA 1MOZA 3ZXUB 4YAGA 1ODCA 5B7NA 1TU0A 2ALJA 2GM3A 2O2EA 4DIKA 2XUAA 3OLVA 3QNUA 4H7IA 1J1ZA 1GXSB 1RAEA 2PX5A 2I5PO 3NUZA 4CRWB 1E2NA 2GEBA 2HRBA 3AM5A 3B6MA 3OX2A 3H13A 3LFTA 3VNBA 1E94E 1SOWA 4Q34A 1VPTA 2VPQA 1VFPA 4QOFA 4ND4A 1Y9DA 2WC1A 1BH6A 5TQ0B 1DWOA 2PT5A 3K70D 2ZT7A 3KQTA 2VRNA 4IQ4A 3SM9A 2HJGA 3EOZA 1N9KA 2D3TA 4L85A 4LMRA 4PAGA 5FO0A 2CCGA 4R1TA 4CMAA 3B7WA 4C5CA 1V1MB 1D3AA 5HS6A 4LF4B 5EP2A 1F0NA 2WSSD 2ZI3A 2AL7A 3ZDLA 2PBZA 4YO7A 1W36D 2OD7A 2CL7X 2X58A 1A9SA 4KUGA 4XWAA 4CG1A 2H9YA 2Z8YM 3L7DA 2O3TA 5CTAA 3V7OA 3TBFA 4IM7A 4JZKA 5ECGC 4EFKA 4YAOA 5FLYA 5DV9A 3STXA 2P3QA 3RM3A 3EAQA 2CNWA 3M2TA 4FCWA 5C1PA 1N2JA 2O1XA 3RBVA 5JVDF 5J2UB 4PZAA 2ZREA 4J4BA 4KEAA 3BA1A 2JLVA 4TKUA 1U0RA 3O8QA 3V6MA 1DKLA 4Z0PA 4U0KA 4YPVA 1OI2A 1L4HA 3H9CA 3IKJA 3QHQA 4LNHA 5KTPA 4AB1A 4BVJA 5GWXA 4E2XA 3BAFA 4Y1RA 3T3PB 2VJPA 2HK6A 3IJPA 1G9SA 1NVAA 1SD2A 1W44A 3B38A 4HBZA 1CFJA 1PZMA 2V6MA 4FNAA 4ZAWA 4OLBA 3J81k 1JALA 2E9SA 4AL0A 4D99A 3TZLA 5CEFA 5I7VA 4AKHA 1OT5A 2D1RA 3MWJA 1Q5PA 1T9ZA 5HCIA 1OXUA 1P1CA 2H1RA 1J33A 2AN5A 3QUTA 5J3JA 1YL7A 2ZJAA 5BN4B 3R3YA 3TZEA 5ELXA 3C74A 1YRLA 1ZXLA 4W9NC 3U3JA 2YV2A 4ZMSA 3L2OB 3LA6A 2O2HA 3MJHA 5F23A 2AWYA 1MOPA 5JDCC 2FOIA 1OXKA 4II2A 1O57A 2PVCA 3AW9A 5PNTA 1VC2A 4G8CA 5TSDA 3WL4A 3EX7C 1ADYA 2DMRA 3PPIA 3HA3A 4HQ6A 2VP6A 3FH0A 2O3JA 4TTTS 3RWMB 4YNBA 3C7JA 3K09C 3HFSA 3L0YA 3MQ2A 13PKA 1PNTA 3FNQA 5CFRA 3H1TA 3AR5A 4JKOA 2B3DA 3RSZA 3SHWA 2QRVA 2G72A 3R3SA 1X2EA 3H9JA 3PIIA 2REOA 5DBOA 5EWLB 5DYTA 1KSFX 1VBFA 5GQSA 4PO9A 1NJGA 1QIIA 3LWBA 5I51A 3F90A 4Q4AA 1TPZA 2VBFA 2J67A 4AUMA 4AF6A 1JFLA 1V0JA 2I9PA 5AJZA 1B1CA 4G1CA 1BYIA 4FZRA 1SCAA 3RVDA 2DKNA 1Q0UA 4LJAA 5FIUA 2D5RB 2YWFA 3FM9A 3IUYA 3MYRA 1RP7A 3KLBA 4JCCA 2HLPA 3Q87B 5TPWB 3GPDG 4Q21A 4YYZA 4MCIA 3E8SA 1LNQA 3RODA 3RRJA 2ZSUA 3UHAA 2YKZA 5F28E 4ARVA 3HPRA 4YAWA 2J4CA 4LXXA 4UNIA 2AP3A 3DXZA 3E0XA 1P2VA 1XDZA 2WVOA 2VPXA 3DTTA 3EQ7A 3L8MA 2O0JA 3NBMA 1T5SA 1XLTA 1CR2A 1RBQA 2P7IA 3FKSD 3HHEA 5HRCA 1M0EA 2PNOA 1BCRA 3GRRA 1IZZA 1N1CA 1KI1A 2Q9UA 4EQZA 3NW9A 5TQ2B 1Y82A 2PLAA 2Q4TA 4M1SA 2GPJA 4UOQA 2P2DA 4QDTA 3VBEA 3G2JA 4NYJR 1R5NA 5BN1A 4JH0A 4EVSA 1DTWB 2X4DA 1C1YA 4XZ3A 3UO8B 1I5NA 4AYWA 4QUEA 5AW4A 2L9JA 1E3JA 2E1PA 1KEVA 3HO1A 3BE4A 4ROSA 1S7GA 1O4WA 1TTHA 3V4OA 5C81A 1EFLA 3MXOA 4B3RB 3PB3A 3U4GA 4CM4A 4DR2B 3HEMA 5DVZA 4ZXFA 1N36B 2VF5X 1HGXA 3BGDA 1IE3A 5CFOA 3FMIA 3QOYA 4XA8A 2DWQA 2PUEA 3VAAA 4V0OA 3MJVA 5P8WA 2MSNA 3WIEA 5KTKA 1YE5A 3EPLA 3EPRA 2NM0A 3L7JA 1DZ3A 2FXIA 2I9KA 1W0JA 4V3CA 3EWSA 1Z8DA 5I5EA 3W2WA 2GWHA 5ED0A 1ORJA 1GYRA 4OK6A 5AXDA 1ZH8A 3X2SA 3ZDQA 1S89A 1W94A 4OATA 1FFYA 1OCCC 1GGMA 2YL7A 2UZAA 4IO1A 3ZPXA 4BB9A 4RLQA 2ONCA 3FCUB 4IXDA 4MYUA 5EWJA 4B7CA 3BZBA 3NTRA 4BMXA 4JJ8A 1PQYA 3AEQB 2H57A 1T3ZA 2XCOA 5BN3A 3JY6A 4I6JA 3UJPA 1TU3A 3TLJA 1L3CA 1TVEA 1ZN8A 4U7PB 5JMOA 5CRIA 1JILA 4ZEVA 2L19A 3DV9A 2O2GA 3LZ6A 4DJFC 5JSQA 1N6PA 1RKEA 1OLXB 2KJQA 5AKHA 4RVOA 2YJTD 4ZYWA 3HKEA 2W2NA 3AUYA 2PXCA 4L7QA 4OKIA 3EOAI 4AIRA 2I76A 5C5DA 4LDAA 4N03A 5IDYA 1PG5A 4V0LA 1JQLB 4LJRA 1NXSA 2IXDA 3LV8A 1DSSG 4BBZA 1ZY2A 3DBLA 4U1RA 4JVLA 1WASA 3Q0TA 4RTJA 1YBAA 1KSGA 4YQZA 3GLQA 3CE6A 3AFOA 4X1YB 2WAOA 2HUJA 3N8NA 5B1EA 3OD5A 4UM9B 1GSIA 1KMHA 4KBYA 3DTVA 2ZUEA 4X1KA 2R00C 3O47A 1YB1A 2H48A 3F67A 1DAKA 2A3RA 1RLOA 1GGVA 2PK3A 3O4HA 1QGOA 2WWVD 2PA0A 1IUNA 4DDTA 1G6HA 3MUOA 3QIAA 2GAOA 1SAYA 2ZSBA 4N7BA 1KMNA 2EW2A 3CURA 5I9LA 1O6BA 4I14A 3OICA 4B80A 1EUYA 1I2ZA 4G1UC 3P4XA 5JCJD 2XGJA 4V39A 2I15A 5LN1A 1AB6A 2RKOA 3PC4A 5JZ9A 1F4PA 2DKOA 3NTOA 3W9YA 1Y6QA 3HLTA 4ARUA 3HHPA 4GBGA 4N7RA 1R3DA 3CZ6A 4WOKA 3EN0A 1NGSA 4PY2A 3SN6A 4YPOA 5I9TA 1PTJA 1XPJA 4PYRA 4IIHA 1R4AA 3I6BA 1XPUA 1EFPA 3W1VA 3K96A 3GARA 1WZEA 3N2KA 4R9SA 4AZ3A 2ZVJA 2ZQYA 3ZXXA 3IXLA 3G8AA 1BH2A 1EWYA 4F8EA 1GD1O 3IALA 4DC9A 2B6NA 4ZZIA 3DEJA 3D2BA 3L04A 3LSTA 2QX6A 2YZNA 3GA0A 2R1UA 5D1NA 2RHDA 1CQXA 4EGCB 3MX3A 4XYBA 4YRQA 3RSSA 1X15A 3BFJA 1IWOA 3HDHA 4IDPA 3QX3A 3SIWA 3W2FA 4UBLA 4Q3KA 1L7AA 3EXAA 4YCAA 5CU7A 3FJ1A 1CRZA 5E1MA 4JEAA 2A2ZA 4H27A 3GDFA 1HYQA 2IC5A 1CS0B 1T1JA 4O08A 3TNFA 3EQ8A 5G4KB 5K5EA 5KBYA 3EGXB 3SOZA 3U1TA 2CZGA 3CMMA 2CJFA 3CEMA 3GD7A 1GGKA 3AJMA 1BE8A 3G68A 4OQFA 4C30A 3VBCA 4A3SA 1KVTA 1Z2DA 5EXEA 5IM4F 2CXQA 4S04A 4W5QA 3O8RA 1Y1PA 4A5OA 2VSXA 2J7KA 3PXXA 2OZPA 3ZKWB 4DEXA 1OX5A 2QA5A 3O5AA 2CNKA 2QENA 4INPA 4B45A 5E3HA 4OQNA 4A0SA 3ODPA 5KVCA 1XNQB 2W2LA 4LRYA 1DDGA 4RHYA 2RGGA 2R79A 2IUSA 4ZT4A 3UNXA 2V7EA 1ZHZA 4D9IA 4IAQA 4K8RB 2B3TA 3RF6A 1RZUA 3QF7A 2QUAA 1H9TA 1XL0A 2J9FB 2QTLA 3IVAA 4R16A 1UL1X 2OPBA 1W73A 3EA0A 4L0QA 3WK5A 3WVNA 3AVYA 1ODIA 2D1QA 4BU0A 1U99A 5IDVA 1AQLA 1ORIA 2JK1A 3OLZA 4XFJA 3VKWA 1MO6A 2DLDA 2J6CA 2QUHA 5SZIA 1PS8A 5I4KA 4ZCTA 3UYLA 4AZ0A 3FMOB 2FRXA 5HR5A 1VE1A 1NJ6A 3DCNA 1YZ3A 3FFWA 2C61A 2ADOA 3DI5A 3OA0A 3UK2A 1NLMA 3DHNA 4BBJA 3EGDA 3N2ZB 1GVHA 4RTPA 3CWZA 2NSHA 3WYNA 1L5NA 3VOAA 4KNYA 4CQMB 3IAS1 4QTXA 5ADWA 1R0ZA 1IY2A 4L5AA 5UKDA 4X66B 1UOEA 1LFDB 4YT5A 3B48A 2PZBA 1FE8A 2I33A 3G17A 4OU4A 5FLKA 3TI9A 4RJLA 4X5OA 3ZU3A 3KP1A 4ZCRA 2GBCA 1ECCA 1G2QA 1L8XA 2P0AA 3LUTB 4FMPA 4O1HA 4ZOEA 1KU6A 5ALMA 4EI8A 3U0CA 1KP3A 1K8QA 2Y1CA 3TDMA 1RRGA 2QXYA 3CVOA 1QYRA 3GLSA 3BG5A 3LLCA 3OESA 1VJCA 2JLCA 2AMFA 5AJUA 1GZ3A 5J4VA 3QTHA 3P0RA 3TSAA 4DR5B 2OPHA 3WNZA 3HB5X 3OECA 3GELA 2DC1A 3EVFA 3H9UA 4NCHA 2KYRA 5KTTA 2VKTA 4OK5A 3VGPA 4QFBA 3UZUA 5C5CA 2EPNA 4ZQEA 4C88A 4MS2A 1OFUA 4KYIB 3IPAA 2IDJA 3QUSA 4ISCA 4QHSA 5AJWA 3VH1A 3ZCTA 5SY6A 2F64A 4JK3A 4JU9A 4IOKA 4OG2A 5EJGA 1C0IA 1JG4A 3C5VA 4MOWA 4N18A 3VMFA 5HHTA 5B2ZA 2LZ0A 3OMWA 4P93A 1U2TA 4XLZA 3BIWA 3IILA 3WLTA 2RHOA 2QT0A 2VPZA 4D81A 4EW3A 4UEQA 5IT0A 1ZZPA 4LK2A 5F12A 3T7EA 3IB6A 3ZI4A 5IT4A 3CLRD 1XEWY 1G4HA 4XD2A 2QNLA 2QGZA 4HH3C 3KYJB 1BFKA 5DS4A 1LSJA 4UXIA 4OMFG 2C5SA 1WBBA 4YROA 4Q0MA 1SKBA 2WIFA 3BL8A 2VA9A 1WXGA 2AOXA 1SQSA 4Q66C 1R8QA 4RADA 4DXDA 3N59A 3L8CA 4KLAA 4WOBA 1UPXA 4YTEA 3ZCQA 3Q3JB 2ZTUA 2NTVA 4DXWA 4JJIA 4M1KA 4DMFA 4KDRA 4OX9B 5E9AA 4BC1A 4L22A 4HLUA 3DFFA 4C0SA 4PACA 4EAQA 4HK4A 3OPYI 2OSVA 1JAIA 1OXMA 2QPOA 1OH7A 4FKZA 1EHIA 3FVVA 4EGSA 1AQ6A 2ZP1A 3OCZA 3MT0A 4FKMA 1TCBA 4K9RA 4L95C 1VM6A 4NU0A 4UMFA 3UMIA 3LYUA 1EM8A 5A62A 4XD7D 4AY3A 1TYAE 3ZIBA 1GZ7A 3OWTA 4DJJA 2VPWA 5JUAA 1ADFA 3ANSA 4MJLA 3K3PA 1R6XA 2Q3TA 1AZWA 2AD1A 2NADA 3CV3A 4ZVQA 3U3BA 4R9NA 3T5MA 3RQSA 1CUYA 3CW8X 3EFOA 4WCFA 3KQKA 3OM1A 1CGNA 3LHIA 3MMXA 4PG6A 4D98A 4QQKA 1SXPA 4JJGA 4ZO7A 4HH4A 3WL7A 1R5JA 2ZIXA 1LLCA 4UUPA 4UU0A 1I4YA 1TU4A 3ITDA 3W7BA 4K0RA 2LP4Y 3PFWO 5EHIA 5K01A 1ZAKA 2PRKA 2O48X 4LZOA 5KYYA 1Z3CA 4RACA 3UAYA 3BFKA 1EEHA 3NM5A 4H9GA 1VBNA 1QG6A 2WRZA 2JJ1D 2B0HA 3T1HB 1GEEA 4EIYA 2FJUA 3ZUPA 1YZCA 3GJ8A 3CUUA 1Z6XA 3EH2A 4WNIA 3JWJA 2PGIA 3EXHB 3LUGA 4YB8A 1AMOA 2VJMA 1KOGA 2AJCA 3LM8A 4IMIB 4O6VA 3RQIA 1AQJA 1G2PA 1KHTA 3OOSA 4MKGA 5LQRA 3AHFA 1LTHR 5HUJA 1QDUA 5IP5A 4MGIR 1M34A 1ZC4A 1NI4A 2RGAA 1AUPA 1H2EA 2BFDB 3ED1A 4QEZA 4KXMA 4P22A 1T1SA 4R8RA 3JZ0A 3B1VA 4M1QA 1CUEA 3PDCA 4IF4A 4TMVA 1UK8A 3C4VA 2ASEA 3SEQA 3FXHA 2IBFA 4KV7A 3WGZA 2AYYA 1O9GA 3CCCA 4B4OA 1M2HA 1I0LA 2ANBA 5M29A 2DB3A 1NUTA 3DFIA 4JLKA 1G4AE 1Q91A 2JGLA 3D0OA 3RS3A 3Q3EA 3A9WA 5KYTA 2OQ2A 4RPLA 3HWRA 2HXYA 3OQIB 2AK2A 2XV1A 1CEQA 3ZHYA 4G0MA 2LK4A 5C7OO 1YRAA 1E59A 3C4QA 4EVQA 1DRVA 1PRYA 5DHQA 2CXPA 4GKBA 3M5WA 3AR2A 2AN9A 2BGIA 3CLVA 3R3VA 3ZWYA 3W4YA 5CX1A 2J9UA 1RD4A 2BV3A 2OCDA 1FQKA 1O7JA 2CB0A 1F4VA 3EJNA 1L4FA 1XL1A 2HMUA 3CEJA 2OA0A 3VU3A 1E3WA 2WUVA 4FHDA 4Q3AA 1JG2A 4JQCA 5JCZA 3FPFA 1FLNA 1DLIA 1N6OA 3ETJA 4G1FA 3W0LB 1KP2A 4DV3B 5T64A 3QLTA 4DY6A 3RIXA 2R4TA 3QW4B 4Q18A 1KS2A 5T1DB 4DLNA 3RROA 4YXFA 5EWLA 4DAOA 3QMKA 3KVOA 1YVDA 3LLMA 1H93A 4Y6QA 1Z5WA 2A9VA 3R24A 4FMDB 3AETA 3CUYA 4DIFA 4K0DA 1LH0A 5IXSA 1FRVA 1HDEA 4HNQA 4I2NA 4WRRA 4XKJA 1OFIA 5JD6A 4LYAA 2E1RA 2VBGA 3A3KA 3JSXA 4BUZA 1JWAB 5LXTB 3R8XA 3TJ6A 2FUCA 3AC0A 4GDMA 4X20B 4L6IA 3UWKA 4M38A 3FTFA 5BSVA 4F5YA 3JARA 4JNKA 4LLEA 1KJQA 3HJTA 3WLIA 4XCVA 5TPWA 4N0EA 1ZSYA 2JFBA 4XD7A 3UXMA 1WB9A 4P3PA 3OPYA 2JGKA 4QFCA 3FNGA 5FOSA 621PA 5E8JA 1M2FA 2O3UA 3CB4A 1MDBA 3EF3A 4UATA 3SHVA 3T06B 1U3CA 3NHPA 3BREA 4OJQA 2BFWA 2OFWA 2Q21A 4GI1A 2R62A 4TKVB 5D1HA 4F4IA 2QR5A 4L28A 5DYWA 3THOA 3Q7LA 4TQGA 1ESDA 2O06A 2YQYA 3GFQA 2O7SA 2R25B 3RIHA 4AJ9A 3Q6MA 2O7NA 2ZE6A 3H6HA 3NEYA 4QULA 1VYHA 2VH1A 3WYCA 1SIUA 1MAWA 4KN5A 1F1JA 1LPBB 4L78A 5EI5A 3WO0A 3ICQB 5TT0A 3NDRA 1RP1A 2PUAA 5ICEA 4IXNA 4HOYA 4GZ5A 1TF7A 3R7WB 2ZB2A 2QR3A 4HFFB 1RJDA 3A4YA 5AHKA 3OZAA 4XTCS 9MHTA 3C5CA 4E0BA 5IJ0B 4QDJA 1SUBA 2ZB7A 5EIAA 2BGUA 2WJ6A 1JQBA 3GWZA 5TR9A 5KUTA 1OQCA 1ONPA 4P83A 2E48A 4E6EA 4YAFA 3UBTA 3ELUA 1AJEA 1D7OA 1FNNA 3EIHA 3H18A 5HIJA 2WHPA 5IJXA 2CLDX 2HADA 1IZ0A 1STOA 2JZOA 5GV7A 3U19A 2K2QB 3QFTA 1SVSA 1XKTA 4FZ5A 4S1NA 5DYIA 1QYCA 5JAMA 2D06A 2FG5A 3N2NA 1ZN2A 4TWBA 3L1IA 3QFSA 3MB5A 2OCCC 2I3ZA 3N7TA 5IC5A 2I8BA 3E84A 4ESVA 2DVMA 5HUQA 1HKHA 1Z16A 2QL9A 3LZCA 5AKGA 2HCRA 1QIKA 2WIDA 3C15C 4L8VA 4RDXA 1FU8A 3SS9X 4I66A 2XUZA 3P9RA 1M6VA 3RC2A 3EOBI 4JTAB 1P74A 3IBCA 2X0JA 2H4JA 3L8ZA 3HFGA 1M2GA 2GXQA 1NVEA 2C8JA 3HRKA 4QYXA 5JMTA 4OJNA 2NSFA 3NYRA 4F86A 5LNK6 1BWSA 3IDOA 4QELA 3RHTA 1D1QA 5DWDA 4F5EA 3KVYA 3R09A 5CBPB 1W5BA 4Y2YA 1YR6A 5B3IA 1S0UA 2Z09A 4OQDA 4DILA 2HWXA 2B61A 3PITA 1NQTA 4ALKA 1E3WB 4N06A 1CW2B 2GEFA 2P3LA 1U3UA 2FMXA 3LIIA 3RS8A 4J0GA 1U9JA 2OAP1 1DE0A 3QOWA 3SYNA 1T8PA 3RIYA 3JAKB 2Z43A 1EJ2A 5AHWA 3K33A 2HA6A 3PRHA 1IHOA 4PR3A 1FTWA 1A3CA 1RYNA 1F51E 2RB5A 2Z56A 4HVLA 4YRSA 3M89A 4REQB 1KDZA 1M6YA 1GYPA 1I1NA 4LQ4A 2XB6A 3FDZA 4JI2B 4DR6B 5BOSB 1GL9B 2G17A 4MV5A 4EEXA 1P2SA 1TCAA 3SD7A 5AW7A 1AKQA 3ROGA 2PFSA 4X94A 4YCSA 4TYMA 1SD1A 2NX2A 4P4LA 1REQB 1O0BA 1NF2A 3I3SR 4FQ8A 2HFKA 5ALVA 1WZNA 2VHYA 3T3OA 2COUA 4Z54A 4TYNA 5LMNB 1Z9BA 4K9DA 4KWTA 2AI1A 4BB6A 4JUIA 5L0FA 3R8CA 4O4IB 1FMTA 5FBKA 4P33A 4PTYA 1NAHA 3FYUB 2RC5A 2BEJA 5LUBA 1ZVKA 3OQMA 4BO9A 3PTZA 3AYZB 2HIAA 3HNIA 4CTKA 4X3OA 4F2PA 1NU7D 5HWSA 5L3ZA 5LIPA 4AMBA 4C6RA 2WU4A 4NEHB 2HCTA 2PNJA 2GN8A 4M21A 3B1ZA 1OXBA 3R7AA 3T1TA 3CU5A 3JZFA 3KQQA 3AM3A 1GTSA 2HHCA 3U5ZB 1UOQA 1UWVA 1ZJ5A 4KYUA 2LTAA 1H1DA 1YACA 3IURA 3I2KA 4J0FA 4NH4A 4KXUA 2R4QA 1SUPA 4LF7B 4V3BA 1CX9B 1QV9A 4Y6OA 1FBTA 4D56A 4RDHA 1HE3A 4TTJA 5EQFA 5MN6A 1OKKA 1VL8A 5D01A 3Q7TA 4D9BA 4M9CA 4F1KA 6CHYA 5J1TB 1B6SA 4UBNA 4C1NA 1ZOOA 2EX1A 2GWRA 5C1OA 2I91A 4E21A 4EMTA 2BZGA 3POVA 1VKNA 4PYJA 2CBGA 5FAKA 4CT4B 1IC6A 4JI6B 4PGHA 3ONEA 1YKGA 2NTYC 1ZHFA 3DLCA 2AXPA 4G4IA 1W85B 3CZAA 3L18A 2JHFA 4TV9F 2NWQA 4E46A 1FRFS 5IXYA 3K70B 3HB7A 5KJFA 4GVLA 3ZHTA 2PG3A 4HO1X 2G5TA 2RJOA 3OZ7A 5U4QA 1HT1E 3PNOA 4X7MA 5DTMA 2PS9A 5C53B 1G3IA 4BB0A 4EWLA 1KPIA 3V2UA 3F6PA 5HJ2A 1WD7A 2D1YA 4F46A 4YJHB 5LMUB 3GCXA 4ZYXA 2Q3EA 2CHGA 1F2TB 3SC4A 2FZEA 3KOWA 3IAEA 4HX9A 2BWJA 3A9VA 1U98A 4EECA 1H6BA 4HD8A 2AUNA 1WKCA 1YA8A 4BJTA 3E8XA 3C6MA 4Z7JA 1WB5A 3KEGA 4MP6A 1SH7A 1E0SA 4FE7A 3VPSA 2BGTA 4PYNA 1QKIA 4C4TA 3RABA 4RNDB 5ABPA 1K98A 3BTOA 3E4CA 3E03A 1NZEA 1C3JA 3WMWA 1RZVA 5KO2A 1ZCAA 1CRQA 3G2QA 2GMWA 2PR7A 3IESA 4LMAA 3S68A 3T41A 3ZZ0A 4MDEA 2WR8A 3M1LA 3A6PC 2GK6A 1Y4UA 4YBZA 1OB5A 4DCOA 1JDUA 1FU7A 4IV8A 1R6DA 3MA0A 1L8OA 3L1MA 3ZDBA 1B6RA 1JE1A 3P1JA 2FMFA 2XVZA 3P5BA 2G83A 4NCKA 1U8FO 2ORED 1WDLA 1V2GA 3GROA 4NC3A 1KAMA 2H1WA 3IA7A 4M60A 1CUCA 3ENZA 4U9IS 5BMOA 2WW8A 4HEQA 3A27A 1GEGA 1XRJA 2E0IA 5I8WA 1Q0LA 4CM8B 2Y1OA 4BQPA 1RXWA 4DLAA 2F17A 2ZIGA 3BJEA 3N70A 2YJGA 3H83A 4L5IA 4KXYA 3REGA 3HADA 3MWDB 1X1DA 5EZYF 3P2YA 1O8BA 4UD2A 3VR2D 2F3UA 4FBLA 1CG6A 1RI1A 2WG2A 1E3LA 1CQZA 2XUDA 4I9NA 4M7OA 4O4IA 1SUAA 3VC3A 2VEDA 3VU8A 1JH9A 3A6JA 3IBTA 3IIMA 2REBA 5D3ZA 4ZT2A 4MV8A 1R9JA 1EESA 3PPVA 4OHPA 3KRTA 3QXHA 3G13A 5GM1A 2WJJA 1IIRA 1I3OA 1WXQA 5JC8A 2JI7A 3VR4D 1L5HA 1A2OA 2W6OA 2PKRA 1RKEB 1OLXA 3UMGA 5LQNA 3WLRA 4A2PA 2W45A 1IVYA 3HYNA 4KQ1A 1P0IA 1T1GA 3UOAB 4RJKA 4HLQB 4ZI3A 2WZDA 1SOMA 4WKNA 1PR0A 1Q1BA 1ISFA 1RWOA 2HDNB 3D3WB 3V2IA 2Z9BA 3ME5A 1A2QA 4YALA 2G04A 5K8JB 3MBOA 4JB8A 2NU9B 1ZMTA 4EUNA 1U63A 5BMVF 2DETA 5THKA 4F2HA 1FC0A 3AU9A 2GERA 1L7NA 3FYSA 3GXOA 3LT5A 4ULWA 4ZO6A 2NT4A 5EXDA 5DNCA 3IO3A 1YZKA 4JJEA 5FWAA 4XPXA 3EUFA 4HV4A 3KH2A 1Z5UA 2ZXFA 3EZ2A 4RWZA 2QM3A 4HTFA 3W04A 1ODJA 2F9LA 4F3KA 2YEVA 1F8XA 3B0VC 1X1QA 2DH6A 4UBOA 4LV6A 2EKDA 4PBTA 2GZAA 3KL4A 1HDRA 1A9ZA 1C5KA 1LK7A 3G79A 3NIGB 3PRKE 4LV5B 3RO7A 3VVCA 1MQ8B 4DWOA 1DC7A 4TKMA 1H4SA 2R48A 2WTBA 2CXUA 1H8EA 2NXNA 3OP1A 4FOPA 4QM6A 5AJXA 1KARA 4PLYA 2VJAA 3JQGA 4BE4A 2KBEA 2Y27A 1Z5ZA 2BFBA 4O4HA 4OHOA 2H51A 2WG0A 3QXGA 3WGLA 4Q02A 1LNZA 4BEMJ 3SYRA 3ZOZA 1VPVA 4LY3A 4WK6A 3TF5A 4DABA 5JNLA 4RM2A 3FMSA 1NWCA 4MS4B 1Z0JA 2Z8YA 4DA7A 3RT7A 3QI2A 2XQFA 1JN0A 1P33A 2YMQA 1TVMA 3ZLUA 2G1UA 4XQ9A 3ADCA 1KQFA 1T8YA 2I2FA 4HDKA 3QWIA 2R7UA 4DCCA 3NGXA 4P7BA 2L6GA 2OV3A 3TW0A 1NSYA 4B3HA 4C78A 4KGZA 2R65A 1ZU4A 3C8GA 2QW8A 1O95C 1GL7A 3HRHA 4JT8A 3UUGA 3ZXYA 2GZRA 2PXXA 1T9AA 3MERA 3UAZA 3TEMA 4TTAA 4JL5A 4H08A 2A92A 1XI2A 4MUHA 4TT8A 4OD0A 5CIVA 2OO3A 2ES4A 3AMVA 3I3OA 1NFOA 1BQ3A 1Q7BA 3B70A 2GYUA 2FFAA 4P3XA 3IPLA 4Z9FA 5EIBD 3VR0A 3X2EA 3K1HA 5EE5B 5B5SA 1LI4A 1PNVA 3AOEC 3WDMA 2OHVA 3WL8A 1OXBB 2B82A 2X3YA 4QOHA 2ZUUA 4WFKA 4H0FA 4MZXA 1A0OA 2GZSA 1ZRNA 1C8BA 3RARA 2LIGA 4YRFA 1E2MA 5ELLA 5AVZA 2OLJA 4OQ4A 3AZOA 4GMDA 4Y2HA 2QTCA 1C30A 3I83A 3QKUA 3RNLA 4CKWB 2I2CA 2Y1EA 2EJCA 2JIMA 2C4MA 3OUUA 3IMFA 1HO3A 1I2MA 3A2MA 4TKUB 5H02A 2CFSA 3TE7A 3VOBA 5BRAA 1E92A 1ZKMA 2VUHB 1C9JA 3KNZA 3PI7A 2Z1MA 4KYVA 4TSFD 1OFHA 3UKOA 2YXPX 3ZS8A 3MPOA 4D9JA 3DP7A 4QXAA 3PGJA 3T1VA 3B1WA 3ZE1B 4AZSA 1ZX1A 4PNZA 2CV1A 5C5IA 4L51A 3A10A 2C1ZA 2HJMA 2XLOA 4MCHA 3W1EA 1Q1ZA 1WU8A 3GH3A 5CD9A 2GM9A 5FFMA 2WKSA 1KJIA 3BZUA 4B09A 5JECA 2F8MA 1ZD9A 2ZBFA 3WNCA 2WUDA 3QV1A 2CLOB 4D4JA 4I5IA 2XUOA 5BWBA 3QX8A 2Y66A 2REXB 4L9RA 5BOSA 3ZWCA 1XEXA 2CMDA 2QD1A 3ROTA 3ZHQA 2HSDA 2QYSA 3GH1A 3QLUA 2P40A 1N25A 3GCWA 2X51A 2GTHA 4BP9A 2QG9A 3C6QA 4FWBA 1SU4A 5B58C 2Z3VA 5CA0F 4MUIA 1E0DA 2FX5A 4EMSA 1PTKA 1QGYA 3LBNA 5FDFA 3DE1X 3M4NA 4PQGA 4UZSA 3IR7A 1H4VB 1UJ4A 2GF2A 1HF3A 3AEKB 3GHYA 4KACA 4RIGA 2AZDA 3GBVA 4ZVNA 1Q0KA 1OFGA 1Z38A 1V2HE 1C80A 3MHTA 2J1LA 3W9SA 3WK4A 1JWLA 1RI2A 2P3SA 4P2BA 4RHCA 1YDMA 5SY4A 3ZG6A 5FP0A 4BZPA 2QW1A 3RNOA 1G63A 5IAKA 3IE1A 1FP4B 3IP7A 3NWPA 2CD7A 4IHJB 5JATA 1Z5OA 4YJGA 3JRXA 3B20A 3ZLTA 1E5LA 3KOOA 5E4JA 2NSLA 4LOKA 5L6MB 4RSRA 1I51A 1NJ5A 1U8ZA 2Q1TA 5IBQA 2QQEA 1UMDA 4TWAA 2OXEA 2GBIA 1V25A 3AT1A 1RQXA 3FFTA 4JP2A 2FJPA 4X44A 4HQLA 1Q2XA 3R7FA 2LFDA 4KX3A 2KGOA 2IDMA 1BX1A 2B4QA 1UJ5A 2IYNA 2KS6A 1G5TA 2PMEA 1WDKA 4HRYA 1NMZA 5FEMA 1CK4A 1SKYB 1Z34A 2YZGA 3CNQS 5KSPA 1YS6A 1GOTA 1V43A 2X41A 3B1XA 3CG0A 5COGA 4FOSA 4LK3A 4RMJA 1X7YB 2ZRJA 1N2CA 2Q7RA 3OF2A 4Y6RA 1WLYA 4RSMA 2QTFA 4K9SA 1C9NA 3VR5A 5B1BC 1IBLB 3PYLA 1NVVQ 4E12A 1U1FA 3UJ7A 4ZHQB 1IHYA 1W1UA 1XMXA 2W2QA 3PNVA 4IL5A 5EHNA 3UJ6A 1VA5A 4P53A 4OGGA 1EZZA 2R6R1 2WE8A 3D8BA 5C8ZA 4H4DA 3WISA 1HQDA 4RPJA 4S05A 4MDFA 4P1ZA 3KE9A 3QPUA 1KI3A 2J31A 3V32A 3A4LA 1D7AA 5BN5B 1ENPA 1EBUA 5A3RA 3PHHA 1MENA 4YASA 3W2VA 4BNNA 4URUR 3V4RA 2CDQA 1C1DA 2B36A 2JAOA 2IY9A 3AKCA 4B3JA 3KVVA 1TUIA 3WGUA 1FUIA 1G18A 4HFNA 3CNLA 4PBSA 2ZJZA 5LXTF 1A9OA 2HV8A 1QRUA 4LA4A 1Q0RA 1VL6A 2Z08A 1QG4A 4RKRA 5BYJA 3WGVA 4CUJA 4F5ZA 1NTOA 1WDWB 1YTUA 2Q50A 2WSSA 3NRHA 1IXRC 1OY1A 2RBGA 5IJAA 1OBOA 4YAIA 4OL0A 4WW0A 2Z2JA 3X0DA 1GR0A 1G4US 3V5ZA 1KBQA 2ASVA 2FMIA 3OZFA 4UVGA 5I47A 3TUZC 5EIOA 3CLUD 1C1HA 3W8RA 4BVLA 1CNFA 4C5BA 4NFHA 4Y30A 3MJCA 4NU5A 2X7XA 2O54A 3I5QA 2F48A 2JGJA 3RAPR 1JPVA 2C54A 5AK4A 1C8KA 1UDXA 5KOJB 5F1PA 3H5RA 3IUEA 3NJRA 3STVA 2RC6A 3BIXA 4WNAB 3VZQA 5KOIA 4OAOA 2L81A 3PHJA 5HA5A 1UDWA 5LQDA 3RS0A 3W05A 2BJHA 3ONFA 1Y37A 4Y3UA 5EERA 3UKJA 3ZVNA 2OBXA 3HY3A 4BNVA 3NT5A 5DYGA 3UMYA 3D2LA 3ONNA 3OIFA 3D0RA 1C30B 1CUHA 3AP2A 4EHKA 1WOLA 2IYWA 1OAKA 4UNPA 5J2TF 3ESZA 5K1ZA 3EASA 3VVMA 1OXSC 1HK7A 2YJ6A 2SNIE 2UAGA 3BB4A 2XNCA 4HLUC 5CT4A 1T1EA 4JKVA 3JZAA 1YS7A 5FYDA 4ER7A 1GCOA 2L0XA 2O0KA 5KHAA 1YCGA 2BFFA 2ZT8A 4B6GA 1QANA 5ITSA 5KREA 3CLSC 4KMMA 2DYRC 3LMKA 1QFSA 1QVXA 1WNFA 5CFZA 1A9YA 1RI5A 1Z13A 3JQRA 4ZI7B 1M74A 1K5HA 4W7IA 2UZIR 1MH9A 3KFVA 5M04A 4ZVUA 4QPDA 5BYBA 3AFNA 3SHTA 4MVJP 4ZCPA 4BVAA 4DMCA 3QWBA 1ITZA 2LSEA 1WCIB 4A6PA 1I2DA 4LVCA 2OD9A 3AB8A 1XQYA 1YDEA 2CLKB 2GI4A 3PF8A 3L0BA 4GGPA 2P9HA 2ZBPA 3SJAA 4D3FA 3AONB 2XRMA 4IR7A 4UUNA 3WBFA 2PL9A 4ZHSA 5ES4B 5K51A 4QDLA 1YA9A 1QR6A 2BKLA 2FX3A 4Z4QA 3DDNA 3DC7A 4M0LA 2IY7A 3TW8B 2F1RA 5JXGA 1R7RA 1QFMA 4P0TA 4JJ7A 2WWFA 3KR0A 2A9KA 4I2VA 4EZIA 2HLHA 3U44A 4D92A 1EWTA 2Q4RA 1BN7A 4AS1A 4XFDA 4N9QA 2YZ7A 5GZ6A 2W42A 3EMKA 4JKIA 2O1WA 1LRKA 4J1NA 1A96A 1GO2A 2W8ZA 3HXPA 1JHDA 3YASA 3C8MA 5KYWA 4BAUA 1PEYA 4AICA 3A4MA 1QRSA 2EPOA 3KSAC 4PSCA 4TS9A 3B3JA 3H2UA 5IN5A 3GQVA 2P4HX 2DUWA 2XUPA 3AINA 3HCFA 1VIAA 1E4YA 3BDIA 3N2LA 3T3EA 1G5RA 3RT1A 1CJSA 2O4CA 3BZWA 4E0IA 2G76A 5BQOA 3AR7A 5IDQA 2Q2QA 5AK6A 4YUWA 2H52A 2B9EA 3H5TA 2JLRA 1KEPA 1ZK0A 3R1IA 5F64A 4AU1A 1O97C 4QGBA 4RHXA 4CE6A 3DHEA 1PZNA 3HVHA 2Z5FA 1E4VA 1OHHA 4I19A 4P80A 3SYLA 5INTA 1DB3A 1UFOA 2TS1A 3ZWOA 4L5CA 2VP9A 4FFRA 2PZLA 3E9VA 2H54A 3JQ8A 5SYMA 4I1RA 4RDAA 4Q01A 1I4DD 1U81A 2J48A 2QWXA 5EUMA 1MF7A 5T8KA 2HHHB 4EY8A 1SUCA 3AP1A 4PYIA 2VDRB 3BYZA 1JNXX 1U4OA 2JGRA 2X9NA 4NNPA 4FNOA 4OYYA 3RUDA 4XFKA 2E6UX 1JFSA 2EXXA 1BE0A 3EMBA 1L5GB 4KO1S 1G8AA 2P2LA 5F9FA 2Q0QA 4AL4A 3DZJA 2ISCA 5ALJA 1Q16A 1P6XA 4IMPA 4GT1A 5F9HA 4I5EA 4OB8A 3MJSA 5LD2C 3FHOA 3KSZO 3GIDA 4MVRA 2YJNA 4CCWA 1T1IA 1MXFA 4Y1EA 5ALOA 3NBYC 1Z6ZA 4DEYA 3TRJA 7ADHA 2XE8A 2PUJA 3G8CA 1ZW2A 5EKXA 3K6BA 3P7MA 3OWOA 1X1BA 3SKYA 1MQ9A 1Y1SA 1Z35A 5C7YA 5KYYB 4R83A 2DUJA 1JQJC 1QVRA 4Q9HA 2A9QA 1PTJC 4TL7A 5E6UB 1XD2A 1ODTC 1JEYA 1QE0A 2JW5A 4LHVA 1B3BA 3EODA 1FMVA 4HZUA 1TF2A 1YJXA 5CK5A 4KE6A 1I7NA 4FHFA 2WJHA 5B30A 2FFQA 5AJTA 3SXJA 1Y1RA 1GGFA 1T3HA 1KY2A 2J9XB 1AZLA 2YXDA 4F2GA 3VQTA 2X14A 4RY9A 4Y98A 1W0JD 3PQ6A 2JFHA 4GZ6A 3E58A 3TW6A 3QUQA 1PFWA 4BGIA 4D80A 2UUOA 3LC0A 1GAXA 1QO9A 1WSBA 2CJWA 3N0WA 1QGDA 3DKAA 4MYTA 4I5DA 2C07A 1GN9A 4CQMA 3M4ZA 4QUBA 4LXYA 2PDAA 2WMDA 3OPMA 4I55A 2VCYA 3I73A 3U0BA 4DR3B 3MWLA 3DG9A 4PO8A 4Q1EA 4PXSA 1GKYA 3I8SA 2IXOA 4U3JB 4CM6A 3OQOA 3WGQA 1RFGE 4Y6SA 4YK7A 4WFJA 3ZWDA 2VZ8A 4XX1A 2IZ1A 3GQBB 2HA2A 3DP9A 1TX4B 2I99A 2PAFA 3MS2A 1Z33A 5C0OE 2ZZMA 1V9CA 4MMYB 2ECQA 3AILA 4Z0TA 4ZLDA 1VYKA 1YOBA 2GRAA 2YFKA 3JYYA 1V45E 4WA8A 5DOZA 5LZ8A 3TIVA 5L9AA 3F6EX 1K86A 2D0OB 4DSUA 1KO4A 3S29A 5EPEA 3NHMA 4A10A 1X7GA 1RYBA 2AUTA 5AC4A 2GAFA 3E6AA 3FKJA 3ICEA 1CY1A 2V7QA 3N0VA 1SZIA 3H9EO 2E49A 2IDKA 1XDGA 2J9VA 2VAMA 2A1UA 1VJGA 1J7KA 2KLBA 3SX2A 4BO6A 5IH7A 3WGTA 3I62A 1JHRA 1CZLA 5KX5B 1DBIA 1IEWA 2A88A 3FZEA 4GX1A 1K05A 5BV8A 4GL2A 3VNUA 1BVHA 3AM4A 1HMYA 2H4HA 1FYDA 4XWOA 2QJFA 2HT6A 4ALMA 2DWCA 1QO0A 4U7WA 3ABSB 5EJEA 1BWQA 2DSTA 1CZOA 1NYQA 4CDGA 4IV5A 3PEVA 2AX4A 3O31A 4BLUA 1BO6A 1WB6A 4NH0A 2BF4A 2W4QA 1O5IA 1IL0A 1WUYA 4CEJB 4LDRA 3L05A 4RGQA 2GVZC 2P6RA 4MYDA 2ZE5A 5TDHA 8LDHA 4AN0A 3TK0A 2O2YA 5KSZA 2IS2A 2ODQA 4PNPA 3CAXA 2VWQA 1JMKC 2E4VA 4PCVA 5I4CA 3I4UA 1MX3A 1Y3IA 2W6JD 3JQAD 5C7LO 3NEAA 4R71A 1P80A 2EKQA 5KWEA 1K3FA 3GRVA 1EK2A 5TJHA 1U1CA 1WOMA 2C9ZA 3K9BA 4EKIA 5K0SA 1RAAA 1QF6A 2PSDA 1XTIA 2HEGA 2XZDA 4KAJA 3B6EA 1JG3A 1H4TA 1U6IA 3P19A 1CJUC 3AFMA 4BWVA 1CS4C 3GFTA 2IYZA 2R6GA 1ECPA 3A6FA 3G7UA 4LRXA 3UT6A 2JFVA 2VATA 3FOBA 4KGDA 4WLNA 3EDMA 1FK8A 5GADl 1WKVA 4ECAA 1A9PA 4LOIA 4YRCA 1WEKA 4BGUA 5BQFA 2OWDA 1A5ZA 2O7QA 2QQFA 1X7ZA 1HY5A 4BFTA 5C8DA 1QH1A 4F5DA 4K86A 3MIIA 2WVNA 1PQ4A 2EF1A 5ICFA 2C4HA 3RKUA 1JDJA 2IP1A 2P91A 3KX2A 1BX3A 4G7OF 1RJEA 3M34A 4PC2A 3QXXA 4YVFA 3AF6A 1QGUA 4F06A 3M49A 2EEPA 3QP9A 4LVUA 5IFLA 1ZS9A 1OI4A 3MINA 3KSRA 1ETHA 2BEWB 4ULVA 1PVVA 4CIVA 4LFBB 1N1MA 3S2IA 3SHOA 1XEWX 4CGZA 4OL9A 3L8FA 1VBMA 4FGLA 5BUSA 1G55A 4MR9B 3FFBA 4C06A 2X8WA 2C8KA 1ZCBA 4PGMA 1BDJB 5AXAA 2WPDA 2VRWA 1E69A 3F5MA 4MB6A 1U6JA 2OORC 4UHFA 3LPMA 1U2DA 1ORRA 5L0GA 3ZY5A 3PFKA 5DF1A 2JIQA 3T5CA 4RKEA 3K70C 3U3KA 3QVZA 2GPBA 4CEHA 3MYFA 2NZ8A 1B42A 1DAPA 1QBGA 2H8AA 3DHVA 4IFTA 4UMEA 5HJEA 3B52X 2XM4A 3OWXA 1HDYA 1YUNA 4PIVA 4WK0B 1A9RA 3E5NA 5F5FA 2QP4A 3B7GA 3PHGA 5DN6A 1UXJA 4KFCA 3BS4A 4ZXPA 3SY8A 1U0TA 4WJLA 3L77A 2PGLA 1LTQA 4ND7A 3LDAA 4EOGA 3EULA 4WK2B 4U5CE 2GEVA 1Z12A 1WXIA 3CG4A 1DC6A 1XYGA 2VF8A 3LAYA 4UHJA 5JLAA 1IBSA 4MHOA 4KO2S 3TZKA 2FPOA 2ZAMA 1FFHA 3TULA 2WYHA 4X8LA 5EA2A 4ZZ2A 3QNMA 3SE7A 1YKFA 3TAXA 2JB9A 3TOVA 2XYQA 4D44A 4B33A 4Q4JB 3LCVB 3QEMB 2ZIWB 3U7JA 3VH4A 4EMBA 3RWBA 4BFSA 3Q3VA 1H23A 1QXSA 5DW3A 3DUFA 2DPXA 3A26A 3Q2KA 1NW8A 3TTWA 3CC8A 3N86A 1MFZA 3KD3A 4X45A 4XGKA 2F4VB 4IG9A 2EYQA 3FUVA 3WP0A 2GPAA 1M1ZA 4IQGA 2Q2NA 4U9UA 3S2UA 1GTVA 3SQLA 1T9DA 2JCVA 1UJ6A 4PEVA 3TGPA 2WD9A 4W8KA 1MHPA 2MIIA 4OIFA 4MICA 2JEOA 2WNSA 4YRPA 5TLSA 1TTQB 3FCAA 3WNVA 1V8OA 1JRLA 3LBHA 3CUSA 4W1QA 1NQ5A 1DX4A 1OR8A 3ZWIA 1I1OA 1CVRA 2IVZA 2R4UA 3ETHA 3F74A 2GPSA 4MQEB 1MBZA 1LE2A 5BORA 1M6WA 3JQAA 4ZEXA 1U0GA 3OPVA 1UT6A 4ITRC 4BKPA 1QP0A 5FHQA 2AD5A 4QNNA 3WMEA 4PR9A 4Z0HO 4HUTA 3PUIA 1LUAA 4WBNB 2ZATA 4DLWA 3FR7A 3H19A 1WKBA 5HM6A 1TVKA 1KMIY 5J4HA 3BWBA 2J3IA 1MA0A 2P5UA 4BVHA 5JRDS 1K04A 1WCIA 4FDTA 3QITA 1PJZA 1SVLA 4QBIA 1CR1A 4ZOLF 2AOTB 4V0MA 2CYDA 5AVOA 1YDHA 2C94A 4DW8A 1TVCA 3D2CA 3NBFA 3R5JA 1KQPA 3AR8A 4YRRA 1UBEA 2G40A 4MYCA 2VWHA 1LX7A 1A8UA 1M10A 1GNVA 1JR4A 3QKSA 2REQA 3OX4A 2ECKA 4IO0A 4KDFA 3BJIC 3DL7A 4QXRA 2R8XA 2QRQA 3FPJA 4M0MA 2J5BA 3TINA 2ZUCA 3C3YA 4R8KA 1EDDA 9ABPA 5KJ1A 1AXEA 1V41E 3VAZA 1GL6A 3HKCB 4C21A 2XOKA 4C3EA 3VYVA 4LAFA 4H6PA 4P0PB 1AGRA 4WSOA 4Z3KA 4RESA 4GMFA 1OILA 3EA5A 4O3FA 1ECJA 1G17A 3TSYA 1DEHA 5CW2A 4B4WA 4KN8A 3R6DA 1ZGBA 4RFVA 4QQ8A 3DLPX 1GGEA 4ZOAA 4PAWA 3DDUA 4ZU6X 3ZSUA 2WZLA 1N2EA 1W9MA 2DYKA 2MWQA 3TQFA 1Z7EA 5TMBA 4QUGA 5BSRA 4FX2A 1YE3A 1Y4ZA 3N2IA 4YN3A 3WWOA 1WXFA 4Q19A 1WRBA 3G2IA 4UTOA 4L5JA 2X5NA 3LKZA 4QDKA 1GZSA 2BHLA 1YDFA 1LK0A 2JD2A 1Y5RA 2XKJE 4U9HS 2C0QA 2OM2A 1UMBA 3NIWA 5FL7D 2KYHA 3ICVA 4QUJA 5FUQA 2TRSB 1SF8A 3VR5H 4C4OA 5AOAA 4BQFA 4HGQA 3P2KA 1EP1B 4U5XA 5JFGA 2PZJA 4KBLA 3TSWA 4EA7A 1DAEA 2G5GX 4G23A 1GA6A 2AG6A 3QBDA 2ZYAA 3N05A 2HA3A 5JNRA 3LTNC 2AFHB 4FJ0A 3AHIA 3N0XA 4FWTA 1T4BA 4RK0A 1QVAA 1NQUA 4N3GA 1VE5A 1BEZA 4B6QA 3JSAA 1H6DA 1JPJA 2IXTA 3KYDB 2EJTA 3C7DB 3KHKA 4BX8A 5BWLA 3GEIA 2EQAA 3AJ9A 3TNYA 1IY9A 1SXJD 3I9V1 4O2RA 5K8IA 3Q8XB 4HWOA 1DX6A 1HDCA 4IILA 5F51A 3KPHA 3CLRC 4BV2A 4DC1A 3AG2C 5I7EA 3O4IA 4ND3A 1PLKA 2VNSA 3EG5A 1MPTA 1SZDA 3B6KA 2ZYIA 1ZGCA 5F78A 1E2FA 1Y3BE 1NJ2A 2EHDA 3TZ6A 5C3MA 1JOGA 1K7CA 1XTUA 2GF9A 3QJGA 4P81A 4P5DA 5G4KA 1JF8A 2NO0A 2NVUB 2C3MA 4H54A 2DFLA 4ZP1A 3S5JA 2OEVA 3RR2A 1IBKB 4IJKA 1MTZA 4PC1A 3ZZUA 3AF2A 2C3OA 1PFKA 3BMNA 2OYCA 5IKMA 1CPQA 2FPSA 2VXCA 4JP8A 1RLMA 2I8CA 3IX7A 3F0TA 4D45A 4EMUA 2XB2A 3SS7X 5AW3A 5T41A 1YOVA 1KZ6A 1E7SA 2O2IA 2XNDA 5JDIA 4CMEA 2QD2A 5MDHA 5K2OA 4ZVVA 4KODA 1KYIA 1QJ4A 1KYYA 1VIYA 2PSHA 2PRZA 3FWYA 3GW8A 1QRRA 3IS3A 1OYYA 1E4EB 1HDOA 1ZWLA 3AGQA 3PUZA 3JQ8B 1N7HA 4JUDX 4NE7A 5EWJB 3WTBA 4O5AA 4E7SA 5E4YA 4PPYA 2CNNA 5KVVA 4RZXA 2Q5OA 3T5TA 3OTIA 1NBBA 4J49A 3DDOA 2Y93A 5B4VA 3PUYA 1YZVA 4IVNA 2FX2A 5A3QA 4KGXA 2F43B 3TW4A 3MBGA 1WF6A 2QJWA 2BFCB 3CKMA 5ALDA 1G64A 2IEBA 1KA9H 5CR9A 4DIDA 3T0IA 1NDHA 4CR8A 1GT91 3D3KA 3I9MA 4LQCA 1ZZEA 2QZ4A 3JS5A 4L76A 2DFDA 3W6PA 4ZICA 1WQ3A 3RG2A 2BEUB 1IB0A 1PAUA 2W71A 1YA7O 2ZSFA 4RW0A 1EG2A 1H1LA 2TMGA 3QMPA 4INOA 4G01B 4XQEA 1E1RA 3QNWA 1DP4A 1LPNA 3ZD7A 2LW7A 5JSFA 3QBVA 3U0VA 3UYKA 4F97A 3D5QA 1ZI9A 5BN3B 3DAGA 3GM2A 5TPZD 1WSDA 2RGNA 4Y8VA 3W5HA 2C5AA 3IHKA 3KSDO 2JFFA 4EHNA 4RIHA 3DC2A 3IP5A 1ZW3A 4W7SA 3G0HA 4F21A 2ZRHA 3SXZA 4PS1A 1SU6A 1NMQA 4DF3A 1W4AA 2JF0A 4WUTA 3SIXA 3U5TA 2AYZA 4J3NA 4DLBA 1GLVA 1AURA 3II6X 2FWMX 3O7WA 4JGBA 4W7HA 3KAQA 2WQZA 3PJFA 4D0NA 4RK7A 2X4IA 3AEUB 4BEJA 1FRNA 4ZKEA 4EL5A 5KQRA 5GOTA 4V1CI 5MN4A 3PNQA 5A9SA 2J9FA 2XMZA 1WXWA 2CMFA 3JQ7B 4H0NA 3A3PA 3P9ZA 4OK3A 5FOVA 1X3LA 4FONA 1QH8A 1WXHA 2ZUVA 2O19A 2JJMA 3EVAA 3P2IA 4OLAA 2YJ5A 2BBTA 2XUGA 5FTNA 4E1VA 4IRXA 5MN5A 3BORA 5GAJA 1XROA 4PZLA 2WIJA 3W34A 1HDXA 1UKYA 4CSAC 3ZHCA 4CKZA 2NOAA 4M98A 1S6YA 4BX9A 2P6UA 1VCOA 3G0DA 4DRZA 5BP7A 2R7KA 3MJFA 1UXKA 1IRXA 1OI3A 1C7RA 1Q50A 4ID3A 5AM4A 2VBIA 1UT8A 2BI7A 5CBPA 1X92A 3G0CA 3M9LA 4LISA 1E9DA 2E4XA 3JQBC 2CB9A 2XT6A 5FB3A 3Q4GA 1MD9A 4MYHA 4DHEA 1IIBA 4HAOA 5EZSA 2VVTA 4G36A 3VPAA 4CMJA 1LM3B 1JDVA 1EFDN 2BM0A 2QT9A 3L0SA 1T29A 1TAHA 1VDZA 4N3AA 1HT3A 2HF7A 2FWRA 2M6SA 3H3XA 1U9CA 2QL6A 2WJAA 3N6XA 4ID9A 1XRSB 3A4IA 3AL0C 4JQOA 3OJ0A 2O14A 5AVVA 4GQIA 3UGPA 3ZV6A 5FTLA 2HDOA 2V4UA 1I10A 3KTFA 3MD0A 4ASUA 2F8LA 5I9IA 3O10A 4N5HX 2OLKA 3NATA 2HXGA 1WATA 1RKUA 4DADA 3BB1A 1E79A 2HZ8A 1NSTA 4H7PA 5B3KA 1MRZA 1A0BA 3UJBA 4TS3A 4A27A 4NV1A 5JAUA 2XGOA 4NY1A 4JLSA 1RJ9A 3EWIA 4EYGA 1AKVA 1T3SA 2XWPA 5DTIA 5ALUA 3G8DA 3DDZX 2DUNA 3NORA 5FPPA 2OCYC 2C7VA 1ZOIA 3T4PA 1WTCA 1UZAA 3HBFA 1PR4A 3OC0A 1OGYA 4KL8S 3U4AA 1AUXA 3KOXA 1BE6A 1Z8HA 3RB8A 3Q7SA 2P9JA 1DMSA 1DFIA 2VTBB 1TZMA 1XVIA 4DNFA 1G6Q1 4BZZA 3AJEA 5D6NA 5E7QA 1ZMXA 2YYYA 3PRYA 4JWTA 3HA7A 5DK4A 1G8FA 1MAVA 5DCLA 5AICA 1X74A 4DGQA 4EY4A 2ATIA 3WBBA 4G37A 4GC9A 2HC9A 1AGPA 2CK3D 2LBPA 4MITA 3E27A 2DR0A 3VDXA 3DGFC 3U16A 4MVJM 3NTXA 1JKJB 2DT5A 1Z8NA 2EF0A 4Q7CA 2RHBA 1ONOA 1Q19A 4BNYA 2OILA 3NS7A 4TYPA 1R37A 3MC1A 1EGHA 3JQ6A 4ZEOA 2B8TA 2VHCA 4Q4ZF 1K5DA 4RFSA 3VV3A 2VQEB 2IX3A 1NI4B 4U2BA 2ZI9A 3F46A 3OSUA 5COQA 1OVMA 1TW2A 2FW6A 3DD5A 3OQPA 2OXIA 1V7CA 2BKAA 1HZZC 2BGNA 4QOSA 1G8HA 1TQHA 2J4FA 3FNEA 4PRZA 1X1TA 1FMCA 3V8PA 1NXTA 3SU8A 2XDQB 3OI7A 4YLYA 4LZZA 3HXOA 4ZU3A 3K9NA 1R6VA 5DQTA 2A1UB 2BMDA 3OOEA 3GODA 3UNGC 3CRNA 3OOJA 3GEBA 3HLKA 4GMHA 4PZUA 5IKPA 1YL5A 1R4NA 3H9QA 3ISVA 5KNBA 1ADBA 1QDEA 5HK8A 1OASA 4JLWA 4B3DA 4AUEA 3QU4A 5ENZA 1JSXA 1ORSC 2FPUA 3G6KA 2MCFA 1WUHS 1OWLA 1NVGA 1GN8A 2FW1A 3AFIA 1ZH6A 1XPRA 1TM1E 3FI0A 4B0PA 5GV8A 2Q6TA 3LKBA 3LUKA 2UUBB 4KWCA 3DCYA 4D2IA 3ZX4A 3NUGA 2OHGA 1M9NA 1T6ZA 5DBFA 3RSLA 5A6VA 2ZPUA 2FLVA 3LSYA 3PCRB 5JS2A 1DS6A 3OE5A 5EXTA 1VJRA 1KDPA 3WGHA 1POXA 1QC5A 4XVQA 1HDGO 5I48A 3NOXA 5F73A 5EXXA 3W77A 2XWQA 4AKTA 3DYIA 2VDKB 2ZDQA 2Q46A 1HLDA 5F3RA 6PFKA 4A26A 1NLZA 4BEVA 1O58A 2R1VA 3LT2A 5H9VA 1IY8A 1JB9A 2XTJA 4KJXA 2K7FA 2XDAA 3DVSX 1DJMA 2A0XA 1G7TA 2IV2X 1YK0A 3VPGA 2QYTA 3F8SA 1GGHA 1XZDA 5TE9A 2AKAB 3IAFA 2DCUA 2FPGB 2I1WA 2I4MA 4KI0A 3QVWA 3TQRA 1UANA 2GK7A 3HKCA 5B1SA 2QE7A 1G3UA 4LIPD 4RS3A 1BD3A 3K2EA 3AVWA 2HFJA 2XTZA 4DIBA 1HW1A 2DHEA 4UPDA 2XMDA 2BD0A 3GVXA 4FEEA 1TGYA 3C1TA 4HGOA 1M8GA 3U4MA 5FT9A 4F92B 3C1AA 3VO1A 1F0YA 1N3LA 1P5JA 3VX3A 2LVBA 4MI1A 2QXTA 4A16A 4U8GA 5MGNA 3V8VA 4DANA 3FOPA 4GH5A 4WN9B 1Z7BA 2QGFA 4EB8A 1ZC3A 4BTVA 1MKYA 1P6UA 3RS4A 3ER6A 1ZK2A 4ZYZA 1BDMA 3UGJA 2PX4A 1EB8A 3ORHA 3RAJA 4B31A 2FP4A 3D7MA 4YJKA 2JI4A 1ZYRF 3W8HA 3GN1A 3O3CA 2RHHA 4PLVA 4RCVA 4ZAXA 3B5EA 4IX9A 2WWTA 3EFEA 5B3JA 3D4OA 3T34A 5HJ5A 5KQGA 1D04A 1DJOA 1US8A 3MAAC 4WD3A 4MRRA 4CDVA 1TYDE 1SHZA 1P1KA 1YRWA 1ESEA 2P4SA 1MQVA 4O4JA 2FUG6 4RTMA 5IS2A 2DERA 3EARA 1E2LA 1OXTA 3DBHB 3DWFA 1II8A 4MVZA 4XCQA 2Y2UA 3AHJA 1EM8B 4DC0A 4HSGA 4P4TA 1KGDA 4PC6A 4A8PA 4IWNA 1BJKA 4URWR 3JTLO 4FBGA 1U1IA 2XNJA 2E89A 1HT2E 1PR6A 1IY0A 1GY8A 2C9DA 1GYQA 1YO6A 3WLOA 4DHWA 4M9RA 2ID8A 1GAEO 1MB0A 2QAGC 3M5CA 3LPCA 4X95A 1AUQA 1WMAA 1XRNA 4JOCA 5ESXA 4XEFA 1CZHA 3SZRA 2X2FA 3ZNOA 1PW7A 3GPIA 2LWIA 3BMQA 4D46A 1U7PA 2OAEA 4PU0A 1T6QA 1YJCA 1KZ4A 1FDOA 4DYHA 1M6EX 3O8OB 1NXQA 3AF5A 4IUDS 4P08A 2HREA 2D13A 4XX0B 1OI7A 1E7MA 2I8LA 3REQA 3UXYA 4YQFA 3UH1A 1P17A 3TLEA 3RV4A 1HORA 4DJAA 5C4GB 4F3YA 3I4LA 3N07A 1NMEA 2YZSA 5JISA 1ACJA 1YQTA 2AOUB 4C0WA 3U44B 1T2EA 3SAJA 4NI5A 1MA3A 2HZ7A 2VNHA 2FFBA 2C2MA 4HUQB 2Z2YA 4KQXA 4MLZA 4XPZA 3DR5A 5B6JA 4RTNA 4NXMB 3K9HA 4YT8A 5F7XA 4AJPA 1Y42X 2NAPA 3GUZA 2H06A 3ELYA 1PL7A 3ZDFA 1E77A 3MTAA 1CP3A 2CDBA 4DJ9A 3OHPA 1DQZA 3OIYA 5FBQB 2VJDA 3N3BC 4G41A 3K0SA 1N2CB 2P2NA 2QU8A 1M0TA 1V1MA 4Z51A 1QP7A 1RRCA 2J3KA 3EG9B 1E98A 1CDZA 2B0JA 1I80A 3BSSA 3ID6C 5TRTA 1CT9A 5KSOA 3R8FA 3IBYA 1K08A 4IH4A 4DT1B 2WM8A 1JEAA 3G1WA 3LP5A 3ICPA 1TFKB 4C6SA 3NO4A 5IUKC 1RWQA 2NAFA 2GD2A 2XLCA 5K8VA 2VP5A 5H80A 3RC1A 3KS9A 2VH5R 1OLSB 1U1GA 3HN7A 3HI6A 2ZAIA 4RXMA 5EJ2A 4PZZA 3C6XA 4EUHA 2I2WA 4MW2A 1GTG1 2H4WA 3UWSA 3TLGB 2QBYB 3OFVA 2WIAA 4PG7A 1TMKA 5ERYA 4XWTA 1G21A 2QPAA 2H5LA 1GRNA 3DMGA 3FYUC 5FA6A 2HXSA 3IKVA 1PIWA 3ORSA 4K6FA 2HK7A 4UFNA 1R27A 2IPXA 3H8JA 4RGBA 5B58T 1J49A 1P0QA 3RS7A 4M49A 1H7IA 3S99A 1JIKA 4TM8A 2C2BA 3EDYA 3UAVA 2FF5A 3DNFA 3R44A 4DY4A 5KOJA 1XV5A 4JZAA 1W5SA 3IVGA 4IH1A 1G9XA 3O9MA 4HL6A 4K05A 2BMVA 4H1HA 5FQNA 4BMVA 2QLJA 2N75A 2RBKA 4J94A 4E07A 1VSVA 4PNEA 5LU9A 4ZAGA 3HU3A 1U0NA 4HAYA 2LQGA 2WFLA 1U5BB 1T6UA 1MMGA 1CVLA 3F3YA 3QWAA 1XMJA 1FXWA 5K9ZA 4HQKA 1VL0A 2ZJ7A 4YLGA 4CKBA 2EZ8A 2FE1A 4WI1A 3JVIA 4NAUA 5F2OA 4BGEA 2YFYA 4D3ZA 4J4TA 4KXQA 2F8SA 4UFOA 3KYIA 5G02A 2UYQA 3EDOA 4PLHA 3NDPA 3RTGA 1TYCA 4MQ4A 2C2YA 3PQ7A 1J20A 2EEZA 3U2LA 3OZDA 2NV6A 3LYLA 2WZCA 3FMVA 3UK6A 2IS6A 2C29D 4Q7MB 4W8PA 4FWIB 2HD4A 4D9NA 4ZJUA 4FOOA 2XPCA 3DMHA 3ORYA 4H1TA 3DZDA 3ML1A 4RVNA 5FPYA 3JATB 4IWBA 3F6YA 4OOEA 1EBFA 5G40A 2HX1A 4UZFA 3ZK7A 2ZZNA 2WD8A 3U7QB 3AEUA 1NVXQ 3IQIX 4FOTA 3A4NA 2I6UA 3IDZA 4QPNA 2GCEA 4HXFB 4FE4A 2ZI5A 2GO1A 5I7RA 2LV8A 4J75A 3EGWA 3CJTA 2J5QA 4NCBA 2GPTA 4PRKA 4MVOA 4YXWD 4C7OA 2A5DA 5KVQA 4B40A 1YFZA 4JEBA 3FLBA 2QT1A 3DAYA 4HFMA 4KE7A 3DOCA 4L2IA 4U6QA 4UNNA 1E9EA 5DHFA 3LWZA 2P1ZA 1CUUA 3EEQA 1P91A 3OH8A 4D4GA 2WZFA 2O07A 4G56A 4B3FX 2NV2B 2MWMA 3MBKA 3PQ3A 3RSHA 1WM1A 2AVNA 4BXOB 4JQZA 4XE5A 2GHRA 4FYMA 4PYKA 5FUBA 1T0PA 2WPNA 5IJ9B 1G8YA 4EHDA 3QSGA 1OB2A 2WILA 4UM8B 1QUFA 4F2WA 1G4WR 5HG0A 1M54A 2GFQA 3BD6A 3I2YX 1FSSA 1VJ0A 2QRVB 2NMVA 5DLEA 3H7IA 4IDHA 5I7SA 5JNSA 1XQ6A 2YXEA 2BUAA 2P4EA 2P9TA 4XRGA 4BNFA 2WUEA 1D1CA 1E2BA 2VSYA 2E4YA 1FRZA 2ZETA 3OEED 4BP8A 4O63O 5KTSA 3T15A 3G0IA 1YLMA 3L46A 4I1OA 3PUVA 3ZBQA 3GLRA 1OZ0A 3FGZA 1E6UA 2IRWA 3CRRA 3K1IA 1PKXA 1N92A 3IUQA 3CTPA 4TLBA 1KO8A 1DFHA 3QKIA 1HOXA 5EMJA 1N0VC 2V98A 1F9EA 1P1RA 2YH2A 3TLGA 2QBYA 3LY5A 2PKQO 2VYCA 3G02A 2IOYA 5JAHA 1W5EA 1V7ZA 1JMVA 3A1UA 2BF7A 1I7SB 3L8DA 3R3XA 1MORA 3UM9A 2Q99A 1YB7A