4KNWA

The crystal structure of human hdhd4 in complex with magnesium and the phosphate mimetic vanadate
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
239
structure length
239
Chain Sequence
SRVRAVFFDLDNTLIDTAGASRRGMLEVIKLLQSKYHYKEEAEIICDKVQVKLSKECFHPYNTCITDLRTSHWEEAIQETKGGAANRKLAEECYFLWKSTRLQHMTLAEDVKAMLTELRKEVRLLLLTNGDRQTQREKIEACACQSYFDAVVVGGEQREEKPAPSIFYYCCNLLGVQPGDCVMVGDTLETDIQGGLNAGLKATVWINKNGIVPLKSSPVPHYMVSSVLELPALLQSIDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Design, synthesis, functional and structural characterization of an inhibitor of N-acetylneuraminate-9-phosphate phosphatase: Observation of extensive dynamics in an enzyme/inhibitor complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords N-acylneuraminate-9-phosphatase
total genus 84
structure length 239
sequence length 239
chains with identical sequence B, C
ec nomenclature ec 3.1.3.29: N-acylneuraminate-9-phosphatase.
pdb deposition date 2013-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.710 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4knwA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4knwA01
4YCMA 2MU1A 3W5AA 1Z4KA 1YDFA 4UARA 2YJ6A 2FPWA 3ZU6A 3L8EA 1VJ5A 3A1DA 2GHQA 3ZVMA 5AI6A 4YCNA 3D6JA 1Z5UA 4NAVA 3NRJA 4BX3A 3WK7A 2RARA 2WHEA 3B8EA 1ZRMA 1J8DA 2NO5A 1U2TA 4DFDA 5E0OA 2HI0A 5AHXA 4O8CA 4XQ0A 2QLTA 2YMPA 1RDFA 5ALVA 2CFSA 1Z88A 3IJ5A 3W5CA 3AR4A 3WKBA 1YS9A 4BYGA 3L8FA 3ZTYA 1NRWA 1ZD2P 2FEAA 3HYCA 3PDWA 1U7PA 2B8JA 3AR5A 3QU7A 4FYPA 4MWOA 4OFZA 4B6JA 3QU5A 3NANA 3QYPA 3R9KA 1FEZA 4KYTA 3W5BA 1T5SA 1TJ3A 3AR7A 2OYCA 1NNLA 4AS3A 3IRUA 1WZCA 2ZBFA 1K1EA 4JDPA 3SKYA 1ZJJA 2C8LA 5AVXA 2JGAA 3OPXA 4OD0A 3S6JA 2YN4A 3I28A 2C9MA 4BEWA 2CFRA 1SU4A 2B30A 4Y2VA 5AVRA 4IG4A 3N28A 5IT0A 4CF3A 2B1QA 3NAMA 2YMQA 3F9RA 3SMVA 2HOQA 2YMMA 5AW8A 5ALJA 2CN1A 3MN1A 3SLRA 2PKEA 2WM8A 5IT4A 5ALNA 3OCVA 4XOUA 3QUTA 4AS2A 4F71A 3AR9A 2WF8A 4EX6A 2O2XA 1YMQA 2G09A 2W4MA 2QYHA 5ALKA 1S8OA 3DDHA 1RMQA 3UM9A 4UW9A 1VJRA 2RB5A 5ALIA 3U7GA 2AH5A 4HGOA 1L8OA 4H1WA 2W11A 1CR6A 1L6RA 3N5KA 4L57A 2ZG6A 2DQSA 4HGQA 3N1UA 3ET4A 1RLMA 3ZVLA 1RMTA 3VAYA 4FE3A 2R8XA 3L1UA 2I34A 4CE6A 5ALHA 2GO7A 2YJ5A 3ET5A 5AK3A 4PNHA 5AI9A 2Q5EA 2NO4A 3A3YA 3L7YA 4YCLA 3KD3A 3L0CA 2C8KA 1JUDA 4KNVA 1RMYA 3EF1A 2WF7A 1L7NA 2I6XA 4BNDA 1RQLA 3L8GA 5ALWA 1ZD5A 5AM2A 2BY4A 4L6CA 5ALRA 3GYGA 3AR2A 3KOOA 5ALSA 2EAUA 5ALOA 3FZQA 3E81A 1ZRNA 4Y2YA 1S2OA 2PR7A 3BWVA 4KN8A 4HAIA 3OCWA 4J2TA 5A3RA 4KX5A 3QUQA 4UM7A 1YV9A 3EWIA 2B82A 1L8LA 3W5DA 2JAOA 2GFHA 5AVYA 2CFTA 2R8YA 4EENA 4UMFA 2FUCA 2G06A 1RKVA 5AVSA 2HX1A 1ZS9A 3WKCA 2EATA 2EARA 2IOFA 1YJ5A 1RRCA 3OTQA 2P9JA 3FPBA 4EX7A 1AQ6A 5ALZA 2IYEA 1RPZA 4RESA 1Z4MA 3ZWKA 4YIKA 3FVVA 5ALGA 2FUEA 3L0BA 2ZXEA 2RBKA 2C88A 5AM5A 4ZEVA 2PQ0A 2ODAA 2IOHA 4UASA 2YFYA 4F72A 5AW0A 5ALLA 2O9JA 3MMZA 4HGNA 3U7HB 2WF9A 5AK4A 1Z4OA 2P27A 3I1YA 2I33A 4YGYA 4UMVA 2I7DA 1ZD4A 4UAUA 1WVIA 4EZEA 4Y2UA 1SWWA 5AW6A 4Y2TA 3WKEA 2OBBA 5ALPA 4UM5A 1L7MA 5AW1A 3A1CA 1Z4NA 4UMEA 1Z4PX 3DV9A 3NASA 4I9FA 5AI8A 2I54A 5T41A 1WPGA 3I6BA 2YMLA 2FPXA 3HLTA 5ALFA 2HO4A 5AKIA 5ALTA 5IS2A 2P11A 5AI5A 1TJ5A 1LVHA 2FDRA 2X4DA 3PGVA 3WGVA 2I55A 4G63A 5AW5A 5AM1A 2ZBGA 3U19A 4UU0A 1Z4JA 4ZEWA 4JB3A 1YNSA 2Q4RA 1QQ7A 1EK1A 3QXGA 1QQ6A 4I9GA 3R4CA 2JAWA 2ZBDA 2G0AA 3N07A 3SHQA 3UMCA 2GHTA 1Z5GA 2FPRA 2VKQA 3ESQA 3L8HA 3L1VA 2HDOA 3U26A 2AUTA 2JARA 4Y2PA 2R8ZA 1Z4QA 5AW3A 1T9ZA 3NIWA 2HSZA 3WK5A 1O08A 2HF2A 5AKEA 3K1ZA 2HEGA 2FPSA 5AKXA 4NWIA 1RC8A 3QU4A 2G08A 1L7PA 4UMDA 2YJ4A 3FPSA 3B9RA 5A3SA 1RKUA 3DAOA 5AIBA 1IWOA 5AKHA 1QH9A 5AK5A 5AVTA 5AW4A 5AKGA 5AI0A 1U2SA 3ESRA 3A1EA 3QUBA 2ZBEA 3ZUPA 3AR6A 2W43A 2BDEA 4Y2QA 4FFDA 3ZVNA 2Q4TA 3OCYA 3TLMA 3R09A 1SWVA 4CNQA 5AVZA 4CF5A 5ALEA 3E8MA 2FPUA 3WK6A 3L0YA 1Z4IA 1N8NA 4IFTA 4Y2RA 1X42A 3ED5A 1QQ5A 3U7EB 4HGRA 3CNHA 4YH1A 4NFLA 1RLOA 2IA5A 1QYIA 3EPRA 3WK4A 1EK2A 4CF4A 3SKXA 3NALA 1RQNA 4Y2JA 4UAVA 2G07A 2AGVA 5AVVA 3N8GA 1XP5A 4GIBA 5AKKA 3OCXA 2D2VA 2MSNA 3I76A 4HGPA 3RFUA 5AM3A 5AM4A 4KX3A 5AW7A 1L7OA 3KDPA 3ONNA 3NUQA 4Y2XA 2HHLA 3EF0A 4BNDB 4KNWA 3UMBA 4C4SA 3J7TA 3ZX5A 5AKJA 1ZD3A 5AKYA 5AESA 1XPJA 4C4RA 3IB6A 4ZEXA 3L5KA 5ALQA 1WR8A 3QGMA 3QNMA 1Q92A 2HF7A 1TJ4A 1KYTA 5AICA 4AP9A 5AM0A 3ZTWA 2ZOSA 2WFAA 1J97A 3E84A 4BBJA 3FM9A 4UATA 2G80A 3FGOA 2HCFA 5ALYA 2WF5A 3QX7A 3ZW7A 3MC1A 3AR3A 3M9LA 4QJBA 1RKQA 2YY6A 4RETA 5AK6A 5AKZA 4GXTA 5A3QA 5AIAA 2AMYA 5AW9A 4HYTA 1RLTA 3WKAA 5ALMA 2IOFK 3U13A 2YBDA 2BDUA 1U7OA 1VFPA 1XVIA 2B8EA 5AI4A 3UMGA 2OA0A 4OHFA 3PCTA 4MUMA 2YJ3A 4DCCA 4DW8A 2C4NA 4UU1A 1O03A 2R8EA 3SF0A 3ZX4A 1U02A 5ALXA 3SD7A 4YIHA 4EEKA 5AW2A 4DWOA 3M1YA 4BX2A 3ZWDA 1Q91A 5AVWA 1TA0A 2FI1A 3OCUA 2JAUA 3QU9A 4EELA 5AVUA 4J03A 2RAVA 2G1AA 3B9BA 4Y2SA 4BEVA 2GMWA 5AKLA 2B0CA 3BA6A 4L6AA 4BKMA 1F5SA 2NYVA 4OCZA 3E58A 3KC2A 1CQZA 1PW5A 3QU2A 4NV0A 3ZI4A 3QUCA 3P96A 4E88A 3MPOA 3KBBA 5ALUA 1LTQA 5ALDA 3RF6A 3CZ4A 5JJBA 4Y3UA 1Z4LA 3OCZA 3PGLA 4XPZA 1ZOLA 3WKDA 1T5TA 3WK8A 2B1RA 3DNPA 3KZXA 4XE5A 5FP0A 3WGUA 2OM6A 4BX0A 3QLEA 1Y8AA 2P69A 4G9BA 1N9KA 5AVQA 4C4TA 3U7FB 1NF2A 4NABA 3WK9A 1TE2A 2WF6A 3AR8A 4QQFA 1MH9A
chains in the Genus database with same CATH superfamily
5J4VA 2BMDA 4DM4A 4J0GA 3OZ7A 4DRYA 1JZQA 2R2AA 2ZKLA 3EC1A 3RK0A 2BC9A 1XZDA 3BAZA 5DS4A 2C2BA 5K45A 2FPWA 2Q6TA 1LI5A 1BYIA 3MIZA 1ETUA 3T7JA 3AUUA 1FDWA 2FMKA 5AI6A 1QIMA 4Z4QA 4KNYA 3H5WA 1RRKA 3C3JA 5MN4A 1JHRA 1N0WA 4OQZA 5GJWC 3DHEA 4TPKA 4JP5A 1W2WA 5FZTA 1HG1A 1V6CA 4KE8A 4XWGA 1E98A 1KIMA 3V4PB 4BVBA 3FCAA 2YZMA 3QP9A 3W1WA 2P8SA 4EKEA 4JL6A 4H17A 4WGFA 2CLKB 4DLLA 2EV9A 5F1YA 2RFLA 2WOJA 4N0DA 1KKMA 4C0WA 4Z4GA 1RE0A 5B3AA 2C7OA 2YV2A 2X19A 1RDFA 3CFYA 3WO0A 4QJ4A 1X1QA 3LNMB 3IJ5A 3BWCA 3GRKA 1BHO1 2C2WA 3TOMA 5E1BA 3W5CA 1QVZA 2PT5A 2LBPA 2ZRIA 3W5HA 3QXCA 4U2BA 4XYBA 3FWHA 3JQGB 3HYCA 4LYGA 3LQFA 3BSFA 4FLEA 5IM4F 1Q0GA 1H4QA 2QLLA 5ULLA 5C52B 4HCJA 2AQ8A 3JARB 2WB7A 1FYVA 3QW2A 4IXTA 4E22A 4LSWA 4TS3A 5ICGA 1EFHA 1OTHA 2BR4A 5EP4A 1T5BA 2JGLA 3HJHA 4PLVA 1DOAA 4WAUA 4AD8A 3MZ0A 5TF0A 1ZD8A 1QG2A 2PX3A 2GBPA 4A8HA 4YAUA 4MVCA 4Z0NA 1GV0A 4AUEA 1HH4A 1JQBA 1U28C 1E32A 1J90A 4BWGA 2CUZA 3T7SA 1D5CA 1ID8A 2E4ZA 4MINA 4X71A 2ZRPA 2YASA 2P30A 3CC8A 4HDMB 1FZTA 2CDQA 2Q5FA 1HFEL 4GZLA 3UH0A 4YRBA 3GCXA 2W2LA 1Q1ZA 4DC1A 1PZEA 4QQKA 3SAJA 1CPYA 3DMTA 3IBSA 3U3RA 2Y69C 3X2SA 5LXTA 5JJ5A 2H2AA 2FZVA 1SCQA 2R7SA 3LOQA 1NVFA 2H31A 2O5RA 3HDVA 4G5SA 4RQUA 3VR4A 4EWLA 3GFOA 1HZZC 1OA0A 2NXEA 1C8VB 2YMQA 3NBYC 3NAMA 2A6EF 2YMMA 4RLHA 5H5JA 2Q6IA 1D1PA 3NLLA 1YL6A 1UBUS 1XZMA 2EGGA 2RAFA 4AFNA 1DTEA 3BQ9A 3TKAA 4DDWA 1Y9DA 3GZ4A 1BE6A 4G0HA 1DAEA 1VYUA 4DJAA 5A4MS 5JZSA 5JCOA 2WF8A 4LNHA 4URXR 3L7KA 2AI3A 4YREA 2BFMA 3F8TA 4P7KA 4X1YB 3TEJA 3GRFA 3C62A 1KQOA 3BH0A 2VTVA 5TPWA 5EP1A 4CYMA 4N6HA 2H8GA 3OPYA 2Y6VA 5IAJA 4J0CA 3HXOA 2AH5A 2EIXA 3DZFA 5LQRA 3UK6A 4N9WA 2DUMA 3GFGA 4DDVA 1T1EA 5KNDA 1CDZA 2QQEA 2ZI7A 5I3CA 2Z5VA 4L4SA 4R71A 5HRUA 5FHRA 1N5OX 1NIPA 3OP1A 4MH0R 3AUJB 2NTNA 4TRNA 3ET4A 4ZHQB 3IRVA 1L3BA 1O9GA 1RLMA 1GZ5A 2AS0A 2X5NA 4F8EA 1BU5A 4O2RA 5IXYA 4FE3A 2HHJA 2Q2WA 3L01A 2HWYA 2I0FA 2V0CA 1QGAA 3CXUA 4S2UA 3UT5B 4PNEA 3D31A 2XXAA 1UJNA 4REMA 4RK6A 5LR6A 4DA8A 4DNOA 4EG6A 2YFHA 3MJEA 3Q40A 5KJEA 4E3WA 4L50A 4IXMA 4NBVA 3ENNA 2C4KA 2WDPA 2QD5A 2QLBA 1GVHA 4OU4A 4Q7KA 4D45A 1XXHB 1UP7A 4MZXA 3QPVA 4XYEA 1WZEA 4E5PA 2NUAB 2PUTA 3BE5A 3V34A 2Z3WA 1Y6GA 1IW7F 2G8LA 1X77A 4OQFA 2ILVA 3C7AA 5EMKA 4BE4A 1UXJA 5DI3B 5JOQA 2NVOA 3SEAA 4G1UC 2CL6X 4UNIA 5B36A 3E81A 4BLSA 5B30A 4XPXA 3WJ2A 3BD7A 2VG8A 4OJNA 1N34B 1BE8A 2PZFA 4N0QA 5CYOA 1SC1A 1RP1A 1CZRA 2AR0A 3LY8A 4BAUA 3OJCA 4LZLA 4Z7NB 4O1IA 3T52A 1LSOA 4TS1A 4BB0A 4RTSA 1UC9A 2X86A 4XRRA 4CIHA 4JBYA 2LIVA 3VDQA 2WBLC 1J7JA 5KREA 5JXJA 2ZTHA 3H8WA 2OBMA 3LQ4A 5E6SA 1Y1PA 3ZHOA 4YMUA 3OECA 3OMXA 1RKVA 2QE7D 1DEAA 2AUNA 5D3ZA 4G0WA 4G81A 3NBUA 1QR6A 3HNLA 3RE1A 2Z2YA 4MTFA 2A1UB 3KVYA 1IY0A 4FFRA 4GFDA 4KCGA 3PWKA 3TZHA 5KBYA 2QAGA 5SYAA 4ZT3A 3U3XA 1KR5A 2VJKA 3OTQA 4JIGA 3FSRA 4N0MA 3WQBA 3WV5A 2LSEA 3COZA 1FTSA 2V98A 4MVJF 1ZHWA 5L3VA 2FX2A 3REGA 1VLHA 1RPZA 2J3KA 1DRKA 2J31A 3PHF2 4KXNA 3A25A 4EZIA 4KTTE 2XZPA 3BMXA 1BH2A 3FVVA 4E0BA 1CU1A 4YJFB 1RXIA 4OB6A 4PWYA 5K0TA 3SYKA 1IM5A 3ZK9A 1C9MA 4R1SA 5JASA 1NFQA 5DMHA 1G6HA 1QO9A 2C7VA 3ORHA 3PFGA 3T9BA 3I53A 2YX1A 2YFYA 1X1BA 5D00A 1C1YA 4WCDA 5KTMA 1J0AA 3ZJVA 3AG6A 1LLDA 5BV8A 4UE2A 2DX7A 5CVDA 5D92A 5J63A 5KEIA 1XDGA 5EFZA 4DLUA 2IYNA 4MIEA 2RH4A 2GETA 3RPEA 2C04A 3QPAA 1GPKA 2I33A 3PCRB 2A5GA 2QRQA 5BURA 4KBFA 1UXKA 1BHQ1 4LRWA 4NZPA 2FW1A 4GGMX 1U8YA 2P3LA 1TYEB 4Y2UA 2JI7A 5AW6A 1V2HE 4EF6A 1ZHYA 2OCCC 3SXUB 2NAFA 1LS4A 1VJGA 3D64A 3NVDA 4BNFA 4PSVA 3K9FC 3GLFA 4EKGA 3SVLA 4IVNA 1IJFA 5FEMA 1KZGB 1D1QA 2PH5A 2EW1A 4B2PA 5JT1A 3DWFA 3G5MA 1SVKA 2BMWA 4IIBA 2EWWA 3MRTA 1P17A 3I6BA 4OM8A 5MN6A 3EDOA 4I9NA 4U5XA 1DHRA 4QX6A 5KYWB 4DSUA 4K9NA 4HMOA 1E1CA 4DQ0A 3FAPB 3F8SA 4O4LB 3JVEA 2BJHA 5DWVA 2P11A 3W4IA 4E5SA 3PNBA 2WZDA 1GFIA 5EPEA 4R16A 2REXB 1OX4B 2UZAA 3H2BA 2GBFA 3RW9A 4AY6A 1CJBA 3PGVA 3AVPA 1ORWA 3QLUC 4LDAA 4RS4A 4HX9A 4PX2A 1FJ2A 3HMQA 3I01A 3SDBA 1B2RA 2QTFA 1PJBA 4KXYA 1CR0A 4YDHB 5CXXA 1MT0A 1OX4A 5FOXA 1T2DA 1M9NA 3PBKA 4ZV9A 5BR4A 2AFIA 2B2XA 3I34X 1EFPA 3HCPA 4ZP1A 3WFIA 4EY6A 3IPLA 1LPAB 1K6XA 1HNZB 3UAXA 2FWBA 4BBPA 4J0FA 1ETHA 3ZU5A 1ZONA 1W87A 1Z6QA 4PZUA 3OZTA 4TGLA 2RMKA 2VH1A 3Q7IA 4ZQFA 4JROA 4KPUA 1BKSB 3FSGD 3FRIA 4NNJA 4HFFB 1MJNA 3ZJ4A 3KLNA 3VZPA 1PP4A 2EHJA 2X4LA 3S2UA 4TTAA 4YMGA 4RM2A 1IBCA 3G4XA 1JJIA 3HZOA 1BRTA 5F7JA 1JTEA 2HDOA 2J9YB 2QL9A 2JFQA 1E3QA 3AHJA 4I9UA 3PQ6A 4XTCS 3KEOA 2ZSKA 3PNLA 5HIJA 2PX8A 3HO8A 4LFBB 1KO8A 4GEHA 1ENYA 4XYMA 3ZC4A 5DASA 5SZJA 4TN5A 4B5KA 3E9VA 1COZA 1S3FA 4KQ6A 4E18A 5ICEA 3RLFA 4DA9A 2CLDX 1GZ3A 1ZH2A 5GMOA 4QD3A 4F3KA 4B4OA 3BEOA 2B8WA 2DUUA 3UWMA 3WMWA 1N5IA 3B78A 2WKQA 5IU6A 1OVMA 3W6UA 2D7DA 1YH3A 1Q0KA 1FJHA 5BW5A 2B5OA 2VFAA 2VF5X 4N5IX 2Q0QA 1WUIS 3GLUA 5K4AA 2NP6A 3C18A 1EGMB 1J21A 4FP9A 3HSYA 3A0RB 5D6OA 1JKMA 4WKNA 1VLLA 2FQWA 1GM5A 3K0FB 3N39C 4JZYA 4OOFA 3R3XA 1D1TA 1E89A 3N8DA 4Y67A 3DC7A 5EJ2A 3ZHBA 2OZLA 4JCZA 1EX6A 2Q4TA 3JU3A 3DYIA 5LLSA 3MCAA 2EP8A 4YQYA 3KLBA 1GLNA 5AVZA 4S1VA 1X1CA 1L6IA 4NLLA 1XZGA 2I66A 2J9RA 4DCJA 1TAUA 1MXHA 2X9VA 3UGQA 2BGMA 1QONA 1DPFA 2BIFA 2FW0A 3CUKA 5COQA 3QVLA 2EWMA 3TM5A 1MIOA 3LBFA 4QU0A 2Y4NA 2JPUA 2HBYA 4IKEA 5A3VA 3VR4D 4TTVA 3VNRA 2C8VA 4C2BA 2X8LA 1DS6A 5JAMA 2R8BA 1BG6A 2JANA 4B6EA 5C37A 4G7OF 4NFLA 4HNGA 4MJ3A 1DG1G 1RLIA 2QF7A 4Q3NA 2FPPB 2R7XA 1QNLA 2VZ9A 1YJBA 3UJNA 3OFJA 4LF7B 1HRDA 1TT7A 3C7KA 5CFRA 1UQUA 2E7ZA 3MK31 1T01A 2AG6A 4B9AA 4WI1A 4C43A 1KMHA 1XVTA 5H1YA 3T4XA 4DBRA 2C98A 4R2HA 3R8CA 5BP7A 1XAGA 4P6VF 4LF6B 4LOKA 3HVIA 5LQCA 1RPJA 4QELA 2FG5A 2JLCA 4GIBA 3ROTA 4ZZ3A 1QFZA 1Z34A 3LPNA 5BQGA 1EAYA 1TQ6A 1XWWA 4MRSA 1FVXA 2O8DB 2H1FA 4II7A 4Q7EA 2OP0A 4ALKA 1JVNA 2GTIA 3CVOA 2ZUDA 1AKRA 3S2YA 1AS3A 4G0VA 4XIFA 1WCYA 1WP9A 2QW8A 4JASB 5CRIA 4JP3A 4D43A 4ZGGA 5A6SA 3ZX5A 4DMFA 4YP1A 4RHXA 1L9XA 5F5XA 3KB1A 3RT1A 2DJ5A 4FUQA 3ENVA 2IYLD 2YH2A 5JSQA 3FMSA 1DJLA 3I6YA 1ZCBA 3LCMA 1EX1A 5AESA 2I4MA 2F17A 4AE4A 2OE2A 3COWA 3TIFA 5ALQA 1LPPA 2C2HA 4AMZA 3THYA 3ANXA 4P84A 3ZTWA 5FJIA 1DL5A 3T4RA 3E84A 3NP9A 4BP9A 4YGXB 3A11A 1YZQA 2IPAB 5BN4A 2XCTB 2EZ8A 1WTAA 1U6KA 3DDOA 3TLZA 3LKDA 1CUAA 2NXWA 4GXTA 4YBZA 1L3CA 4LDRA 4YXWA 2O3SA 2PXCA 4U2FA 3VAAA 3R9XB 4HYTA 1FOEB 2O2SA 3ZNNA 3W9YA 5CVJA 1B43A 3DL7A 3B6KA 2PNJA 1YVIA 4Y9SA 1XVAA 3RSOA 2YLDA 4BJTA 1E86A 1M6VB 1RVV1 2CK3D 2ZYRA 4IHJA 5TPZD 3PWSA 4B3HA 4AJLA 4WCVA 1K4KA 3RUPA 3IHTA 3HV0A 4F6CA 2G1PA 3MB8A 3TBFA 1EWVA 1O4WA 3VF0A 1KC3A 3BD8A 1PYDA 1NI4B 3NTRA 5D84A 4Y1GA 4QM7A 2ERYA 1E6EA 4LEIA 4OHFA 4PJMA 4YJ2B 2IH4A 1GAXA 4KBLA 4WZ6A 1HDZA 1JJAA 2IUYA 4B43A 5PNTA 1B6TA 4TRJA 1VBFA 1DPGA 4OYHA 1OASA 4D80A 3JQAB 4YCCA 2GF0A 3DPSA 3KX2A 1YRBA 2QXUA 4CDAA 3QEMA 5ALXA 3Q11A 1WB4A 4TMYA 4MK4A 4UM9D 4WXPA 1UBKS 4ALMA 4EEKA 4ENUA 5JXGA 2WWFA 4JR2A 4LV8B 1CR2A 2CY0A 1QQTA 1NG1A 1B15A 3JZDA 3H9GA 2C3OA 2VAVA 3QKTA 3KFXA 1RHJA 4NPHA 3S7TA 4E7ZA 4UD2A 4D9EA 3MCUA 2XRHA 3QPCA 1GZHB 1W44A 3E0QA 1RZRD 2JAUA 2BZSA 5ICFA 2GN2A 1Q74A 3BIJA 4L6IA 4AZVA 3LTNC 4QARA 3IHKA 4GSKA 4Y2SA 1DJMA 1S01A 4V0KA 4P4UA 4I4TF 1BD3A 1ULUA 5AWFC 2QTGA 4B4UA 1B7GO 3RVSA 1DIRA 2J6IA 1LM3B 4L6AA 1A71A 1WMBA 3Q5GA 4KH1A 2JASA 2NYVA 3VI4B 3TRDA 3WDLA 3E58A 1ULZA 1ZN2A 2IDJA 4C0SA 3OF3A 3S81A 4KFCA 3NFRA 2QUIA 4LMRA 1NSYA 3MILA 3NNDA 2ZVJA 4CDNA 2B4TO 1TKNA 2H07A 2XF8A 4IL5A 5EFOA 1T5IA 1U8CB 2D2XA 2W2QA 4RV4A 1YC5A 4LJRA 1TAQA 5F5FA 1DWPA 1YQEA 2ZIAA 4J30B 3K35A 5CT9A 4BNGA 1Z47A 3CUTA 2ZYVX 2FCRA 1DQNA 3E9RA 3DKAA 2CWWA 2G76A 3K8OE 4I5IA 2ETXA 5GP1A 5H7XA 1NZJA 2HLNA 1M66A 4OM7A 4ROTA 4AJ2A 3GJQA 2VEOA 3QZUA 1XDDA 2HC9A 3EXIA 1R12A 1QX4A 3R6TA 1Y4SA 1UOPA 3Q7QA 4DMKA 2WVNA 1DTWA 4MQFB 1YUBA 4G9BA 1WEHA 3WHKA 2Q62A 1S2LA 2EDAA 3BTUA 3SJZA 4ETNA 3GUVA 4NJEA 3PUXA 4B3TB 3K70B 2QVBA 2KJGA 1ZW2A 1EKYA 2X9GA 2YZ2A 3H4TA 3PD7A 3QIAA 5FO1A 5AK0A 2ZJOA 3BD6A 5C4IA 1EESA 4O4LF 1DC5A 1SUPA 2QVZX 1RFLA 2KQUA 5BT8A 4ZDKA 3OOJA 2VJYA 4Y9TA 2ZSUA 1N1GA 2IIBA 3IDFA 4MLPA 3PU6A 2C9OA 5KNDD 4YL1A 3MTEA 3EHEA 5CB6A 4ZPJA 2YRFA 3AG4C 1WAMA 2AFRA 3DZKA 2XVXA 4DA0A 1PJ2A 3UUWA 1U63A 1P7CA 4QUDA 1HX7A 1U0BB 3JRTA 3IL2A 4NAVA 1E7QA 2YW2A 5E4TA 2RJNA 4JJIA 1S96A 5LKRA 4D3DA 1M1XB 5DPMA 3MGCA 2HGSA 3MEQA 5JLJA 3I9NA 1IJEA 1J8DA 1E77A 1UEIA 256BA 1PWZA 3KIPA 1A9XB 3LI2A 2PO7A 4GX1A 4ML3A 4TM8A 1Z68A 2Y3IA 1OIVA 4R9UC 4HRAA 1NP6A 3VYRB 4JLNA 4GQIA 4UPDA 3EZ9A 2QE7A 3HBMA 4ZRMA 4C14A 4UTPA 4JTCB 1OYWA 2W83A 1K92A 3PFKA 1WUJS 2DPYA 1PT7A 4B46A 5JY6A 1QUFA 2Q3LA 2QD2A 4ULVA 2H57A 2PZAA 1NNUA 5JMWA 3RYIA 4D74A 1G4UR 2L69A 3U4QA 3CPJB 2XQGA 4A92A 1K4MA 3T4UA 4KYTA 3DAHA 3U4CA 5DLJA 5FPQA 1G5TA 4DOMA 4UOQA 1P2VA 1NNLA 4WJZA 2VK2A 2FFJA 3H2VA 4YRLA 3HA3A 3PDHA 3IPAA 3PNYA 5FFNA 3HB7A 4WLVA 5CLQA 1YQGA 1G8JA 1TIBA 1YO6A 3I3OA 2VJAA 3KR1A 4O2BB 3ZE1B 2NUPB 5A5DA 3VV3A 4G36A 4JDPA 1TUGA 5JPCA 4HHEA 1HYBA 2YN4A 5K6AA 1SGWA 1KH1A 4NBNA 3OEEA 1U28A 2F9MA 4G3XA 3V6LA 3VRCA 3PP8A 1H2FA 1TM1E 2Y0CA 4AZWA 4LF9B 4CUKA 1ISSA 1FLDA 4N82A 2OL4A 3BQMB 3OA2A 5CDGA 2C5EA 3RYTC 3VKWA 3EEQA 4BZPA 5J2UA 3W3AH 4BFZA 3P26A 1XMSA 1I1QB 4Z1MA 2PWBA 4LJ7A 3SR0A 3UY4A 3GEHA 1L7CA 3BKWA 1E2IA 4RY2A 2K4MA 5IABA 1RI4A 1N2CE 2GEDA 3MT0A 3T1YB 4XOUA 3Q8MA 1EX9A 3PNOA 3E3AA 4WLOA 2FZEA 1Y42X 2JZCA 4ARAA 5KPDA 5ISMA 1O4VA 5EJ8A 1BXGB 4MUXA 1DRWA 3KJGA 3ZDLA 1TW2A 4HFRA 4WKBA 2PYZA 2QY6A 2WWTA 4MW7A 3GAZA 4RH1A 4WIAA 4X97A 4K6GA 5DBOA 5F12A 1JTFA 5DYTA 4WBNF 1QIEA 3TLGA 2QN9A 3VZRA 1YVRA 1L4MA 2HMWA 2BLNA 1FU7A 4WKOA 2IZ6A 1IZ9A 2XQJA 5FOSA 4BNZA 4B3SB 3KSAC 4CV1A 3LESA 5KMGA 3ZKWB 1YB7A 1W0KA 4KLRA 3VSBA 3WGLA 4C78A 1R9JA 5A02A 1UH5A 1IVSA 3JATA 5FBZA 1Q3HA 4MA0A 2OEPA 3PEFA 5EKDA 3BMQB 1J22A 4HLUC 4QBGB 5HJEA 1QHIA 1WCIA 2IZOA 3PLNA 5CJJA 1GS9A 1O1YA 2YJ5A 3LXUX 5DHAA 5K0GA 2Q5HA 4PNHA 5C31A 3TFQA 4QYIB 4HB3A 3ACDA 1V3QE 1XEXA 3GOQA 3MJCA 4H7IA 2C2MA 1X1AA 1X92A 4JJ7A 4U7FA 4RK0A 2EZ4A 4XGIA 1UP6A 4XWKA 1QVVA 3LWBA 2JKYA 4QICA 4HVCA 2QJFA 2OOSA 2I6QA 4BNDA 4FPXA 3HA7A 3RVPA 5SICE 2GZDA 2IUUA 3R74A 2BW0A 3CU5A 1DFGA 5J58A 3JX9A 3JAWA 1SKBA 2FK7A 1RYNA 4U9DA 3GYGA 1QBKC 2ZIUB 3L0DA 4GI7A 1TTHA 3AMVA 3AFGA 1WO8A 1NUQA 2FXVA 1FDOA 1VG9B 3N0TA 3FTDA 4I1OB 5F4ZA 4DL9A 3HB4X 4NPCA 2R7QA 1WHSB 4RD6A 4Y2YA 5IBRA 1JP7A 1VIMA 4NFHA 2GCOA 3OJWA 4EA6A 2DHDA 3MYIA 4L9RA 2NAPA 2CNWA 3DJYA 4B7CA 2L6FA 2CHVA 1Y7TA 3OCWA 4CL2A 4BO3A 2HJVA 3CGGA 4EG8A 4FGZA 2IJGX 3E7FA 4C4YA 2VPXA 1M5TA 1WY7A 3VR6A 3GYBA 4IIYA 1F38A 2VT2A 4OJYA 4MNDA 1SCJA 4RTOA 3LFTA 4ARZA 2VHQA 3ZBQA 3AV0B 3GA0A 3V4RA 2NMVA 2M32A 2B4QA 1I1HA 2BEUB 1VA4A 2G70A 2WHRA 4B6GA 4UMFA 3I5XA 1E2HA 4UEOA 1SBQA 1LKZA 1P19A 2ZIXB 1L7XA 4LMPA 2QX7A 4JUCA 2GHRA 3OEHD 4XH9B 5FXMA 4P6IC 4M0KA 1EWRA 4ZDJA 3QHQA 2FVXA 4JODA 1EDEA 2QMHA 5A69A 1OLXB 1X7HA 4IUCS 5DLPA 2JKZA 3TL3A 2YYSA 4IGGA 3U2QA 3W05A 3HU1A 1QZTA 3IBGA 1EA5A 2DB4A 1QGDA 3QE4A 2F64A 3WMXA 4CI9A 4YCJA 1Z2DA 3LLSA 4MDYA 3G2PA 3JRXA 4EX7A 4HJXA 3UMYA 3NIDB 4R8VA 4BN0A 4NULA 1R37A 3AOGA 3LQRA 1G7CA 1GSAA 5FWYB 2GAIA 1QYDA 2P9CA 2JCGA 2VJPA 1VHDA 1DRUA 1FYDA 4I46A 5HYVA 3A04A 2RBKA 5AM5A 5KCZA 4AKSA 1SJ9A 1LLCA 3P1JA 4YHBA 2DBYA 221PA 1KEPA 1CV2A 4MCJA 1B4DA 1JR2A 3DOEA 4LOLA 1MNAA 4UHKA 3BSSA 3CR3C 4N4AA 3AKCA 4M7OA 4ZOAA 3CLTC 3HKEA 4GZ6A 1ZWKA 2Q28A 4IDNA 4QEZA 3VH2A 2NO1A 1UJBA 3E9YA 1H2EA 5H81A 5BYAA 3GDWA 4GI1A 4DV7B 1QP4A 1QK4A 3R3ZA 2EP7A 4P0PB 1YMVA 4NYMR 4KSCA 4GOXA 3LRPA 2ZDGA 1TX4B 3Q3JB 1KDPA 4GC9A 2FJUA 4KC0A 1JILA 2LCQA 4DMCA 4C4XA 3LD9A 1FUUA 2W2KB 4HV4A 1Y1RA 1X1TA 4Y2TA 4FINA 2NU8A 2H1HA 3E9CA 4CIAA 4MGZR 2EZ9A 3G2MA 3HPQA 4X66B 2DU8A 2YYAA 4BNJA 2X41A 5ALFA 1Z5VA 1ZDMA 2R79A 3LGSA 4PIMA 2YVUA 3IQGX 4UUQA 4B5LA 3IQIX 2EYUA 1WCV1 4JKVA 2YV4A 2LDXA 1FS5A 2PHZA 821PA 2AD1A 5AI8A 2I54A 2G7ZA 1I6KA 1W4LA 4AY3A 3WGIA 4MR8A 4GWKA 1V25A 3IS3A 2RGXA 2XX3A 3KV3O 2H65A 4CTKA 4BGDA 1W76A 1V7CA 4G1CA 5GOTA 3FTCA 2Y9PB 5BNWA 2EILC 1YQQA 1YZYA 3OX1A 3AQBA 1QKKA 3EQZA 4XARA 4B2LA 4LZNA 2CXHA 1BJRE 3EH1A 2FP3A 1A8HA 1GNRA 1QHHB 1VSQA 5DTQA 2J1LA 4REQB 4B34A 1QQ3A 4UUMA 1LVUA 4R1TA 3WMRA 4NCBA 2ZBGA 3TTVA 4UU0A 5F98A 3TMAA 2L18A 5EK0A 3EVFA 4TV8F 2E5LB 1NNSA 1MO3A 1U9YA 3VPBA 1SR8A 4JLUA 3OWTA 1TOAA 2ZR7A 2C99A 5JQGB 4KREA 3I9KA 3V5YA 5L53A 2WJJA 2OWEA 1Q2XA 1AHPA 1AZTA 2H8AA 2A30A 2AUMA 1GTRA 3ETDA 3MELA 3NTUA 4GICA 2Z09A 4YASA 3N70A 4D8TA 4JYAB 3B70A 1R0ZA 2PVSA 3OJFA 4G86A 4K88A 3ZU4A 1EVYA 5TT0A 3TSYA 2QORA 3PR1A 4OQNA 1E9SA 1PZFA 1WHTA 3O31A 3OE5A 1R0KA 2ZAYA 4X8HA 1ZM7A 2Y1CA 2IBSA 2WUDA 5H9VA 1SVNA 3B1VA 5EVCA 5EMMA 1C14A 4D9GA 3L43A 4TMFA 4ENTA 1W5FA 1LBEA 1PV1A 2AE1A 1N9GA 3NIWA 4IKOA 4M54A 1XDBA 4KAFA 3BGDA 4KGVA 1RBMA 4S1NA 5J4HA 2GPWA 1KE2A 3RC8A 4JURI 3A1VA 1SOMA 1QV6A 3EG5A 1JAYA 1U1IA 2R6DA 2Z1NA 4KYUA 5EXEA 3WWYA 5TDHA 3JQ9A 1UPTA 1L7PA 3SJAA 4N7BA 2AXQA 3FPSA 5D01A 4MIKA 3IXMA 1RKUA 1P29A 3KRTA 2NTYC 2IT1A 1Q20A 5E8RA 1XP8A 4XLZA 4OIQF 1OT5A 4GI3A 4PBRA 3CF4G 2QPAA 5MFZA 3FFTA 2IYWA 3PDJA 1Y4AE 3KJIA 2Z0MA 3DF9A 4WBXC 4KXUA 4C0KA 3ESRA 2A3RA 1TB4A 1ZD9A 3B13B 3HDQA 5JJLA 2X3FA 1H9TA 3KP1A 5TJ9A 3SEFA 4KR6A 5CLLA 3UQZA 2O59A 2QR5A 2Y68A 3R40A 4X6UA 2V7BA 1QO7A 3TGWA 2J6BA 3VJKA 3M1LA 4GMXA 1UDWA 2AJDA 4C01A 5HIKA 2XRZA 4L07A 1Z5ZA 3RASA 3NG1A 3B6EA 3EHDA 4PFSA 1MH1A 4DVGA 2V6IA 1UBEA 4K7BA 3C87A 4G7HF 3OQPA 3EY4A 3ITEA 1HEYA 4PPGA 1QVAA 3VOBA 4EVSA 5JAIA 3D3JA 3K72B 5C8DA 2P7VA 2WHPB 3O8DA 4NSNA 1UJ2A 4R05A 2ZIXA 4Z1OA 3G2OA 2DCMA 3LY7A 1SQSA 2PANA 3HA5A 3E9DA 2IP2A 5A4FS 4B2IA 2Z6UA 1X38A 5DGIA 1KOGA 4TVBA 2AZDA 5DS6A 3HY4A 3OT4A 1JG7A 1ESEA 2UVPA 3H5VA 2W8BB 1ZPDA 5E1MA 4QHTA 4Y2JA 3ZBUA 4IAQA 3CKMA 3NH9A 4JB2A 4CKBB 1G41A 2OECA 3H6HA 4AX8A 1ZMBA 1B73A 4G8JA 3CPEA 1PGNA 3ONWA 2FRDA 4M6WA 2WU0A 4X45A 4B6SA 2VDNB 4BOYA 3P9PA 3IOEA 5HQTA 5HGXA 5TQ0B 3OCXA 1N6NA 1W0KD 1JOGA 1I6LA 3MJFA 4OIMA 4TQUS 4UJ3A 3GMIA 1KDVA 3RBAA 3RFUA 4BCDA 3VJRA 1W5BA 4KMMA 5IASA 1EM8A 2GBIA 1CJSA 4RDCA 2JCXA 3VU0A 1C1HA 3L4KA 1V16A 3STYA 4N4WA 2A14A 1GPWB 3SYRA 4BNDB 3VJLA 2JIZA 4Z9YA 2YL3A 1U7UA 1UPXA 2GK7A 4OA8A 3JD0A 4QUEA 3I32A 5E2AA 1GADO 1EVJA 3PXCX 3NRBA 3W6ZA 3QF4A 3E22B 3I5YA 4MTLA 1XEXB 2ZJ4A 4Q3DA 2OORA 2V55B 3DM9B 3L18A 4OLJA 3WSTA 1A9SA 3ZXUB 4A10A 1YVPA 4IAOA 1GGJA 13PKA 2ZETA 4D4LA 3MNFA 5JXWA 5LQJA 5EAIA 1LF5A 2XTJA 3O75A 2EGUA 4BWFB 2R7NA 3ID6C 4V0MA 4N41A 3D8RA 3V4OA 1ZI8A 2AX3A 4I1MA 2A0BA 3W2WA 1X8KA 1IIRA 1J8QA 1D1CA 2CVOA 3CONA 3GN1A 2VYVA 5BW8A 4OG2A 4LFCB 2G9ZA 1DWQA 2O05A 3M83A 2IYQA 3FCYA 3MC1A 1RKQA 1WW8A 2YY6A 3DC2A 5AK6A 1XVVA 4Z86A 1KVSA 3UBMA 1NLUA 2BMAA 4MYUA 3QFCA 3ER6A 2AMYA 2IXBA 1U1EA 1U7HA 1RLTA 1R4MA 4HPWA 3WKAA 4Z9BA 1IXKA 3ZDCA 3D4OA 1UDXA 1P4HA 3AL0C 2H7OA 1BROA 2E55A 1Y8RA 2QVLA 3M15A 1OGJA 3DBVO 4QREA 3M4BA 1MB9A 1O58A 3VKVA 5A9SB 1R4AA 3I6IA 1FR0A 2PYDA 3VAZA 1GUZA 1U99A 3FIUA 2P9EA 1YOVB 3HWSA 3IEEA 4XASA 4DT1B 1I0IA 1WXHA 4URHA 4NPAA 4Q00A 1OF1A 5K0JA 3KL4A 3A6KA 2N46A 4RFSB 3A4LA 3H6GA 5JYBA 5AHOA 4NS1A 1A04A 1OBVA 1PN3A 1YVDA 1BDMA 1JDPA 1QYXA 1MAHA 3DTTA 3I8OA 3K9QO 5EIAA 1Z6AA 4RY0A 3W2VA 1L5SA 4DWOA 5HJ7A 3KTAA 3B20A 3LF1A 2NLOA 3C5VA 3W1EA 2OHIA 5KINB 1GZVA 4LF5B 4IGEA 2ORYA 4MVOA 5HA5A 2IF0A 3O47A 4UXIA 2FN3A 3GJRA 3BDIA 2VTKA 3QU9A 4FMBB 4KRYA 3V00A 1GCGA 4KWEA 2A57A 1SULA 2G1AA 3WWOA 2BFFB 1MO4A 2HXGA 1PUXA 3SXUA 4DIKA 1NPDA 3PT9A 3SX0A 3C8DA 2VDRB 5EE3A 1JALA 4LJ6A 2O57A 2VYND 4KWCA 4MVQA 4M55A 4R1MA 4LVUA 5DSXA 5ILGA 1KEKA 1BVUA 2RC6A 3OA1A 2WYVA 1YZAA 4UDNA 3MWDA 4HN2A 5ENZA 3RRMA 1QIHA 1E18A 2BELA 2WK1A 2HU8A 2XDQA 3I9V1 1E5DA 1GIAA 1ZGZA 1H1LB 2Q1UA 3QU2A 2XKKA 4LCJA 1L5LA 4FJ1A 3G13A 1RM5A 5COFA 1TCAA 5DHFA 5DTJA 4EKNB 3OQMA 2ORIA 4OHVA 2BFWA 2YL2A 3Q7GA 1JI3A 3JT1A 4D4GA 1ACJA 3ETNA 3PVCA 3K0HA 3V2IA 4CHTA 4QSMA 4MYHA 4EUNA 5HFNA 3PIDA 4UBKA 4Q18A 4EKIA 2N9UA 3IVMA 4DF3A 2GZMA 3US6A 4I50F 5KVVA 2XIJA 1YZVA 2PUEA 3VVMA 2JGJA 5K8JB 4MXDA 5BSWA 4IG9A 3TD9A 4CEIA 4FCTA 4FLMA 1Q7EA 2YV3A 2PUGA 4TTRA 1BIFA 4Y9RA 2QZZA 3EVZA 3GAAA 4MYTA 4QGGA 4A1FA 2H1RA 4I7EA 4L8FA 3VO8A 2HA2A 3GUHA 5IK2A 4E09A 1MH9A 4EB6A 3BWDD 3GPLA 1ICEA 2ZAGA 2ERXA 4URWR 2QQFA 2ODTX 5H68A 5K4GA 2DPXA 5FTWA 1KTVA 3ILSA 2B1GA 1YZGA 3AF1A 3RUEA 2XAUA 4NOLA 4DJDC 1JBQA 2E37A 1I94B 4NI5A 5E2IA 1L8XA 1Z0AA 2PSJA 2IU6A 2NU6A 1A77A 2GHQA 2W22A 5ELLA 3CPSA 3RFCA 2XVZA 1RJDA 1UZAA 2X4IA 1NR1A 4KFTA 3FPEA 1MMFB 5JI3E 3F73A 3AQ4A 3D2CA 4RFLA 4JJFA 1T4DA 9MHTA 4P54A 3ANNA 4KN9S 5F73A 4N6OA 1W25A 3RFVA 4CV2A 2FZKA 1V96A 3CF2A 2CDRA 3UYLA 4RHTA 2BBOA 2KB0A 3TMKA 3FTPA 3HWRA 3OT1A 4PZPA 1EVIA 1OXBA 1R7RA 1GTSA 1USVA 4FLFA 4PTYA 1JSCA 1Q0MA 2AWCA 1P4JA 3W3ZB 9LDTA 2QRLA 3GRCA 3FVWA 3RVDA 2DGDA 4NY3A 1Z2PX 1G2PA 1N6HA 3OZRA 1QGUA 4RVOA 5FWXB 5CU7A 3HP7A 5KOIA 1OFGA 2P77A 4GLJA 1YLMA 3ZTYA 4Q48A 3ESCA 3D0QA 1QFMA 3RW0A 3WLPA 3MX3A 2H7CA 4WLEA 4BEJA 2IS4A 4MWOA 3QU7A 4OFZA 2VDMB 3KHUA 4MP8A 3VSDA 3LHKA 1CZHA 5CM8B 2OGWA 1FEZA 2PPVA 2XLBA 2XPCA 3MRSA 1XL1A 4ULWA 1U1GA 2R05A 1DJPA 1TJ3A 3BM5A 4ZZIA 3RYCB 2NGRA 1MGOA 2GGSA 1Z7EA 3ELBA 4FYMA 4JVOA 1KI1A 1DZIA 1OLSB 2FSGA 3GJXC 5JU6A 1QC5B 4DHEA 5LU9A 1K6JA 1Q0ZA 1CF4A 4XLPF 1E6CA 1OJ7A 2CJPA 1JS1X 3PX2A 3UHPA 2Z30A 2O20A 4O4IF 1WF6A 3R23A 4R0MA 3FJYA 2WA1A 1W4ZA 2PZGA 3TNJA 4LHWA 3LT1A 4NBSA 1POXA 2EC5A 5TVKA 5AVRA 4BKOA 1ZN7A 3OLCX 1J99A 1HYQA 3O8BA 2B1QA 4PLZA 3S8EA 3ZDAA 3PC4A 1VL0A 4MV5A 3RTCA 1H0SA 1CEXA 1SR2A 5JWRA 1C41A 3QXXA 5U9CA 3KQHA 3EA4A 3AI7A 5JT4A 3RRNA 3RJTA 1C0LA 2QRJA 1ZO8A 2Q0XA 4AS2A 2VYQA 5A7GA 1HT2E 3TZQA 4KLZA 4GI2A 1REQA 1E7MA 2QYHA 3MYRA 1KI4A 2WYHA 3LFHA 4IJ5A 3GJ5A 3LRTA 4X60A 5BSTA 3V9AA 3F2IA 4P82A 5F2NA 3D7KA 1C17M 3RU9A 1WDKA 2P9HA 1VJRA 3OC0A 4N12A 5DKFA 5FWYA 1EUYA 3U7GA 1RM0A 3QLVC 3I2JA 1E62A 3PPXA 5IAEA 3ZDFA 2HMAA 5BOSB 1QG6A 1N8TA 1KBOA 1NXSA 1OSNA 1B0UA 1Q57A 2DKOA 4HQ6A 4UOZA 3DV0A 1JH9A 2WAOA 2G71A 1F60A 4CFZA 3MRXA 1PSWA 2RI0A 3PLRA 2VH2A 3CZ6A 4R83A 1XZPA 1SXJC 4HAXA 4IDQA 4FOPA 2AI2A 3ZV4A 1H9AA 2J0EA 4U00A 3T0FA 3BCRA 1SCNE 3UUEA 3VAYA 4DLPA 5IFLA 3IMKA 1BX1A 1J2YA 2YJNA 4JD5A 1F51E 1ZM3A 4MYDA 4Q4LA 4S1TA 4DSTA 4QUAA 3ZIAD 2X5KO 5BWLA 1CNEA 3UJ6A 1CERA 1K2WA 3IUSA 3ODPA 4C2UA 4M1MA 2C8KA 2FEXA 3T5MA 6GPBA 4X0RA 2CZQA 1ZOPA 2JEOA 3MD9A 3E5RA 4RPHA 3Q0EA 3FHLA 2FOLA 2G5PA 2BSXA 2NXNA 4BRZA 5LDGA 4LDPA 1RQLA 3IURA 3AKZA 3TQOA 5IKMA 2QTHA 1G5HA 2P7HA 5DQTA 1SEPA 3JZFA 3ELYA 1CJTC 4IW3B 3C24A 4MQUA 5DHSA 1XCPA 1ZA1A 2CNNA 5CDFA 3U7QB 4Q9AA 3R6DA 3VR2A 3W8DA 2AYYA 2BFCB 5G0VA 4AF7A 4EAAA 1AQJA 1B93A 3PYMA 4QYWA 4BZWA 1RKCA 1ZRNA 3IH5A 4M49A 4I19A 3ZPXA 4FMPA 1HE2A 3PEVA 4C5CA 2FY8A 1BH6A 2AJ8A 2QTVB 2Y77A 5B2ZA 4NOKA 1RPTA 1JMVA 3C4JA 4BYMA 1AS2A 2BZ1A 1W52X 3F5SA 3FVQA 2XTZA 2VPPA 3CUSA 4GL2A 4RTPA 4X54A 1R50A 3UCXA 1GA4A 1O0SA 1CVLA 4G0OA 2QTCA 5G40A 4YUAA 4MVJG 2I3AA 4KJZA 1HT0A 4KK3A 3IQWA 1Z5WA 2HCBA 2Q49A 4R1LA 4XUDA 5G1OA 5I7UA 1F8GA 2HPZA 3GFVA 3O4FA 2Y0EA 3TSOA 4ZEMA 1GSOA 1W73A 3ETJA 2A5FA 1ZS9A 2QE6A 4MMYB 4QYXA 4XD2A 4E5NA 3W9BA 4ZI5A 1YRQA 4BTLA 4QZVA 3L0SA 4FHCA 5CFOA 4MAMA 1PHRA 5TRTA 2CJWB 4PCLA 4OHCA 1A9RA 2P5YA 4R9RA 3ETGA 1UZLA 2Y3HA 1A7EA 4PN3A 4B3IA 5ALZA 4RC9A 1B0ZA 1DJQA 1N1DA 3T1HB 2A9KA 4NENB 1Z0SA 1G20A 2INGX 1T6UA 2B92A 1IBKB 1X9IA 2AOTB 1G1MA 3ASOC 3FOFC 1Y82A 1ZU5A 4GI5A 1XDUA 1ZMTA 4GXNA 4A0QA 1OI2A 2IOHA 3FXAA 2VCHA 3QVVA 3ZKWA 3T7DA 5HNKA 4IMPA 4F72A 2BE5F 2VP9A 3H2YA 4J16A 3H3FA 4D8VA 1P39A 1ZOIA 4LRUA 4RTKA 4FM9A 3FYUB 3TL2A 3N24A 2DP4E 3CUYA 3DDSA 2XDQB 2QD1A 3HYTA 1AKVA 3I23A 3PYLA 4CGYA 2OK8A 3FKSA 4U4AA 5EKXA 4I2VA 4JOSA 2BGTA 1ZU4A 3IP6A 2I7DA 2FW6A 1TD9A 3OLXA 1F8XA 4N8SA 2EJCA 4HNRA 5HQJA 3TW8A 1BEUB 4Q0MA 3UK2A 3MFQA 4XKJA 2K87A 4RBNA 1DAKA 1D0XA 1OCEA 3G0CA 2W2NA 3H19A 3ORYA 3HKBB 1P6QA 1P7VA 2QOEA 3OIUA 5AHKA 4BBAA 3TM4A 2Y1EA 4MS3B 4M0DA 1ZVQA 2DYSC 3HNKA 1SUIA 3AW9A 3BJIC 3ZCPA 3PFIA 3NHRA 2VXOA 3RU7A 5CT4A 4EO4A 3PIRA 1F6DA 1NVKA 3DV9A 3EDYA 3I42A 4HQOA 4RX1A 3NASA 2YXPX 2I22A 4OFBA 4OTZA 3TYXA 1U5BB 1PFUA 1SMKA 2FAXA 2PRIA 1T5HX 4E1VA 1BOOA 2FPXA 3AKYA 1JWAB 4JEBA 1QRRA 2CFCA 2WSMA 3GJ6A 4RK1A 1EUCB 5CXSA 2X6TA 4LHXA 4DEVA 2PD3A 2AFIB 1KFJB 1KI6A 1P45A 3LAWA 2XRMA 1SZCA 3JQBC 1GWNA 1P7YA 2IQIA 3DKRA 5DO9A 4KKXB 5THXA 3F71A 2VCBA 4O4HB 4R1UA 3VZSA 3PHGA 2V5AA 4PPQA 1KYWA 1XZEA 3EGOA 4CM1A 1I33A 4QU9A 4BGUA 2R25B 5MF6A 4ESHA 5AM1A 1YA8A 4HB0A 3NPAA 4IIVA 4U1RA 1JQDA 4ETWA 3A10A 2E21A 2XWBF 4D1YA 1BBHA 1IVYA 1H22A 3SDZA 4HMPA 2Q4BA 3QX8A 4DMLA 4YLEA 3V4SA 1HQDA 5C1IA 2CMKA 5B3JA 4C07A 4I9GA 4IJQA 1XRRA 2GD1O 3PQ8A 4EEXA 5TE9A 1GCAA 1ULAA 4KK4A 1KDRA 2JFOA 3V8BA 4BWYA 1IPEA 2QDXA 3CZAA 2G72A 2NOAA 4JAVC 1AKNA 4W9NA 5DBEX 4YRJA 3WWDA 5JNWA 3IEMA 2YV1A 1P9LA 3CHYA 2ZS8A 2W6MA 1J42A 2BD0A 3C45A 1C7RA 2ZJ0A 3E2IA 4YWHA 3EZHA 3P0EA 5CDFE 3Q2IA 4R32A 1KFCB 4Y2PA 1MO6A 1YUNA 3R7AA 1Q83A 2WICA 3EULA 3WK5A 2L42A 2RGDA 2ZRJA 1ORSC 1F17A 4KQWA 4GP6A 2GSDA 3N2GB 2CFOA 3MQ2A 2GDZA 3J81k 5TS3A 4HL6A 4KODA 3V7WA 2R7AA 2JBAB 3K0AB 4KZKA 1QV7A 1SZPA 3M1IA 4M4SA 4NMHA 5DHTA 4J7XA 4WN9A 2JK0A 5AKHA 4OSOA 2ZSEA 1JDBB 1Y4UA 1R74A 1TO6A 1YJAA 3QKRB 3VMFA 2IXOA 3ICCA 2XGSA 1OZGA 1PK8A 3SLGA 2HSGA 1TYCA 2ZRKA 4ZOLF 5LQNA 2ZU0C 2C7RA 4BDTA 4NR0A 2ZJ8A 4F2PA 3ZVNA 1I3KA 3AF2A 4CM8A 2Z6AA 3AB3A 3IPRA 1XZHA 4FFSA 4R9SA 4D46A 3OCYA 3WB0A 3TLMA 1DGQA 1YAJA 4QI2A 2DFDA 3R09A 4HGZA 4LKOA 4PG4A 5CGZA 2WZBA 5EPUA 1NVMB 2A9OA 3FUXA 2RGUA 3PQ5A 1G8KA 5FI5A 1QBGA 1OMOA 3H16A 2VYNA 3DKKA 1V7PC 3T8YA 3AYXB 3G82C 4DMMA 4J6FA 1RTTA 1YI8A 4Y2RA 1APBA 2H9AA 3MCVA 3ZIUA 3IXQA 4YUYA 5JSUA 4C0BA 4C1BA 4G0QA 2YZSA 4MR9A 1CETA 3CX4A 1MBZA 5JY1A 3IAS1 4JP8A 3LY9A 2NSJA 1RLOA 5EUBA 2QRVA 5EHZA 4L3OA 3AVWA 1DAOA 3NT2A 4US2R 2GLUA 3IPMO 3KG2A 5KNCH 2DUWA 4NTAA 3BDVA 4GEKA 4YBRA 4C3EA 2KYHA 2A1TR 2E89A 4PCAA 2JHFA 2HA0A 2OLEA 1YARO 3I5PA 2YBEA 1S2MA 4BIMA 4P7GA 1T0UA 3D6TB 1DQPA 2M9MA 5KWSA 1NR7A 2A9PA 1NW5A 4AKTA 1NPYA 4LOJA 1YC2A 2O50A 3BILA 1SK8A 3C16C 4K8OA 4QNRA 2GM9A 5DHUA 2NU8B 3RAGA 1JI0A 4J2OA 4QYTA 1JRAA 1E2PA 1FPMA 2PRYA 1PEKE 4KVFA 2O7QA 4PAGA 5HDBB 4D81A 1MZVA 1F7UA 4KX3A 1CQWA 2W2VA 3Q7TA 4GOKA 1UJMA 3A37A 2C5SA 5FNVA 1M34B 1KJ8A 2Q00A 4TWZA 1F06A 3NM4A 4WRRA 1DO0A 3M3DA 3ZWMA 4DJFC 5JEEA 2V5VA 1G2OA 5JPDA 2FPMA 1CP3A 2CUKA 1NBBA 3IO5A 3R3WA 3U9LA 1W8DA 1XTKA 2YJZA 1FY2A 3WODF 2AI1A 4H3KB 3OM9A 3G0OA 1GGMA 5F5HA 1ZM9A 3PXUA 4CR8A 3NC0C 4I3FA 3ZVRA 2W6QA 4LYFA 4RE5A 1NNEA 2Q41A 3RQEA 3S0XA 3E35A 3S5UA 2WTXA 2YWJA 2ZCUA 1DP4A 3TOSA 1ISRA 1XEWX 1KYTA 2O0LA 1V7QA 3EDCA 4L75A 5FORA 1T1SA 2ZWIA 1X7XA 3P9QA 1A0OA 4KIGA 1QMGA 1GPLA 4X61A 3RLIA 2HYIC 5AKZA 5DQZA 5IMBA 3B60A 4ESVA 3EODA 2P3OA 5LZ7A 4U2EA 4Q82A 2XKJE 1AKYA 2Q3BA 4KL8S 1IEWA 1MFPA 4JVNA 4HZIA 4ZKEA 2VP4A 3HCNA 5LBIA 3HR4A 4BMSA 1KWKA 4YACA 3ZJUA 4FD3A 4EB0A 3JSAA 5HILA 2IU3A 4EO7A 1C8KA 2RGNC 3TK1A 3WBKA 4AKGA 4YJWA 2GN9A 1JFVA 3N0XA 3KKBA 3QF7A 2L19A 3RQFA 2V3VA 2OCIA 3V8EA 2GZHA 4YL0A 3L4BC 4NJOA 3TLKA 4QU8A 2VHVA 5WRFA 4W7IA 3NU1A 5D2CA 3C4QA 4JJKA 1UKAA 1S0UA 2VUTA 1EFDN 5L0FA 1NFRA 2X9NA 4L8GA 4Q03A 2FW7A 2V1XA 3CNOA 5ARDA 1RADA 3J80A 3U4MA 3K1AA 3UTCA 1S2DA 4G0MA 2A84A 2R25A 5D51S 4OX9B 4MTOA 4YP9A 3GAFA 5KOJA 2PIDA 1B00A 3TWOA 2WG2A 2A0KA 2O6HA 1E20A 3PNMA 1PQYA 3NCTA 3PQFA 3PTAA 1CBUA 1I4TD 1PX2A 3OF5A 4LW8A 3DGEC 1EWTA 4FDTA 3ZU2A 5AVWA 2J0SA 1DOHA 4R0VA 3Q2OA 1DADA 3PB3A 3UJ3X 3FCCA 1LA2A 2GOYA 3S7ZA 5HUHA 1B14A 4YLGA 2XYHA 4V3BA 5DDIP 4XWOA 1GPNA 3TJZA 4BQQA 2W2KA 2P5UA 3NW9A 4OMDA 2VH5R 5M7EA 2CKMA 1ND6A 1FMVA 1QCZA 2NQTA 2QG9A 4IMJB 5JS1A 1VE5A 2Z2IA 1FVFA 1ULSA 2BKEA 3JWGA 3ADKA 3E48A 4O4IA 3RVLA 1YJGA 4E15A 3DXXA 2V6BA 4HXFB 2B5VA 4WBNA 2A5LA 2JFXA 5C5IA 1BDJB 1GUDA 3DOUA 1KZ4A 3QUCA 3A28A 2FLKA 5HQ3A 3K0FA 4MB2A 5EL0A 1K9SA 1WLSA 2J3MA 3GLHB 3RNOA 5L7TA 1Q3TA 3KSZO 3LUPA 4OI0A 3UHJA 4AYTA 2F00A 5DNUA 3VKHA 4YO8A 2WVOA 1O94A 2JFPA 5HZGA 3HY6A 1G21B 2X1HA 2XV1A 3CGWA 4UQOA 5F7OA 4R8RA 5LUAA 3DMNA 3H1FA 3A4MA 1H8ED 3P27A 4YDSA 4ZYYA 1R6XA 3CZRA 3GXOA 3NXSA 5E7IA 2B1RA 1C4OA 2A86A 2ZTMA 3H5NA 3BHNA 5FP0A 3OQ6A 3MBOA 1OXKA 3ISVA 1H2BA 3C85A 4NH4A 1XC7A 3QBDA 2P69A 4FYHA 3JY6A 4EIWA 3C3YA 4YY3B 1OOEA 2XGMA 2OAEA 5JD5A 1E9BA 2RD2A 1TE2A 1OYVA 1KO4A 1F8YA 2HIGA 5BOVA 2ZITA 2PNOA 1YDFA 3HKKA 4Q4JA 4ZAWA 4TSFD 1Y3HA 3WRYC 2OBNA 1VJCA 3GB9A 3KT3A 3LOUA 1ECPA 4ARCA 1IPHA 1A7DA 2WG1A 3A6PC 1KQFA 4YMIA 4KTVE 3JCZA 1KO1A 2YL0A 2QK4A 3H1PA 2ZDHA 3GH1A 2MSWA 4O5AA 4BO2A 3OLQA 1XZKA 1SU6A 1JG3A 3A4VA 2XA1A 1COWA 5JARA 1E92A 1DO8A 2ZEJA 3KE8A 4QI0A 3E70C 2OBYA 4FS8A 4P35A 4TV9A 2BFEA 3WTCA 4QDJA 5GPGB 3REFA 3MW8A 3V8NA 2DSTA 3HEBA 2WPDA 1GQSA 1WXQA 4YMTA 2P2DA 5KSPA 3WVNA 2H9IA 5L3RA 1MQVA 4YMWA 1AZLA 3WQHA 2TECE 4CLDA 1L7BA 2JH3A 3CVWA 1W93A 3KEGA 2VBFA 2HI0A 3RIHA 2G6BA 4IIFA 3PKJA 4I14A 4XQ0A 3F6CA 3I72A 3CY6A 3SDSA 1BMFD 1H2HA 1DV1A 1EZZA 2IYUA 4WJ0A 2P9BA 3CLHA 2GJSA 3LVRE 3WKBA 2F4VB 4LS3A 3K94A 2R5FA 4MVYA 1TA4A 2V7EA 1RC1A 2Z8XA 3L8FA 2H29A 1ZD2P 3EF3A 1T36A 4F2WA 3ZY2A 3R3UA 1GZ4A 1JTVA 2HQ1A 4M9QA 4ZQIA 5KOJB 4QRHA 3NHMA 2O8BA 1SC4A 2QMOA 3GVXA 4H7JA 1KP9A 5G1NA 3Q8LA 1IN6A 1XTBA 1TFRA 1Z13A 1VI6A 1CPQA 3RGWS 2BL2A 1JWBB 1KAHA 1T1GA 3GPDG 3QYFA 2Y1LA 1Y3FE 5KVCA 1SK9A 3PPWA 2A33A 3FMVA 2HJWA 3M1CB 2UKDA 1M6NA 4W1QA 2C8LA 1P18A 5F51A 2R7MA 2FETA 2HJ3A 4ZJPA 1BW9A 4D6XA 4XLNF 1EH5A 1ZXXA 2CFRA 1NVVQ 2VXYA 3F5MA 4MV8A 4D4IA 2VR1A 2W6PA 3MMNA 1RBQA 5HFAA 4Q4JB 3HKCB 1YB1A 1OAKA 1KDZA 1NXVA 3SQWA 1AHNA 1SKYB 3ZZMA 3H75A 3BHJA 3G1UA 3V4FA 2XDAA 1QTRA 4D3FA 4DDTA 2XB4A 2XHZA 5DV9A 3EEOA 2IXAA 4LWPA 1YASA 3KWFA 1X2BA 1EFCA 2PJZA 3ZZNA 3OO0A 3ROZA 2NO6A 4DQXA 4M88A 1VCNA 1UBSB 1BAPA 2GXAA 4IJ6A 2BF4A 2Z57A 5F7XA 1AXEA 4Q3EA 4B40A 1SXQA 5HS6A 4W7HA 1O8CA 3CZQA 3DXFA 4XDYA 1N75A 4B3GA 1E2EA 4BLRA 4DCVA 5J1TB 1H3EA 2QLMA 2LVBA 3OPNA 1KWGA 2O3RA 4CMEC 4XI9A 2OO5C 4F92B 2BUBA 3EDMA 4OJTA 4DJ5X 4AQYB 4PIPA 5H80A 4HWSA 1REQB 4AJPA 4QLAA 3ZE8A 1PJZA 2GM3A 4CM4B 2EFEB 3PSAA 3FDZB 3VU9A 2VJDA 3P9RA 3QBVA 1G55A 3OZCA 3WGZA 3E7DA 4DYHA 1DC6A 4MAFA 3PXBA 3S1AA 4RUKA 2BWJA 4NP6A 4TS4A 2EINC 1FSFA 2YIVX 4JLPA 2KC3A 4EKWA 2D74A 2R6ZA 1HQYE 1JT2A 2VHXA 1VBKA 3AUTA 3H7IA 3F6YA 2PTHA 4WY8A 1X74A 4LJ4A 2JIBA 1NBMA 2XF2A 4DGQA 3H2KA 4A2CA 4FC7A 4CDGA 2A0UA 1T2FA 2BGUA 1AZSC 2BHTA 3KPHA 1ML3A 1T3GA 1UZUA 2MSLA 5G2OA 1KJNA 2ZB4A 3KD3A 4R7TA 1SNYA 5FTKA 4EHDA 4C9BA 3NO4A 5B6PA 1YI0A 3WIOA 5KNCA 2Q5CA 2GTPA 4IJUA 5EP2A 3ROXA 3C5WP 3ZIBA 3AI1A 2HXYA 3RADC 2PZJA 2OO7A 2H51A 3R5HA 1I30A 2LCHA 3E05A 2ID8A 4LJ8A 2HJHA 4B87A 2KQ9A 1JQEA 2PX4A 1D2HA 3P9YA 1Y1TA 4KQ2A 4XB1A 5EE0A 1Z0KA 5J4LA 5DM1A 3DW1X 5CFLA 3F6PA 5I9NA 1G4WR 2Z5FA 4EG0A 5L7WA 3JVVA 4BKQA 2MMGA 4DBZA 3ZCXA 4J3FA 4CT5A 1JDBC 3L40A 4WOKA 3KALA 1LS1A 3DE0X 1CK4A 3K5WA 1A9PA 1IEVA 4EY5A 2JA1A 1GAWA 2P67A 3IIMA 2WM2A 1TCVA 4HDAA 5A3RA 4CWAA 3GJ3A 3JYQA 3EWIA 2E5FA 3U4GA 3EGDA 1J9GA 3MTDA 4R41A 4HLCA 3LO8A 3DNFA 1HEIA 1OZFA 1SB8A 2TYSB 4WZAA 1RAFA 1SURA 4IDBA 4UHJA 5TQVA 3OJXA 4EENA 2Z56A 2AW5A 3ND9A 1C02A 1R6TA 3NETA 3RRJA 4CF7A 2XZOA 1L5ZA 1T2EA 1Y48E 4E30A 2CZCA 1E3EA 1RS0A 4WZZA 3KFLA 3SJ7A 4DZZA 2R1TA 3L6UA 2LCFA 2RGWA 1T6YA 3FH0A 3TD7A 1MX5A 1UWLA 2OGUA 3MQ4A 1QSPA 4MEBA 5KQPA 5JDCA 1CUGA 2QTRA 3DR5A 3ORSA 2ERCA 1Z5PA 5AOVA 4M7WA 2VNJA 4K05A 2B4RO 2OAQ1 2QXTA 3ZLVA 5IKEA 1ECFA 5ARCA 1R5JA 1NYTA 2PT7A 2I7TA 2DZDA 2TRSB 4FNGA 2G3YA 3TOXA 3ZLTA 5P8WA 3P97A 5C51B 4GKJB 2VTBA 3GT0A 1UAAA 2GCGA 2ZRGA 3QSGA 4P4NA 2R11A 2DI3A 2Y1XA 3RROA 1L2TA 4UULA 1GNPA 3VPSA 1RPNA 2QX6A 2V8OA 4GYJA 1AGXA 3NEYA 2VHEA 2B8NA 4ZCPA 5IH7A 4P33A 2SKDA 2ZRCA 5B2FA 4JOBA 3L1IA 1T8RA 3JVUA 4U6SA 2PS1A 1A5TA 4WACA 4XCXA 1PR2A 4MX8A 1TGVA 1OUMA 3FRJA 4MV0A 2LD4A 1U9JA 1GAJA 2RCNA 4OAQA 4PTLA 2CW5A 1E64A 2OLJA 1IM8A 1BQ4A 1NPTO 1SO8A 3A9UA 4CPDA 3GLIA 2OQMA 2F4NA 5DH9A 4E5YA 2GYUA 4GRIA 4IDFA 1M56C 3D02A 1L7MA 3FMGA 2EWVA 3DEHA 5BQFA 1H1LA 5ICMA 3HU2A 1Z4PX 4M1WA 3FJ1A 4HAZA 5LA6B 1CUJA 1XKTA 2BRUA 3MWDB 3PC3A 5M34A 4G5RA 5YASA 5A6AA 1DSSG 1OXTA 3TX6A 3N76A 4LG1A 4OD4A 3E61A 3RJMA 1J0DA 3S99A 1M6WA 1W9HA 2NZ8A 1UBLS 1UFKA 2P5TB 2P91A 2RBGA 1OYOA 3BIFA 4H9GA 2ZB2A 4MTGA 4O1MA 1E3TA 1GYRA 4HWKA 5ALTA 1CJVC 4ZT5A 2ZUBA 3KQOA 3NTOA 1W35A 3KPWA 3L84A 3PGXA 4FEYA 4JFAA 4YP7A 2PUCA 1NW9B 2BKUA 2NACA 1RAIA 3ANSA 3GLHE 3P9IA 2OORC 2V74B 3H86A 4EYQA 3AGQA 3EGCA 3Q5DA 5G4KA 3S8YA 2GJKA 4EAQA 2WUVA 1EE9A 4QFCA 1OAOA 1SD1A 4CM5A 4E6PA 1ZX1A 2CBXA 2P40A 2C2GA 3MGGA 5C32A 5L0JA 3SS7X 2GESA 2EKLA 2FJ0A 1NBME 3OURA 4RYLA 1EDBA 3SJUA 1UBJS 4AN1A 3U19A 5A6JA 4B7UA 3BRWA 2CMHA 2BEKA 2QI9F 4K1OA 2WINI 2W58A 3U31A 4LV6A 4BCCA 4L5BA 4UM8B 3KS9A 4PXAA 4NECA 2ZIEA 4A3SA 2BGLA 4DSAA 3SZGA 3ASYA 3GRZA 4ENRA 1U04A 4FFNA 3KOZA 4HWPA 5B3SC 1VMIA 3T4EA 3JALA 1JAFA 2DHCA 3EMKA 3FY4A 4YQEA 5K51A 3UJ8A 4U5EE 1K5HA 1J0CA 5D1NA 3V97A 1LLQA 1TF7A 4YN0B 5C5EA 3KKLA 4JZKA 4WNAA 4KVZA 1IEQA 4RZQA 2HIHA 4A8JC 3I64A 5LLDA 1M7GA 5LU8A 4OY3A 2FNAA 1TZJA 2C78A 1TA9A 2CFIA 3K0CC 3LYHA 4WXRA 3N2EA 5EGSA 2Q6LA 3LHSA 1XMIA 1VSUA 4J16C 4X95A 2J8ZA 1PYOA 2D4AA 1RHKA 3G2QA 5JD6A 3C6YA 4RTLA 4P86A 4KPFC 4RHEA 1Z2NX 1LBSA 1KVQA 1SCUA 4JBNA 1NOJA 4X9XA 3DWEX 5JS5A 1X7WB 1DAGA 1R8YA 3UGPA 3L7BA 2BKXA 1QF9A 3O95A 1R1DA 3JQFC 4UMDA 1W4RA 5DWDA 2NIPA 4B79A 2QKYA 4JC8A 3IKLA 1OI3A 4D99A 1X7WA 5BV0A 4IEEA 5CB0A 3NBKA 4YMSA 2EDCA 1G3MA 4QRDA 4RPLA 4DBQA 4PJNA 1P60A 2YEVA 2R4UA 3H1AA 3JD3A 1LDEA 4ERXA 1U7DA 3BE6A 3D4NA 4NCNA 3WQRA 3JPWA 4GXQA 4OQQA 5E6RB 2GNAA 4X3PA 2B25A 4Y2QA 4YXWD 2D0IA 4FU0A 3CSKA 3GFBA 4PFJA 4BO5A 1LKXA 4PGAA 2H4ZA 5EHIA 4KO1S 3LEOA 3ZD8A 4HNQA 3IKMB 4BVGA 5CCBA 1G8AA 2AFHB 3OAAA 1X80A 1QF6A 2AOVA 4Z9HA 5EWMA 1UM9B 4BV8A 4I2NA 1EGQA 2RHLA 1P3JA 5KX5F 2VATA 1IXYA 1J07A 4XJSA 3RIMA 2H48A 2Y0PA 3VYTB 1A69A 5D3MA 7REQB 4IO0A 2B61A 3SYNA 2CD7A 4C5BA 4CKBA 1NV9A 1YE8A 3U56A 3LBHA 4JI8B 2AHOA 2JLXA 4CKWA 3ADPA 3NMJA 1L5OA 1W8IA 2K7FA 1N25A 1MJHA 4N3BA 3L7AA 2JFVA 2G7MC 4I55A 2NTJA 2MJLA 3W77A 4KG7A 3AVQA 3KTAB 4JUDX 5DLEA 1UBNA 1P72A 3NKVA 1FBTA 4LRQA 4MV7A 4O59O 3AIIA 4CV0A 1M2OB 2L6HA 1NFFA 1RQNA 3IT1A 1TL7C 1Y7IA 4LTDA 4PYOA 5CTAA 3ZWCA 1GTG1 1L7EA 1TEXA 2H1SA 1PTKA 2AGVA 3KKEA 4IJMA 2XBMA 1CW2B 3O4JA 1R9GA 4RFSA 2GN8A 3RVRA 4JBHA 4FNOA 2EG9A 4YALA 1WP4A 2MHRA 1YZCA 1FLNA 1NLMA 1RJ9B 5K8CA 1FSPA 2HH9A 4DRIB 5L45A 3I76A 3WJAA 3FW1A 4YWQA 5AW7A 4IRUB 4M9CA 5KWEA 1ZAKA 4GBJA 2HIAA 3U62A 3BXHA 3EG9A 1WCWA 3QEJA 3QVSA 2GAQA 3PC6A 2IPOA 2R1VA 5HKKA 2EFJA 1R5OA 4OGKA 1EFUA 2ZI9A 2OHOA 3FXHA 1GILA 3J7TA 4OUKX 1ODCA 1XV5A 2J3QA 4N6CA 5DNAA 1YCFA 3NONA 1FZQA 1ESZA 4R7GA 3NORA 4NE7A 1IN1A 3V4ZA 1V8ZA 1I24A 1QSGA 1U2RA 1TFOB 3A4IA 3ZW9A 5EKSA 4DWVA 4EY4A 1YONA 5IH3A 1U3DA 2XCSB 3NI2A 3T1NA 3QGMA 2X0RA 1EEXB 1DDOA 2GCPA 2XXBA 2YUTA 3FFWA 2PWAA 2IY8A 3GN2A 1Q1EA 1NYRA 4LDQA 2VBCA 2XVYA 3EQ8A 3GC6A 4IJKA 4DRXA 3ZG6A 3E1SA 3OA0A 1FMJA 3GWGA 3L4SO 5EA2A 3T9AA 3F47A 1RXCA 4G01B 4L8YA 3BL8A 1DJOA 2GQ0A 1ZCJA 3KVOA 4JCOA 4KPUB 2WILA 3AM3A 3BAFA 4HB2A 5G0TA 1XZAA 2HUPA 4S24A 4BJ6C 3RIYA 4XM0A 4LC0A 3ITDA 2AOUB 1I5OA 2OGSA 3SJBA 5A4JA 3PE6A 1KPHA 1ILWA 1QE0A 3KR0A 4EW2A 1UC8A 4F3RA 4BXOB 2J67A 1CSEE 1K9VF 4NCAA 5K05A 2HADA 1GTL1 1XELA 2Q4EA 2CDNA 5FQOA 2OV8A 4Q05A 3EUAA 2HN9A 4KMOA 5GAJA 1NN5A 2VS1A 3HBFA 4CLOA 3D3WB 5AI4A 1K97A 5CK4A 3WE7A 5CA0A 5MGNA 1VJTA 1XU7A 4OHWA 2WAAA 4IWXA 5CG2A 1JDUA 3LKZA 4D8YA 1MVNA 3MBGA 1Q2UA 3FDXA 4Q9LA 1GDHA 5F52A 3T3HA 3I09A 4M60A 4CQJA 4OHUA 2JBHA 2HHHB 2NU7B 1P5HA 4LQDA 2G88A 3MHTA 1SHTX 1G5RA 3ZSUA 4YIHA 2MYSA 2ALJA 1WMDA 3NJ4A 5JZVA 2VCCA 2PX5A 1N1MA 1G5FA 4FWTA 4LXIA 3RTEA 5LIRA 2R2GA 3IEIA 1Q91A 3CCCA 4KI7A 2A35A 3W0LB 1YZFA 2VJOA 3BGSA 5AVUA 2JJ1A 3PRHA 4XGRA 3WRXA 4E17A 3ELWA 2CVHA 3BX1A 4B1FA 4Z1MD 1TM4E 3F7NA 1YR1A 5FHQA 3QJYA 5E6UA 3WLIA 3GODA 2GBGA 3KC2A 2PA0A 1Q0FA 2GUGA 3NGMA 4OHMA 1JEDA 2J59A 1F5SA 2QT9A 3RBXA 4UTRA 2QN2A 2IU0A 1JU3A 4GT1A 4R6XA 1ZC3A 1DV2A 4TUYF 1ZK4A 2BGIA 4PVCA 1F2UB 1HO3A 2WWIA 4CTJA 4XX0A 1V9CA 1D6MA 5M29A 1XRLA 1GSIA 4G0YA 1SAYA 1FJXA 3NYWA 5I3ZA 5E3JA 3UF0A 3RF6A 5H59A 2WEKA 3QMWA 4HN9A 4IHJF 1Q0QA 3TZKA 1HDRA 3IHUA 4ZOBA 3X1ZA 3W34A 3AVOA 5JZ9A 1KZ1A 1YDGA 2UZ1B 4JS0A 3R20A 3H5LA 5GONF 3LQ1A 5IBQA 2D62A 1LY1A 2R8PA 2NV0A 1N0IA 2QTZA 2R5WA 4EZBA 2C4TA 2H5EA 3EGIA 1H7IA 3KSRA 4JJ4A 1CUHA 3VU9B 2ZSIA 1P0QA 4REOA 2Q3JA 1LK0A 2WE8A 3S55A 1TQ8A 4V0NA 2R7VA 1X1DA 4U9UA 3BGOS 4LYYA 4Z54A 1TVEA 3GRPA 4ZK2A 5JSLA 1ZXBA 2VVTA 3LBIA 4G8BA 3B0UX 4R1NA 1DUSA 2XYRA 1DAMA 4RTNA 2XCRB 1Z28A 5KIAA 3GAMA 4B17A 2MMCA 1RZRA 4Q1EA 2QMUA 5H82A 3C6KA 2WYUA 2UAGA 3ZIDA 1ZUNB 3FDJA 3FMOB 3PJDA 1MB3A 3GEDA 2AN5A 4YEDA 2O8FB 5ES4B 3EIUA 1E79A 2EFGA 1FUKA 2FSVA 2R7TA 1A2QA 1U81A 3GI1A 4F3YA 2PUWA 1VPVA 5IJXA 3RWOA 1JQJC 4IRUA 2CEKA 5T6MA 1ZC4A 2FEWB 3DDUA 1SCAA 2V6FA 2WG0A 4QQRA 1R4NA 4X00A 4Z9IA 4R3WA 3TOVA 4MVUA 1V37A 1X1EA 4G26A 1GPYA 3E7PA 2WZQA 4GEGA 3RVZA 5DI3A 1N0HA 1C1DA 5CVCA 3WNDA 4D97A 4YRGA 3UGTA 5ADHA 2ZSJA 3PPYA 3SIRA 3WL4A 2R7UA 1YZHA 1CWUA 2ZJ6A 5JO9A 1E2FA 4G0ZA 1GDDA 3FA2A 4U63A 4D4HA 4G5HA 4AJIA 4FE7A 1Y6RA 2NUTB 1GL3A 2A1DD 2E4VA 2OFWA 3N86A 2VCYA 2ZVDA 3QYPA 1R0YA 5FLEX 2OB2A 2J0UA 4N7MA 1DX6A 1QE3A 3AR7A 5JWOA 5BN1A 5LYJB 1WB5A 4IV5A 4XR4A 4F4BA 4A9AA 1U8EA 4PCUA 3EXHC 4RTMA 2O8CA 3PC8A 4RMHA 1XQVA 3ED1A 3K32A 2ZBFA 3CO5A 4FGKA 1FNTc 2YINC 3IUEA 2FDXA 5TEWA 1S7CA 1P62B 2HF8A 2ODBA 2Z6VA 5BORA 3HO1A 2GVZC 1C3JA 1K98A 4ZOLA 5DEOA 2NU6B 1TLLA 3KYBA 4A03A 3ZBTA 2WQ6A 4TWRA 2O4CA 2Q27A 2ZBVA 3LF2A 3R3SA 1WBBA 1NY5A 4OAOA 2J5XA 3H11A 3RUAA 4Q4CA 1JDTA 5B58C 1A98A 2HWUA 5IYZF 4BATA 1JFSA 3GEEA 1NJGA 1U3WA 4MPRA 2E1RA 3AJEA 4AT1A 4OYRA 3GMTA 2CDCA 1F12A 5ED0A 5JLAA 3ZY6A 3IFSA 3FUWA 1KI2A 1QQBA 1H8HD 4Y6GB 3T7EA 2E3JA 4L7QA 1UXHA 1Z15A 3OCVA 5LM3A 4C6RA 4DUGA 4RHUA 4EX6A 2O2XA 1A1VA 4YRTA 3UAWA 2XNJA 1KK1A 3TL6A 2CF6A 2XXJA 4PYIA 5SY9A 3BRCA 1KK3A 1UT6A 2ZXRA 1XNHA 2ETSA 3W7AA 4NCQA 4DLSA 4E5DA 1Z7Qc 1QCCA 5EWJB 3DAFA 2NNLD 5LVAA 1B42A 2I7CA 3PITA 4DNQA 5HM8A 1UT5A 3X1YA 3UOAB 2XEXA 2ZBPA 1ZL2A 3A4TA 3ZNQA 4G9EA 2EHDA 1S05A 2NVWA 3BRSA 3C5CA 1FTWA 3UG6A 3FOPA 1MQSA 1ZGHA 5BV2P 4DSZA 3KJEA 1GQQA 2VN8A 4ND8B 1QKJA 1V16B 5K1ZA 3UAZA 3ABMC 5C1OA 3HN2A 3FHDA 3A31A 4ZANA 2D06A 1WKVA 5IZCC 4F2GA 1K04A 1PJTA 4QGBA 5DLQC 3RUHA 4GQBA 2GAAA 1RJ9A 1E9EA 1QAOA 1ZHXA 4QDTA 4AP6A 2X7JA 2ZRDA 3GD7A 1UJCA 4LJLA 3JD4A 3M5WA 2PBFA 1POWA 1W48A 2V7QA 1OFUA 3DE4X 3R5JA 4B4WA 2DWPA 4CODB 5CFMA 4MULA 2CNOA 4G2TA 1G5PA 2YFQA 1L7NA 2PMFA 1Y98A 3WXMA 2C00A 1RP7A 3OOWA 5EQDA 2Q29A 2XLDA 4F5EA 3G9XA 2J4CA 3S44A 1N5KA 1GZ6A 3SZUA 3WGOA 2ZI5A 4RDAA 4PW0A 1QK5A 3CLTD 3KEQA 2AG8A 4RIGA 1KAMA 2OQIA 3DVQX 3ZCTA 3IAXA 1M5UA 4AMVA 2O2GA 4M0UA 4K0DA 3A05A 4OQXA 2G3KA 1EFVB 2KM1A 2XWQA 3EXEB 3DPIA 1ZIPA 2F3TA 3DVAA 3P19A 5BUCA 1N7IA 1QIFA 4Q5SF 3DEKA 3JQ9C 4YCAA 4MWCA 2AOWA 1BMTA 2QGZA 3BWVA 3KLPX 3Q4GA 4IGIA 1OXXK 4XM1A 2F1IA 4UVGA 2FWJA 3HB5X 5CHEA 1S1MA 4PFQA 3RVKA 2BOVA 4CDVA 4EG4A 5BMVF 3L2OB 1L4HA 2W2XA 3UIEA 4KE6A 4JOQA 1DELA 2O14A 1URPA 5BSUA 3ZE9A 1C80A 4HTFA 1F8FA 2MHCA 1NULA 1XLTA 2AF3C 2GFHA 2Q3HA 3HZZA 3KVRA 4FBGA 3U3BA 4ZC1A 1FIUA 1R18A 4M1SA 1RWVA 5DMXA 1Y1SA 2CHFA 2M6RA 4E0IA 2FUCA 5AC4A 2QQ5A 3OEED 2LW7A 4QEKA 1L5KA 2JC3A 2HX1A 1PT9A 2R60A 3PZRA 2YV5A 3G68A 2WYIA 5I7SA 5I7HA 4FCVA 5A5FA 1RQ2A 5DK4A 1FU8A 2QQ0A 1XQ6A 5JH7B 3DBHA 4P5PA 4ZO9A 2PGLA 5E0KB 3ZWPA 4UREA 2DBVO 5IBPA 3RDPA 3ZWIA 4E14A 2AEJA 2QE9A 1LVKA 4I4TB 2V9CA 3G9QA 4H1TA 4Q9KA 2FG6C 2PK3A 1Z8NA 2ISSD 3LLCA 1PUJA 4EPXA 2RAUA 2BE7A 4YJGA 5K3FB 1QFXA 5TF4A 5LQSA 1IYZA 1QCDA 1NBEA 1TUBA 1JXMA 2OMEA 3MD0A 3TGPA 3L0BA 2GEKA 4N49A 2IUSA 3DLAA 5T6BA 4A4DA 4Y9DA 1TI7A 1FUIA 5JAHA 4J1NA 4AUMA 5AXBA 1EWQA 2JHCA 4ZRNA 1G8MA 3BSYA 1MAWA 1JVBA 3AM4A 4MKGA 4O25A 5FUMA 1UBMS 1ZINA 1NF3A 3FNQA 3B1FA 1QG0A 4RANA 4BQIA 2D8AA 4DVJA 1JHPA 4HX2A 5E1DA 1M2VB 1XK7A 4ETMA 1AC5A 3PG5A 4U2GA 4UMVA 1EM8B 1M73E 3T7IA 4MI6A 5BSMA 4BX9A 4CDRA 1UINA 1CFZA 4Q9NA 1G21A 3D3KA 3MT7A 1V54C 1L4YA 4X7MA 2FE4A 4OLAA 3OLYA 2MSKA 3HFSA 1VHLA 3DT9A 4DDKA 4ZA2A 3D2AA 3EXG1 1Y8QB 2XUAA 4P3XA 5K8VA 3VYWA 3GQBA 2E85A 1A9ZA 3OP4A 4IDPA 1V43A 4HDKB 3ZQYA 2AMFA 3VC1A 4KZPA 3KCQA 1Q1NA 1Y6ZA 2R6R1 3KMIA 1NBHA 1YQXA 4B32A 1EP2B 3HO6A 2HXSA 5K09A 4JJZA 3EW7A 1AQLA 4HAOA 3B5EA 3ZWYA 2HTEA 4HGYA 3H2UA 2BEWB 3WRXC 2AOXA 3IAUA 1O6ZA 2HO4A