1TFOB

Ribonuclease from escherichia coli complexed with its inhibitor protein
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
86
structure length
86
Chain Sequence
KMAMIDLAKLFLASKITAIEFSERICVERRRLYGVKDLSPNILNCGEELFMAAERFEPDADRANYEIDDNGLKVEVRSILEKFKLH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin/toxin inhibitor
molecule keywords Colicin D
publication title Relation between tRNase activity and the structure of colicin D according to X-ray crystallography
pubmed doi rcsb
source organism Escherichia coli
total genus 27
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 2004-05-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.650 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Colicin D 1tfoB00
1V74B 1TFKB 1TFOB
chains in the Genus database with same CATH superfamily
5COMA 3CZ6A 3B29A 4K7BA 3H65A 3RIPA 4OIPF 4O6YA 1H7IA 2AVKA 1K04A 5D91A 1OW8A 2Q9CA 3FAJA 4E7ZA 3QW1A 1E2XA 4PFPA 4W8KA 3SXKA 3C18A 3RQGA 3ZSUA 4CS8A 3Q7LA 4LLCA 1AVOB 4E0IA 2J0WA 3FOPA 4D4NA 4FAPB 4DBRA 2AU5A 4E7SA 3QW0A 1HMDA 4ZLDA 3MBGA 1YZCA 4JVSA 3V7OA 1YARO 4CS7A 5L3VA 1XWJA 2B0HA 4DVYP 1NU7D 4EIYA 2R7QA 1OCOC 1WOLA 1MMDA 1ORJA 1G5ZA 1WGWA 1F1MA 2HSBA 3KYIA 3NYJA 4LLEA 1NSGB 1NZEA 5TJ5E 3FDQA 4I1MA 5T3TA 3U8VA 2L7AA 3IQ5A 1AEPA 4XPWA 3BEHA 1D0YA 2WVOA 4L6RA 1MNEA 4Z9IA 2V3CC 1LS1A 3G4ZA 2HV6A 3JSEO 4LDRA 3CQZA 3K33A 1GS9A 2J46A 3CAXA 4XEKA 3LNMB 4IWBA 1Z7Qc 2Y39A 3N2ZB 1FR0A 3M79A 4YJWA 5COFA 2OCCC 4WGZA 2A1DD 3TK0A 4EKWA 4U5BE 5HV9A 2R7XA 3M4BA 5DQZA 2D5RB 3SXMA 5AGFA 3X2QC 4NY3A 1O3UA 3WG7C 3H2UA 2L81A 1C17M 3SEOA 3AG3C 3ZWIA 1ZHYA 4K1OA 2YLIA 5CI8A 5IY5C 1FAPB 3B0VC 3SYNA 1MMGA 3ZDLA 1GGQA 1JPNA 2ICWG 4AX2A 1QLEC 2KQ9A 2WZFA 5BQGA 2A6HF 2Q9AA 4WJ0A 2FGYA 3IEEA 4AL0A 4E18A 1OKKD 2H7BA 1Z23A 1ORSC 2IXOA 1OCCC 2R7VA 4M63A 2QLAA 1DOWA 4MW3A 3SXYA 4DRIB 1EKYA 2PBEA 3KYJA 4J30B 4YT2A 5KYXB 2XRHA 3EFOB 4LERA 2J45A 2L6GA 3JRMO 3AJMA 3OEOA 2VH3A 2Y3HA 2Y3BA 4P6IC 2F22A 3EH1A 2EINC 2XLVA 4WGYA 1GQAA 4JURI 1TWCA 3LS0A 4E0HA 3UNGC 1RJ9A 4KBLA 2AWCA 4CSAC 1JAFA 4GQHA 3J06A 3L34A 1HW2A 1H9TA 5KYYB 1T01A 4OIQF 3C63A 1Y4CA 1ZHWA 3MLGA 4YL0A 1VMAA 3A9CA 3LLKA 4OD5A 3JCUQ 3ZC4A 2OJED 2XL6A 2GFHA 3DAGA 3VRCA 1L7CA 4OIOF 1M57C 2ZD9A 3CEXA 2EIKC 5JP7A 4MNDA 3RQEA 256BA 3AG4C 2HUJA 2HS5A 5D92A 2PP4A 2BL2A 5BQHA 3CSKA 5E33A 3RFYA 1L3PA 4JTCB 3K1HA 4H4KC 2AP3A 4JW1A 4EBBA 4R32A 2GAQA 5A6AA 4MW8A 1QZXA 2XS1A 4U5DE 3HKKA 4NTFA 4EBJA 2RSEB 2CNWA 2HFIA 1OCRC 2VB6A 4JJGA 4O7GA 3GANA 4A2NB 3HTKC 3W2VA 1N1CA 3LESA 3JYHA 1Z3IX 4PJLA 5BQIA 3JZ0A 1ZHXA 2D4UA 3GEHA 2KNHA 3GM1A 4U5FE 4C3DA 3SP1A 1PD1A 3M15A 2C03A 1D1BA 3VYWA 5AC5A 1JR8A 4J7YA 1M2VA 4O6MA 3EH2A 2PF4E 5B3SC 2OKUA 5L0IA 1LVKA 1XZQA 4FWVA 4KI2A 4NQFA 3V5ZA 2Y3DA 1QVXA 4ULVA 1K05A 3FHDA 4JE9A 1VLTA 1SF8A 2R7TA 4ANJA 3QMKA 5F28E 2O9XA 2WVNA 5KYWB 1Z6AA 1FFHA 1YZAA 3O6XA 2ZXWC 2ZXOA 3M4CA 3W8HA 1LM3B 4MVQA 2IYLD 1Q0DA 2X51A 1SZIA 3E70C 3QZCA 3DE9A 4N6HA 2XLDA 1RMVA 3HLZA 1NLXA 1M56C 3N0TA 1BBHA 3E9VA 3S29A 1CPQA 2DYRC 2EPMX 1G8XA 3C8GD 2DB4A 2RD9A 3T6JA 3NDBB 5B3IA 2J9VA 2XS8A 3JT1A 1T9KA 3ATPA 3L0IA 3LEVA 3OA1A 3Q6NA 4DBQA 4JCZA 2WVQA 4MVMA 5GPGB 2YQYA 1WTYA 3FMSA 1S7ZA 3HJCA 2NUTA 2P61A 1HY5A 1NFOA 3O10A 3SNHA 2KYHA 1E85A 3U9JA 4CS9A 2NPUA 1APCA 2KK1A 2LP4A 2YL7A 3LLIA 3IPMO 1ZZPA 2PX3A 3RF3A 1JOGA 1ST6A 2G62A 2J8WA 3GODA 1CGME 1UFBA 2W4MA 4IAQA 3EHMA 3S84A 2WL8A 2HJMA 1MNDA 4FESA 2YKZA 4AL1A 2OJQA 3RVYA 1BDJB 1LIHA 2LCHA 4GYTA 1JRAA 1TKNA 1OR2A 3UR3C 1J8YF 1D1CA 3HNIA 4NC3A 2PFDA 3U2LA 4C3BA 3SZRA 3MFNA 1ZW3A 4LACB 4NCQA 1LI5A 2HMZA 2Q4FA 3GORA 4AE4B 1RXQA 3LUTB 3AG2C 4DJ9A 4J7TA 2QUPA 2NUPB 4BJ5C 3Q7GA 1BR4A 1U6HA 2Y69C 4XLPF 4G0HA 1WWPA 4CX9A 2CYDA 1R4TA 1YAUO 3K6BA 4RBNA 2QTVA 3EZHA 4U9EA 3ZQYA 2FFHA 4PACA 2IXMA 4PR9A 5A6JA 3POVA 5T1DB 1ZYRF 2QY9A 2XXAB 3N24A 4ER9A 2HKVA 3K1IA 5L0DA 1AUEA 1T6UA 2EILC 2ZXPA 3ECSA 3DZAA 2A6EF 2Q9BA 1YYJA 2W4BA 2CDQA 2BE5F 4JC7A 3I4UA 5L0CA 4EWCA 2YRFA 2ASRA 2KSFA 3NYMA 3ZQVA 1KNYA 1QSPA 1S05A 2JPUA 2VCCA 4IGGA 5A6BD 3HNLA 3UGPA 3O39A 2KC3A 4XWJA 4Z9JA 4I1OB 4X0RA 3TOLA 2IXNA 2XLHA 3WAQA 2YZSA 3EPVA 1A7VA 3GM3A 3QVYA 5KYUB 4AK9A 1Q0GA 2EPLX 2VC9A 2R7OA 3NRHA 1OW7A 2P7VA 3EZIA 2OEVA 3WODF 5KYXA 3VF0A 2R05A 3EFOA 1QKRA 2GA0A 3B0UX 3FVYA 4EBKA 2R7RA 2WZGA 4JTDB 3ZTMA 5A69A 1SYQA 4RD9A 3O55A 4YL1A 4CJGA 1QPUA 2WZLA 1LE2A 1YLMA 1VLSA 1TFKB 1C03A 2GDCA 3AGUA 1CPRA 2J7PA 2R02A 3DM9B 4YN0B 3TJ5A 4CS8C 3K66A 4XPYA 4CS9C 5A6KA 5KYYA 3EGXB 1FNTc 2R7UA 1E83A 3C8GB 4I3MA 4CDYA 3V5XA 3NMJA 2OU6A 4YT5A 2KGOA 2DI3A 2JD3A 1PD0A 4PJMA 3PDMP 2YL1A 3GWNA 2YVKA 4O79A 4ZLCA 1BR1A 4ULWA 1WATA 3VM6A 1PCXA 1VYKA 4MVSA 1A0BA 1Q0KA 1RKEB 4MTOA 3C7JA 4YT8A 3DJNB 3NKEA 3DXJF 3I5QA 3EQLF 5B1AC 3U0CA 2L9JA 2HSQA 2XM0A 5COGA 1SMYF 3MYFA 1LE4A 4Q5SF 5L0JA 4K0DA 5JVEA 1WASA 1UG7A 1ZHZA 4H54A 4Z9HA 3PHF2 2BC5A 2Q7RA 2LK4A 3EGDB 4JTAB 3RW0A 3T9OA 1U89A 4ONSA 4U9DA 4CDVA 3TJ6A 3S90A 1SR2A 2G3VA 1OR3A 1MMNA 3JSZA 1Z63A 3A11A 2I15A 4KC9A 2P1AA 4DRJB 2KJGA 3H2VA 2A0BA 4XLNF 3K1IC 3UMIA 3QTHA 2IOQA 5E3CA 1O5HA 2XM4A 5EK0A 3B71A 1EQ1A 4E17A 3ASNC 3NG1A 1A7DA 1ORYA 4XQ1A 2EPKX 4BEMJ 5DVWA 1MQVA 4CDAA 1VOMA 2I8BA 3NMKA 2H8AA 3ABLC 3F46A 4GEHA 2X0CA 1TWHA 1NFNA 4HFKB 4JKVA 4PJJA 5HSWA 1M2OA 4N6CA 3UGOA 2OQMA 1YYXA 2H7VC 2CW0F 2R7WA 5DS4A 1BR2A 1RKCA 3UMKA 4CBEA 1OXBA 1TR2A 2NSFA 3LEOA 4IAOA 2QE9A 3OWTA 4J32B 3W8IA 5KYWA 2M64A 1E86A 2R25A 1E84A 1YJGA 3AOUA 1HE9A 3TD7A 1B68A 4BJ6A 1ZW2A 1NBBA 1TQGA 2LD6A 2XL8A 3DI5A 4LDQA 4OINF 4JEAA 1YA9A 2V26A 2L6HA 3JRTA 2J0XA 1D0XA 2J9WA 3EG9B 4IJJA 1T5OA 2PNOA 3R2PA 4PFOA 1TWGA 3U3FA 1OKKA 4YT4A 3DD7A 5CI9A 4BPMA 1VYIA 2DGJA 2Y3GA 4NTAA 1YVIA 1ZHTA 2P0NA 3GEEA 4MTGA 5L3QA 2DYSC 3ZIBA 4EUKB 4UDVA 4OIRF 4B6IA 1R5ID 5E3AA 4FX5A 3U2MA 4DRHB 1A7EA 1XZPA 1IZMA 5E2QA 4JZAA 3WHNA 3FAPB 4CIPA 4JJFA 2AWYA 4U5GA 4DOZA 2LIGA 2IXPA 1C02A 5AC4A 2EIJC 2CNWD 1I4ZA 1CGNA 3G50A 4U5HA 3QVZA 3NYLA 3ITFA 4C7OA 3B9QA 2MYSA 1G4US 2OG2A 1Q0FA 1T6IA 2OOCA 2YLGA 3LAYA 4MS2A 3JYYA 1Q0MA 4PK4A 2E87A 1YDIA 2R03A 1HW1A 3KMIA 4MVOA 4XTKA 4IARA 1V4AA 2R9RB 4P9FA 5L0GA 4AE4A 4EHPA 4YWQA 1JMWA 3SXZA 4KNWA 2MWQA 1HMOA 2NUPA 2EPNA 3ABKC 1EI7A 2LFDA 1BZ4A 4MVZA 5KYNA 2Q00A 4G7HF 3S28A 2XLWA 3UMHA 1H6GA 2YL3A 3TQOA 2YWAA 5BUOA 3ZG1A 4CIHA 2TMVP 1V55C 4N4WA 3GM2A 4F4BA 4MTFA 3T6BA 1FMVA 3DMDA 3IQCA 2XXAA 2WB7A 5FZTA 1T6QA 2YLDA 4PJNA 2YL0A 3Q6MA 1WN0A 2J9UA 2IBFA 2L6FA 4HEAJ 3U9MA 3AQBA 1KTMA 2CCYA 3PCVA 1G4WR 3IHUA 4G7ZF 2A68F 2HMQA 4JIOA 4XEFA 4Q7CA 2QNLA 5CIVA 1ZVZA 2CGEA 2EIMC 3C62A 4CJOA 4WABA 3VAYA 2A69F 2VCBA 5B1BC 3KKBA 1FTSA 3DJUB 2YHSA 1EA8A 5KYUA 4BG0A 4BJ6C 3F47A 3RKOF 4D4XA 1K40A 4DVZA 5EHHA 3RVZA 2YEVA 1MMAA 3W2WA 3LS1A 2MHRA 2HZ8A 1RJ9B 1D0ZA 2VCAA 3JTLO 4LDKA 4U5CE 4YK5A 3X1OA 3S27A 3PMRA 1YA7O 3NKDA 4QI2A 2PX0A 1H9GA 1V74B 4KNVA 4G78A 1OXKA 4QDLA 2XL4A 2NG1A 2H7OA 3KL4A 2LQGA 2XLOA 4O6NA 1J8MF 4XEVA 3MYIA 5DS5A 3DM5A 2KW3C 3T6GB 1TWAA 3EGXA 1NU9C 3HNKA 3C8GA 4JEBA 3RH3A 5JLIA 1I4YA 2M4EA 3I5PA 3M1CB 3U3BA 3LJBA 3RQFA 3T4RA 2JX0A 2EPOA 2ZXRA 2Z15A 3G4XA 1LS4A 4Q4ZF 3L8IA 3IQ6A 4I44A 1FMWA 1VK5A 1RKEA 3DKAA 3IQTA 4QI0A 4DXWA 1GM5A 1FFTC 3U8PA 1VTMP 1VB5A 5L0HA 1A41A 1OW6A 2R7SA 3ZVRA 4P9TA 1Z5ZA 3AGTA 1U0BB 3AQCA 3LNRA 2HJ3A 1TFOB 2LFFA 3EGDA 1LPEA 4XPXA 4BJTA 2XLMA 4C3EA 3B0PA 1M6TA 5DLJA 3L8JA 3KH2A 2W9YA 3ABMC 2XSEA 2C04A 4MVRA 2UUIA 1IW7F 1HE1A 4YL3A 4N06A 5T3WA 1DOVA 3KPHA 3DWWA 3TOMA 4G7OF 5F5HA 1CGOA 3ASOC 3V5YA 2G3KA 4IB4A 4BJ5A 4BEJA 5JS5A 5L0FA 4MQ9F 3TULA 2FAPB 1M2VB 2HV7A 3FXHA 2W45A 3NMIA 2GWWA 3HNJA 4W8PA 3BRJA 1JPJA 2ETSA 5JSLA 4JRZA 2NSGA 5JRAA 3DE8A 2J9BA 1I5NA 4NTBA 1ZU5A 2IM8A 4RDAA 2A0UA 3RYLA 1OQCA 2P6VA 1QQ3A 3GEIA 5FCLA 1PV3A 1D1AA 1RCPA 2LSEA 3AG1C 4IRUA 5EGYA 5JUAA 4HFFB 1Y6DA 1NG1A 4JCHA 3GWLA 2J7PD 3EHNA 3EJNA 3FOOA 3L1MA 5DQTA 3S9OA 1V54C 4A4AA 3US6A 3DAFA 1O87A 2UUHA 3U5SA 3S0XA 1W2WA 5F5FA 4HE8D 1LKXA 1OCZC 5JT4A 3R7CA 4C7OB 1KU2A 3C8ZA 2B0JA 3MX3A 4BJ1A 5DS6A 2OEXA 3ZTZA 3EG9A 5A6BA 2Q3TA 1ZU4A 3W4YA 2XLEA 4CSAA 1LI7A 4OD4A 2ZPAA 4MVUA 2NUTB 4U5EE 5K0IA 2VASA 3K7DA
chains in the Genus database with same CATH topology
1V74B 1TFKB 1TFOB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1V74 B;  1TFK B;  1TFO B; 
#chains in the Genus database with same CATH topology
 5COM A;  3CZ6 A;  3B29 A;  4K7B A;  3H65 A;  3RIP A;  4OIP F;  4O6Y A;  1H7I A;  2AVK A;  1K04 A;  5D91 A;  1OW8 A;  2Q9C A;  3FAJ A;  4E7Z A;  3QW1 A;  1E2X A;  4PFP A;  4W8K A;  3SXK A;  3C18 A;  3RQG A;  3ZSU A;  4CS8 A;  3Q7L A;  4LLC A;  1AVO B;  4E0I A;  2J0W A;  3FOP A;  4D4N A;  4FAP B;  4DBR A;  2AU5 A;  4E7S A;  3QW0 A;  1HMD A;  4ZLD A;  3MBG A;  1YZC A;  4JVS A;  3V7O A;  1YAR O;  4CS7 A;  5L3V A;  1XWJ A;  2B0H A;  4DVY P;  1NU7 D;  4EIY A;  2R7Q A;  1OCO C;  1WOL A;  1MMD A;  1ORJ A;  1G5Z A;  1WGW A;  1F1M A;  2HSB A;  3KYI A;  3NYJ A;  4LLE A;  1NSG B;  1NZE A;  5TJ5 E;  3FDQ A;  4I1M A;  5T3T A;  3U8V A;  2L7A A;  3IQ5 A;  1AEP A;  4XPW A;  3BEH A;  1D0Y A;  2WVO A;  4L6R A;  1MNE A;  4Z9I A;  2V3C C;  1LS1 A;  3G4Z A;  2HV6 A;  3JSE O;  4LDR A;  3CQZ A;  3K33 A;  1GS9 A;  2J46 A;  3CAX A;  4XEK A;  3LNM B;  4IWB A;  1Z7Q c;  2Y39 A;  3N2Z B;  1FR0 A;  3M79 A;  4YJW A;  5COF A;  2OCC C;  4WGZ A;  2A1D D;  3TK0 A;  4EKW A;  4U5B E;  5HV9 A;  2R7X A;  3M4B A;  5DQZ A;  2D5R B;  3SXM A;  5AGF A;  3X2Q C;  4NY3 A;  1O3U A;  3WG7 C;  3H2U A;  2L81 A;  1C17 M;  3SEO A;  3AG3 C;  3ZWI A;  1ZHY A;  4K1O A;  2YLI A;  5CI8 A;  5IY5 C;  1FAP B;  3B0V C;  3SYN A;  1MMG A;  3ZDL A;  1GGQ A;  1JPN A;  2ICW G;  4AX2 A;  1QLE C;  2KQ9 A;  2WZF A;  5BQG A;  2A6H F;  2Q9A A;  4WJ0 A;  2FGY A;  3IEE A;  4AL0 A;  4E18 A;  1OKK D;  2H7B A;  1Z23 A;  1ORS C;  2IXO A;  1OCC C;  2R7V A;  4M63 A;  2QLA A;  1DOW A;  4MW3 A;  3SXY A;  4DRI B;  1EKY A;  2PBE A;  3KYJ A;  4J30 B;  4YT2 A;  5KYX B;  2XRH A;  3EFO B;  4LER A;  2J45 A;  2L6G A;  3JRM O;  3AJM A;  3OEO A;  2VH3 A;  2Y3H A;  2Y3B A;  4P6I C;  2F22 A;  3EH1 A;  2EIN C;  2XLV A;  4WGY A;  1GQA A;  4JUR I;  1TWC A;  3LS0 A;  4E0H A;  3UNG C;  1RJ9 A;  4KBL A;  2AWC A;  4CSA C;  1JAF A;  4GQH A;  3J06 A;  3L34 A;  1HW2 A;  1H9T A;  5KYY B;  1T01 A;  4OIQ F;  3C63 A;  1Y4C A;  1ZHW A;  3MLG A;  4YL0 A;  1VMA A;  3A9C A;  3LLK A;  4OD5 A;  3JCU Q;  3ZC4 A;  2OJE D;  2XL6 A;  2GFH A;  3DAG A;  3VRC A;  1L7C A;  4OIO F;  1M57 C;  2ZD9 A;  3CEX A;  2EIK C;  5JP7 A;  4MND A;  3RQE A;  256B A;  3AG4 C;  2HUJ A;  2HS5 A;  5D92 A;  2PP4 A;  2BL2 A;  5BQH A;  3CSK A;  5E33 A;  3RFY A;  1L3P A;  4JTC B;  3K1H A;  4H4K C;  2AP3 A;  4JW1 A;  4EBB A;  4R32 A;  2GAQ A;  5A6A A;  4MW8 A;  1QZX A;  2XS1 A;  4U5D E;  3HKK A;  4NTF A;  4EBJ A;  2RSE B;  2CNW A;  2HFI A;  1OCR C;  2VB6 A;  4JJG A;  4O7G A;  3GAN A;  4A2N B;  3HTK C;  3W2V A;  1N1C A;  3LES A;  3JYH A;  1Z3I X;  4PJL A;  5BQI A;  3JZ0 A;  1ZHX A;  2D4U A;  3GEH A;  2KNH A;  3GM1 A;  4U5F E;  4C3D A;  3SP1 A;  1PD1 A;  3M15 A;  2C03 A;  1D1B A;  3VYW A;  5AC5 A;  1JR8 A;  4J7Y A;  1M2V A;  4O6M A;  3EH2 A;  2PF4 E;  5B3S C;  2OKU A;  5L0I A;  1LVK A;  1XZQ A;  4FWV A;  4KI2 A;  4NQF A;  3V5Z A;  2Y3D A;  1QVX A;  4ULV A;  1K05 A;  3FHD A;  4JE9 A;  1VLT A;  1SF8 A;  2R7T A;  4ANJ A;  3QMK A;  5F28 E;  2O9X A;  2WVN A;  5KYW B;  1Z6A A;  1FFH A;  1YZA A;  3O6X A;  2ZXW C;  2ZXO A;  3M4C A;  3W8H A;  1LM3 B;  4MVQ A;  2IYL D;  1Q0D A;  2X51 A;  1SZI A;  3E70 C;  3QZC A;  3DE9 A;  4N6H A;  2XLD A;  1RMV A;  3HLZ A;  1NLX A;  1M56 C;  3N0T A;  1BBH A;  3E9V A;  3S29 A;  1CPQ A;  2DYR C;  2EPM X;  1G8X A;  3C8G D;  2DB4 A;  2RD9 A;  3T6J A;  3NDB B;  5B3I A;  2J9V A;  2XS8 A;  3JT1 A;  1T9K A;  3ATP A;  3L0I A;  3LEV A;  3OA1 A;  3Q6N A;  4DBQ A;  4JCZ A;  2WVQ A;  4MVM A;  5GPG B;  2YQY A;  1WTY A;  3FMS A;  1S7Z A;  3HJC A;  2NUT A;  2P61 A;  1HY5 A;  1NFO A;  3O10 A;  3SNH A;  2KYH A;  1E85 A;  3U9J A;  4CS9 A;  2NPU A;  1APC A;  2KK1 A;  2LP4 A;  2YL7 A;  3LLI A;  3IPM O;  1ZZP A;  2PX3 A;  3RF3 A;  1JOG A;  1ST6 A;  2G62 A;  2J8W A;  3GOD A;  1CGM E;  1UFB A;  2W4M A;  4IAQ A;  3EHM A;  3S84 A;  2WL8 A;  2HJM A;  1MND A;  4FES A;  2YKZ A;  4AL1 A;  2OJQ A;  3RVY A;  1BDJ B;  1LIH A;  2LCH A;  4GYT A;  1JRA A;  1TKN A;  1OR2 A;  3UR3 C;  1J8Y F;  1D1C A;  3HNI A;  4NC3 A;  2PFD A;  3U2L A;  4C3B A;  3SZR A;  3MFN A;  1ZW3 A;  4LAC B;  4NCQ A;  1LI5 A;  2HMZ A;  2Q4F A;  3GOR A;  4AE4 B;  1RXQ A;  3LUT B;  3AG2 C;  4DJ9 A;  4J7T A;  2QUP A;  2NUP B;  4BJ5 C;  3Q7G A;  1BR4 A;  1U6H A;  2Y69 C;  4XLP F;  4G0H A;  1WWP A;  4CX9 A;  2CYD A;  1R4T A;  1YAU O;  3K6B A;  4RBN A;  2QTV A;  3EZH A;  4U9E A;  3ZQY A;  2FFH A;  4PAC A;  2IXM A;  4PR9 A;  5A6J A;  3POV A;  5T1D B;  1ZYR F;  2QY9 A;  2XXA B;  3N24 A;  4ER9 A;  2HKV A;  3K1I A;  5L0D A;  1AUE A;  1T6U A;  2EIL C;  2ZXP A;  3ECS A;  3DZA A;  2A6E F;  2Q9B A;  1YYJ A;  2W4B A;  2CDQ A;  2BE5 F;  4JC7 A;  3I4U A;  5L0C A;  4EWC A;  2YRF A;  2ASR A;  2KSF A;  3NYM A;  3ZQV A;  1KNY A;  1QSP A;  1S05 A;  2JPU A;  2VCC A;  4IGG A;  5A6B D;  3HNL A;  3UGP A;  3O39 A;  2KC3 A;  4XWJ A;  4Z9J A;  4I1O B;  4X0R A;  3TOL A;  2IXN A;  2XLH A;  3WAQ A;  2YZS A;  3EPV A;  1A7V A;  3GM3 A;  3QVY A;  5KYU B;  4AK9 A;  1Q0G A;  2EPL X;  2VC9 A;  2R7O A;  3NRH A;  1OW7 A;  2P7V A;  3EZI A;  2OEV A;  3WOD F;  5KYX A;  3VF0 A;  2R05 A;  3EFO A;  1QKR A;  2GA0 A;  3B0U X;  3FVY A;  4EBK A;  2R7R A;  2WZG A;  4JTD B;  3ZTM A;  5A69 A;  1SYQ A;  4RD9 A;  3O55 A;  4YL1 A;  4CJG A;  1QPU A;  2WZL A;  1LE2 A;  1YLM A;  1VLS A;  1TFK B;  1C03 A;  2GDC A;  3AGU A;  1CPR A;  2J7P A;  2R02 A;  3DM9 B;  4YN0 B;  3TJ5 A;  4CS8 C;  3K66 A;  4XPY A;  4CS9 C;  5A6K A;  5KYY A;  3EGX B;  1FNT c;  2R7U A;  1E83 A;  3C8G B;  4I3M A;  4CDY A;  3V5X A;  3NMJ A;  2OU6 A;  4YT5 A;  2KGO A;  2DI3 A;  2JD3 A;  1PD0 A;  4PJM A;  3PDM P;  2YL1 A;  3GWN A;  2YVK A;  4O79 A;  4ZLC A;  1BR1 A;  4ULW A;  1WAT A;  3VM6 A;  1PCX A;  1VYK A;  4MVS A;  1A0B A;  1Q0K A;  1RKE B;  4MTO A;  3C7J A;  4YT8 A;  3DJN B;  3NKE A;  3DXJ F;  3I5Q A;  3EQL F;  5B1A C;  3U0C A;  2L9J A;  2HSQ A;  2XM0 A;  5COG A;  1SMY F;  3MYF A;  1LE4 A;  4Q5S F;  5L0J A;  4K0D A;  5JVE A;  1WAS A;  1UG7 A;  1ZHZ A;  4H54 A;  4Z9H A;  3PHF 2;  2BC5 A;  2Q7R A;  2LK4 A;  3EGD B;  4JTA B;  3RW0 A;  3T9O A;  1U89 A;  4ONS A;  4U9D A;  4CDV A;  3TJ6 A;  3S90 A;  1SR2 A;  2G3V A;  1OR3 A;  1MMN A;  3JSZ A;  1Z63 A;  3A11 A;  2I15 A;  4KC9 A;  2P1A A;  4DRJ B;  2KJG A;  3H2V A;  2A0B A;  4XLN F;  3K1I C;  3UMI A;  3QTH A;  2IOQ A;  5E3C A;  1O5H A;  2XM4 A;  5EK0 A;  3B71 A;  1EQ1 A;  4E17 A;  3ASN C;  3NG1 A;  1A7D A;  1ORY A;  4XQ1 A;  2EPK X;  4BEM J;  5DVW A;  1MQV A;  4CDA A;  1VOM A;  2I8B A;  3NMK A;  2H8A A;  3ABL C;  3F46 A;  4GEH A;  2X0C A;  1TWH A;  1NFN A;  4HFK B;  4JKV A;  4PJJ A;  5HSW A;  1M2O A;  4N6C A;  3UGO A;  2OQM A;  1YYX A;  2H7V C;  2CW0 F;  2R7W A;  5DS4 A;  1BR2 A;  1RKC A;  3UMK A;  4CBE A;  1OXB A;  1TR2 A;  2NSF A;  3LEO A;  4IAO A;  2QE9 A;  3OWT A;  4J32 B;  3W8I A;  5KYW A;  2M64 A;  1E86 A;  2R25 A;  1E84 A;  1YJG A;  3AOU A;  1HE9 A;  3TD7 A;  1B68 A;  4BJ6 A;  1ZW2 A;  1NBB A;  1TQG A;  2LD6 A;  2XL8 A;  3DI5 A;  4LDQ A;  4OIN F;  4JEA A;  1YA9 A;  2V26 A;  2L6H A;  3JRT A;  2J0X A;  1D0X A;  2J9W A;  3EG9 B;  4IJJ A;  1T5O A;  2PNO A;  3R2P A;  4PFO A;  1TWG A;  3U3F A;  1OKK A;  4YT4 A;  3DD7 A;  5CI9 A;  4BPM A;  1VYI A;  2DGJ A;  2Y3G A;  4NTA A;  1YVI A;  1ZHT A;  2P0N A;  3GEE A;  4MTG A;  5L3Q A;  2DYS C;  3ZIB A;  4EUK B;  4UDV A;  4OIR F;  4B6I A;  1R5I D;  5E3A A;  4FX5 A;  3U2M A;  4DRH B;  1A7E A;  1XZP A;  1IZM A;  5E2Q A;  4JZA A;  3WHN A;  3FAP B;  4CIP A;  4JJF A;  2AWY A;  4U5G A;  4DOZ A;  2LIG A;  2IXP A;  1C02 A;  5AC4 A;  2EIJ C;  2CNW D;  1I4Z A;  1CGN A;  3G50 A;  4U5H A;  3QVZ A;  3NYL A;  3ITF A;  4C7O A;  3B9Q A;  2MYS A;  1G4U S;  2OG2 A;  1Q0F A;  1T6I A;  2OOC A;  2YLG A;  3LAY A;  4MS2 A;  3JYY A;  1Q0M A;  4PK4 A;  2E87 A;  1YDI A;  2R03 A;  1HW1 A;  3KMI A;  4MVO A;  4XTK A;  4IAR A;  1V4A A;  2R9R B;  4P9F A;  5L0G A;  4AE4 A;  4EHP A;  4YWQ A;  1JMW A;  3SXZ A;  4KNW A;  2MWQ A;  1HMO A;  2NUP A;  2EPN A;  3ABK C;  1EI7 A;  2LFD A;  1BZ4 A;  4MVZ A;  5KYN A;  2Q00 A;  4G7H F;  3S28 A;  2XLW A;  3UMH A;  1H6G A;  2YL3 A;  3TQO A;  2YWA A;  5BUO A;  3ZG1 A;  4CIH A;  2TMV P;  1V55 C;  4N4W A;  3GM2 A;  4F4B A;  4MTF A;  3T6B A;  1FMV A;  3DMD A;  3IQC A;  2XXA A;  2WB7 A;  5FZT A;  1T6Q A;  2YLD A;  4PJN A;  2YL0 A;  3Q6M A;  1WN0 A;  2J9U A;  2IBF A;  2L6F A;  4HEA J;  3U9M A;  3AQB A;  1KTM A;  2CCY A;  3PCV A;  1G4W R;  3IHU A;  4G7Z F;  2A68 F;  2HMQ A;  4JIO A;  4XEF A;  4Q7C A;  2QNL A;  5CIV A;  1ZVZ A;  2CGE A;  2EIM C;  3C62 A;  4CJO A;  4WAB A;  3VAY A;  2A69 F;  2VCB A;  5B1B C;  3KKB A;  1FTS A;  3DJU B;  2YHS A;  1EA8 A;  5KYU A;  4BG0 A;  4BJ6 C;  3F47 A;  3RKO F;  4D4X A;  1K40 A;  4DVZ A;  5EHH A;  3RVZ A;  2YEV A;  1MMA A;  3W2W A;  3LS1 A;  2MHR A;  2HZ8 A;  1RJ9 B;  1D0Z A;  2VCA A;  3JTL O;  4LDK A;  4U5C E;  4YK5 A;  3X1O A;  3S27 A;  3PMR A;  1YA7 O;  3NKD A;  4QI2 A;  2PX0 A;  1H9G A;  1V74 B;  4KNV A;  4G78 A;  1OXK A;  4QDL A;  2XL4 A;  2NG1 A;  2H7O A;  3KL4 A;  2LQG A;  2XLO A;  4O6N A;  1J8M F;  4XEV A;  3MYI A;  5DS5 A;  3DM5 A;  2KW3 C;  3T6G B;  1TWA A;  3EGX A;  1NU9 C;  3HNK A;  3C8G A;  4JEB A;  3RH3 A;  5JLI A;  1I4Y A;  2M4E A;  3I5P A;  3M1C B;  3U3B A;  3LJB A;  3RQF A;  3T4R A;  2JX0 A;  2EPO A;  2ZXR A;  2Z15 A;  3G4X A;  1LS4 A;  4Q4Z F;  3L8I A;  3IQ6 A;  4I44 A;  1FMW A;  1VK5 A;  1RKE A;  3DKA A;  3IQT A;  4QI0 A;  4DXW A;  1GM5 A;  1FFT C;  3U8P A;  1VTM P;  1VB5 A;  5L0H A;  1A41 A;  1OW6 A;  2R7S A;  3ZVR A;  4P9T A;  1Z5Z A;  3AGT A;  1U0B B;  3AQC A;  3LNR A;  2HJ3 A;  1TFO B;  2LFF A;  3EGD A;  1LPE A;  4XPX A;  4BJT A;  2XLM A;  4C3E A;  3B0P A;  1M6T A;  5DLJ A;  3L8J A;  3KH2 A;  2W9Y A;  3ABM C;  2XSE A;  2C04 A;  4MVR A;  2UUI A;  1IW7 F;  1HE1 A;  4YL3 A;  4N06 A;  5T3W A;  1DOV A;  3KPH A;  3DWW A;  3TOM A;  4G7O F;  5F5H A;  1CGO A;  3ASO C;  3V5Y A;  2G3K A;  4IB4 A;  4BJ5 A;  4BEJ A;  5JS5 A;  5L0F A;  4MQ9 F;  3TUL A;  2FAP B;  1M2V B;  2HV7 A;  3FXH A;  2W45 A;  3NMI A;  2GWW A;  3HNJ A;  4W8P A;  3BRJ A;  1JPJ A;  2ETS A;  5JSL A;  4JRZ A;  2NSG A;  5JRA A;  3DE8 A;  2J9B A;  1I5N A;  4NTB A;  1ZU5 A;  2IM8 A;  4RDA A;  2A0U A;  3RYL A;  1OQC A;  2P6V A;  1QQ3 A;  3GEI A;  5FCL A;  1PV3 A;  1D1A A;  1RCP A;  2LSE A;  3AG1 C;  4IRU A;  5EGY A;  5JUA A;  4HFF B;  1Y6D A;  1NG1 A;  4JCH A;  3GWL A;  2J7P D;  3EHN A;  3EJN A;  3FOO A;  3L1M A;  5DQT A;  3S9O A;  1V54 C;  4A4A A;  3US6 A;  3DAF A;  1O87 A;  2UUH A;  3U5S A;  3S0X A;  1W2W A;  5F5F A;  4HE8 D;  1LKX A;  1OCZ C;  5JT4 A;  3R7C A;  4C7O B;  1KU2 A;  3C8Z A;  2B0J A;  3MX3 A;  4BJ1 A;  5DS6 A;  2OEX A;  3ZTZ A;  3EG9 A;  5A6B A;  2Q3T A;  1ZU4 A;  3W4Y A;  2XLE A;  4CSA A;  1LI7 A;  4OD4 A;  2ZPA A;  4MVU A;  2NUT B;  4U5E E;  5K0I A;  2VAS A;  3K7D A; 
#chains in the Genus database with same CATH homology
 1V74 B;  1TFK B;  1TFO B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...