1TFOB

Ribonuclease from escherichia coli complexed with its inhibitor protein
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
86
structure length
86
Chain Sequence
KMAMIDLAKLFLASKITAIEFSERICVERRRLYGVKDLSPNILNCGEELFMAAERFEPDADRANYEIDDNGLKVEVRSILEKFKLH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Colicin D
publication title Relation between tRNase activity and the structure of colicin D according to X-ray crystallography
pubmed doi rcsb
source organism Escherichia coli
molecule tags Toxin/toxin inhibitor
total genus 27
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 2004-05-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.650 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Colicin D 1tfoB00
1TFKB 1V74B 1TFOB
chains in the Genus database with same CATH superfamily
1RJ9A 1FFHA 3FVYA 3KPHA 5BQGA 1WN0A 1LS4A 3DM9B 1FMVA 5IY5C 1HW2A 2J9BA 2A6EF 2RSEB 2YQYA 4NY3A 5D92A 4AX2A 4BEJA 2JX0A 3DM5A 1FTSA 4MNDA 3EH1A 4R32A 3QVZA 1EQ1A 2ZXPA 4ZLDA 1TWCA 4A2NB 2Y39A 1PV3A 4NTBA 2J7PA 2E87A 3AOUA 3I5PA 4O6YA 3V5ZA 3ZTZA 2R7OA 3FOPA 3SEOA 2XSEA 4IAOA 3S0XA 1TWHA 4G78A 4F4BA 5A6BD 1LKXA 2R7RA 1MMGA 2J9UA 3ABMC 1U0BB 5F5FA 1M2VA 2BL2A 2G3VA 2CYDA 4KI2A 2FGYA 3HJCA 3RIPA 2OJED 3FXHA 3LUTB 3IHUA 1CGNA 3C62A 3KKBA 3LEOA 4JVSA 4RDAA 3U2LA 4P9TA 4GEHA 2A69F 3WAQA 2IXOA 4NC3A 2VCCA 4U5GA 4Q4ZF 2FFHA 2C03A 4E7SA 4MQ9F 2QNLA 4ZLCA 3S29A 4PR9A 3KYJA 1ZW3A 2WL8A 1RJ9B 4K1OA 1VTMP 1VLSA 1CGOA 1SZIA 4MTFA 2GFHA 4JKVA 4JTDB 1WOLA 3C8GA 1S7ZA 2DB4A 4JW1A 2KC3A 2Q9AA 3GODA 3W4YA 1ORJA 4EHPA 2L7AA 5KYUB 1T6IA 3DWWA 2L9JA 2VCBA 4YK5A 2X0CA 5EGYA 2KJGA 3K66A 4MVMA 2XXAA 4JURI 1YZCA 2Q9BA 3IQ6A 3LESA 4KNWA 1H9GA 3JYHA 1H7IA 2H7VC 1E2XA 2HV7A 4JTAB 2XLVA 2ZXWC 5CIVA 1GS9A 4ULWA 4MVOA 4EBBA 1OR2A 3ZQVA 3K1IA 2M4EA 3MFNA 3T6JA 1KU2A 4W8KA 1RKEA 2WZGA 3SYNA 3ZDLA 5A6AA 3NKDA 1M2VB 4I1MA 2EPMX 3DXJF 3L8IA 3U2MA 4QI2A 2PBEA 1YDIA 3JT1A 4RD9A 4WJ0A 5COFA 1OCOC 5DLJA 2H7BA 2FAPB 2H8AA 1QLEC 2L6HA 4G7HF 2YL7A 2Y3GA 3EGXA 4CX9A 3MBGA 2VH3A 4O7GA 2WZFA 1TWGA 2WVQA 3G50A 3NYLA 1OCCC 2YLIA 1LI5A 1O5HA 1LI7A 2WVNA 4HEAJ 3FMSA 3ZSUA 2GDCA 3PDMP 2EPOA 3SXMA 4I1OB 1D1AA 1YAUO 2KNHA 1PCXA 2PFDA 5KYYA 3C8GB 1ZU4A 3ATPA 2V26A 2J8WA 5B3IA 1XZPA 5BQHA 3CEXA 2Q9CA 4PJMA 1WGWA 4Q7CA 5JRAA 2XM4A 4EWCA 1VOMA 2H7OA 2XXAB 3LNRA 2NG1A 1QSPA 4U5HA 2P0NA 5COGA 1C17M 4PJLA 4ULVA 4P6IC 4W8PA 4EIYA 2YWAA 4MVUA 5B1AC 1Q0GA 1T6UA 3GM3A 3OEOA 3U9MA 1UFBA 1V55C 1D0XA 4ER9A 1WASA 1BDJB 5JVEA 4PFPA 4U5EE 3JTLO 3RF3A 1A7VA 3UR3C 2QLAA 5L0DA 4PJJA 3VRCA 1H9TA 1RKEB 1HE1A 4I44A 5DS5A 3AQBA 4Q5SF 2DGJA 3ECSA 2IBFA 5EK0A 5JP7A 3NRHA 3S84A 3LEVA 2UUHA 3QW0A 3NMIA 5B3SC 1QPUA 3LS0A 4P9FA 5BQIA 3POVA 4U5BE 4U5DE 1OCRC 5JUAA 3EQLF 2PX0A 3X2QC 3TULA 5A6BA 1ZHWA 2YRFA 3EGXB 4J30B 4PJNA 1D1BA 2XM0A 2R7TA 2Z15A 5L0JA 1MMNA 3BEHA 4YWQA 1EI7A 3O10A 3SZRA 2Y69C 3U8PA 1K40A 3X1OA 1L3PA 4MW3A 4XQ1A 3QVYA 3DJNB 1JPNA 3DMDA 4BPMA 3GM1A 4C3BA 4CS8C 1Q0KA 3U5SA 3U3FA 3WODF 1DOWA 1JAFA 1L7CA 3EFOA 4BJ1A 5KYYB 4N06A 4MS2A 4LLEA 4E0IA 4KNVA 3NYMA 4K0DA 4YL1A 5E3CA 5T1DB 4JC7A 4JCHA 3O6XA 3IQCA 1G4WR 4N6HA 5E33A 3RQFA 1YLMA 2A6HF 3A9CA 3T4RA 3GORA 1OW6A 1UG7A 4JEAA 4DBQA 4QI0A 3SXYA 1E84A 1SMYF 3QW1A 3FHDA 2L81A 5B1BC 5DS4A 4IWBA 3NDBB 4BJ5C 2HJMA 3KH2A 1ORYA 1NFNA 2EIKC 2Y3HA 1B68A 3I5QA 3N24A 1H6GA 4GQHA 2EIMC 4YL0A 1AEPA 1Z3IX 1OXKA 3US6A 1M2OA 3QTHA 4YL3A 2MHRA 3B0VC 1Q0DA 2CNWD 1NZEA 1FFTC 1M6TA 4XPYA 2Q00A 3VYWA 1K04A 4M63A 1TFKB 2W4MA 2GAQA 4JE9A 3AG4C 2NUTA 3PHF2 5HSWA 2L6GA 1SF8A 3TJ5A 2CCYA 2J46A 3ZG1A 2AWYA 2HZ8A 3LLKA 2YKZA 2LIGA 2AVKA 2ZD9A 3CQZA 3K7DA 2R25A 3HTKC 5DVWA 4CS7A 2NSFA 3AQCA 3GEIA 2NUPA 1BR2A 2UUIA 3AG2C 3GEHA 4H54A 4H4KC 4B6IA 1A7EA 3RFYA 4FX5A 2OOCA 3TD7A 4DRIB 4I3MA 1VMAA 1CPQA 3JRMO 2MYSA 1OXBA 1PD1A 5L0CA 1OKKD 3ABLC 4CSAC 1FAPB 3AGTA 1PD0A 3AJMA 2HJ3A 1ZHXA 1D1CA 4XEVA 2R7WA 2HSBA 4JJFA 2EINC 4PACA 1V54C 3E9VA 1NSGB 3ASOC 3B29A 1FNTc 1OW8A 3O39A 2Y3DA 1VLTA 4XEKA 2TMVP 4EKWA 2AP3A 2P6VA 5L0GA 2HUJA 1LS1A 2XLDA 1ZZPA 1KTMA 2A68F 2B0HA 2JPUA 3L34A 4O6NA 2LFFA 1T6QA 2YL0A 3JSEO 4RBNA 5AC4A 1A7DA 1NBBA 1I5NA 1IZMA 3DE8A 3N0TA 5JSLA 2I8BA 5L0HA 3SXZA 3L1MA 3CZ6A 1VB5A 2Q3TA 3R2PA 4N6CA 2PX3A 3S90A 4YN0B 1S05A 2NUTB 1OR3A 1VYIA 4MTGA 3W2WA 3RVZA 4GYTA 3H2UA 1GQAA 1KNYA 2HMZA 3DE9A 3W8IA 3UGOA 1JR8A 3IQ5A 3LS1A 5JLIA 5E3AA 1D0YA 1AUEA 3JYYA 4OIRF 2CDQA 2AU5A 3UGPA 2G3KA 4NQFA 1R4TA 2P1AA 3ITFA 1MMAA 1C03A 3EGDA 3UMKA 1ZW2A 5D91A 4LDKA 2R7VA 3SNHA 4MTOA 5DS6A 2KGOA 2OJQA 4JRZA 1Z63A 2V3CC 4ANJA 2A1DD 1V74B 2YLDA 1NU7D 4JEBA 3C63A 4AL0A 5JS5A 3B0PA 3GEEA 4MVZA 3S28A 3TOLA 1Z7Qc 1ZU5A 4BJ5A 2OQMA 3EHMA 3SP1A 3H65A 5CI8A 2A0UA 4CDVA 1T01A 3MYFA 2WZLA 3ZQYA 2XS8A 4CDAA 3HNJA 4D4NA 1YZAA 2W4BA 2YLGA 3S27A 3GANA 3FAPB 3C18A 1FR0A 4OIQF 4EBKA 1TWAA 2QUPA 4G0HA 5DQZA 4UDVA 1HE9A 1Z23A 4AL1A 4XPXA 4BJTA 1LIHA 3RKOF 2Q4FA 1JPJA 2KW3C 3I4UA 1F1MA 3DKAA 1TQGA 5CI9A 3RQGA 4OIPF 3LLIA 2XLWA 1E85A 3NG1A 5K0IA 2CNWA 3RW0A 1BZ4A 1YJGA 3IQTA 5TJ5E 4BEMJ 4CSAA 2ZPAA 4IB4A 3TJ6A 4J7YA 4IJJA 2XLMA 4JJGA 4XPWA 3EGDB 4G7ZF 5L0IA 4Z9IA 5BUOA 1ZHYA 3W8HA 2IXNA 4CS9C 2CGEA 1ZHTA 3AG3C 4YJWA 2AWCA 4D4XA 4DBRA 1APCA 5KYXA 2KSFA 1MQVA 2OCCC 3L0IA 4Z9HA 1M56C 1QQ3A 3M79A 2J45A 4L6RA 3SXKA 3T6BA 3UNGC 2VB6A 1RMVA 1FMWA 1BR1A 4EBJA 2GWWA 3DAGA 1MMDA 1OKKA 3MLGA 2R7SA 1I4YA 3V5XA 4EUKB 1MNEA 4MVQA 3LNMB 2R05A 3S9OA 3FDQA 3V5YA 1K05A 5KYWA 1G5ZA 4MVRA 1OCZC 3U3BA 3HNIA 4KC9A 1YA7O 3MX3A 2BC5A 1OQCA 1W2WA 2LP4A 2M64A 3HKKA 5F28E 1WATA 1EKYA 1BBHA 2ICWG 1ZHZA 2W45A 3JSZA 3UMHA 4HE8D 3GWNA 1NFOA 3EG9A 2LCHA 2J0XA 4X0RA 4QDLA 4DJ9A 2KYHA 1R5ID 2HMQA 3E70C 3B0UX 1RCPA 3DI5A 2IXMA 2P61A 4O6MA 3EZIA 1VK5A 2OU6A 2R03A 2QY9A 4ONSA 5F5HA 1YYJA 1ZYRF 1BR4A 1U89A 2F22A 5KYUA 1T9KA 1YA9A 3Q6NA 3U0CA 3EPVA 1GGQA 1M57C 4N4WA 2HKVA 2W9YA 3G4XA 3KYIA 3M15A 5AGFA 3TQOA 2IXPA 3ZVRA 1LE2A 2DYRC 4C3DA 4WGZA 3ABKC 1YYXA 3DZAA 3ZTMA 3M1CB 1O3UA 1LM3B 1Q0FA 1QKRA 2D4UA 2YVKA 5AC5A 3WHNA 5KYXB 4IAQA 3EFOB 2OKUA 2R7QA 2IYLD 2ZXRA 3DD7A 3Q7LA 3TK0A 2WVOA 3KMIA 1WWPA 1E86A 2J9WA 2R9RB 2XS1A 1I4ZA 4DVZA 2DI3A 4A4AA 1HW1A 3EZHA 1ZVZA 4C3EA 1U6HA 2J9VA 1YVIA 4CJOA 1NU9C 1Y4CA 2IOQA 1Y6DA 2Y3BA 4BG0A 2ASRA 5KYWB 2C04A 2EPNA 4YT2A 2X51A 3CSKA 3N2ZB 4XTKA 2KK1A 4LLCA 2HSQA 1LVKA 1CPRA 1CGME 4NTAA 1WTYA 4HFFB 4C7OA 4XLPF 4U5FE 2XLHA 4U9EA 2A0BA 4LDQA 3EG9B 3M4CA 1XWJA 2XRHA 4OINF 3VF0A 4YT8A 1GM5A 1ST6A 4E7ZA 3G4ZA 4E0HA 3ZC4A 1LE4A 3HNLA 4BJ6C 2B0JA 3GM2A 3T6GB 4DVYP 3JRTA 4MVSA 3ASNC 4PK4A 3LJBA 3RYLA 3CAXA 3L8JA 4CS9A 2J7PD 3RVYA 2XL8A 3VM6A 2EPLX 4CS8A 2QE9A 2OEXA 2NUPB 1G8XA 4NCQA 1NLXA 3KL4A 1C02A 1XZQA 3NYJA 4LACB 4OD4A 4Z9JA 2CW0F 4U5CE 4CBEA 1G4US 3DAFA 4LDRA 3LAYA 1Q0MA 4J7TA 3R7CA 3T9OA 3RH3A 4FAPB 5A69A 1QZXA 2OG2A 4HFKB 2LK4A 3NKEA 4XLNF 2XL4A 3UMIA 1MNDA 1DOVA 3GWLA 3A11A 2EILC 2LFDA 5FZTA 2XLOA 1SYQA 2VASA 5COMA 1D0ZA 2XLEA 1SR2A 1JRAA 4XWJA 3Q7GA 2NPUA 3JCUQ 2QTVA 2PP4A 3EHNA 3F46A 3HLZA 5DQTA 1V4AA 2KQ9A 4KBLA 3PCVA 3RQEA 3TOMA 4DOZA 4AE4A 1A0BA 2IM8A 2ETSA 3C7JA 3EJNA 4C7OB 3F47A 2NSGA 3QMKA 4J32B 4JTCB 1LPEA 4WABA 1J8YF 3VAYA 2R7XA 2P7VA 2R02A 4PFOA 2Q7RA 3H2VA 1HY5A 2DYSC 1Z6AA 1VYKA 1E83A 3C8GD 2YZSA 1TKNA 1OW7A 4FESA 2J0WA 4OD5A 3PMRA 4YT4A 2G62A 3C8ZA 3B71A 4JZAA 4O79A 4CDYA 2YEVA 2WB7A 5L0FA 5KYNA 3O55A 1TR2A 3V7OA 2LQGA 2YL1A 2OEVA 5T3WA 3WG7C 4AK9A 4DRHB 2BE5F 3AGUA 2GA0A 3NMKA 4E17A 5FCLA 4LERA 2HV6A 2O9XA 4JCZA 1RXQA 2LSEA 2I15A 5L3VA 1EA8A 256BA 5A6KA 4XEFA 2EIJC 1JOGA 2LD6A 3M4BA 3EH2A 5T3TA 5HV9A 2R7UA 3J06A 2JD3A 4FWVA 4DRJB 2VCAA 3FAJA 5L3QA 1Z5ZA 1IW7F 3MYIA 5E2QA 3W2VA 2YL3A 2MWQA 3IPMO 4K7BA 3NMJA 2D5RB 1AVOB 2VC9A 4IRUA 3U9JA 2PNOA 3B9QA 4MW8A 3HNKA 5GPGB 4DXWA 1TFOB 2HFIA 2ZXOA 1NG1A 1QVXA 3BRJA 3K33A 2HS5A 3IEEA 1O87A 4YT5A 4AE4B 2PF4E 2RD9A 3FOOA 3ZWIA 3AG1C 5A6JA 3K1IC 4CJGA 3K6BA 1N1CA 2YHSA 1J8MF 1JMWA 2EPKX 4BJ6A 2XL6A 4CIHA 4WGYA 1RKCA 1ORSC 1YARO 3U8VA 3JZ0A 3QZCA 3ZIBA 4E18A 3Q6MA 1HMOA 5JT4A 1A41A 3DJUB 3K1HA 3OWTA 1T5OA 4IGGA 2L6FA 5EHHA 4OIOF 1HMDA 3OA1A 4G7OF 4JIOA 4NTFA 4IARA 4CIPA 4U9DA
chains in the Genus database with same CATH topology
1TFKB 1V74B 1TFOB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TFK B;  1V74 B;  1TFO B; 
#chains in the Genus database with same CATH topology
 1RJ9 A;  1FFH A;  3FVY A;  3KPH A;  5BQG A;  1WN0 A;  1LS4 A;  3DM9 B;  1FMV A;  5IY5 C;  1HW2 A;  2J9B A;  2A6E F;  2RSE B;  2YQY A;  4NY3 A;  5D92 A;  4AX2 A;  4BEJ A;  2JX0 A;  3DM5 A;  1FTS A;  4MND A;  3EH1 A;  4R32 A;  3QVZ A;  1EQ1 A;  2ZXP A;  4ZLD A;  1TWC A;  4A2N B;  2Y39 A;  1PV3 A;  4NTB A;  2J7P A;  2E87 A;  3AOU A;  3I5P A;  4O6Y A;  3V5Z A;  3ZTZ A;  2R7O A;  3FOP A;  3SEO A;  2XSE A;  4IAO A;  3S0X A;  1TWH A;  4G78 A;  4F4B A;  5A6B D;  1LKX A;  2R7R A;  1MMG A;  2J9U A;  3ABM C;  1U0B B;  5F5F A;  1M2V A;  2BL2 A;  2G3V A;  2CYD A;  4KI2 A;  2FGY A;  3HJC A;  3RIP A;  2OJE D;  3FXH A;  3LUT B;  3IHU A;  1CGN A;  3C62 A;  3KKB A;  3LEO A;  4JVS A;  4RDA A;  3U2L A;  4P9T A;  4GEH A;  2A69 F;  3WAQ A;  2IXO A;  4NC3 A;  2VCC A;  4U5G A;  4Q4Z F;  2FFH A;  2C03 A;  4E7S A;  4MQ9 F;  2QNL A;  4ZLC A;  3S29 A;  4PR9 A;  3KYJ A;  1ZW3 A;  2WL8 A;  1RJ9 B;  4K1O A;  1VTM P;  1VLS A;  1CGO A;  1SZI A;  4MTF A;  2GFH A;  4JKV A;  4JTD B;  1WOL A;  3C8G A;  1S7Z A;  2DB4 A;  4JW1 A;  2KC3 A;  2Q9A A;  3GOD A;  3W4Y A;  1ORJ A;  4EHP A;  2L7A A;  5KYU B;  1T6I A;  3DWW A;  2L9J A;  2VCB A;  4YK5 A;  2X0C A;  5EGY A;  2KJG A;  3K66 A;  4MVM A;  2XXA A;  4JUR I;  1YZC A;  2Q9B A;  3IQ6 A;  3LES A;  4KNW A;  1H9G A;  3JYH A;  1H7I A;  2H7V C;  1E2X A;  2HV7 A;  4JTA B;  2XLV A;  2ZXW C;  5CIV A;  1GS9 A;  4ULW A;  4MVO A;  4EBB A;  1OR2 A;  3ZQV A;  3K1I A;  2M4E A;  3MFN A;  3T6J A;  1KU2 A;  4W8K A;  1RKE A;  2WZG A;  3SYN A;  3ZDL A;  5A6A A;  3NKD A;  1M2V B;  4I1M A;  2EPM X;  3DXJ F;  3L8I A;  3U2M A;  4QI2 A;  2PBE A;  1YDI A;  3JT1 A;  4RD9 A;  4WJ0 A;  5COF A;  1OCO C;  5DLJ A;  2H7B A;  2FAP B;  2H8A A;  1QLE C;  2L6H A;  4G7H F;  2YL7 A;  2Y3G A;  3EGX A;  4CX9 A;  3MBG A;  2VH3 A;  4O7G A;  2WZF A;  1TWG A;  2WVQ A;  3G50 A;  3NYL A;  1OCC C;  2YLI A;  1LI5 A;  1O5H A;  1LI7 A;  2WVN A;  4HEA J;  3FMS A;  3ZSU A;  2GDC A;  3PDM P;  2EPO A;  3SXM A;  4I1O B;  1D1A A;  1YAU O;  2KNH A;  1PCX A;  2PFD A;  5KYY A;  3C8G B;  1ZU4 A;  3ATP A;  2V26 A;  2J8W A;  5B3I A;  1XZP A;  5BQH A;  3CEX A;  2Q9C A;  4PJM A;  1WGW A;  4Q7C A;  5JRA A;  2XM4 A;  4EWC A;  1VOM A;  2H7O A;  2XXA B;  3LNR A;  2NG1 A;  1QSP A;  4U5H A;  2P0N A;  5COG A;  1C17 M;  4PJL A;  4ULV A;  4P6I C;  4W8P A;  4EIY A;  2YWA A;  4MVU A;  5B1A C;  1Q0G A;  1T6U A;  3GM3 A;  3OEO A;  3U9M A;  1UFB A;  1V55 C;  1D0X A;  4ER9 A;  1WAS A;  1BDJ B;  5JVE A;  4PFP A;  4U5E E;  3JTL O;  3RF3 A;  1A7V A;  3UR3 C;  2QLA A;  5L0D A;  4PJJ A;  3VRC A;  1H9T A;  1RKE B;  1HE1 A;  4I44 A;  5DS5 A;  3AQB A;  4Q5S F;  2DGJ A;  3ECS A;  2IBF A;  5EK0 A;  5JP7 A;  3NRH A;  3S84 A;  3LEV A;  2UUH A;  3QW0 A;  3NMI A;  5B3S C;  1QPU A;  3LS0 A;  4P9F A;  5BQI A;  3POV A;  4U5B E;  4U5D E;  1OCR C;  5JUA A;  3EQL F;  2PX0 A;  3X2Q C;  3TUL A;  5A6B A;  1ZHW A;  2YRF A;  3EGX B;  4J30 B;  4PJN A;  1D1B A;  2XM0 A;  2R7T A;  2Z15 A;  5L0J A;  1MMN A;  3BEH A;  4YWQ A;  1EI7 A;  3O10 A;  3SZR A;  2Y69 C;  3U8P A;  1K40 A;  3X1O A;  1L3P A;  4MW3 A;  4XQ1 A;  3QVY A;  3DJN B;  1JPN A;  3DMD A;  4BPM A;  3GM1 A;  4C3B A;  4CS8 C;  1Q0K A;  3U5S A;  3U3F A;  3WOD F;  1DOW A;  1JAF A;  1L7C A;  3EFO A;  4BJ1 A;  5KYY B;  4N06 A;  4MS2 A;  4LLE A;  4E0I A;  4KNV A;  3NYM A;  4K0D A;  4YL1 A;  5E3C A;  5T1D B;  4JC7 A;  4JCH A;  3O6X A;  3IQC A;  1G4W R;  4N6H A;  5E33 A;  3RQF A;  1YLM A;  2A6H F;  3A9C A;  3T4R A;  3GOR A;  1OW6 A;  1UG7 A;  4JEA A;  4DBQ A;  4QI0 A;  3SXY A;  1E84 A;  1SMY F;  3QW1 A;  3FHD A;  2L81 A;  5B1B C;  5DS4 A;  4IWB A;  3NDB B;  4BJ5 C;  2HJM A;  3KH2 A;  1ORY A;  1NFN A;  2EIK C;  2Y3H A;  1B68 A;  3I5Q A;  3N24 A;  1H6G A;  4GQH A;  2EIM C;  4YL0 A;  1AEP A;  1Z3I X;  1OXK A;  3US6 A;  1M2O A;  3QTH A;  4YL3 A;  2MHR A;  3B0V C;  1Q0D A;  2CNW D;  1NZE A;  1FFT C;  1M6T A;  4XPY A;  2Q00 A;  3VYW A;  1K04 A;  4M63 A;  1TFK B;  2W4M A;  2GAQ A;  4JE9 A;  3AG4 C;  2NUT A;  3PHF 2;  5HSW A;  2L6G A;  1SF8 A;  3TJ5 A;  2CCY A;  2J46 A;  3ZG1 A;  2AWY A;  2HZ8 A;  3LLK A;  2YKZ A;  2LIG A;  2AVK A;  2ZD9 A;  3CQZ A;  3K7D A;  2R25 A;  3HTK C;  5DVW A;  4CS7 A;  2NSF A;  3AQC A;  3GEI A;  2NUP A;  1BR2 A;  2UUI A;  3AG2 C;  3GEH A;  4H54 A;  4H4K C;  4B6I A;  1A7E A;  3RFY A;  4FX5 A;  2OOC A;  3TD7 A;  4DRI B;  4I3M A;  1VMA A;  1CPQ A;  3JRM O;  2MYS A;  1OXB A;  1PD1 A;  5L0C A;  1OKK D;  3ABL C;  4CSA C;  1FAP B;  3AGT A;  1PD0 A;  3AJM A;  2HJ3 A;  1ZHX A;  1D1C A;  4XEV A;  2R7W A;  2HSB A;  4JJF A;  2EIN C;  4PAC A;  1V54 C;  3E9V A;  1NSG B;  3ASO C;  3B29 A;  1FNT c;  1OW8 A;  3O39 A;  2Y3D A;  1VLT A;  4XEK A;  2TMV P;  4EKW A;  2AP3 A;  2P6V A;  5L0G A;  2HUJ A;  1LS1 A;  2XLD A;  1ZZP A;  1KTM A;  2A68 F;  2B0H A;  2JPU A;  3L34 A;  4O6N A;  2LFF A;  1T6Q A;  2YL0 A;  3JSE O;  4RBN A;  5AC4 A;  1A7D A;  1NBB A;  1I5N A;  1IZM A;  3DE8 A;  3N0T A;  5JSL A;  2I8B A;  5L0H A;  3SXZ A;  3L1M A;  3CZ6 A;  1VB5 A;  2Q3T A;  3R2P A;  4N6C A;  2PX3 A;  3S90 A;  4YN0 B;  1S05 A;  2NUT B;  1OR3 A;  1VYI A;  4MTG A;  3W2W A;  3RVZ A;  4GYT A;  3H2U A;  1GQA A;  1KNY A;  2HMZ A;  3DE9 A;  3W8I A;  3UGO A;  1JR8 A;  3IQ5 A;  3LS1 A;  5JLI A;  5E3A A;  1D0Y A;  1AUE A;  3JYY A;  4OIR F;  2CDQ A;  2AU5 A;  3UGP A;  2G3K A;  4NQF A;  1R4T A;  2P1A A;  3ITF A;  1MMA A;  1C03 A;  3EGD A;  3UMK A;  1ZW2 A;  5D91 A;  4LDK A;  2R7V A;  3SNH A;  4MTO A;  5DS6 A;  2KGO A;  2OJQ A;  4JRZ A;  1Z63 A;  2V3C C;  4ANJ A;  2A1D D;  1V74 B;  2YLD A;  1NU7 D;  4JEB A;  3C63 A;  4AL0 A;  5JS5 A;  3B0P A;  3GEE A;  4MVZ A;  3S28 A;  3TOL A;  1Z7Q c;  1ZU5 A;  4BJ5 A;  2OQM A;  3EHM A;  3SP1 A;  3H65 A;  5CI8 A;  2A0U A;  4CDV A;  1T01 A;  3MYF A;  2WZL A;  3ZQY A;  2XS8 A;  4CDA A;  3HNJ A;  4D4N A;  1YZA A;  2W4B A;  2YLG A;  3S27 A;  3GAN A;  3FAP B;  3C18 A;  1FR0 A;  4OIQ F;  4EBK A;  1TWA A;  2QUP A;  4G0H A;  5DQZ A;  4UDV A;  1HE9 A;  1Z23 A;  4AL1 A;  4XPX A;  4BJT A;  1LIH A;  3RKO F;  2Q4F A;  1JPJ A;  2KW3 C;  3I4U A;  1F1M A;  3DKA A;  1TQG A;  5CI9 A;  3RQG A;  4OIP F;  3LLI A;  2XLW A;  1E85 A;  3NG1 A;  5K0I A;  2CNW A;  3RW0 A;  1BZ4 A;  1YJG A;  3IQT A;  5TJ5 E;  4BEM J;  4CSA A;  2ZPA A;  4IB4 A;  3TJ6 A;  4J7Y A;  4IJJ A;  2XLM A;  4JJG A;  4XPW A;  3EGD B;  4G7Z F;  5L0I A;  4Z9I A;  5BUO A;  1ZHY A;  3W8H A;  2IXN A;  4CS9 C;  2CGE A;  1ZHT A;  3AG3 C;  4YJW A;  2AWC A;  4D4X A;  4DBR A;  1APC A;  5KYX A;  2KSF A;  1MQV A;  2OCC C;  3L0I A;  4Z9H A;  1M56 C;  1QQ3 A;  3M79 A;  2J45 A;  4L6R A;  3SXK A;  3T6B A;  3UNG C;  2VB6 A;  1RMV A;  1FMW A;  1BR1 A;  4EBJ A;  2GWW A;  3DAG A;  1MMD A;  1OKK A;  3MLG A;  2R7S A;  1I4Y A;  3V5X A;  4EUK B;  1MNE A;  4MVQ A;  3LNM B;  2R05 A;  3S9O A;  3FDQ A;  3V5Y A;  1K05 A;  5KYW A;  1G5Z A;  4MVR A;  1OCZ C;  3U3B A;  3HNI A;  4KC9 A;  1YA7 O;  3MX3 A;  2BC5 A;  1OQC A;  1W2W A;  2LP4 A;  2M64 A;  3HKK A;  5F28 E;  1WAT A;  1EKY A;  1BBH A;  2ICW G;  1ZHZ A;  2W45 A;  3JSZ A;  3UMH A;  4HE8 D;  3GWN A;  1NFO A;  3EG9 A;  2LCH A;  2J0X A;  4X0R A;  4QDL A;  4DJ9 A;  2KYH A;  1R5I D;  2HMQ A;  3E70 C;  3B0U X;  1RCP A;  3DI5 A;  2IXM A;  2P61 A;  4O6M A;  3EZI A;  1VK5 A;  2OU6 A;  2R03 A;  2QY9 A;  4ONS A;  5F5H A;  1YYJ A;  1ZYR F;  1BR4 A;  1U89 A;  2F22 A;  5KYU A;  1T9K A;  1YA9 A;  3Q6N A;  3U0C A;  3EPV A;  1GGQ A;  1M57 C;  4N4W A;  2HKV A;  2W9Y A;  3G4X A;  3KYI A;  3M15 A;  5AGF A;  3TQO A;  2IXP A;  3ZVR A;  1LE2 A;  2DYR C;  4C3D A;  4WGZ A;  3ABK C;  1YYX A;  3DZA A;  3ZTM A;  3M1C B;  1O3U A;  1LM3 B;  1Q0F A;  1QKR A;  2D4U A;  2YVK A;  5AC5 A;  3WHN A;  5KYX B;  4IAQ A;  3EFO B;  2OKU A;  2R7Q A;  2IYL D;  2ZXR A;  3DD7 A;  3Q7L A;  3TK0 A;  2WVO A;  3KMI A;  1WWP A;  1E86 A;  2J9W A;  2R9R B;  2XS1 A;  1I4Z A;  4DVZ A;  2DI3 A;  4A4A A;  1HW1 A;  3EZH A;  1ZVZ A;  4C3E A;  1U6H A;  2J9V A;  1YVI A;  4CJO A;  1NU9 C;  1Y4C A;  2IOQ A;  1Y6D A;  2Y3B A;  4BG0 A;  2ASR A;  5KYW B;  2C04 A;  2EPN A;  4YT2 A;  2X51 A;  3CSK A;  3N2Z B;  4XTK A;  2KK1 A;  4LLC A;  2HSQ A;  1LVK A;  1CPR A;  1CGM E;  4NTA A;  1WTY A;  4HFF B;  4C7O A;  4XLP F;  4U5F E;  2XLH A;  4U9E A;  2A0B A;  4LDQ A;  3EG9 B;  3M4C A;  1XWJ A;  2XRH A;  4OIN F;  3VF0 A;  4YT8 A;  1GM5 A;  1ST6 A;  4E7Z A;  3G4Z A;  4E0H A;  3ZC4 A;  1LE4 A;  3HNL A;  4BJ6 C;  2B0J A;  3GM2 A;  3T6G B;  4DVY P;  3JRT A;  4MVS A;  3ASN C;  4PK4 A;  3LJB A;  3RYL A;  3CAX A;  3L8J A;  4CS9 A;  2J7P D;  3RVY A;  2XL8 A;  3VM6 A;  2EPL X;  4CS8 A;  2QE9 A;  2OEX A;  2NUP B;  1G8X A;  4NCQ A;  1NLX A;  3KL4 A;  1C02 A;  1XZQ A;  3NYJ A;  4LAC B;  4OD4 A;  4Z9J A;  2CW0 F;  4U5C E;  4CBE A;  1G4U S;  3DAF A;  4LDR A;  3LAY A;  1Q0M A;  4J7T A;  3R7C A;  3T9O A;  3RH3 A;  4FAP B;  5A69 A;  1QZX A;  2OG2 A;  4HFK B;  2LK4 A;  3NKE A;  4XLN F;  2XL4 A;  3UMI A;  1MND A;  1DOV A;  3GWL A;  3A11 A;  2EIL C;  2LFD A;  5FZT A;  2XLO A;  1SYQ A;  2VAS A;  5COM A;  1D0Z A;  2XLE A;  1SR2 A;  1JRA A;  4XWJ A;  3Q7G A;  2NPU A;  3JCU Q;  2QTV A;  2PP4 A;  3EHN A;  3F46 A;  3HLZ A;  5DQT A;  1V4A A;  2KQ9 A;  4KBL A;  3PCV A;  3RQE A;  3TOM A;  4DOZ A;  4AE4 A;  1A0B A;  2IM8 A;  2ETS A;  3C7J A;  3EJN A;  4C7O B;  3F47 A;  2NSG A;  3QMK A;  4J32 B;  4JTC B;  1LPE A;  4WAB A;  1J8Y F;  3VAY A;  2R7X A;  2P7V A;  2R02 A;  4PFO A;  2Q7R A;  3H2V A;  1HY5 A;  2DYS C;  1Z6A A;  1VYK A;  1E83 A;  3C8G D;  2YZS A;  1TKN A;  1OW7 A;  4FES A;  2J0W A;  4OD5 A;  3PMR A;  4YT4 A;  2G62 A;  3C8Z A;  3B71 A;  4JZA A;  4O79 A;  4CDY A;  2YEV A;  2WB7 A;  5L0F A;  5KYN A;  3O55 A;  1TR2 A;  3V7O A;  2LQG A;  2YL1 A;  2OEV A;  5T3W A;  3WG7 C;  4AK9 A;  4DRH B;  2BE5 F;  3AGU A;  2GA0 A;  3NMK A;  4E17 A;  5FCL A;  4LER A;  2HV6 A;  2O9X A;  4JCZ A;  1RXQ A;  2LSE A;  2I15 A;  5L3V A;  1EA8 A;  256B A;  5A6K A;  4XEF A;  2EIJ C;  1JOG A;  2LD6 A;  3M4B A;  3EH2 A;  5T3T A;  5HV9 A;  2R7U A;  3J06 A;  2JD3 A;  4FWV A;  4DRJ B;  2VCA A;  3FAJ A;  5L3Q A;  1Z5Z A;  1IW7 F;  3MYI A;  5E2Q A;  3W2V A;  2YL3 A;  2MWQ A;  3IPM O;  4K7B A;  3NMJ A;  2D5R B;  1AVO B;  2VC9 A;  4IRU A;  3U9J A;  2PNO A;  3B9Q A;  4MW8 A;  3HNK A;  5GPG B;  4DXW A;  1TFO B;  2HFI A;  2ZXO A;  1NG1 A;  1QVX A;  3BRJ A;  3K33 A;  2HS5 A;  3IEE A;  1O87 A;  4YT5 A;  4AE4 B;  2PF4 E;  2RD9 A;  3FOO A;  3ZWI A;  3AG1 C;  5A6J A;  3K1I C;  4CJG A;  3K6B A;  1N1C A;  2YHS A;  1J8M F;  1JMW A;  2EPK X;  4BJ6 A;  2XL6 A;  4CIH A;  4WGY A;  1RKC A;  1ORS C;  1YAR O;  3U8V A;  3JZ0 A;  3QZC A;  3ZIB A;  4E18 A;  3Q6M A;  1HMO A;  5JT4 A;  1A41 A;  3DJU B;  3K1H A;  3OWT A;  1T5O A;  4IGG A;  2L6F A;  5EHH A;  4OIO F;  1HMD A;  3OA1 A;  4G7O F;  4JIO A;  4NTF A;  4IAR A;  4CIP A;  4U9D A; 
#chains in the Genus database with same CATH homology
 1TFK B;  1V74 B;  1TFO B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...