4WGZA

Crystal structure of cytochrome c' from alcaligenes xylosoxidans ncimb 11015 at ph 6.0
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
126
structure length
126
Chain Sequence
EFAKPEDAVKYRQSALTLMASHFGRMTPVVKGQAPYDAAQIKANVEVLKTLSALPWAAFGPGTEGGDARPEIWSDAASFKQKQQAFQDNIVKLSAAADAGDLDKLRAAFGDVGASCKACHDAYRKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray Crystallographic Elucidation for the Alkaline High-spin State Transition of Iron(III) Cytochrome c' from Alcaligenes xylosoxidans NCIMB 11015
doi rcsb
molecule tags Electron transport
molecule keywords Cytochrome c'
total genus 53
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2014-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01322 Cytochrom_C_2 Cytochrome C'
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 4wgzA00
3M15A 4CDVA 4NC3A 1BBHA 5B3IA 2XLHA 3M79A 3ZTZA 3TOLA 5JSLA 2YLDA 1CPRA 3QW1A 4IARA 3ZWIA 5JRAA 2XL8A 4WGZA 1YZCA 1RCPA 4CIPA 1E86A 3HNLA 1LM3B 1QQ3A 2XLDA 2YL0A 1E83A 4CDAA 2YL1A 1YZAA 4WGYA 1CGOA 2BC5A 4U9DA 1S05A 4CX9A 5JP7A 2XLOA 1M6TA 3ZQYA 3VRCA 2YKZA 3L1MA 3M4CA 3C63A 3U8PA 1GQAA 3ZQVA 2YLIA 4IB4A 4CJGA 3IQ5A 5JVEA 3QVYA 1E85A 3DE8A 4CDYA 4ER9A 3NMJA 2J9BA 2J8WA 1APCA 1EKYA 5JS5A 1CGNA 3FOOA 1YYXA 1CPQA 2XLWA 3HNIA 2XM4A 1A7VA 4JEBA 2YL3A 1QPUA 3QW0A 4N6HA 3M4BA 4D4NA 1MQVA 1NBBA 4D4XA 2XLEA 1E84A 4IAQA 3FOPA 3QVZA 4JE9A 5JLIA 2XM0A 4JEAA 4L6RA 2YLGA 5AGFA 4JKVA 4ULVA 3NMIA 2XLVA 3TOMA 1JAFA 256BA 2YL7A 5JT4A 3C62A 3ZTMA 3NMKA 2XLMA 4N4WA 3HNKA 4CJOA 3HNJA 3IQ6A 4U9EA 4EIYA 5JUAA 1YYJA 3DE9A 2XL6A 2QLAA 2CCYA
chains in the Genus database with same CATH superfamily
1RKEB 4JRZA 1E2XA 5HV9A 2Y69C 2QTVA 3A9CA 4BEMJ 3K7DA 5B3IA 5HSWA 2NPUA 2RSEB 3AQCA 3TOLA 4PJLA 1KNYA 1H6GA 4MVZA 1CPRA 2J9UA 4KBLA 4AE4A 2G3KA 1QVXA 4HFKB 2XL8A 3S9OA 5DQZA 5L0JA 2WZGA 5EK0A 2AU5A 4AX2A 3JT1A 2PX3A 4PR9A 4E7SA 3FDQA 4OIQF 2HUJA 5A69A 4CS8A 4PJMA 4CIPA 4XEVA 3UGPA 2Q3TA 4JCZA 3CEXA 4YT8A 1ORYA 1TWHA 4K7BA 4LDKA 1O5HA 1V74B 1QQ3A 2XLDA 1OCZC 4QI2A 2YL0A 4RDAA 3OWTA 1NFOA 4IGGA 2FFHA 1CGOA 2J0WA 2KSFA 4NTAA 3MYIA 3SXKA 5EHHA 4CX9A 1Z6AA 3VYWA 3ZG1A 1I5NA 2EIMC 2PF4E 2ZXWC 3DJUB 2R03A 5AC5A 4C7OA 2YKZA 3RKOF 1G4US 2A68F 3NYLA 2UUIA 1LIHA 2PP4A 1Z3IX 3B0VC 5CIVA 5L0CA 1WOLA 3S27A 2YRFA 3EGXA 1W2WA 1LS4A 3U8VA 5FCLA 1ORJA 4IB4A 4CJGA 1ZU4A 1OR2A 3IQ5A 3ZVRA 3S84A 1MMDA 4A4AA 2F22A 5F28E 4ER9A 2HMQA 1LE4A 4B6IA 1D1CA 1OKKA 1NLXA 3L8IA 4EBKA 2R7SA 4CIHA 1N1CA 3C18A 3EFOB 1YA7O 3HJCA 3HKKA 2J45A 3N0TA 3GEHA 4JVSA 4EBBA 1CGME 3L0IA 4IRUA 4NQFA 2QY9A 2WL8A 2J0XA 1M57C 4G7HF 3TULA 1JPNA 4H4KC 4XWJA 3RYLA 1NU9C 1HW2A 3KMIA 1VYKA 4QDLA 3LS1A 2L7AA 1NFNA 2C03A 4CS7A 4YT5A 3H2UA 5E3AA 5DLJA 5L0FA 2EILC 2YL3A 3POVA 3CAXA 1XZQA 4N6HA 3M4BA 4CSAC 1FAPB 4OIOF 2EIJC 1LI7A 1MQVA 4MVUA 3RQEA 2OQMA 2ZXOA 4D4XA 1TWCA 1E84A 4YJWA 4YK5A 3WODF 3JRTA 3QVZA 3DJNB 2O9XA 3W2VA 4DBQA 3EGXB 4O6NA 1NSGB 2L9JA 1YA9A 2OOCA 3C8GA 4JEAA 4XTKA 4BG0A 1KU2A 1OKKD 3DM5A 4LDRA 2G3VA 1QZXA 3EG9B 3TOMA 1M2VB 256BA 2HFIA 1HE9A 2YWAA 4OD5A 2X51A 2L6FA 3K1IC 2EPKX 2WVNA 4MVRA 2Q9CA 1EI7A 1A0BA 1D0YA 1YVIA 5EGYA 3ZTMA 3NMKA 4FESA 3MFNA 2NUTA 2VC9A 4O7GA 3RIPA 1FMWA 4WJ0A 2NUPB 5KYWA 3X2QC 4EUKB 3JSEO 4PK4A 1M2OA 1T6IA 1A7EA 5BUOA 1ZZPA 4JIOA 2LK4A 3CQZA 5JUAA 4JC7A 3AGUA 1DOVA 4KC9A 2A0UA 3SP1A 5KYXB 2QLAA 2CNWA 3DMDA 2M4EA 2Q9BA 3EHMA 2Q7RA 5K0IA 2ZD9A 5D91A 1BBHA 2JPUA 2R7OA 4MW8A 1Z7Qc 3SYNA 2IM8A 3ZTZA 3X1OA 1ZYRF 2P61A 2KNHA 2MYSA 1FMVA 2Q9AA 3U3FA 3AOUA 4F4BA 4PJJA 4NY3A 5JRAA 2HS5A 2HKVA 1JPJA 3JZ0A 2W45A 2P7VA 1T5OA 4KNWA 4WGZA 2J46A 3U9MA 4BJ5A 4ZLDA 2AVKA 3C8ZA 2PNOA 4GEHA 4JURI 1BZ4A 2NUPA 4GYTA 2L6GA 4Z9HA 1Z23A 4C3EA 5E33A 2KYHA 2QE9A 3QZCA 3FVYA 5A6AA 1AEPA 3LLKA 1OQCA 3U0CA 4CDAA 1YJGA 4WGYA 3RVZA 2QNLA 3DI5A 3FXHA 1B68A 1VB5A 4NTFA 2P6VA 1PV3A 2HZ8A 3EQLF 3ASOC 5JP7A 4BEJA 2XLOA 4I1MA 1ZHTA 3AG4C 1F1MA 3UMKA 1FR0A 1RKCA 4QI0A 3LEVA 3DZAA 4YT2A 2DI3A 2LFFA 2KGOA 3C63A 5GPGB 3K33A 3U8PA 3LLIA 4LERA 4MS2A 1GQAA 1OW8A 1OCCC 4LLEA 1A41A 3CSKA 4NTBA 2JD3A 4BPMA 4KI2A 1HY5A 1BDJB 3I4UA 4OINF 2XRHA 3EH1A 4JW1A 4PFOA 2GA0A 3EGDB 1E85A 2LCHA 2D4UA 5A6KA 3L8JA 4RBNA 4CSAA 3AJMA 2WVQA 2EPOA 3DWWA 3OEOA 2OJED 4DJ9A 1OXBA 2JX0A 2KK1A 3AQBA 1Y6DA 1LKXA 4JCHA 4WABA 2LQGA 5CI8A 1APCA 1MNEA 4MW3A 1EKYA 3UMHA 5JS5A 1CGNA 1V4AA 2W4MA 1YAUO 2IXOA 3T6GB 1O87A 5DS4A 1YYXA 3EHNA 3EH2A 2OCCC 3VM6A 3VAYA 2TMVP 4E18A 4OD4A 4P6IC 1QPUA 2KJGA 4AE4B 1PCXA 3LS0A 3R7CA 3NDBB 3TK0A 4ZLCA 1ZU5A 4J30B 4J32B 3GANA 4FWVA 3SXZA 4AL0A 5KYWB 4FX5A 3K1IA 1Q0KA 2YQYA 3LESA 2KQ9A 2V26A 1NZEA 2L6HA 3GWLA 4JE9A 4DRJB 3SNHA 5JLIA 4E0IA 3AGTA 1RJ9B 2YEVA 3NYMA 2XM0A 1MNDA 4L6RA 3EJNA 2EPNA 2H8AA 4JKVA 3W2WA 1OXKA 2IOQA 3EGDA 3KYIA 2XLVA 3NMIA 4Q7CA 3RW0A 2ZPAA 3RFYA 3MX3A 5A6BD 1OCOC 1OW7A 1U6HA 2Z15A 2XXAB 2PFDA 2YL7A 4LDQA 2C04A 3C7JA 1MMGA 5F5HA 2EPLX 3C62A 3EZIA 2AWCA 3DAGA 3Q6MA 3QMKA 1G8XA 3S90A 3UGOA 1ZVZA 1S7ZA 2KW3C 3DAFA 3KKBA 4K0DA 2VB6A 2XSEA 5KYNA 3K1HA 3SZRA 3UMIA 2GWWA 1C02A 4U5CE 5T1DB 4CJOA 1GGQA 3IQ6A 1SYQA 4CS8C 1LPEA 2XS8A 2IXPA 4JJGA 1C03A 3O39A 4O6YA 2DYRC 5DS6A 5DS5A 1MMNA 4EHPA 3AG3C 4U5BE 3G50A 3T6JA 3DE9A 1YLMA 3F46A 3H65A 2XL6A 1ZHWA 3EZHA 3L34A 1T6UA 1M2VA 2EINC 4NC3A 4CDVA 2HSQA 5BQIA 2XLHA 3S0XA 1K04A 2P0NA 1HE1A 4EBJA 1VOMA 3ABKC 3I5QA 4I3MA 3GM2A 4IARA 3QW1A 5JSLA 4JZAA 4I44A 2WB7A 2BL2A 4PACA 4Q4ZF 1MMAA 4U5GA 2Y3HA 2KC3A 3WHNA 2V3CC 1Q0DA 3DKAA 1AVOB 5D92A 3W4YA 4MTOA 2IBFA 3JYHA 1R5ID 3GODA 5BQGA 4P9TA 1LM3B 3K6BA 5TJ5E 3U2MA 3ZIBA 3Q7GA 4BJ6A 4PJNA 1TKNA 4CBEA 2H7BA 4DOZA 3B0UX 1GS9A 1ST6A 1TR2A 1YZAA 2UUHA 2VASA 3AG1C 2FGYA 3ASNC 3BEHA 2DYSC 4Z9JA 5E3CA 2J7PA 1VLTA 1NG1A 4G7OF 1ZHXA 3B29A 3GEEA 3R2PA 4BJ5C 3U5SA 3ABLC 1M6TA 4HFFB 4N06A 3V5XA 4EKWA 3ZQYA 4MQ9F 4CS9C 3VRCA 3DM9B 3ITFA 3OA1A 4XPWA 3M4CA 5KYUA 4JTAB 2HV7A 2OU6A 4OIRF 2FAPB 4C3BA 4PFPA 5KYYB 2R7VA 2J7PD 2W9YA 3B0PA 1OR3A 4YL0A 5B1AC 2GFHA 2YLIA 4ULWA 1VMAA 1PD1A 4GQHA 3W8IA 3V7OA 2DGJA 4IJJA 1WN0A 4MVMA 3HLZA 2A6EF 3V5ZA 3IQTA 3NKDA 1Q0FA 3TD7A 2AWYA 3DD7A 2J9BA 3ABMC 4MVOA 1SR2A 1WASA 3KYJA 2WZLA 4XPXA 4U5DE 1JMWA 3Q6NA 4A2NB 1OW6A 2LD6A 3FOOA 1NU7D 1I4YA 1LI5A 2XXAA 2RD9A 2CYDA 1CPQA 1A7VA 3N2ZB 4JEBA 3RQGA 5KYYA 1M56C 4AL1A 1EA8A 3E70C 4DBRA 4E17A 4HE8D 1XZPA 3ATPA 1D0XA 1JRAA 2GAQA 4C7OB 4Q5SF 2R7UA 1LE2A 2HJ3A 2XLEA 3GWNA 1VLSA 1TWAA 3GM1A 3M1CB 4IAQA 1JOGA 4JJFA 1SF8A 2E87A 4NCQA 4ANJA 3A11A 2R02A 1ZHZA 2WVOA 2A6HF 2ZXPA 3CZ6A 1O3UA 3GORA 3E9VA 3TQOA 1EQ1A 4DRIB 3F47A 2YLGA 2HV6A 4O6MA 2IXNA 5KYUB 3O10A 4ULVA 5COFA 1J8MF 4U5EE 1YARO 1RXQA 3KL4A 1JAFA 5E2QA 1QLEC 5A6BA 1OCRC 1RMVA 5JT4A 4K1OA 5T3WA 5COMA 1Z5ZA 3NRHA 3SXYA 4G78A 1D0ZA 3FHDA 3LNMB 4YT4A 3QTHA 1C17M 1TFKB 4AK9A 5FZTA 4YWQA 3V5YA 2B0JA 1JR8A 2GDCA 2MHRA 2WZFA 2XLMA 4N4WA 2MWQA 3EPVA 2R7XA 2P1AA 3HNJA 3VF0A 3U3BA 4XPYA 4U9EA 4EIYA 5A6JA 5L3QA 2VCAA 2R7QA 1SMYF 1H9TA 1A7DA 3IEEA 2ASRA 4XLPF 1YYJA 2ZXRA 1GM5A 3B71A 3GEIA 2CCYA 1T6QA 1FTSA 3UNGC 1D1AA 2NG1A 3M15A 4RD9A 5BQHA 1V55C 1L7CA 4IAOA 3FMSA 3G4XA 3M79A 3G4ZA 1H9GA 4ONSA 5T3TA 2CW0F 1FNTc 3T4RA 5AC4A 2YLDA 2AP3A 4X0RA 3LJBA 3NG1A 3ZWIA 4DVYP 3PDMP 1Y4CA 3Q7LA 3O55A 3I5PA 3KPHA 1D1BA 1YZCA 2NSGA 5L3VA 4C3DA 3TJ6A 2YVKA 1RCPA 1HW1A 1PD0A 3EFOA 3LUTB 3U2LA 4E0HA 2BE5F 3ECSA 2HMZA 2VCBA 1U0BB 1L3PA 5L0GA 3IPMO 1E86A 4CS9A 2R7TA 3HNLA 1ZHYA 3TJ5A 2R7WA 4J7YA 2NSFA 3EG9A 2A0BA 3UR3C 2I8BA 1K40A 3LAYA 2YL1A 1BR2A 1E83A 2BC5A 2D5RB 1U89A 1ORSC 1UG7A 4IWBA 1V54C 1S05A 4U9DA 5DVWA 3RQFA 4MNDA 1WWPA 1WTYA 4LLCA 2J9WA 3J06A 3O6XA 3SEOA 4H54A 3MLGA 2M64A 4DXWA 1TWGA 2X0CA 3FAPB 2L81A 3L1MA 2EIKC 2R25A 4G7ZF 2W4BA 4R32A 4Z9IA 5KYXA 4JTCB 4YL3A 1RJ9A 3US6A 3ZQVA 1HMOA 2CGEA 4W8KA 2XL4A 3C8GB 3JCUQ 4MTGA 5JVEA 2J9VA 3K66A 3QVYA 5L0IA 4P9FA 2ETSA 1HMDA 4M63A 3W8HA 3DE8A 4CDYA 5L0DA 2EPMX 2LIGA 2NUTB 3NMJA 4HEAJ 4MVSA 4YN0B 5L0HA 1BR1A 3JTLO 3MBGA 5DQTA 2J8WA 3C8GD 1Q0MA 3WAQA 1YDIA 4MTFA 2I15A 3PHF2 2LSEA 1LS1A 3AG2C 3IHUA 4FAPB 1J8YF 5B3SC 1TQGA 4U5HA 3MYFA 1K05A 3ZDLA 4G0HA 3WG7C 2R9RB 3JYYA 4MVQA 1VTMP 2XLWA 2YZSA 3HNIA 2XM4A 4KNVA 3SXMA 1Z63A 1RKEA 3LNRA 1VYIA 2VH3A 3N24A 1WATA 3QW0A 3RVYA 1AUEA 4UDVA 1I4ZA 4D4NA 2ICWG 2VCCA 4W8PA 3FAJA 1NBBA 4E7ZA 1XWJA 2OKUA 2OJQA 2YHSA 3RH3A 3DXJF 4EWCA 2HJMA 3NYJA 1G4WR 3FOPA 2PBEA 4YL1A 5F5FA 2IYLD 2LP4A 1SZIA 3JSZA 3HTKC 2Q4FA 4N6CA 5AGFA 2HSBA 2Y3BA 2Q00A 2Y39A 1LVKA 3BRJA 4XQ1A 2H7OA 3PMRA 3ZC4A 1FFTC 4DRHB 4DVZA 1IZMA 1G5ZA 2R05A 2H7VC 2OEVA 3H2VA 2OG2A 2G62A 1QSPA 2Y3DA 4BJTA 2R7RA 4BJ1A 4JTDB 5B1BC 1T01A 2DB4A 2CNWD 1WGWA 3LEOA 4U5FE 2CDQA 1FFHA 2Y3GA 3NKEA 5COGA 3ZSUA 5CI9A 4XLNF 1Q0GA 3IQCA 2QUPA 3U9JA 1IW7F 3HNKA 1BR4A 1DOWA 1H7IA 3S29A 1ZW2A 2IXMA 2OEXA 3KH2A 3GM3A 4XEKA 3T6BA 1KTMA 4BJ6C 2LFDA 1QKRA 3RF3A 3S28A 2B0HA 3JRMO 5IY5C 1T9KA 2A69F 3B9QA 2PX0A 1R4TA 1TFOB 1ZW3A 4I1OB 1VK5A 4J7TA 4LACB 2XS1A 3PCVA 2A1DD 4O79A 4XEFA 1UFBA 3T9OA 4OIPF
chains in the Genus database with same CATH topology
3M15A 4CDVA 4NC3A 1BBHA 5B3IA 2XLHA 3M79A 3ZTZA 3TOLA 5JSLA 2YLDA 1CPRA 3QW1A 4IARA 3ZWIA 5JRAA 2XL8A 4WGZA 1YZCA 1RCPA 4CIPA 1E86A 3HNLA 1LM3B 1QQ3A 2XLDA 2YL0A 1E83A 4CDAA 2YL1A 1YZAA 4WGYA 1CGOA 2BC5A 4U9DA 1S05A 4CX9A 5JP7A 2XLOA 1M6TA 3ZQYA 3VRCA 2YKZA 3L1MA 3M4CA 3C63A 3U8PA 1GQAA 3ZQVA 2YLIA 4IB4A 4CJGA 3IQ5A 5JVEA 3QVYA 1E85A 3DE8A 4CDYA 4ER9A 3NMJA 2J9BA 2J8WA 1APCA 1EKYA 5JS5A 1CGNA 3FOOA 1YYXA 1CPQA 2XLWA 3HNIA 2XM4A 1A7VA 4JEBA 2YL3A 1QPUA 3QW0A 4N6HA 3M4BA 4D4NA 1MQVA 1NBBA 4D4XA 2XLEA 1E84A 4IAQA 3FOPA 3QVZA 4JE9A 5JLIA 2XM0A 4JEAA 4L6RA 2YLGA 5AGFA 4JKVA 4ULVA 3NMIA 2XLVA 3TOMA 1JAFA 256BA 2YL7A 5JT4A 3C62A 3ZTMA 3NMKA 2XLMA 4N4WA 3HNKA 4CJOA 3HNJA 3IQ6A 4U9EA 4EIYA 5JUAA 1YYJA 3DE9A 2XL6A 2QLAA 2CCYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M15 A;  4CDV A;  4NC3 A;  1BBH A;  5B3I A;  2XLH A;  3M79 A;  3ZTZ A;  3TOL A;  5JSL A;  2YLD A;  1CPR A;  3QW1 A;  4IAR A;  3ZWI A;  5JRA A;  2XL8 A;  4WGZ A;  1YZC A;  1RCP A;  4CIP A;  1E86 A;  3HNL A;  1LM3 B;  1QQ3 A;  2XLD A;  2YL0 A;  1E83 A;  4CDA A;  2YL1 A;  1YZA A;  4WGY A;  1CGO A;  2BC5 A;  4U9D A;  1S05 A;  4CX9 A;  5JP7 A;  2XLO A;  1M6T A;  3ZQY A;  3VRC A;  2YKZ A;  3L1M A;  3M4C A;  3C63 A;  3U8P A;  1GQA A;  3ZQV A;  2YLI A;  4IB4 A;  4CJG A;  3IQ5 A;  5JVE A;  3QVY A;  1E85 A;  3DE8 A;  4CDY A;  4ER9 A;  3NMJ A;  2J9B A;  2J8W A;  1APC A;  1EKY A;  5JS5 A;  1CGN A;  3FOO A;  1YYX A;  1CPQ A;  2XLW A;  3HNI A;  2XM4 A;  1A7V A;  4JEB A;  2YL3 A;  1QPU A;  3QW0 A;  4N6H A;  3M4B A;  4D4N A;  1MQV A;  1NBB A;  4D4X A;  2XLE A;  1E84 A;  4IAQ A;  3FOP A;  3QVZ A;  4JE9 A;  5JLI A;  2XM0 A;  4JEA A;  4L6R A;  2YLG A;  5AGF A;  4JKV A;  4ULV A;  3NMI A;  2XLV A;  3TOM A;  1JAF A;  256B A;  2YL7 A;  5JT4 A;  3C62 A;  3ZTM A;  3NMK A;  2XLM A;  4N4W A;  3HNK A;  4CJO A;  3HNJ A;  3IQ6 A;  4U9E A;  4EIY A;  5JUA A;  1YYJ A;  3DE9 A;  2XL6 A;  2QLA A;  2CCY A; 
#chains in the Genus database with same CATH topology
 1RKE B;  4JRZ A;  1E2X A;  5HV9 A;  2Y69 C;  2QTV A;  3A9C A;  4BEM J;  3K7D A;  5B3I A;  5HSW A;  2NPU A;  2RSE B;  3AQC A;  3TOL A;  4PJL A;  1KNY A;  1H6G A;  4MVZ A;  1CPR A;  2J9U A;  4KBL A;  4AE4 A;  2G3K A;  1QVX A;  4HFK B;  2XL8 A;  3S9O A;  5DQZ A;  5L0J A;  2WZG A;  5EK0 A;  2AU5 A;  4AX2 A;  3JT1 A;  2PX3 A;  4PR9 A;  4E7S A;  3FDQ A;  4OIQ F;  2HUJ A;  5A69 A;  4CS8 A;  4PJM A;  4CIP A;  4XEV A;  3UGP A;  2Q3T A;  4JCZ A;  3CEX A;  4YT8 A;  1ORY A;  1TWH A;  4K7B A;  4LDK A;  1O5H A;  1V74 B;  1QQ3 A;  2XLD A;  1OCZ C;  4QI2 A;  2YL0 A;  4RDA A;  3OWT A;  1NFO A;  4IGG A;  2FFH A;  1CGO A;  2J0W A;  2KSF A;  4NTA A;  3MYI A;  3SXK A;  5EHH A;  4CX9 A;  1Z6A A;  3VYW A;  3ZG1 A;  1I5N A;  2EIM C;  2PF4 E;  2ZXW C;  3DJU B;  2R03 A;  5AC5 A;  4C7O A;  2YKZ A;  3RKO F;  1G4U S;  2A68 F;  3NYL A;  2UUI A;  1LIH A;  2PP4 A;  1Z3I X;  3B0V C;  5CIV A;  5L0C A;  1WOL A;  3S27 A;  2YRF A;  3EGX A;  1W2W A;  1LS4 A;  3U8V A;  5FCL A;  1ORJ A;  4IB4 A;  4CJG A;  1ZU4 A;  1OR2 A;  3IQ5 A;  3ZVR A;  3S84 A;  1MMD A;  4A4A A;  2F22 A;  5F28 E;  4ER9 A;  2HMQ A;  1LE4 A;  4B6I A;  1D1C A;  1OKK A;  1NLX A;  3L8I A;  4EBK A;  2R7S A;  4CIH A;  1N1C A;  3C18 A;  3EFO B;  1YA7 O;  3HJC A;  3HKK A;  2J45 A;  3N0T A;  3GEH A;  4JVS A;  4EBB A;  1CGM E;  3L0I A;  4IRU A;  4NQF A;  2QY9 A;  2WL8 A;  2J0X A;  1M57 C;  4G7H F;  3TUL A;  1JPN A;  4H4K C;  4XWJ A;  3RYL A;  1NU9 C;  1HW2 A;  3KMI A;  1VYK A;  4QDL A;  3LS1 A;  2L7A A;  1NFN A;  2C03 A;  4CS7 A;  4YT5 A;  3H2U A;  5E3A A;  5DLJ A;  5L0F A;  2EIL C;  2YL3 A;  3POV A;  3CAX A;  1XZQ A;  4N6H A;  3M4B A;  4CSA C;  1FAP B;  4OIO F;  2EIJ C;  1LI7 A;  1MQV A;  4MVU A;  3RQE A;  2OQM A;  2ZXO A;  4D4X A;  1TWC A;  1E84 A;  4YJW A;  4YK5 A;  3WOD F;  3JRT A;  3QVZ A;  3DJN B;  2O9X A;  3W2V A;  4DBQ A;  3EGX B;  4O6N A;  1NSG B;  2L9J A;  1YA9 A;  2OOC A;  3C8G A;  4JEA A;  4XTK A;  4BG0 A;  1KU2 A;  1OKK D;  3DM5 A;  4LDR A;  2G3V A;  1QZX A;  3EG9 B;  3TOM A;  1M2V B;  256B A;  2HFI A;  1HE9 A;  2YWA A;  4OD5 A;  2X51 A;  2L6F A;  3K1I C;  2EPK X;  2WVN A;  4MVR A;  2Q9C A;  1EI7 A;  1A0B A;  1D0Y A;  1YVI A;  5EGY A;  3ZTM A;  3NMK A;  4FES A;  3MFN A;  2NUT A;  2VC9 A;  4O7G A;  3RIP A;  1FMW A;  4WJ0 A;  2NUP B;  5KYW A;  3X2Q C;  4EUK B;  3JSE O;  4PK4 A;  1M2O A;  1T6I A;  1A7E A;  5BUO A;  1ZZP A;  4JIO A;  2LK4 A;  3CQZ A;  5JUA A;  4JC7 A;  3AGU A;  1DOV A;  4KC9 A;  2A0U A;  3SP1 A;  5KYX B;  2QLA A;  2CNW A;  3DMD A;  2M4E A;  2Q9B A;  3EHM A;  2Q7R A;  5K0I A;  2ZD9 A;  5D91 A;  1BBH A;  2JPU A;  2R7O A;  4MW8 A;  1Z7Q c;  3SYN A;  2IM8 A;  3ZTZ A;  3X1O A;  1ZYR F;  2P61 A;  2KNH A;  2MYS A;  1FMV A;  2Q9A A;  3U3F A;  3AOU A;  4F4B A;  4PJJ A;  4NY3 A;  5JRA A;  2HS5 A;  2HKV A;  1JPJ A;  3JZ0 A;  2W45 A;  2P7V A;  1T5O A;  4KNW A;  4WGZ A;  2J46 A;  3U9M A;  4BJ5 A;  4ZLD A;  2AVK A;  3C8Z A;  2PNO A;  4GEH A;  4JUR I;  1BZ4 A;  2NUP A;  4GYT A;  2L6G A;  4Z9H A;  1Z23 A;  4C3E A;  5E33 A;  2KYH A;  2QE9 A;  3QZC A;  3FVY A;  5A6A A;  1AEP A;  3LLK A;  1OQC A;  3U0C A;  4CDA A;  1YJG A;  4WGY A;  3RVZ A;  2QNL A;  3DI5 A;  3FXH A;  1B68 A;  1VB5 A;  4NTF A;  2P6V A;  1PV3 A;  2HZ8 A;  3EQL F;  3ASO C;  5JP7 A;  4BEJ A;  2XLO A;  4I1M A;  1ZHT A;  3AG4 C;  1F1M A;  3UMK A;  1FR0 A;  1RKC A;  4QI0 A;  3LEV A;  3DZA A;  4YT2 A;  2DI3 A;  2LFF A;  2KGO A;  3C63 A;  5GPG B;  3K33 A;  3U8P A;  3LLI A;  4LER A;  4MS2 A;  1GQA A;  1OW8 A;  1OCC C;  4LLE A;  1A41 A;  3CSK A;  4NTB A;  2JD3 A;  4BPM A;  4KI2 A;  1HY5 A;  1BDJ B;  3I4U A;  4OIN F;  2XRH A;  3EH1 A;  4JW1 A;  4PFO A;  2GA0 A;  3EGD B;  1E85 A;  2LCH A;  2D4U A;  5A6K A;  3L8J A;  4RBN A;  4CSA A;  3AJM A;  2WVQ A;  2EPO A;  3DWW A;  3OEO A;  2OJE D;  4DJ9 A;  1OXB A;  2JX0 A;  2KK1 A;  3AQB A;  1Y6D A;  1LKX A;  4JCH A;  4WAB A;  2LQG A;  5CI8 A;  1APC A;  1MNE A;  4MW3 A;  1EKY A;  3UMH A;  5JS5 A;  1CGN A;  1V4A A;  2W4M A;  1YAU O;  2IXO A;  3T6G B;  1O87 A;  5DS4 A;  1YYX A;  3EHN A;  3EH2 A;  2OCC C;  3VM6 A;  3VAY A;  2TMV P;  4E18 A;  4OD4 A;  4P6I C;  1QPU A;  2KJG A;  4AE4 B;  1PCX A;  3LS0 A;  3R7C A;  3NDB B;  3TK0 A;  4ZLC A;  1ZU5 A;  4J30 B;  4J32 B;  3GAN A;  4FWV A;  3SXZ A;  4AL0 A;  5KYW B;  4FX5 A;  3K1I A;  1Q0K A;  2YQY A;  3LES A;  2KQ9 A;  2V26 A;  1NZE A;  2L6H A;  3GWL A;  4JE9 A;  4DRJ B;  3SNH A;  5JLI A;  4E0I A;  3AGT A;  1RJ9 B;  2YEV A;  3NYM A;  2XM0 A;  1MND A;  4L6R A;  3EJN A;  2EPN A;  2H8A A;  4JKV A;  3W2W A;  1OXK A;  2IOQ A;  3EGD A;  3KYI A;  2XLV A;  3NMI A;  4Q7C A;  3RW0 A;  2ZPA A;  3RFY A;  3MX3 A;  5A6B D;  1OCO C;  1OW7 A;  1U6H A;  2Z15 A;  2XXA B;  2PFD A;  2YL7 A;  4LDQ A;  2C04 A;  3C7J A;  1MMG A;  5F5H A;  2EPL X;  3C62 A;  3EZI A;  2AWC A;  3DAG A;  3Q6M A;  3QMK A;  1G8X A;  3S90 A;  3UGO A;  1ZVZ A;  1S7Z A;  2KW3 C;  3DAF A;  3KKB A;  4K0D A;  2VB6 A;  2XSE A;  5KYN A;  3K1H A;  3SZR A;  3UMI A;  2GWW A;  1C02 A;  4U5C E;  5T1D B;  4CJO A;  1GGQ A;  3IQ6 A;  1SYQ A;  4CS8 C;  1LPE A;  2XS8 A;  2IXP A;  4JJG A;  1C03 A;  3O39 A;  4O6Y A;  2DYR C;  5DS6 A;  5DS5 A;  1MMN A;  4EHP A;  3AG3 C;  4U5B E;  3G50 A;  3T6J A;  3DE9 A;  1YLM A;  3F46 A;  3H65 A;  2XL6 A;  1ZHW A;  3EZH A;  3L34 A;  1T6U A;  1M2V A;  2EIN C;  4NC3 A;  4CDV A;  2HSQ A;  5BQI A;  2XLH A;  3S0X A;  1K04 A;  2P0N A;  1HE1 A;  4EBJ A;  1VOM A;  3ABK C;  3I5Q A;  4I3M A;  3GM2 A;  4IAR A;  3QW1 A;  5JSL A;  4JZA A;  4I44 A;  2WB7 A;  2BL2 A;  4PAC A;  4Q4Z F;  1MMA A;  4U5G A;  2Y3H A;  2KC3 A;  3WHN A;  2V3C C;  1Q0D A;  3DKA A;  1AVO B;  5D92 A;  3W4Y A;  4MTO A;  2IBF A;  3JYH A;  1R5I D;  3GOD A;  5BQG A;  4P9T A;  1LM3 B;  3K6B A;  5TJ5 E;  3U2M A;  3ZIB A;  3Q7G A;  4BJ6 A;  4PJN A;  1TKN A;  4CBE A;  2H7B A;  4DOZ A;  3B0U X;  1GS9 A;  1ST6 A;  1TR2 A;  1YZA A;  2UUH A;  2VAS A;  3AG1 C;  2FGY A;  3ASN C;  3BEH A;  2DYS C;  4Z9J A;  5E3C A;  2J7P A;  1VLT A;  1NG1 A;  4G7O F;  1ZHX A;  3B29 A;  3GEE A;  3R2P A;  4BJ5 C;  3U5S A;  3ABL C;  1M6T A;  4HFF B;  4N06 A;  3V5X A;  4EKW A;  3ZQY A;  4MQ9 F;  4CS9 C;  3VRC A;  3DM9 B;  3ITF A;  3OA1 A;  4XPW A;  3M4C A;  5KYU A;  4JTA B;  2HV7 A;  2OU6 A;  4OIR F;  2FAP B;  4C3B A;  4PFP A;  5KYY B;  2R7V A;  2J7P D;  2W9Y A;  3B0P A;  1OR3 A;  4YL0 A;  5B1A C;  2GFH A;  2YLI A;  4ULW A;  1VMA A;  1PD1 A;  4GQH A;  3W8I A;  3V7O A;  2DGJ A;  4IJJ A;  1WN0 A;  4MVM A;  3HLZ A;  2A6E F;  3V5Z A;  3IQT A;  3NKD A;  1Q0F A;  3TD7 A;  2AWY A;  3DD7 A;  2J9B A;  3ABM C;  4MVO A;  1SR2 A;  1WAS A;  3KYJ A;  2WZL A;  4XPX A;  4U5D E;  1JMW A;  3Q6N A;  4A2N B;  1OW6 A;  2LD6 A;  3FOO A;  1NU7 D;  1I4Y A;  1LI5 A;  2XXA A;  2RD9 A;  2CYD A;  1CPQ A;  1A7V A;  3N2Z B;  4JEB A;  3RQG A;  5KYY A;  1M56 C;  4AL1 A;  1EA8 A;  3E70 C;  4DBR A;  4E17 A;  4HE8 D;  1XZP A;  3ATP A;  1D0X A;  1JRA A;  2GAQ A;  4C7O B;  4Q5S F;  2R7U A;  1LE2 A;  2HJ3 A;  2XLE A;  3GWN A;  1VLS A;  1TWA A;  3GM1 A;  3M1C B;  4IAQ A;  1JOG A;  4JJF A;  1SF8 A;  2E87 A;  4NCQ A;  4ANJ A;  3A11 A;  2R02 A;  1ZHZ A;  2WVO A;  2A6H F;  2ZXP A;  3CZ6 A;  1O3U A;  3GOR A;  3E9V A;  3TQO A;  1EQ1 A;  4DRI B;  3F47 A;  2YLG A;  2HV6 A;  4O6M A;  2IXN A;  5KYU B;  3O10 A;  4ULV A;  5COF A;  1J8M F;  4U5E E;  1YAR O;  1RXQ A;  3KL4 A;  1JAF A;  5E2Q A;  1QLE C;  5A6B A;  1OCR C;  1RMV A;  5JT4 A;  4K1O A;  5T3W A;  5COM A;  1Z5Z A;  3NRH A;  3SXY A;  4G78 A;  1D0Z A;  3FHD A;  3LNM B;  4YT4 A;  3QTH A;  1C17 M;  1TFK B;  4AK9 A;  5FZT A;  4YWQ A;  3V5Y A;  2B0J A;  1JR8 A;  2GDC A;  2MHR A;  2WZF A;  2XLM A;  4N4W A;  2MWQ A;  3EPV A;  2R7X A;  2P1A A;  3HNJ A;  3VF0 A;  3U3B A;  4XPY A;  4U9E A;  4EIY A;  5A6J A;  5L3Q A;  2VCA A;  2R7Q A;  1SMY F;  1H9T A;  1A7D A;  3IEE A;  2ASR A;  4XLP F;  1YYJ A;  2ZXR A;  1GM5 A;  3B71 A;  3GEI A;  2CCY A;  1T6Q A;  1FTS A;  3UNG C;  1D1A A;  2NG1 A;  3M15 A;  4RD9 A;  5BQH A;  1V55 C;  1L7C A;  4IAO A;  3FMS A;  3G4X A;  3M79 A;  3G4Z A;  1H9G A;  4ONS A;  5T3T A;  2CW0 F;  1FNT c;  3T4R A;  5AC4 A;  2YLD A;  2AP3 A;  4X0R A;  3LJB A;  3NG1 A;  3ZWI A;  4DVY P;  3PDM P;  1Y4C A;  3Q7L A;  3O55 A;  3I5P A;  3KPH A;  1D1B A;  1YZC A;  2NSG A;  5L3V A;  4C3D A;  3TJ6 A;  2YVK A;  1RCP A;  1HW1 A;  1PD0 A;  3EFO A;  3LUT B;  3U2L A;  4E0H A;  2BE5 F;  3ECS A;  2HMZ A;  2VCB A;  1U0B B;  1L3P A;  5L0G A;  3IPM O;  1E86 A;  4CS9 A;  2R7T A;  3HNL A;  1ZHY A;  3TJ5 A;  2R7W A;  4J7Y A;  2NSF A;  3EG9 A;  2A0B A;  3UR3 C;  2I8B A;  1K40 A;  3LAY A;  2YL1 A;  1BR2 A;  1E83 A;  2BC5 A;  2D5R B;  1U89 A;  1ORS C;  1UG7 A;  4IWB A;  1V54 C;  1S05 A;  4U9D A;  5DVW A;  3RQF A;  4MND A;  1WWP A;  1WTY A;  4LLC A;  2J9W A;  3J06 A;  3O6X A;  3SEO A;  4H54 A;  3MLG A;  2M64 A;  4DXW A;  1TWG A;  2X0C A;  3FAP B;  2L81 A;  3L1M A;  2EIK C;  2R25 A;  4G7Z F;  2W4B A;  4R32 A;  4Z9I A;  5KYX A;  4JTC B;  4YL3 A;  1RJ9 A;  3US6 A;  3ZQV A;  1HMO A;  2CGE A;  4W8K A;  2XL4 A;  3C8G B;  3JCU Q;  4MTG A;  5JVE A;  2J9V A;  3K66 A;  3QVY A;  5L0I A;  4P9F A;  2ETS A;  1HMD A;  4M63 A;  3W8H A;  3DE8 A;  4CDY A;  5L0D A;  2EPM X;  2LIG A;  2NUT B;  3NMJ A;  4HEA J;  4MVS A;  4YN0 B;  5L0H A;  1BR1 A;  3JTL O;  3MBG A;  5DQT A;  2J8W A;  3C8G D;  1Q0M A;  3WAQ A;  1YDI A;  4MTF A;  2I15 A;  3PHF 2;  2LSE A;  1LS1 A;  3AG2 C;  3IHU A;  4FAP B;  1J8Y F;  5B3S C;  1TQG A;  4U5H A;  3MYF A;  1K05 A;  3ZDL A;  4G0H A;  3WG7 C;  2R9R B;  3JYY A;  4MVQ A;  1VTM P;  2XLW A;  2YZS A;  3HNI A;  2XM4 A;  4KNV A;  3SXM A;  1Z63 A;  1RKE A;  3LNR A;  1VYI A;  2VH3 A;  3N24 A;  1WAT A;  3QW0 A;  3RVY A;  1AUE A;  4UDV A;  1I4Z A;  4D4N A;  2ICW G;  2VCC A;  4W8P A;  3FAJ A;  1NBB A;  4E7Z A;  1XWJ A;  2OKU A;  2OJQ A;  2YHS A;  3RH3 A;  3DXJ F;  4EWC A;  2HJM A;  3NYJ A;  1G4W R;  3FOP A;  2PBE A;  4YL1 A;  5F5F A;  2IYL D;  2LP4 A;  1SZI A;  3JSZ A;  3HTK C;  2Q4F A;  4N6C A;  5AGF A;  2HSB A;  2Y3B A;  2Q00 A;  2Y39 A;  1LVK A;  3BRJ A;  4XQ1 A;  2H7O A;  3PMR A;  3ZC4 A;  1FFT C;  4DRH B;  4DVZ A;  1IZM A;  1G5Z A;  2R05 A;  2H7V C;  2OEV A;  3H2V A;  2OG2 A;  2G62 A;  1QSP A;  2Y3D A;  4BJT A;  2R7R A;  4BJ1 A;  4JTD B;  5B1B C;  1T01 A;  2DB4 A;  2CNW D;  1WGW A;  3LEO A;  4U5F E;  2CDQ A;  1FFH A;  2Y3G A;  3NKE A;  5COG A;  3ZSU A;  5CI9 A;  4XLN F;  1Q0G A;  3IQC A;  2QUP A;  3U9J A;  1IW7 F;  3HNK A;  1BR4 A;  1DOW A;  1H7I A;  3S29 A;  1ZW2 A;  2IXM A;  2OEX A;  3KH2 A;  3GM3 A;  4XEK A;  3T6B A;  1KTM A;  4BJ6 C;  2LFD A;  1QKR A;  3RF3 A;  3S28 A;  2B0H A;  3JRM O;  5IY5 C;  1T9K A;  2A69 F;  3B9Q A;  2PX0 A;  1R4T A;  1TFO B;  1ZW3 A;  4I1O B;  1VK5 A;  4J7T A;  4LAC B;  2XS1 A;  3PCV A;  2A1D D;  4O79 A;  4XEF A;  1UFB A;  3T9O A;  4OIP F; 
#chains in the Genus database with same CATH homology
 3M15 A;  4CDV A;  4NC3 A;  1BBH A;  5B3I A;  2XLH A;  3M79 A;  3ZTZ A;  3TOL A;  5JSL A;  2YLD A;  1CPR A;  3QW1 A;  4IAR A;  3ZWI A;  5JRA A;  2XL8 A;  4WGZ A;  1YZC A;  1RCP A;  4CIP A;  1E86 A;  3HNL A;  1LM3 B;  1QQ3 A;  2XLD A;  2YL0 A;  1E83 A;  4CDA A;  2YL1 A;  1YZA A;  4WGY A;  1CGO A;  2BC5 A;  4U9D A;  1S05 A;  4CX9 A;  5JP7 A;  2XLO A;  1M6T A;  3ZQY A;  3VRC A;  2YKZ A;  3L1M A;  3M4C A;  3C63 A;  3U8P A;  1GQA A;  3ZQV A;  2YLI A;  4IB4 A;  4CJG A;  3IQ5 A;  5JVE A;  3QVY A;  1E85 A;  3DE8 A;  4CDY A;  4ER9 A;  3NMJ A;  2J9B A;  2J8W A;  1APC A;  1EKY A;  5JS5 A;  1CGN A;  3FOO A;  1YYX A;  1CPQ A;  2XLW A;  3HNI A;  2XM4 A;  1A7V A;  4JEB A;  2YL3 A;  1QPU A;  3QW0 A;  4N6H A;  3M4B A;  4D4N A;  1MQV A;  1NBB A;  4D4X A;  2XLE A;  1E84 A;  4IAQ A;  3FOP A;  3QVZ A;  4JE9 A;  5JLI A;  2XM0 A;  4JEA A;  4L6R A;  2YLG A;  5AGF A;  4JKV A;  4ULV A;  3NMI A;  2XLV A;  3TOM A;  1JAF A;  256B A;  2YL7 A;  5JT4 A;  3C62 A;  3ZTM A;  3NMK A;  2XLM A;  4N4W A;  3HNK A;  4CJO A;  3HNJ A;  3IQ6 A;  4U9E A;  4EIY A;  5JUA A;  1YYJ A;  3DE9 A;  2XL6 A;  2QLA A;  2CCY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...