4WGZA

Crystal structure of cytochrome c' from alcaligenes xylosoxidans ncimb 11015 at ph 6.0
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
126
structure length
126
Chain Sequence
EFAKPEDAVKYRQSALTLMASHFGRMTPVVKGQAPYDAAQIKANVEVLKTLSALPWAAFGPGTEGGDARPEIWSDAASFKQKQQAFQDNIVKLSAAADAGDLDKLRAAFGDVGASCKACHDAYRKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c'
publication title X-ray Crystallographic Elucidation for the Alkaline High-spin State Transition of Iron(III) Cytochrome c' from Alcaligenes xylosoxidans NCIMB 11015
doi rcsb
molecule tags Electron transport
total genus 53
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2014-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01322 Cytochrom_C_2 Cytochrome C'
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 4wgzA00
1YYJA 3HNJA 2XLWA 2YKZA 1EKYA 3FOOA 3IQ5A 4NC3A 4ER9A 1YZAA 1LM3B 4CDAA 2YL7A 3DE8A 3M4CA 2J8WA 4L6RA 5JSLA 5JLIA 2XL8A 2XLDA 4WGZA 2XLVA 3HNIA 1JAFA 4JEBA 3U8PA 2QLAA 1YYXA 1YZCA 4CX9A 5JT4A 3IQ6A 2XM0A 2XL6A 2YLDA 3NMKA 4CJOA 3M79A 3ZTMA 1NBBA 2XLHA 3M4BA 2BC5A 3VRCA 1M6TA 4EIYA 1CGNA 1E85A 1MQVA 3QW0A 2CCYA 4IARA 2YLIA 3QW1A 1E86A 4U9DA 4ULVA 256BA 2XLEA 5JS5A 1APCA 3NMIA 2YL3A 1CGOA 3FOPA 1QQ3A 4U9EA 5JP7A 3QVYA 2XM4A 3NMJA 3QVZA 1A7VA 2YL0A 4WGYA 3TOMA 1E84A 3HNLA 2J9BA 2YLGA 3C62A 1BBHA 1S05A 1E83A 1CPRA 3ZWIA 3ZQYA 3ZTZA 1GQAA 3C63A 4JEAA 5B3IA 3L1MA 4N6HA 4CIPA 1QPUA 5JRAA 1CPQA 2XLMA 2YL1A 4IB4A 1RCPA 3HNKA 3M15A 5AGFA 4JKVA 4IAQA 3DE9A 4CDVA 3TOLA 5JUAA 4CDYA 2XLOA 4JE9A 4N4WA 3ZQVA 4D4NA 4CJGA 4D4XA 5JVEA
chains in the Genus database with same CATH superfamily
4U5DE 3BEHA 3HNJA 4GQHA 2Y39A 2OEVA 4MQ9F 3AOUA 5L0GA 4LLCA 2A69F 2Q7RA 2UUHA 1Q0FA 1ZHTA 2B0JA 2R7SA 1KU2A 1D0YA 2DYRC 1Q0MA 4MVSA 4F4BA 2XRHA 2I8BA 3U3FA 3X1OA 5CI8A 4NCQA 5BQHA 5KYXB 3RQEA 1J8MF 3ITFA 3FOOA 1Z63A 3TQOA 5FCLA 1YA9A 3R2PA 4NC3A 3GM1A 5L0FA 3JYYA 2WVNA 3M1CB 4ER9A 1YZAA 4HE8D 1NZEA 3DE8A 4G7OF 4AE4A 1KTMA 3M4CA 2L6HA 2J8WA 1ZVZA 3K6BA 3L34A 3L8JA 3U2LA 3C8GD 4BJ5A 1TR2A 1Y4CA 2XLVA 4NTFA 3UGPA 2Y3GA 2J7PA 1H6GA 2GWWA 1YYXA 4ULWA 2J45A 3DXJF 3K1HA 2KSFA 3EGDB 3U2MA 1QLEC 2OEXA 2NG1A 5EHHA 1PD0A 3KMIA 2AU5A 1EQ1A 1RXQA 3N24A 2IXMA 1T01A 3MYIA 3O55A 4N06A 4PFPA 5E33A 4XEVA 1SZIA 3RQFA 2BE5F 1G4US 3GM2A 2A6EF 1Z7Qc 4XQ1A 4JJGA 4AK9A 2P7VA 4CJOA 4DVYP 3M79A 2OJED 2OG2A 3DM5A 3ZTMA 3GORA 1HW2A 2R7VA 4U5FE 3N2ZB 1G8XA 3KYIA 3FHDA 1OR3A 4YL3A 4J7TA 1R4TA 5DVWA 2BL2A 3E9VA 4NTBA 3K33A 2IXOA 2EPOA 4U5BE 4BPMA 4EIYA 1VYKA 1DOVA 3HTKC 1MQVA 3NKEA 4OIOF 2NPUA 3JT1A 3LEOA 2CW0F 1M2OA 2ASRA 3EGXB 1HE1A 1O3UA 1V54C 4FESA 3A9CA 1JMWA 2KJGA 4Z9IA 3RH3A 1FMVA 256BA 1OCCC 2R7QA 1YLMA 2YHSA 3LNRA 2WZFA 4MW8A 1APCA 1U6HA 2HJMA 2OOCA 4YL1A 2XXAB 2AVKA 1E2XA 3KKBA 2EILC 2PFDA 3QMKA 5HSWA 3WODF 1VYIA 1MMAA 3AGUA 2LIGA 5A69A 2E87A 2XM4A 3QVZA 4E0HA 1O87A 3EG9A 5D92A 4R32A 3NYLA 2DYSC 4YT2A 1TFOB 2CNWA 2YRFA 1WATA 2R05A 4KNWA 3SZRA 2YWAA 3EH2A 1PD1A 4XLPF 3U8VA 4I1MA 3V5XA 1MMGA 2YLGA 1YJGA 2NUTA 3ZIBA 1KNYA 1NFOA 2P6VA 3C62A 3H65A 3HJCA 3PCVA 2C04A 1BBHA 1S05A 4IAOA 2L7AA 2HV7A 3O39A 3QTHA 4KBLA 3UMKA 3LS1A 4C3DA 2W45A 4E17A 2P61A 1FMWA 1T6QA 2MWQA 3LNMB 2EPLX 5DLJA 2PX0A 5L0HA 2AWYA 1RKEB 3B29A 1Y6DA 2IYLD 2VB6A 4N6HA 1VLTA 1C03A 4X0RA 1LI7A 2RSEB 4J7YA 3SXZA 3UMIA 3VM6A 2A6HF 4DBQA 1RCPA 1SF8A 3SXYA 1RKCA 1XZPA 2KC3A 5AGFA 3W2VA 5A6BA 1M2VA 3DE9A 3GWNA 3F47A 3TOLA 3LEVA 2XLOA 2LP4A 3ATPA 3ABLC 2Q9AA 3E70C 1SYQA 1DOWA 4B6IA 3LJBA 2VCBA 4GYTA 3DWWA 4CJGA 4UDVA 3H2UA 4C7OB 3U0CA 2ZD9A 1OXBA 3RVZA 4D4XA 4EBBA 5JVEA 3PMRA 2O9XA 2NUPB 3EQLF 3ASOC 3MYFA 5BQIA 3TJ5A 2JD3A 1YA7O 2YKZA 3K66A 3L8IA 1L7CA 2ZXOA 5KYUB 3IQ5A 3GEHA 2EIMC 1N1CA 1CGME 2I15A 2VH3A 4JCHA 3CEXA 1H9GA 3MLGA 1XZQA 3ZDLA 2XS8A 3KH2A 5TJ5E 2NSGA 1BR2A 2J7PD 3NG1A 3TD7A 2YL7A 2M4EA 3LAYA 3FMSA 4H4KC 5JSLA 4L6RA 1Q0GA 5COGA 4EKWA 1WN0A 3KYJA 2H7VC 3LLKA 4JTCB 4KC9A 1BDJB 4ONSA 4MTFA 1M56C 4U5HA 3I5PA 1I5NA 4FX5A 4P9TA 2Y3HA 3JSZA 1V4AA 1D1BA 1BZ4A 3ABKC 4HFKB 1YZCA 3S27A 3TK0A 2R7UA 3N0TA 4M63A 2DI3A 4MVUA 3UGOA 3A11A 3FAJA 1JPJA 4J32B 4BJ1A 4DXWA 4AL1A 1ZU4A 1EI7A 2AP3A 2A1DD 4IGGA 4OD5A 3S29A 1FNTc 3V7OA 1QKRA 3IHUA 5FZTA 4BEJA 5B3SC 2YLDA 4P6IC 1JR8A 5A6JA 4BG0A 2GAQA 1YVIA 2XLHA 3I5QA 3M4BA 5COMA 3EHNA 5AC5A 1RMVA 1T6IA 2BC5A 3EGDA 3ABMC 3ZC4A 2EPMX 1M6TA 2D4UA 5T1DB 3VYWA 1K40A 3AG4C 1V55C 2J9WA 1TFKB 1T9KA 2CCYA 1U0BB 4MTGA 1FTSA 2OU6A 2WVQA 3JTLO 3EFOB 3DD7A 1G4WR 3QW1A 3NYMA 3AG2C 4U9DA 4ULVA 2XLEA 4MVMA 2DB4A 2KYHA 3SYNA 2WVOA 5L0CA 4HEAJ 1JOGA 5F28E 1OKKA 1TWCA 1T6UA 4OINF 3T6JA 1FAPB 3C18A 3ZSUA 5DS5A 3KL4A 4RBNA 2MHRA 3FOPA 2CNWD 1D0ZA 5COFA 1QQ3A 3LS0A 3RFYA 2B0HA 3QVYA 3V5YA 4KNVA 3RIPA 3EZHA 1LI5A 1HMOA 1A7VA 2GA0A 3EGXA 1D1AA 3SXMA 1ORSC 3LESA 4E7SA 4MW3A 3DMDA 3GM3A 2G3KA 4PK4A 3U5SA 3G4ZA 2ZXPA 1E84A 2XXAA 2GFHA 5DQZA 4YJWA 2HUJA 1NU7D 3S0XA 3ZG1A 1ORJA 3AQBA 3I4UA 4NTAA 3HLZA 4MNDA 4QI2A 3ZQYA 1GM5A 5T3WA 1WTYA 5A6AA 2Q4FA 1OCRC 4XTKA 1R5ID 4E7ZA 2R7XA 3T4RA 1HY5A 4G0HA 2WZGA 4BJ5C 3OWTA 5A6KA 3HKKA 4IJJA 4IWBA 5A6BD 2C03A 1VOMA 4N6CA 2EINC 2WZLA 2HZ8A 5T3TA 2HFIA 2WB7A 3US6A 3NDBB 2ICWG 1QPUA 2W4MA 2EIJC 4U5CE 3DZAA 2HMQA 1CPQA 1ZHXA 2XLMA 1NLXA 4BJ6A 1J8YF 4CBEA 1V74B 3DJNB 2XS1A 1T5OA 1D1CA 4OD4A 2L6GA 4LERA 2Q9CA 3JYHA 3U9MA 4Q5SF 5E2QA 3J06A 2Y3DA 4A2NB 5DS4A 1RKEA 3GWLA 3U9JA 2L6FA 4MS2A 1VTMP 3WAQA 2KQ9A 2L81A 2QTVA 4KI2A 1YYJA 2JX0A 3SNHA 4U5GA 1OCZC 3R7CA 2KK1A 1TQGA 4WJ0A 3AJMA 2J46A 3Q6NA 3O10A 1Q0DA 2OKUA 1I4ZA 5KYYB 1XWJA 3B9QA 2R7TA 2LSEA 4YN0B 4C3EA 1GGQA 1EKYA 2FAPB 4XLNF 2G3VA 4O6MA 2J0WA 3C8GB 4O6NA 2UUIA 3T9OA 4C7OA 4DJ9A 2ZXWC 2M64A 2QNLA 1LM3B 4QDLA 4DRJB 1QSPA 3CSKA 3W8IA 1LVKA 3GEEA 5JLIA 4JURI 2QUPA 2W4BA 2XL8A 2XLDA 1UFBA 3SEOA 4W8KA 2TMVP 1JAFA 3EH1A 4JEBA 3U8PA 5E3AA 2QLAA 4K1OA 2R7OA 5CI9A 4G7HF 5E3CA 2CGEA 3JRTA 3DAGA 5KYUA 4BJ6C 4CS7A 4CS9A 1M57C 2HKVA 2Z15A 1OXKA 5KYWB 1HW1A 5JT4A 4YT5A 3JCUQ 1GS9A 3AQCA 3WG7C 5F5HA 1YARO 2XL6A 3W8HA 3K7DA 1LE4A 5DS6A 3G50A 3NMKA 4YK5A 1NG1A 3CAXA 2X0CA 1ST6A 3POVA 1OW7A 4MTOA 1B68A 1NBBA 2H8AA 1RJ9A 2R7WA 4PACA 3T6BA 1HE9A 1LKXA 1Z3IX 3VRCA 4PR9A 4U5EE 2EIKC 1E85A 4Z9HA 1YAUO 1OKKD 3AGTA 3QW0A 4H54A 1D0XA 1L3PA 2OQMA 4O7GA 3RYLA 5EGYA 5L3VA 1U89A 5B1AC 1IZMA 2XL4A 4FWVA 4EBJA 4WABA 5KYXA 1E86A 1NFNA 1O5HA 1Z6AA 2YVKA 3PDMP 3NMIA 3MFNA 1PV3A 5F5FA 1MMNA 2IXPA 2IXNA 1VB5A 1CGOA 2J9UA 1ZHZA 4JC7A 3V5ZA 3PHF2 2A0BA 1ZW2A 2PX3A 2X51A 3EJNA 4DVZA 2XSEA 1Z5ZA 4U9EA 3IQTA 5JP7A 4CS9C 4EHPA 4DBRA 2AWCA 3NMJA 5IY5C 4PJNA 1BR4A 3EFOA 2YZSA 1A7EA 2A68F 2QE9A 2YL0A 4JRZA 4Q7CA 1JPNA 4LDKA 4XEFA 3HNLA 4G78A 5EK0A 4K0DA 1K04A 1AVOB 1C02A 4JTDB 2CYDA 4IRUA 1TWAA 4LACB 3C7JA 1E83A 5B1BC 3RVYA 3ZWIA 4BJTA 5L0IA 4OIQF 2EPNA 5BUOA 2Y69C 1K05A 2ZXRA 1FR0A 2J9VA 2R7RA 4K7BA 4QI0A 3DJUB 1ORYA 3NKDA 1GQAA 4JCZA 3C63A 1ZW3A 1A41A 4E0IA 5B3IA 3FDQA 3B0UX 4CIHA 3S28A 1VLSA 4EWCA 3RW0A 1I4YA 2PBEA 3EHMA 3T6GB 4EUKB 4DOZA 4JZAA 2P0NA 1ZZPA 4AL0A 3DAFA 1LE2A 3M15A 2HSBA 4IAQA 3KPHA 4CDVA 3AG1C 1EA8A 4YT8A 3ZQVA 2PNOA 1JRAA 3JRMO 4MVOA 4XPYA 3VF0A 3DKAA 5AC4A 2JPUA 1G5ZA 3G4XA 4MVQA 2Q00A 1TWHA 3GEIA 2DGJA 4XEKA 2VC9A 3UMHA 2HV6A 2PP4A 1TWGA 2FGYA 3OA1A 4PJMA 5D91A 4AE4B 4CS8A 3EPVA 3RKOF 4JVSA 4YT4A 2A0UA 2XLWA 4RD9A 1LS1A 4O79A 1WASA 3CQZA 1TKNA 3FVYA 1LS4A 1ZHYA 4YL0A 3H2VA 1AUEA 3LUTB 3NYJA 4NY3A 4O6YA 1OCOC 3GANA 1IW7F 2VASA 3B0VC 4CDAA 4CSAA 2R9RB 3C8ZA 1YDIA 3O6XA 3TJ6A 3CZ6A 2HSQA 1VK5A 1Z23A 2OCCC 4XPWA 3ZVRA 2KW3C 4PJJA 3FXHA 2KNHA 4JIOA 4WGZA 2P1AA 3SXKA 5KYYA 4FAPB 3HNIA 4OIRF 1A7DA 4LDRA 2LD6A 4NQFA 3SP1A 4HFFB 3LLIA 2Q3TA 3EZIA 2J0XA 4CX9A 3C8GA 2R03A 4AX2A 5HV9A 4MVZA 4I44A 1S7ZA 4PJLA 3NRHA 2IOQA 1NU9C 2XM0A 3IQ6A 1A0BA 4XPXA 3JZ0A 4Z9JA 2ZPAA 3VAYA 2PF4E 4I1OB 4P9FA 1OR2A 2LK4A 1W2WA 1HMDA 4CS8C 3TULA 3IEEA 1WWPA 3IPMO 2MYSA 5L0JA 3AG3C 4RDAA 2Y3BA 3X2QC 5KYWA 4W8PA 4C3BA 2FFHA 3F46A 2NUPA 4JJFA 4XWJA 1CGNA 3UNGC 4IARA 2YEVA 3Q7LA 5L3QA 3K1IA 3EG9B 4LDQA 4I3MA 1ZYRF 2YLIA 4MVRA 2V3CC 4CSAC 1QVXA 1C17M 1UG7A 5JS5A 1OW6A 3B0PA 4JW1A 4ANJA 1MNEA 2Q9BA 3W4YA 2YL3A 2YQYA 3QZCA 3B71A 2NUTB 1H7IA 1NSGB 2IBFA 2L9JA 2WL8A 3DM9B 4JTAB 2F22A 3RF3A 5CIVA 1SR2A 4G7ZF 4J30B 1WGWA 2H7BA 1LPEA 1OQCA 1VMAA 3FAPB 2GDCA 2OJQA 4A4AA 3DI5A 5K0IA 2ETSA 4PFOA 2HMZA 4E18A 1FFTC 3WHNA 4WGYA 3TOMA 1QZXA 1Q0KA 1FFHA 2VCAA 2W9YA 5GPGB 2J9BA 2V26A 3MX3A 3ASNC 1MNDA 4OIPF 3RQGA 2R02A 3OEOA 3S84A 2CDQA 3JSEO 1CPRA 1M2VB 1ZHWA 3Q7GA 2IM8A 2RD9A 3ZTZA 1MMDA 3UR3C 5BQGA 1LIHA 5L0DA 2VCCA 3GODA 1SMYF 3MBGA 3IQCA 4JEAA 3W2WA 1WOLA 3L1MA 1PCXA 3K1IC 1BR1A 4GEHA 1OW8A 4CIPA 3U3BA 1AEPA 2HJ3A 2KGOA 4YWQA 4ZLDA 2G62A 1F1MA 2NSFA 3ECSA 3S9OA 3BRJA 2YL1A 4IB4A 3HNKA 3Q6MA 4DRIB 5JRAA 4JKVA 4Q4ZF 4EBKA 2LCHA 2LFDA 5JUAA 3L0IA 4LLEA 2LFFA 4JE9A 4N4WA 4CDYA 2R25A 2HS5A 2QY9A 4DRHB 4D4NA 4ZLCA 3S90A 5DQTA 1ZU5A 1RJ9B 5KYNA 4BEMJ 2LQGA 2EPKX 2D5RB 1H9TA 2H7OA
chains in the Genus database with same CATH topology
1YYJA 3HNJA 2XLWA 2YKZA 1EKYA 3FOOA 3IQ5A 4NC3A 4ER9A 1YZAA 1LM3B 4CDAA 2YL7A 3DE8A 3M4CA 2J8WA 4L6RA 5JSLA 5JLIA 2XL8A 2XLDA 4WGZA 2XLVA 3HNIA 1JAFA 4JEBA 3U8PA 2QLAA 1YYXA 1YZCA 4CX9A 5JT4A 3IQ6A 2XM0A 2XL6A 2YLDA 3NMKA 4CJOA 3M79A 3ZTMA 1NBBA 2XLHA 3M4BA 2BC5A 3VRCA 1M6TA 4EIYA 1CGNA 1E85A 1MQVA 3QW0A 2CCYA 4IARA 2YLIA 3QW1A 1E86A 4U9DA 4ULVA 256BA 2XLEA 5JS5A 1APCA 3NMIA 2YL3A 1CGOA 3FOPA 1QQ3A 4U9EA 5JP7A 3QVYA 2XM4A 3NMJA 3QVZA 1A7VA 2YL0A 4WGYA 3TOMA 1E84A 3HNLA 2J9BA 2YLGA 3C62A 1BBHA 1S05A 1E83A 1CPRA 3ZWIA 3ZQYA 3ZTZA 1GQAA 3C63A 4JEAA 5B3IA 3L1MA 4N6HA 4CIPA 1QPUA 5JRAA 1CPQA 2XLMA 2YL1A 4IB4A 1RCPA 3HNKA 3M15A 5AGFA 4JKVA 4IAQA 3DE9A 4CDVA 3TOLA 5JUAA 4CDYA 2XLOA 4JE9A 4N4WA 3ZQVA 4D4NA 4CJGA 4D4XA 5JVEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YYJ A;  3HNJ A;  2XLW A;  2YKZ A;  1EKY A;  3FOO A;  3IQ5 A;  4NC3 A;  4ER9 A;  1YZA A;  1LM3 B;  4CDA A;  2YL7 A;  3DE8 A;  3M4C A;  2J8W A;  4L6R A;  5JSL A;  5JLI A;  2XL8 A;  2XLD A;  4WGZ A;  2XLV A;  3HNI A;  1JAF A;  4JEB A;  3U8P A;  2QLA A;  1YYX A;  1YZC A;  4CX9 A;  5JT4 A;  3IQ6 A;  2XM0 A;  2XL6 A;  2YLD A;  3NMK A;  4CJO A;  3M79 A;  3ZTM A;  1NBB A;  2XLH A;  3M4B A;  2BC5 A;  3VRC A;  1M6T A;  4EIY A;  1CGN A;  1E85 A;  1MQV A;  3QW0 A;  2CCY A;  4IAR A;  2YLI A;  3QW1 A;  1E86 A;  4U9D A;  4ULV A;  256B A;  2XLE A;  5JS5 A;  1APC A;  3NMI A;  2YL3 A;  1CGO A;  3FOP A;  1QQ3 A;  4U9E A;  5JP7 A;  3QVY A;  2XM4 A;  3NMJ A;  3QVZ A;  1A7V A;  2YL0 A;  4WGY A;  3TOM A;  1E84 A;  3HNL A;  2J9B A;  2YLG A;  3C62 A;  1BBH A;  1S05 A;  1E83 A;  1CPR A;  3ZWI A;  3ZQY A;  3ZTZ A;  1GQA A;  3C63 A;  4JEA A;  5B3I A;  3L1M A;  4N6H A;  4CIP A;  1QPU A;  5JRA A;  1CPQ A;  2XLM A;  2YL1 A;  4IB4 A;  1RCP A;  3HNK A;  3M15 A;  5AGF A;  4JKV A;  4IAQ A;  3DE9 A;  4CDV A;  3TOL A;  5JUA A;  4CDY A;  2XLO A;  4JE9 A;  4N4W A;  3ZQV A;  4D4N A;  4CJG A;  4D4X A;  5JVE A; 
#chains in the Genus database with same CATH topology
 4U5D E;  3BEH A;  3HNJ A;  4GQH A;  2Y39 A;  2OEV A;  4MQ9 F;  3AOU A;  5L0G A;  4LLC A;  2A69 F;  2Q7R A;  2UUH A;  1Q0F A;  1ZHT A;  2B0J A;  2R7S A;  1KU2 A;  1D0Y A;  2DYR C;  1Q0M A;  4MVS A;  4F4B A;  2XRH A;  2I8B A;  3U3F A;  3X1O A;  5CI8 A;  4NCQ A;  5BQH A;  5KYX B;  3RQE A;  1J8M F;  3ITF A;  3FOO A;  1Z63 A;  3TQO A;  5FCL A;  1YA9 A;  3R2P A;  4NC3 A;  3GM1 A;  5L0F A;  3JYY A;  2WVN A;  3M1C B;  4ER9 A;  1YZA A;  4HE8 D;  1NZE A;  3DE8 A;  4G7O F;  4AE4 A;  1KTM A;  3M4C A;  2L6H A;  2J8W A;  1ZVZ A;  3K6B A;  3L34 A;  3L8J A;  3U2L A;  3C8G D;  4BJ5 A;  1TR2 A;  1Y4C A;  2XLV A;  4NTF A;  3UGP A;  2Y3G A;  2J7P A;  1H6G A;  2GWW A;  1YYX A;  4ULW A;  2J45 A;  3DXJ F;  3K1H A;  2KSF A;  3EGD B;  3U2M A;  1QLE C;  2OEX A;  2NG1 A;  5EHH A;  1PD0 A;  3KMI A;  2AU5 A;  1EQ1 A;  1RXQ A;  3N24 A;  2IXM A;  1T01 A;  3MYI A;  3O55 A;  4N06 A;  4PFP A;  5E33 A;  4XEV A;  1SZI A;  3RQF A;  2BE5 F;  1G4U S;  3GM2 A;  2A6E F;  1Z7Q c;  4XQ1 A;  4JJG A;  4AK9 A;  2P7V A;  4CJO A;  4DVY P;  3M79 A;  2OJE D;  2OG2 A;  3DM5 A;  3ZTM A;  3GOR A;  1HW2 A;  2R7V A;  4U5F E;  3N2Z B;  1G8X A;  3KYI A;  3FHD A;  1OR3 A;  4YL3 A;  4J7T A;  1R4T A;  5DVW A;  2BL2 A;  3E9V A;  4NTB A;  3K33 A;  2IXO A;  2EPO A;  4U5B E;  4BPM A;  4EIY A;  1VYK A;  1DOV A;  3HTK C;  1MQV A;  3NKE A;  4OIO F;  2NPU A;  3JT1 A;  3LEO A;  2CW0 F;  1M2O A;  2ASR A;  3EGX B;  1HE1 A;  1O3U A;  1V54 C;  4FES A;  3A9C A;  1JMW A;  2KJG A;  4Z9I A;  3RH3 A;  1FMV A;  256B A;  1OCC C;  2R7Q A;  1YLM A;  2YHS A;  3LNR A;  2WZF A;  4MW8 A;  1APC A;  1U6H A;  2HJM A;  2OOC A;  4YL1 A;  2XXA B;  2AVK A;  1E2X A;  3KKB A;  2EIL C;  2PFD A;  3QMK A;  5HSW A;  3WOD F;  1VYI A;  1MMA A;  3AGU A;  2LIG A;  5A69 A;  2E87 A;  2XM4 A;  3QVZ A;  4E0H A;  1O87 A;  3EG9 A;  5D92 A;  4R32 A;  3NYL A;  2DYS C;  4YT2 A;  1TFO B;  2CNW A;  2YRF A;  1WAT A;  2R05 A;  4KNW A;  3SZR A;  2YWA A;  3EH2 A;  1PD1 A;  4XLP F;  3U8V A;  4I1M A;  3V5X A;  1MMG A;  2YLG A;  1YJG A;  2NUT A;  3ZIB A;  1KNY A;  1NFO A;  2P6V A;  3C62 A;  3H65 A;  3HJC A;  3PCV A;  2C04 A;  1BBH A;  1S05 A;  4IAO A;  2L7A A;  2HV7 A;  3O39 A;  3QTH A;  4KBL A;  3UMK A;  3LS1 A;  4C3D A;  2W45 A;  4E17 A;  2P61 A;  1FMW A;  1T6Q A;  2MWQ A;  3LNM B;  2EPL X;  5DLJ A;  2PX0 A;  5L0H A;  2AWY A;  1RKE B;  3B29 A;  1Y6D A;  2IYL D;  2VB6 A;  4N6H A;  1VLT A;  1C03 A;  4X0R A;  1LI7 A;  2RSE B;  4J7Y A;  3SXZ A;  3UMI A;  3VM6 A;  2A6H F;  4DBQ A;  1RCP A;  1SF8 A;  3SXY A;  1RKC A;  1XZP A;  2KC3 A;  5AGF A;  3W2V A;  5A6B A;  1M2V A;  3DE9 A;  3GWN A;  3F47 A;  3TOL A;  3LEV A;  2XLO A;  2LP4 A;  3ATP A;  3ABL C;  2Q9A A;  3E70 C;  1SYQ A;  1DOW A;  4B6I A;  3LJB A;  2VCB A;  4GYT A;  3DWW A;  4CJG A;  4UDV A;  3H2U A;  4C7O B;  3U0C A;  2ZD9 A;  1OXB A;  3RVZ A;  4D4X A;  4EBB A;  5JVE A;  3PMR A;  2O9X A;  2NUP B;  3EQL F;  3ASO C;  3MYF A;  5BQI A;  3TJ5 A;  2JD3 A;  1YA7 O;  2YKZ A;  3K66 A;  3L8I A;  1L7C A;  2ZXO A;  5KYU B;  3IQ5 A;  3GEH A;  2EIM C;  1N1C A;  1CGM E;  2I15 A;  2VH3 A;  4JCH A;  3CEX A;  1H9G A;  3MLG A;  1XZQ A;  3ZDL A;  2XS8 A;  3KH2 A;  5TJ5 E;  2NSG A;  1BR2 A;  2J7P D;  3NG1 A;  3TD7 A;  2YL7 A;  2M4E A;  3LAY A;  3FMS A;  4H4K C;  5JSL A;  4L6R A;  1Q0G A;  5COG A;  4EKW A;  1WN0 A;  3KYJ A;  2H7V C;  3LLK A;  4JTC B;  4KC9 A;  1BDJ B;  4ONS A;  4MTF A;  1M56 C;  4U5H A;  3I5P A;  1I5N A;  4FX5 A;  4P9T A;  2Y3H A;  3JSZ A;  1V4A A;  1D1B A;  1BZ4 A;  3ABK C;  4HFK B;  1YZC A;  3S27 A;  3TK0 A;  2R7U A;  3N0T A;  4M63 A;  2DI3 A;  4MVU A;  3UGO A;  3A11 A;  3FAJ A;  1JPJ A;  4J32 B;  4BJ1 A;  4DXW A;  4AL1 A;  1ZU4 A;  1EI7 A;  2AP3 A;  2A1D D;  4IGG A;  4OD5 A;  3S29 A;  1FNT c;  3V7O A;  1QKR A;  3IHU A;  5FZT A;  4BEJ A;  5B3S C;  2YLD A;  4P6I C;  1JR8 A;  5A6J A;  4BG0 A;  2GAQ A;  1YVI A;  2XLH A;  3I5Q A;  3M4B A;  5COM A;  3EHN A;  5AC5 A;  1RMV A;  1T6I A;  2BC5 A;  3EGD A;  3ABM C;  3ZC4 A;  2EPM X;  1M6T A;  2D4U A;  5T1D B;  3VYW A;  1K40 A;  3AG4 C;  1V55 C;  2J9W A;  1TFK B;  1T9K A;  2CCY A;  1U0B B;  4MTG A;  1FTS A;  2OU6 A;  2WVQ A;  3JTL O;  3EFO B;  3DD7 A;  1G4W R;  3QW1 A;  3NYM A;  3AG2 C;  4U9D A;  4ULV A;  2XLE A;  4MVM A;  2DB4 A;  2KYH A;  3SYN A;  2WVO A;  5L0C A;  4HEA J;  1JOG A;  5F28 E;  1OKK A;  1TWC A;  1T6U A;  4OIN F;  3T6J A;  1FAP B;  3C18 A;  3ZSU A;  5DS5 A;  3KL4 A;  4RBN A;  2MHR A;  3FOP A;  2CNW D;  1D0Z A;  5COF A;  1QQ3 A;  3LS0 A;  3RFY A;  2B0H A;  3QVY A;  3V5Y A;  4KNV A;  3RIP A;  3EZH A;  1LI5 A;  1HMO A;  1A7V A;  2GA0 A;  3EGX A;  1D1A A;  3SXM A;  1ORS C;  3LES A;  4E7S A;  4MW3 A;  3DMD A;  3GM3 A;  2G3K A;  4PK4 A;  3U5S A;  3G4Z A;  2ZXP A;  1E84 A;  2XXA A;  2GFH A;  5DQZ A;  4YJW A;  2HUJ A;  1NU7 D;  3S0X A;  3ZG1 A;  1ORJ A;  3AQB A;  3I4U A;  4NTA A;  3HLZ A;  4MND A;  4QI2 A;  3ZQY A;  1GM5 A;  5T3W A;  1WTY A;  5A6A A;  2Q4F A;  1OCR C;  4XTK A;  1R5I D;  4E7Z A;  2R7X A;  3T4R A;  1HY5 A;  4G0H A;  2WZG A;  4BJ5 C;  3OWT A;  5A6K A;  3HKK A;  4IJJ A;  4IWB A;  5A6B D;  2C03 A;  1VOM A;  4N6C A;  2EIN C;  2WZL A;  2HZ8 A;  5T3T A;  2HFI A;  2WB7 A;  3US6 A;  3NDB B;  2ICW G;  1QPU A;  2W4M A;  2EIJ C;  4U5C E;  3DZA A;  2HMQ A;  1CPQ A;  1ZHX A;  2XLM A;  1NLX A;  4BJ6 A;  1J8Y F;  4CBE A;  1V74 B;  3DJN B;  2XS1 A;  1T5O A;  1D1C A;  4OD4 A;  2L6G A;  4LER A;  2Q9C A;  3JYH A;  3U9M A;  4Q5S F;  5E2Q A;  3J06 A;  2Y3D A;  4A2N B;  5DS4 A;  1RKE A;  3GWL A;  3U9J A;  2L6F A;  4MS2 A;  1VTM P;  3WAQ A;  2KQ9 A;  2L81 A;  2QTV A;  4KI2 A;  1YYJ A;  2JX0 A;  3SNH A;  4U5G A;  1OCZ C;  3R7C A;  2KK1 A;  1TQG A;  4WJ0 A;  3AJM A;  2J46 A;  3Q6N A;  3O10 A;  1Q0D A;  2OKU A;  1I4Z A;  5KYY B;  1XWJ A;  3B9Q A;  2R7T A;  2LSE A;  4YN0 B;  4C3E A;  1GGQ A;  1EKY A;  2FAP B;  4XLN F;  2G3V A;  4O6M A;  2J0W A;  3C8G B;  4O6N A;  2UUI A;  3T9O A;  4C7O A;  4DJ9 A;  2ZXW C;  2M64 A;  2QNL A;  1LM3 B;  4QDL A;  4DRJ B;  1QSP A;  3CSK A;  3W8I A;  1LVK A;  3GEE A;  5JLI A;  4JUR I;  2QUP A;  2W4B A;  2XL8 A;  2XLD A;  1UFB A;  3SEO A;  4W8K A;  2TMV P;  1JAF A;  3EH1 A;  4JEB A;  3U8P A;  5E3A A;  2QLA A;  4K1O A;  2R7O A;  5CI9 A;  4G7H F;  5E3C A;  2CGE A;  3JRT A;  3DAG A;  5KYU A;  4BJ6 C;  4CS7 A;  4CS9 A;  1M57 C;  2HKV A;  2Z15 A;  1OXK A;  5KYW B;  1HW1 A;  5JT4 A;  4YT5 A;  3JCU Q;  1GS9 A;  3AQC A;  3WG7 C;  5F5H A;  1YAR O;  2XL6 A;  3W8H A;  3K7D A;  1LE4 A;  5DS6 A;  3G50 A;  3NMK A;  4YK5 A;  1NG1 A;  3CAX A;  2X0C A;  1ST6 A;  3POV A;  1OW7 A;  4MTO A;  1B68 A;  1NBB A;  2H8A A;  1RJ9 A;  2R7W A;  4PAC A;  3T6B A;  1HE9 A;  1LKX A;  1Z3I X;  3VRC A;  4PR9 A;  4U5E E;  2EIK C;  1E85 A;  4Z9H A;  1YAU O;  1OKK D;  3AGT A;  3QW0 A;  4H54 A;  1D0X A;  1L3P A;  2OQM A;  4O7G A;  3RYL A;  5EGY A;  5L3V A;  1U89 A;  5B1A C;  1IZM A;  2XL4 A;  4FWV A;  4EBJ A;  4WAB A;  5KYX A;  1E86 A;  1NFN A;  1O5H A;  1Z6A A;  2YVK A;  3PDM P;  3NMI A;  3MFN A;  1PV3 A;  5F5F A;  1MMN A;  2IXP A;  2IXN A;  1VB5 A;  1CGO A;  2J9U A;  1ZHZ A;  4JC7 A;  3V5Z A;  3PHF 2;  2A0B A;  1ZW2 A;  2PX3 A;  2X51 A;  3EJN A;  4DVZ A;  2XSE A;  1Z5Z A;  4U9E A;  3IQT A;  5JP7 A;  4CS9 C;  4EHP A;  4DBR A;  2AWC A;  3NMJ A;  5IY5 C;  4PJN A;  1BR4 A;  3EFO A;  2YZS A;  1A7E A;  2A68 F;  2QE9 A;  2YL0 A;  4JRZ A;  4Q7C A;  1JPN A;  4LDK A;  4XEF A;  3HNL A;  4G78 A;  5EK0 A;  4K0D A;  1K04 A;  1AVO B;  1C02 A;  4JTD B;  2CYD A;  4IRU A;  1TWA A;  4LAC B;  3C7J A;  1E83 A;  5B1B C;  3RVY A;  3ZWI A;  4BJT A;  5L0I A;  4OIQ F;  2EPN A;  5BUO A;  2Y69 C;  1K05 A;  2ZXR A;  1FR0 A;  2J9V A;  2R7R A;  4K7B A;  4QI0 A;  3DJU B;  1ORY A;  3NKD A;  1GQA A;  4JCZ A;  3C63 A;  1ZW3 A;  1A41 A;  4E0I A;  5B3I A;  3FDQ A;  3B0U X;  4CIH A;  3S28 A;  1VLS A;  4EWC A;  3RW0 A;  1I4Y A;  2PBE A;  3EHM A;  3T6G B;  4EUK B;  4DOZ A;  4JZA A;  2P0N A;  1ZZP A;  4AL0 A;  3DAF A;  1LE2 A;  3M15 A;  2HSB A;  4IAQ A;  3KPH A;  4CDV A;  3AG1 C;  1EA8 A;  4YT8 A;  3ZQV A;  2PNO A;  1JRA A;  3JRM O;  4MVO A;  4XPY A;  3VF0 A;  3DKA A;  5AC4 A;  2JPU A;  1G5Z A;  3G4X A;  4MVQ A;  2Q00 A;  1TWH A;  3GEI A;  2DGJ A;  4XEK A;  2VC9 A;  3UMH A;  2HV6 A;  2PP4 A;  1TWG A;  2FGY A;  3OA1 A;  4PJM A;  5D91 A;  4AE4 B;  4CS8 A;  3EPV A;  3RKO F;  4JVS A;  4YT4 A;  2A0U A;  2XLW A;  4RD9 A;  1LS1 A;  4O79 A;  1WAS A;  3CQZ A;  1TKN A;  3FVY A;  1LS4 A;  1ZHY A;  4YL0 A;  3H2V A;  1AUE A;  3LUT B;  3NYJ A;  4NY3 A;  4O6Y A;  1OCO C;  3GAN A;  1IW7 F;  2VAS A;  3B0V C;  4CDA A;  4CSA A;  2R9R B;  3C8Z A;  1YDI A;  3O6X A;  3TJ6 A;  3CZ6 A;  2HSQ A;  1VK5 A;  1Z23 A;  2OCC C;  4XPW A;  3ZVR A;  2KW3 C;  4PJJ A;  3FXH A;  2KNH A;  4JIO A;  4WGZ A;  2P1A A;  3SXK A;  5KYY A;  4FAP B;  3HNI A;  4OIR F;  1A7D A;  4LDR A;  2LD6 A;  4NQF A;  3SP1 A;  4HFF B;  3LLI A;  2Q3T A;  3EZI A;  2J0X A;  4CX9 A;  3C8G A;  2R03 A;  4AX2 A;  5HV9 A;  4MVZ A;  4I44 A;  1S7Z A;  4PJL A;  3NRH A;  2IOQ A;  1NU9 C;  2XM0 A;  3IQ6 A;  1A0B A;  4XPX A;  3JZ0 A;  4Z9J A;  2ZPA A;  3VAY A;  2PF4 E;  4I1O B;  4P9F A;  1OR2 A;  2LK4 A;  1W2W A;  1HMD A;  4CS8 C;  3TUL A;  3IEE A;  1WWP A;  3IPM O;  2MYS A;  5L0J A;  3AG3 C;  4RDA A;  2Y3B A;  3X2Q C;  5KYW A;  4W8P A;  4C3B A;  2FFH A;  3F46 A;  2NUP A;  4JJF A;  4XWJ A;  1CGN A;  3UNG C;  4IAR A;  2YEV A;  3Q7L A;  5L3Q A;  3K1I A;  3EG9 B;  4LDQ A;  4I3M A;  1ZYR F;  2YLI A;  4MVR A;  2V3C C;  4CSA C;  1QVX A;  1C17 M;  1UG7 A;  5JS5 A;  1OW6 A;  3B0P A;  4JW1 A;  4ANJ A;  1MNE A;  2Q9B A;  3W4Y A;  2YL3 A;  2YQY A;  3QZC A;  3B71 A;  2NUT B;  1H7I A;  1NSG B;  2IBF A;  2L9J A;  2WL8 A;  3DM9 B;  4JTA B;  2F22 A;  3RF3 A;  5CIV A;  1SR2 A;  4G7Z F;  4J30 B;  1WGW A;  2H7B A;  1LPE A;  1OQC A;  1VMA A;  3FAP B;  2GDC A;  2OJQ A;  4A4A A;  3DI5 A;  5K0I A;  2ETS A;  4PFO A;  2HMZ A;  4E18 A;  1FFT C;  3WHN A;  4WGY A;  3TOM A;  1QZX A;  1Q0K A;  1FFH A;  2VCA A;  2W9Y A;  5GPG B;  2J9B A;  2V26 A;  3MX3 A;  3ASN C;  1MND A;  4OIP F;  3RQG A;  2R02 A;  3OEO A;  3S84 A;  2CDQ A;  3JSE O;  1CPR A;  1M2V B;  1ZHW A;  3Q7G A;  2IM8 A;  2RD9 A;  3ZTZ A;  1MMD A;  3UR3 C;  5BQG A;  1LIH A;  5L0D A;  2VCC A;  3GOD A;  1SMY F;  3MBG A;  3IQC A;  4JEA A;  3W2W A;  1WOL A;  3L1M A;  1PCX A;  3K1I C;  1BR1 A;  4GEH A;  1OW8 A;  4CIP A;  3U3B A;  1AEP A;  2HJ3 A;  2KGO A;  4YWQ A;  4ZLD A;  2G62 A;  1F1M A;  2NSF A;  3ECS A;  3S9O A;  3BRJ A;  2YL1 A;  4IB4 A;  3HNK A;  3Q6M A;  4DRI B;  5JRA A;  4JKV A;  4Q4Z F;  4EBK A;  2LCH A;  2LFD A;  5JUA A;  3L0I A;  4LLE A;  2LFF A;  4JE9 A;  4N4W A;  4CDY A;  2R25 A;  2HS5 A;  2QY9 A;  4DRH B;  4D4N A;  4ZLC A;  3S90 A;  5DQT A;  1ZU5 A;  1RJ9 B;  5KYN A;  4BEM J;  2LQG A;  2EPK X;  2D5R B;  1H9T A;  2H7O A; 
#chains in the Genus database with same CATH homology
 1YYJ A;  3HNJ A;  2XLW A;  2YKZ A;  1EKY A;  3FOO A;  3IQ5 A;  4NC3 A;  4ER9 A;  1YZA A;  1LM3 B;  4CDA A;  2YL7 A;  3DE8 A;  3M4C A;  2J8W A;  4L6R A;  5JSL A;  5JLI A;  2XL8 A;  2XLD A;  4WGZ A;  2XLV A;  3HNI A;  1JAF A;  4JEB A;  3U8P A;  2QLA A;  1YYX A;  1YZC A;  4CX9 A;  5JT4 A;  3IQ6 A;  2XM0 A;  2XL6 A;  2YLD A;  3NMK A;  4CJO A;  3M79 A;  3ZTM A;  1NBB A;  2XLH A;  3M4B A;  2BC5 A;  3VRC A;  1M6T A;  4EIY A;  1CGN A;  1E85 A;  1MQV A;  3QW0 A;  2CCY A;  4IAR A;  2YLI A;  3QW1 A;  1E86 A;  4U9D A;  4ULV A;  256B A;  2XLE A;  5JS5 A;  1APC A;  3NMI A;  2YL3 A;  1CGO A;  3FOP A;  1QQ3 A;  4U9E A;  5JP7 A;  3QVY A;  2XM4 A;  3NMJ A;  3QVZ A;  1A7V A;  2YL0 A;  4WGY A;  3TOM A;  1E84 A;  3HNL A;  2J9B A;  2YLG A;  3C62 A;  1BBH A;  1S05 A;  1E83 A;  1CPR A;  3ZWI A;  3ZQY A;  3ZTZ A;  1GQA A;  3C63 A;  4JEA A;  5B3I A;  3L1M A;  4N6H A;  4CIP A;  1QPU A;  5JRA A;  1CPQ A;  2XLM A;  2YL1 A;  4IB4 A;  1RCP A;  3HNK A;  3M15 A;  5AGF A;  4JKV A;  4IAQ A;  3DE9 A;  4CDV A;  3TOL A;  5JUA A;  4CDY A;  2XLO A;  4JE9 A;  4N4W A;  3ZQV A;  4D4N A;  4CJG A;  4D4X A;  5JVE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...