3ZDLA

Vinculin head (1-258) in complex with a riam fragment
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
256
structure length
256
Chain Sequence
b'MPVFHTRTIESILEPVAQQISHLVIMHEEGEVDGKAIPDLTAPVSAVQAAVSNLVRVGKETVQTTEDQILKRDMPPAFIKVENACTKLVRAAQMLQADPYSVPARDYLIDGSRGILSGTSDLLLTFDEAEVRKIIRVCKGILEYLTVAEVVETMEDLVTYTKNLGPGMTKMAKMIDERQQELTHQEHRVMLVNSMNTVKELLPVLISAMKIFVTTKNTKSQGIEEALKNRNFTVEKMSAEINEIIRVLQLTSWDED'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords VINCULIN
publication title Riam and Vinculin Binding to Talin are Mutually Exclusive and Regulate Adhesion Assembly and Turnover.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Cell adhesion
total genus 116
structure length 256
sequence length 256
ec nomenclature
pdb deposition date 2012-11-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 3zdlA02
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 3zdlA01
1DOVA 1SYQA 3MYIA 5L0JA 2GWWA 4EHPA 2IBFA 1DOWA 2HSQA 3H2UA 3TJ5A 2GDCA 4P9TA 1ST6A 4E18A 3ZDLA 1L7CA 4W8PA 4ONSA 1TR2A 5L0HA 1H6GA 5L0CA 2X0CA 1ZW2A 1QKRA 4IGGA 2B0HA 3TJ6A 3S90A 1RKCA 1U89A 4K1OA 4DJ9A 5L0DA 5L0FA 5L0GA 1ZVZA 3H2VA 1U6HA 2LQGA 5L0IA 1ZW3A 1T01A 3T6GB 4E17A 3VF0A 1XWJA 4PR9A 1RKEA 1RKEB 3RF3A 5FZTA 1YDIA 2L7AA
chains in the Genus database with same CATH superfamily
4XEKA 3U5SA 4BEJA 1J8YF 3AGTA 3C63A 1OKKD 2ZXPA 2W45A 3DM5A 4EWCA 2CW0F 3K1IA 2JX0A 2XXAB 5IY5C 1QVXA 5KYYA 1NFOA 1O3UA 2YKZA 2XL4A 4EUKB 1A7VA 1YYJA 3RQFA 2LFDA 2LIGA 1ZHXA 2YLGA 4NCQA 1U0BB 1LI5A 1C02A 2HS5A 2VC9A 4EBJA 1FR0A 2O9XA 1JMWA 3K1IC 2J9UA 3RVYA 2W9YA 2R7VA 1Z23A 3NG1A 3T9OA 3GEEA 2LSEA 5B3IA 1A0BA 2ASRA 2KGOA 2XLDA 1A41A 4PR9A 4WABA 2KNHA 2H7BA 4N6HA 3NKEA 4QDLA 4LERA 1V54C 3LS1A 5E2QA 3EPVA 3WODF 2WZLA 2EPOA 4XTKA 4F4BA 1RJ9A 1MMAA 1HMOA 4O79A 2XLMA 1LKXA 4YT4A 1WN0A 3UGPA 5JRAA 3GWNA 1EKYA 3JT1A 1G5ZA 4MTGA 4RBNA 3FDQA 4OIPF 3LUTB 2AWYA 3GEIA 2PX0A 2UUHA 5TJ5E 3RH3A 5DS5A 1CGOA 3R2PA 1MMGA 3GM2A 4IRUA 5T1DB 1U89A 2IOQA 1JPNA 3O39A 2R9RB 1W2WA 3DWWA 3QTHA 2C03A 4JRZA 1GGQA 1HW2A 4XWJA 1D0ZA 4U5BE 1U6HA 2LQGA 5DQZA 4I1MA 4GQHA 2G3KA 1MQVA 4HFKB 4BJ6A 4MVUA 1T9KA 4O6YA 2VASA 3IQCA 1ORSC 4RD9A 1NU9C 1LM3B 1DOVA 4Z9HA 1YZAA 3U2MA 1Z5ZA 2HJMA 4YT5A 4QI2A 2NUPA 2IBFA 2Q9CA 2Q7RA 3AG2C 4K7BA 2HSQA 1MMDA 4CDAA 3U0CA 3GWLA 1ST6A 2EIKC 1JPJA 4BJ6C 1NSGB 3KH2A 1M2VA 4ULWA 3S28A 3VAYA 5A69A 4OIOF 3C8GA 2XSEA 2XRHA 4DVYP 1QKRA 4IAOA 4KI2A 2JD3A 1BDJB 1OXBA 4JJFA 2CCYA 4G0HA 1ORYA 3C8ZA 1HY5A 4E7SA 4QI0A 3EFOA 1Q0MA 1FAPB 3C7JA 1NFNA 5JSLA 1BR2A 4IJJA 4YT2A 1CPQA 3I5QA 2I8BA 2YLDA 2OOCA 4AL1A 1Q0GA 5KYXA 5HSWA 3UR3C 3PDMP 4I44A 3AQCA 1OXKA 4U5EE 2XS1A 3LLKA 3K66A 2J8WA 3NMKA 2HMZA 1VOMA 5CIVA 2GWWA 3C62A 1D1BA 1YLMA 3FAPB 1T5OA 1Q0DA 3ZQVA 4BEMJ 2R7RA 3SXMA 3AG4C 2RD9A 3V5XA 3W8IA 3ZIBA 4DBQA 4CSAA 2X0CA 2Q4FA 2Q00A 3Q7GA 4AX2A 2AP3A 4MVQA 2XS8A 2DGJA 3CSKA 1J8MF 1G4US 3F47A 4J30B 4LDRA 2Y3GA 2QUPA 3DMDA 3L1MA 4IAQA 4OINF 2CDQA 1LS4A 4JW1A 4OIRF 4AE4A 3FAJA 3KKBA 1SMYF 1YA7O 4HFFB 1FTSA 4P9FA 4RDAA 3T4RA 3T6GB 3ZTMA 4CSAC 4EBKA 3SEOA 2R7SA 3DAGA 1RKEA 4LDQA 4YWQA 4G7HF 4LLCA 2YVKA 3SXKA 1O87A 1LI7A 3MYIA 4ULVA 4E0HA 1RMVA 3DXJF 1ORJA 4U5FE 3ZVRA 2L6FA 3K33A 4CS7A 5KYYB 3JSEO 2Z15A 1E86A 2YL7A 3QW0A 1T6UA 2GAQA 2PFDA 2IXMA 5L0HA 1LE4A 1OW7A 1TKNA 1WOLA 1YAUO 2AWCA 1OW8A 1V4AA 2YQYA 4JTCB 1ZHYA 3RIPA 1OR2A 3PCVA 5A6BA 3X1OA 3TQOA 3DD7A 2YL3A 4PJMA 2OKUA 3TK0A 2CYDA 3O10A 4Z9JA 3IQTA 3IQ5A 3GODA 1ZHWA 3GANA 3EGXB 3DAFA 3QVYA 2QY9A 1KU2A 4JEBA 3G50A 3ITFA 4WGYA 1RJ9B 2Q9AA 3UMKA 2J7PA 4CJOA 2Q3TA 2NUTA 2XLVA 4A4AA 5GPGB 3KYJA 1QPUA 1BR4A 4D4NA 3EH2A 2DI3A 1YARO 4PJLA 3TD7A 1ZU5A 3X2QC 2MWQA 3N24A 3A11A 4IARA 3GM3A 4J7TA 4W8KA 1IZMA 5BQGA 4MTFA 3K7DA 4OD5A 2B0HA 2CGEA 3NYJA 3UMHA 1LVKA 4MNDA 4G7ZF 1UG7A 1V55C 1G4WR 1NU7D 4PJJA 2VCAA 1BR1A 3M4CA 4DOZA 4DXWA 2CNWD 5A6JA 3H2VA 1SZIA 2HSBA 3N2ZB 2XLOA 1VLSA 2EILC 5B1AC 1K40A 2VCCA 4OIQF 3KMIA 4B6IA 4KNWA 5F28E 4XEFA 1HMDA 1T6IA 4NC3A 3AG3C 3U8PA 1VYIA 3WG7C 1V74B 3N0TA 1PD0A 3KL4A 3SXZA 2NUPB 4EHPA 5HV9A 2VH3A 2XLEA 3FOPA 4P9TA 3JYYA 1R4TA 4NY3A 1OCRC 1L7CA 1ZHZA 3ECSA 3NMIA 4J7YA 4ONSA 4W8PA 3O55A 3VM6A 2V3CC 2IXPA 2W4MA 4MVMA 3C8GB 2OCCC 2ZXOA 3LJBA 4N6CA 1HW1A 4U5GA 2P6VA 3CEXA 1JRAA 4JIOA 4X0RA 3G4ZA 2OG2A 2L6HA 4UDVA 2KC3A 3AG1C 1UFBA 3U9MA 5D92A 1ZYRF 3MX3A 2X51A 2VCBA 3EFOB 1D0YA 3EZHA 4JTDB 3V5YA 4C7OA 3HKKA 1ZW3A 3LS0A 4H4KC 3SYNA 256BA 3DM9B 3RVZA 1VLTA 5KYXB 3IEEA 1KNYA 3E9VA 1Q0FA 4YL1A 3NDBB 3UGOA 3L8JA 3NYLA 3TOLA 5F5HA 3ZG1A 5EHHA 5E3AA 3U8VA 3DE8A 4K0DA 5DS4A 3A9CA 1TWGA 2BL2A 3M15A 3B29A 4LDKA 4U9DA 1S7ZA 1JOGA 2H8AA 2J0XA 4U9EA 4ZLCA 2IM8A 1H6GA 3LLIA 3NRHA 2G62A 3EZIA 4MS2A 2KW3C 2W4BA 4OD4A 2A0BA 2ZPAA 1BBHA 1YJGA 3U3BA 1APCA 3Q6NA 1L3PA 4JKVA 5L0FA 3SNHA 4MTOA 2A0UA 4AE4B 3VF0A 2JPUA 3L8IA 1RKEB 5E3CA 1O5HA 5COMA 4J32B 1YDIA 2DB4A 4HEAJ 2C04A 5L3QA 2A69F 2ICWG 2FFHA 1OR3A 2GFHA 2WB7A 2Y3BA 2GDCA 2PP4A 3JZ0A 4XPXA 4JE9A 3O6XA 1VB5A 3C8GD 1FMVA 1PD1A 3HTKC 1MMNA 2XL8A 3U3FA 2QTVA 4C3BA 5L0CA 2YWAA 1VYKA 5AC5A 3QW1A 2QNLA 2AVKA 4GEHA 3RW0A 5A6AA 1MNDA 2YRFA 1ZVZA 3C18A 4WGZA 3FHDA 3FXHA 5L3VA 1K04A 4CDYA 3GORA 1WASA 1LIHA 4A2NB 4CDVA 3L34A 1AEPA 2PBEA 4JC7A 1FNTc 2D5RB 2J9VA 3T6JA 1ZHTA 1YZCA 2KK1A 4E7ZA 4YT8A 3IPMO 1SYQA 2P1AA 4MW3A 3RYLA 2J9WA 1E85A 2A1DD 4Q4ZF 2NUTB 1DOWA 3ZSUA 4MVRA 1GM5A 2WVOA 4XLNF 2HMQA 5DVWA 2XL6A 3JRMO 1ZU4A 1KTMA 1AUEA 2ZXWC 5EGYA 2ZD9A 4G7OF 1Q0KA 1A7EA 3DKAA 4FX5A 4IGGA 3RKOF 3WAQA 4EIYA 3PHF2 2M64A 5CI8A 3B0UX 2M4EA 2WZFA 4K1OA 2DYRC 2HV6A 4DJ9A 2IXNA 3EGDA 2HFIA 4KC9A 4JZAA 5EK0A 2J46A 5L0IA 5AGFA 3AOUA 4NTBA 4LLEA 4E17A 1WWPA 2ETSA 2KYHA 3HLZA 2I15A 1CGNA 4IWBA 1G8XA 5KYUA 3FMSA 4O6NA 1Z63A 1FMWA 1WATA 4PK4A 5F5FA 1RCPA 4N4WA 4YL3A 2HV7A 1TWCA 2LK4A 3IQ6A 2YZSA 3CQZA 3S9OA 3AJMA 3NYMA 1Y6DA 4KBLA 5KYNA 5K0IA 4XPYA 1Z7Qc 1SF8A 3ZC4A 4ZLDA 5KYWA 1EI7A 3K1HA 1OKKA 4CIPA 4XPWA 1I4YA 3HNIA 3RFYA 1TQGA 3PMRA 2NSGA 1PCXA 1ZW2A 2A6HF 3DE9A 4U5CE 1K05A 3FOOA 3TJ6A 3ZTZA 3S84A 3S90A 1OW6A 1LS1A 2V26A 3W8HA 4JTAB 2FAPB 5DQTA 5A6BD 2EINC 3S29A 2WVNA 5B3SC 3SP1A 3EHMA 2LP4A 3ASNC 1IW7F 3MLGA 4U5HA 4L6RA 1H9TA 4C7OB 4P6IC 3LESA 2KQ9A 2J9BA 5E33A 4ER9A 3GM1A 2R7UA 1EA8A 4MVZA 3R7CA 3M79A 4NQFA 2MYSA 3J06A 2P7VA 3EHNA 4AL0A 5B1BC 2J7PD 1B68A 1HE9A 2EPKX 2OEVA 1M6TA 2HZ8A 4AK9A 1FFTC 3I5PA 3EG9A 3G4XA 2GA0A 3OWTA 4CBEA 2R7XA 2YEVA 2NSFA 3ABKC 3JTLO 4PJNA 3LNMB 1EQ1A 4I3MA 4DRHB 2XLHA 3BEHA 2R02A 3MBGA 2RSEB 2R05A 2J45A 2EIJC 2LFFA 2UUIA 4HE8D 3W2WA 4JURI 4O6MA 3ZQYA 1M2VB 3HNKA 3S0XA 5A6KA 1AVOB 2PF4E 2QLAA 1QZXA 3KPHA 1OCZC 2LCHA 1D0XA 3M4BA 2R7TA 2Y3HA 4MW8A 4DRJB 2WZGA 1I5NA 1TFOB 1BZ4A 1H7IA 1XZPA 2D4UA 2KSFA 3ATPA 5AC4A 3RQGA 2HJ3A 2A68F 2Q9BA 4XEVA 4I1OB 3MFNA 1OCCC 1GQAA 2MHRA 4Z9IA 2IXOA 1NZEA 3EGXA 4ANJA 2R25A 4CS8A 3B71A 2Y39A 4C3DA 1E2XA 1LE2A 2R7OA 4YL0A 1XZQA 5BUOA 1C03A 2QE9A 3DI5A 5COFA 1M57C 3U2LA 3V5ZA 5L0JA 2L81A 2XXAA 3H2UA 3DJNB 2XM0A 2H7OA 4YN0B 3VYWA 4CS8C 4H54A 4E18A 2EIMC 4YK5A 4NTFA 1A7DA 4PACA 2NG1A 3QZCA 4GYTA 2AU5A 4CX9A 3E70C 3JCUQ 3NMJA 4WJ0A 1YA9A 4G78A 1F1MA 3T6BA 1RXQA 4MVOA 5DLJA 2L6GA 1H9GA 4DRIB 4CIHA 2R03A 4LACB 3JYHA 3V7OA 5JS5A 1S05A 1Y4CA 4JVSA 5L0GA 1OQCA 2XM4A 3Q6MA 4FWVA 3ABLC 4O7GA 4CS9A 3QVZA 2YL0A 1XWJA 3CAXA 3UMIA 3AGUA 3DJUB 1GS9A 2YL1A 4BG0A 4CJGA 3EQLF 5JLIA 3HNLA 4DVZA 3MYFA 3NKDA 3F46A 4N06A 3ZWIA 1FFHA 1Z3IX 4CS9C 4XLPF 3EJNA 1C17M 2VB6A 2EPLX 5FCLA 4C3EA 3LAYA 2OQMA 2XLWA 2NPUA 1TWAA 3B9QA 3ZDLA 2DYSC 3Q7LA 5T3WA 3EH1A 1CPRA 1ZZPA 4XQ1A 3M1CB 3L0IA 4IB4A 1MNEA 3JRTA 1E84A 2TMVP 2HKVA 3B0VC 3I4UA 2HUJA 5DS6A 3TULA 2J0WA 2R7QA 3EGDB 3LNRA 2BC5A 4R32A 1VMAA 5BQIA 2WVQA 2R7WA 2LD6A 1VK5A 1HE1A 5KYUB 4JEAA 1Z6AA 1JAFA 2P0NA 3SXYA 3KYIA 3IHUA 2OJQA 1D1CA 3K6BA 4MVSA 5FZTA 1PV3A 3DZAA 4M63A 2G3VA 4EKWA 2OEXA 4U5DE 1T6QA 3TJ5A 5KYWB 1SR2A 2KJGA 1I4ZA 3RQEA 1QQ3A 4JCHA 4D4XA 1NBBA 2PX3A 2H7VC 3US6A 3W4YA 2A6EF 1QLEC 3UNGC 2B0JA 1M2OA 2EPNA 4FESA 5T3TA 1E83A 5L0DA 1NG1A 2F22A 1D1AA 3H65A 2IYLD 5D91A 3S27A 4BJ5A 2P61A 2WL8A 2YLIA 3FVYA 4BJTA 4MQ9F 1T01A 3W2VA 2Y3DA 3LEOA 3WHNA 4BJ1A 5JVEA 3SZRA 4BJ5C 3POVA 1CGME 2L7AA 3AQBA 4BPMA 3EG9B 1VTMP 4Q7CA 4E0IA 2ZXRA 5JT4A 2OU6A 4KNVA 1N1CA 5CI9A 5JP7A 2OJED 3ABMC 3VRCA 3BRJA 4EBBA 2FGYA 3QMKA 1TR2A 3CZ6A 4NTAA 1TFKB 4JJGA 1YYXA 1RKCA 1NLXA 1WGWA 1LPEA 3ASOC 3GEHA 3HJCA 3LEVA 3OA1A 1YVIA 3B0PA 1WTYA 4JCZA 3TOMA 4FAPB 2BE5F 4DBRA 2CNWA 1M56C 4PFOA 1OCOC 5COGA 2EPMX 2Y69C 3HNJA 4Q5SF 2E87A 3U9JA 5JUAA 1QSPA 4YJWA 1TWHA 3RF3A 1JR8A 2YHSA 3JSZA 1R5ID 4PFPA 5BQHA 2L9JA 2PNOA 3OEOA
chains in the Genus database with same CATH topology
1DOVA 1SYQA 3MYIA 5L0JA 2GWWA 4EHPA 2IBFA 1DOWA 2HSQA 3H2UA 3TJ5A 2GDCA 4P9TA 1ST6A 4E18A 3ZDLA 1L7CA 4W8PA 4ONSA 1TR2A 5L0HA 1H6GA 5L0CA 2X0CA 1ZW2A 1QKRA 4IGGA 2B0HA 3TJ6A 3S90A 1RKCA 1U89A 4K1OA 4DJ9A 5L0DA 5L0FA 5L0GA 1ZVZA 3H2VA 1U6HA 2LQGA 5L0IA 1ZW3A 1T01A 3T6GB 4E17A 3VF0A 1XWJA 4PR9A 1RKEA 1RKEB 3RF3A 5FZTA 1YDIA 2L7AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DOV A;  1SYQ A;  3MYI A;  5L0J A;  2GWW A;  4EHP A;  2IBF A;  1DOW A;  2HSQ A;  3H2U A;  3TJ5 A;  2GDC A;  4P9T A;  1ST6 A;  4E18 A;  3ZDL A;  1L7C A;  4W8P A;  4ONS A;  1TR2 A;  5L0H A;  1H6G A;  5L0C A;  2X0C A;  1ZW2 A;  1QKR A;  4IGG A;  2B0H A;  3TJ6 A;  3S90 A;  1RKC A;  1U89 A;  4K1O A;  4DJ9 A;  5L0D A;  5L0F A;  5L0G A;  1ZVZ A;  3H2V A;  1U6H A;  2LQG A;  5L0I A;  1ZW3 A;  1T01 A;  3T6G B;  4E17 A;  3VF0 A;  1XWJ A;  4PR9 A;  1RKE A;  1RKE B;  3RF3 A;  5FZT A;  1YDI A;  2L7A A; 
#chains in the Genus database with same CATH topology
 4XEK A;  3U5S A;  4BEJ A;  1J8Y F;  3AGT A;  3C63 A;  1OKK D;  2ZXP A;  2W45 A;  3DM5 A;  4EWC A;  2CW0 F;  3K1I A;  2JX0 A;  2XXA B;  5IY5 C;  1QVX A;  5KYY A;  1NFO A;  1O3U A;  2YKZ A;  2XL4 A;  4EUK B;  1A7V A;  1YYJ A;  3RQF A;  2LFD A;  2LIG A;  1ZHX A;  2YLG A;  4NCQ A;  1U0B B;  1LI5 A;  1C02 A;  2HS5 A;  2VC9 A;  4EBJ A;  1FR0 A;  2O9X A;  1JMW A;  3K1I C;  2J9U A;  3RVY A;  2W9Y A;  2R7V A;  1Z23 A;  3NG1 A;  3T9O A;  3GEE A;  2LSE A;  5B3I A;  1A0B A;  2ASR A;  2KGO A;  2XLD A;  1A41 A;  4PR9 A;  4WAB A;  2KNH A;  2H7B A;  4N6H A;  3NKE A;  4QDL A;  4LER A;  1V54 C;  3LS1 A;  5E2Q A;  3EPV A;  3WOD F;  2WZL A;  2EPO A;  4XTK A;  4F4B A;  1RJ9 A;  1MMA A;  1HMO A;  4O79 A;  2XLM A;  1LKX A;  4YT4 A;  1WN0 A;  3UGP A;  5JRA A;  3GWN A;  1EKY A;  3JT1 A;  1G5Z A;  4MTG A;  4RBN A;  3FDQ A;  4OIP F;  3LUT B;  2AWY A;  3GEI A;  2PX0 A;  2UUH A;  5TJ5 E;  3RH3 A;  5DS5 A;  1CGO A;  3R2P A;  1MMG A;  3GM2 A;  4IRU A;  5T1D B;  1U89 A;  2IOQ A;  1JPN A;  3O39 A;  2R9R B;  1W2W A;  3DWW A;  3QTH A;  2C03 A;  4JRZ A;  1GGQ A;  1HW2 A;  4XWJ A;  1D0Z A;  4U5B E;  1U6H A;  2LQG A;  5DQZ A;  4I1M A;  4GQH A;  2G3K A;  1MQV A;  4HFK B;  4BJ6 A;  4MVU A;  1T9K A;  4O6Y A;  2VAS A;  3IQC A;  1ORS C;  4RD9 A;  1NU9 C;  1LM3 B;  1DOV A;  4Z9H A;  1YZA A;  3U2M A;  1Z5Z A;  2HJM A;  4YT5 A;  4QI2 A;  2NUP A;  2IBF A;  2Q9C A;  2Q7R A;  3AG2 C;  4K7B A;  2HSQ A;  1MMD A;  4CDA A;  3U0C A;  3GWL A;  1ST6 A;  2EIK C;  1JPJ A;  4BJ6 C;  1NSG B;  3KH2 A;  1M2V A;  4ULW A;  3S28 A;  3VAY A;  5A69 A;  4OIO F;  3C8G A;  2XSE A;  2XRH A;  4DVY P;  1QKR A;  4IAO A;  4KI2 A;  2JD3 A;  1BDJ B;  1OXB A;  4JJF A;  2CCY A;  4G0H A;  1ORY A;  3C8Z A;  1HY5 A;  4E7S A;  4QI0 A;  3EFO A;  1Q0M A;  1FAP B;  3C7J A;  1NFN A;  5JSL A;  1BR2 A;  4IJJ A;  4YT2 A;  1CPQ A;  3I5Q A;  2I8B A;  2YLD A;  2OOC A;  4AL1 A;  1Q0G A;  5KYX A;  5HSW A;  3UR3 C;  3PDM P;  4I44 A;  3AQC A;  1OXK A;  4U5E E;  2XS1 A;  3LLK A;  3K66 A;  2J8W A;  3NMK A;  2HMZ A;  1VOM A;  5CIV A;  2GWW A;  3C62 A;  1D1B A;  1YLM A;  3FAP B;  1T5O A;  1Q0D A;  3ZQV A;  4BEM J;  2R7R A;  3SXM A;  3AG4 C;  2RD9 A;  3V5X A;  3W8I A;  3ZIB A;  4DBQ A;  4CSA A;  2X0C A;  2Q4F A;  2Q00 A;  3Q7G A;  4AX2 A;  2AP3 A;  4MVQ A;  2XS8 A;  2DGJ A;  3CSK A;  1J8M F;  1G4U S;  3F47 A;  4J30 B;  4LDR A;  2Y3G A;  2QUP A;  3DMD A;  3L1M A;  4IAQ A;  4OIN F;  2CDQ A;  1LS4 A;  4JW1 A;  4OIR F;  4AE4 A;  3FAJ A;  3KKB A;  1SMY F;  1YA7 O;  4HFF B;  1FTS A;  4P9F A;  4RDA A;  3T4R A;  3T6G B;  3ZTM A;  4CSA C;  4EBK A;  3SEO A;  2R7S A;  3DAG A;  1RKE A;  4LDQ A;  4YWQ A;  4G7H F;  4LLC A;  2YVK A;  3SXK A;  1O87 A;  1LI7 A;  3MYI A;  4ULV A;  4E0H A;  1RMV A;  3DXJ F;  1ORJ A;  4U5F E;  3ZVR A;  2L6F A;  3K33 A;  4CS7 A;  5KYY B;  3JSE O;  2Z15 A;  1E86 A;  2YL7 A;  3QW0 A;  1T6U A;  2GAQ A;  2PFD A;  2IXM A;  5L0H A;  1LE4 A;  1OW7 A;  1TKN A;  1WOL A;  1YAU O;  2AWC A;  1OW8 A;  1V4A A;  2YQY A;  4JTC B;  1ZHY A;  3RIP A;  1OR2 A;  3PCV A;  5A6B A;  3X1O A;  3TQO A;  3DD7 A;  2YL3 A;  4PJM A;  2OKU A;  3TK0 A;  2CYD A;  3O10 A;  4Z9J A;  3IQT A;  3IQ5 A;  3GOD A;  1ZHW A;  3GAN A;  3EGX B;  3DAF A;  3QVY A;  2QY9 A;  1KU2 A;  4JEB A;  3G50 A;  3ITF A;  4WGY A;  1RJ9 B;  2Q9A A;  3UMK A;  2J7P A;  4CJO A;  2Q3T A;  2NUT A;  2XLV A;  4A4A A;  5GPG B;  3KYJ A;  1QPU A;  1BR4 A;  4D4N A;  3EH2 A;  2DI3 A;  1YAR O;  4PJL A;  3TD7 A;  1ZU5 A;  3X2Q C;  2MWQ A;  3N24 A;  3A11 A;  4IAR A;  3GM3 A;  4J7T A;  4W8K A;  1IZM A;  5BQG A;  4MTF A;  3K7D A;  4OD5 A;  2B0H A;  2CGE A;  3NYJ A;  3UMH A;  1LVK A;  4MND A;  4G7Z F;  1UG7 A;  1V55 C;  1G4W R;  1NU7 D;  4PJJ A;  2VCA A;  1BR1 A;  3M4C A;  4DOZ A;  4DXW A;  2CNW D;  5A6J A;  3H2V A;  1SZI A;  2HSB A;  3N2Z B;  2XLO A;  1VLS A;  2EIL C;  5B1A C;  1K40 A;  2VCC A;  4OIQ F;  3KMI A;  4B6I A;  4KNW A;  5F28 E;  4XEF A;  1HMD A;  1T6I A;  4NC3 A;  3AG3 C;  3U8P A;  1VYI A;  3WG7 C;  1V74 B;  3N0T A;  1PD0 A;  3KL4 A;  3SXZ A;  2NUP B;  4EHP A;  5HV9 A;  2VH3 A;  2XLE A;  3FOP A;  4P9T A;  3JYY A;  1R4T A;  4NY3 A;  1OCR C;  1L7C A;  1ZHZ A;  3ECS A;  3NMI A;  4J7Y A;  4ONS A;  4W8P A;  3O55 A;  3VM6 A;  2V3C C;  2IXP A;  2W4M A;  4MVM A;  3C8G B;  2OCC C;  2ZXO A;  3LJB A;  4N6C A;  1HW1 A;  4U5G A;  2P6V A;  3CEX A;  1JRA A;  4JIO A;  4X0R A;  3G4Z A;  2OG2 A;  2L6H A;  4UDV A;  2KC3 A;  3AG1 C;  1UFB A;  3U9M A;  5D92 A;  1ZYR F;  3MX3 A;  2X51 A;  2VCB A;  3EFO B;  1D0Y A;  3EZH A;  4JTD B;  3V5Y A;  4C7O A;  3HKK A;  1ZW3 A;  3LS0 A;  4H4K C;  3SYN A;  256B A;  3DM9 B;  3RVZ A;  1VLT A;  5KYX B;  3IEE A;  1KNY A;  3E9V A;  1Q0F A;  4YL1 A;  3NDB B;  3UGO A;  3L8J A;  3NYL A;  3TOL A;  5F5H A;  3ZG1 A;  5EHH A;  5E3A A;  3U8V A;  3DE8 A;  4K0D A;  5DS4 A;  3A9C A;  1TWG A;  2BL2 A;  3M15 A;  3B29 A;  4LDK A;  4U9D A;  1S7Z A;  1JOG A;  2H8A A;  2J0X A;  4U9E A;  4ZLC A;  2IM8 A;  1H6G A;  3LLI A;  3NRH A;  2G62 A;  3EZI A;  4MS2 A;  2KW3 C;  2W4B A;  4OD4 A;  2A0B A;  2ZPA A;  1BBH A;  1YJG A;  3U3B A;  1APC A;  3Q6N A;  1L3P A;  4JKV A;  5L0F A;  3SNH A;  4MTO A;  2A0U A;  4AE4 B;  3VF0 A;  2JPU A;  3L8I A;  1RKE B;  5E3C A;  1O5H A;  5COM A;  4J32 B;  1YDI A;  2DB4 A;  4HEA J;  2C04 A;  5L3Q A;  2A69 F;  2ICW G;  2FFH A;  1OR3 A;  2GFH A;  2WB7 A;  2Y3B A;  2GDC A;  2PP4 A;  3JZ0 A;  4XPX A;  4JE9 A;  3O6X A;  1VB5 A;  3C8G D;  1FMV A;  1PD1 A;  3HTK C;  1MMN A;  2XL8 A;  3U3F A;  2QTV A;  4C3B A;  5L0C A;  2YWA A;  1VYK A;  5AC5 A;  3QW1 A;  2QNL A;  2AVK A;  4GEH A;  3RW0 A;  5A6A A;  1MND A;  2YRF A;  1ZVZ A;  3C18 A;  4WGZ A;  3FHD A;  3FXH A;  5L3V A;  1K04 A;  4CDY A;  3GOR A;  1WAS A;  1LIH A;  4A2N B;  4CDV A;  3L34 A;  1AEP A;  2PBE A;  4JC7 A;  1FNT c;  2D5R B;  2J9V A;  3T6J A;  1ZHT A;  1YZC A;  2KK1 A;  4E7Z A;  4YT8 A;  3IPM O;  1SYQ A;  2P1A A;  4MW3 A;  3RYL A;  2J9W A;  1E85 A;  2A1D D;  4Q4Z F;  2NUT B;  1DOW A;  3ZSU A;  4MVR A;  1GM5 A;  2WVO A;  4XLN F;  2HMQ A;  5DVW A;  2XL6 A;  3JRM O;  1ZU4 A;  1KTM A;  1AUE A;  2ZXW C;  5EGY A;  2ZD9 A;  4G7O F;  1Q0K A;  1A7E A;  3DKA A;  4FX5 A;  4IGG A;  3RKO F;  3WAQ A;  4EIY A;  3PHF 2;  2M64 A;  5CI8 A;  3B0U X;  2M4E A;  2WZF A;  4K1O A;  2DYR C;  2HV6 A;  4DJ9 A;  2IXN A;  3EGD A;  2HFI A;  4KC9 A;  4JZA A;  5EK0 A;  2J46 A;  5L0I A;  5AGF A;  3AOU A;  4NTB A;  4LLE A;  4E17 A;  1WWP A;  2ETS A;  2KYH A;  3HLZ A;  2I15 A;  1CGN A;  4IWB A;  1G8X A;  5KYU A;  3FMS A;  4O6N A;  1Z63 A;  1FMW A;  1WAT A;  4PK4 A;  5F5F A;  1RCP A;  4N4W A;  4YL3 A;  2HV7 A;  1TWC A;  2LK4 A;  3IQ6 A;  2YZS A;  3CQZ A;  3S9O A;  3AJM A;  3NYM A;  1Y6D A;  4KBL A;  5KYN A;  5K0I A;  4XPY A;  1Z7Q c;  1SF8 A;  3ZC4 A;  4ZLD A;  5KYW A;  1EI7 A;  3K1H A;  1OKK A;  4CIP A;  4XPW A;  1I4Y A;  3HNI A;  3RFY A;  1TQG A;  3PMR A;  2NSG A;  1PCX A;  1ZW2 A;  2A6H F;  3DE9 A;  4U5C E;  1K05 A;  3FOO A;  3TJ6 A;  3ZTZ A;  3S84 A;  3S90 A;  1OW6 A;  1LS1 A;  2V26 A;  3W8H A;  4JTA B;  2FAP B;  5DQT A;  5A6B D;  2EIN C;  3S29 A;  2WVN A;  5B3S C;  3SP1 A;  3EHM A;  2LP4 A;  3ASN C;  1IW7 F;  3MLG A;  4U5H A;  4L6R A;  1H9T A;  4C7O B;  4P6I C;  3LES A;  2KQ9 A;  2J9B A;  5E33 A;  4ER9 A;  3GM1 A;  2R7U A;  1EA8 A;  4MVZ A;  3R7C A;  3M79 A;  4NQF A;  2MYS A;  3J06 A;  2P7V A;  3EHN A;  4AL0 A;  5B1B C;  2J7P D;  1B68 A;  1HE9 A;  2EPK X;  2OEV A;  1M6T A;  2HZ8 A;  4AK9 A;  1FFT C;  3I5P A;  3EG9 A;  3G4X A;  2GA0 A;  3OWT A;  4CBE A;  2R7X A;  2YEV A;  2NSF A;  3ABK C;  3JTL O;  4PJN A;  3LNM B;  1EQ1 A;  4I3M A;  4DRH B;  2XLH A;  3BEH A;  2R02 A;  3MBG A;  2RSE B;  2R05 A;  2J45 A;  2EIJ C;  2LFF A;  2UUI A;  4HE8 D;  3W2W A;  4JUR I;  4O6M A;  3ZQY A;  1M2V B;  3HNK A;  3S0X A;  5A6K A;  1AVO B;  2PF4 E;  2QLA A;  1QZX A;  3KPH A;  1OCZ C;  2LCH A;  1D0X A;  3M4B A;  2R7T A;  2Y3H A;  4MW8 A;  4DRJ B;  2WZG A;  1I5N A;  1TFO B;  1BZ4 A;  1H7I A;  1XZP A;  2D4U A;  2KSF A;  3ATP A;  5AC4 A;  3RQG A;  2HJ3 A;  2A68 F;  2Q9B A;  4XEV A;  4I1O B;  3MFN A;  1OCC C;  1GQA A;  2MHR A;  4Z9I A;  2IXO A;  1NZE A;  3EGX A;  4ANJ A;  2R25 A;  4CS8 A;  3B71 A;  2Y39 A;  4C3D A;  1E2X A;  1LE2 A;  2R7O A;  4YL0 A;  1XZQ A;  5BUO A;  1C03 A;  2QE9 A;  3DI5 A;  5COF A;  1M57 C;  3U2L A;  3V5Z A;  5L0J A;  2L81 A;  2XXA A;  3H2U A;  3DJN B;  2XM0 A;  2H7O A;  4YN0 B;  3VYW A;  4CS8 C;  4H54 A;  4E18 A;  2EIM C;  4YK5 A;  4NTF A;  1A7D A;  4PAC A;  2NG1 A;  3QZC A;  4GYT A;  2AU5 A;  4CX9 A;  3E70 C;  3JCU Q;  3NMJ A;  4WJ0 A;  1YA9 A;  4G78 A;  1F1M A;  3T6B A;  1RXQ A;  4MVO A;  5DLJ A;  2L6G A;  1H9G A;  4DRI B;  4CIH A;  2R03 A;  4LAC B;  3JYH A;  3V7O A;  5JS5 A;  1S05 A;  1Y4C A;  4JVS A;  5L0G A;  1OQC A;  2XM4 A;  3Q6M A;  4FWV A;  3ABL C;  4O7G A;  4CS9 A;  3QVZ A;  2YL0 A;  1XWJ A;  3CAX A;  3UMI A;  3AGU A;  3DJU B;  1GS9 A;  2YL1 A;  4BG0 A;  4CJG A;  3EQL F;  5JLI A;  3HNL A;  4DVZ A;  3MYF A;  3NKD A;  3F46 A;  4N06 A;  3ZWI A;  1FFH A;  1Z3I X;  4CS9 C;  4XLP F;  3EJN A;  1C17 M;  2VB6 A;  2EPL X;  5FCL A;  4C3E A;  3LAY A;  2OQM A;  2XLW A;  2NPU A;  1TWA A;  3B9Q A;  3ZDL A;  2DYS C;  3Q7L A;  5T3W A;  3EH1 A;  1CPR A;  1ZZP A;  4XQ1 A;  3M1C B;  3L0I A;  4IB4 A;  1MNE A;  3JRT A;  1E84 A;  2TMV P;  2HKV A;  3B0V C;  3I4U A;  2HUJ A;  5DS6 A;  3TUL A;  2J0W A;  2R7Q A;  3EGD B;  3LNR A;  2BC5 A;  4R32 A;  1VMA A;  5BQI A;  2WVQ A;  2R7W A;  2LD6 A;  1VK5 A;  1HE1 A;  5KYU B;  4JEA A;  1Z6A A;  1JAF A;  2P0N A;  3SXY A;  3KYI A;  3IHU A;  2OJQ A;  1D1C A;  3K6B A;  4MVS A;  5FZT A;  1PV3 A;  3DZA A;  4M63 A;  2G3V A;  4EKW A;  2OEX A;  4U5D E;  1T6Q A;  3TJ5 A;  5KYW B;  1SR2 A;  2KJG A;  1I4Z A;  3RQE A;  1QQ3 A;  4JCH A;  4D4X A;  1NBB A;  2PX3 A;  2H7V C;  3US6 A;  3W4Y A;  2A6E F;  1QLE C;  3UNG C;  2B0J A;  1M2O A;  2EPN A;  4FES A;  5T3T A;  1E83 A;  5L0D A;  1NG1 A;  2F22 A;  1D1A A;  3H65 A;  2IYL D;  5D91 A;  3S27 A;  4BJ5 A;  2P61 A;  2WL8 A;  2YLI A;  3FVY A;  4BJT A;  4MQ9 F;  1T01 A;  3W2V A;  2Y3D A;  3LEO A;  3WHN A;  4BJ1 A;  5JVE A;  3SZR A;  4BJ5 C;  3POV A;  1CGM E;  2L7A A;  3AQB A;  4BPM A;  3EG9 B;  1VTM P;  4Q7C A;  4E0I A;  2ZXR A;  5JT4 A;  2OU6 A;  4KNV A;  1N1C A;  5CI9 A;  5JP7 A;  2OJE D;  3ABM C;  3VRC A;  3BRJ A;  4EBB A;  2FGY A;  3QMK A;  1TR2 A;  3CZ6 A;  4NTA A;  1TFK B;  4JJG A;  1YYX A;  1RKC A;  1NLX A;  1WGW A;  1LPE A;  3ASO C;  3GEH A;  3HJC A;  3LEV A;  3OA1 A;  1YVI A;  3B0P A;  1WTY A;  4JCZ A;  3TOM A;  4FAP B;  2BE5 F;  4DBR A;  2CNW A;  1M56 C;  4PFO A;  1OCO C;  5COG A;  2EPM X;  2Y69 C;  3HNJ A;  4Q5S F;  2E87 A;  3U9J A;  5JUA A;  1QSP A;  4YJW A;  1TWH A;  3RF3 A;  1JR8 A;  2YHS A;  3JSZ A;  1R5I D;  4PFP A;  5BQH A;  2L9J A;  2PNO A;  3OEO A; 
#chains in the Genus database with same CATH homology
 1DOV A;  1SYQ A;  3MYI A;  5L0J A;  2GWW A;  4EHP A;  2IBF A;  1DOW A;  2HSQ A;  3H2U A;  3TJ5 A;  2GDC A;  4P9T A;  1ST6 A;  4E18 A;  3ZDL A;  1L7C A;  4W8P A;  4ONS A;  1TR2 A;  5L0H A;  1H6G A;  5L0C A;  2X0C A;  1ZW2 A;  1QKR A;  4IGG A;  2B0H A;  3TJ6 A;  3S90 A;  1RKC A;  1U89 A;  4K1O A;  4DJ9 A;  5L0D A;  5L0F A;  5L0G A;  1ZVZ A;  3H2V A;  1U6H A;  2LQG A;  5L0I A;  1ZW3 A;  1T01 A;  3T6G B;  4E17 A;  3VF0 A;  1XWJ A;  4PR9 A;  1RKE A;  1RKE B;  3RF3 A;  5FZT A;  1YDI A;  2L7A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...