3ZDLA

Vinculin head (1-258) in complex with a riam fragment
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
256
structure length
256
Chain Sequence
MPVFHTRTIESILEPVAQQISHLVIMHEEGEVDGKAIPDLTAPVSAVQAAVSNLVRVGKETVQTTEDQILKRDMPPAFIKVENACTKLVRAAQMLQADPYSVPARDYLIDGSRGILSGTSDLLLTFDEAEVRKIIRVCKGILEYLTVAEVVETMEDLVTYTKNLGPGMTKMAKMIDERQQELTHQEHRVMLVNSMNTVKELLPVLISAMKIFVTTKNTKSQGIEEALKNRNFTVEKMSAEINEIIRVLQLTSWDED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords VINCULIN
publication title Riam and Vinculin Binding to Talin are Mutually Exclusive and Regulate Adhesion Assembly and Turnover.
pubmed doi rcsb
source organism Gallus gallus
total genus 116
structure length 256
sequence length 256
ec nomenclature
pdb deposition date 2012-11-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 3zdlA02
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 3zdlA01
3TJ6A 1H6GA 5L0GA 1ZW3A 1RKCA 2HSQA 4P9TA 3S90A 4W8PA 4ONSA 2B0HA 5L0FA 1T01A 4PR9A 5L0JA 1QKRA 4E17A 2GDCA 2X0CA 1RKEA 1L7CA 1DOVA 5L0DA 1TR2A 1DOWA 5L0IA 1RKEB 4E18A 4EHPA 1ST6A 3MYIA 1YDIA 2L7AA 1ZVZA 1SYQA 1U6HA 3RF3A 4IGGA 5FZTA 3H2VA 5L0CA 3T6GB 3VF0A 3H2UA 2LQGA 2IBFA 1U89A 4DJ9A 3TJ5A 1XWJA 2GWWA 5L0HA 3ZDLA 4K1OA 1ZW2A
chains in the Genus database with same CATH superfamily
1U0BB 2RD9A 3RKOF 2XL8A 3B0PA 1RKCA 2ICWG 3IQ6A 1OR2A 3FOPA 1JOGA 2KQ9A 1VB5A 3PHF2 3ABMC 3ZWIA 3PCVA 1VK5A 2XLHA 1BR2A 4JTDB 3OEOA 3JYHA 4ULWA 3U5SA 4Q7CA 2Q00A 3VM6A 4NQFA 4MVOA 1TR2A 4D4NA 2W45A 1A0BA 1JR8A 1N1CA 2JX0A 5AC5A 4XQ1A 5JS5A 3EG9A 3WODF 1EI7A 2J9VA 3AGTA 3FHDA 2HMQA 2XLEA 3VRCA 1HW2A 3RYLA 5A6KA 3K1IC 1FMVA 2VCBA 3RW0A 1YYJA 2QUPA 3WAQA 2J9UA 2OKUA 4BJ1A 2R03A 3K33A 2Q9BA 5KYYB 3M4BA 3T4RA 2R7QA 1LE4A 3EH1A 2KNHA 3EQLF 4O7GA 2IYLD 256BA 3AQCA 4CS8A 3KL4A 3QVZA 4U5DE 3B71A 3TJ6A 1MMDA 1D1CA 1E85A 4X0RA 1RCPA 2Q9AA 1EKYA 3HNJA 4MS2A 1PV3A 3N24A 1EA8A 1T01A 2YHSA 5L0JA 4IJJA 4E17A 4E7SA 2A69F 1OW8A 3DAGA 5IY5C 2KK1A 3G4ZA 3Q6NA 4LLEA 3LEOA 2EPLX 2P0NA 3UR3C 5COMA 3JYYA 4E18A 2XSEA 2M4EA 4A4AA 4E0HA 2EIJC 2Y3HA 5JLIA 3M4CA 3DD7A 1XZPA 1ORSC 2J9WA 2PNOA 3NYJA 5FZTA 5B1AC 4OINF 3ZG1A 2R7OA 3ECSA 3GWNA 3IQCA 1M57C 1UFBA 1OKKD 2L81A 4PJJA 3E70C 3U3FA 4YT8A 4EBBA 4JVSA 2YL3A 3ABKC 2PX3A 1VLTA 4P6IC 1Q0FA 4MVMA 1VYKA 3O6XA 4FAPB 4MVZA 4W8PA 2XLVA 4AE4B 2C03A 2HV7A 5HV9A 2XS1A 2YLIA 2VH3A 4CDYA 5KYWB 3DE8A 4ANJA 2F22A 4CSAC 1MMGA 4G7OF 2E87A 3DI5A 1TQGA 2FFHA 2GA0A 2EIKC 4D4XA 3HNKA 3U2MA 2LD6A 1V74B 1LI7A 2OEVA 2HMZA 3SXZA 1A7EA 2NSGA 2J46A 1Z63A 1TWAA 3ZVRA 4PFPA 1OCCC 1Z23A 1PCXA 2G3KA 3K66A 2RSEB 3KYIA 3ABLC 3M15A 3ZQVA 4CSAA 4XTKA 2IXNA 1C17M 5BQHA 1J8MF 5DS5A 3NYLA 2L9JA 3BRJA 3ZQYA 1TKNA 1MNEA 5F5HA 4H54A 4JJFA 3JZ0A 1WWPA 4C3EA 3C8GB 5JP7A 2YL7A 2ZXPA 3AQBA 4JE9A 3R7CA 3ZTZA 2J45A 2YKZA 1QPUA 5BUOA 4U9DA 1GS9A 1O5HA 2GDCA 1A7DA 2WL8A 5F5FA 1QQ3A 2XM4A 1DOVA 5L0IA 1T5OA 2LK4A 1ZVZA 2LCHA 1NLXA 4KC9A 2R7UA 4J32B 1OQCA 2R7RA 2CNWD 5KYYA 3FDQA 2KJGA 1MNDA 3UGPA 3ZTMA 2LIGA 4G0HA 2J0XA 2H8AA 4BEMJ 1YVIA 1IW7F 4JCHA 4RD9A 5EK0A 5B3SC 1YAUO 1C03A 2OQMA 3RVYA 3KYJA 2IXOA 1Z7Qc 1H7IA 1CPQA 1TWGA 1B68A 1YJGA 2KC3A 2ZXRA 2B0JA 2Q9CA 1WTYA 3DJNB 1D0ZA 1ZHZA 3SXKA 4DXWA 1QKRA 3SXYA 4YL3A 1NFNA 4JRZA 3DMDA 4ZLCA 1HMDA 1I5NA 1D1AA 2ASRA 3B29A 4MTOA 5KYNA 1EQ1A 2R02A 3M79A 5D92A 4LDRA 2Y3GA 4FWVA 3TOMA 1DOWA 2PX0A 3JSEO 2R05A 1NG1A 3LAYA 3JRTA 3LJBA 3MYIA 4IAQA 3DKAA 3EFOB 2HSBA 4IGGA 2QY9A 3KPHA 1E2XA 3JRMO 4U5FE 4BEJA 5A6JA 4BJ5C 4OIQF 1FFTC 2EIMC 2QNLA 4GYTA 1MQVA 1ZYRF 3JSZA 4PFOA 4DOZA 4BPMA 2PP4A 1Z3IX 4EWCA 4MTGA 5L0HA 3TULA 1R4TA 2L6GA 2L6FA 4QI0A 3I5QA 4AE4A 2P6VA 1VOMA 2I15A 4U5GA 2LFDA 3L34A 3W2VA 1W2WA 2XXAB 2HJMA 2YLDA 3DJUB 3ASOC 5FCLA 5EHHA 3GORA 4N4WA 1F1MA 4JURI 2DYRC 3BEHA 1GGQA 5E3AA 4KNWA 3US6A 5L3VA 4I1MA 4MQ9F 1VTMP 5A6AA 4MW3A 2C04A 3C8ZA 5COFA 3NDBB 1U6HA 1MMAA 3G4XA 3NYMA 2VB6A 3U0CA 4L6RA 5E33A 3IQ5A 2CYDA 2L6HA 3AJMA 2JD3A 3OWTA 4Z9JA 3ZIBA 2D4UA 4NTFA 2HFIA 3QMKA 2XL4A 4WGYA 4DJ9A 3W8HA 5DLJA 5CIVA 4YK5A 3A11A 2AU5A 2DYSC 3MX3A 4JIOA 2H7BA 2NUTB 3C8GA 2MWQA 3L0IA 4AL0A 3T9OA 3DZAA 2X51A 3K1IA 3OA1A 2DGJA 5L0FA 2J9BA 1FR0A 4IARA 1Q0GA 1HW1A 3ASNC 4J30B 1Z5ZA 3NMJA 3MBGA 1E83A 3FAJA 4W8KA 2QLAA 4MTFA 1GQAA 5K0IA 4I1OB 4YWQA 3SYNA 4IRUA 1LPEA 1ST6A 3AG3C 4JKVA 4PJMA 3NKDA 1AVOB 2XM0A 4PJNA 1XZQA 3GEIA 4YT2A 2FGYA 4KNVA 4CX9A 4QI2A 1YA9A 3H2UA 3WHNA 1T9KA 3NG1A 3QZCA 4NC3A 4CS7A 4C7OB 3TJ5A 3NMIA 4KI2A 5KYXB 4XEFA 3N0TA 2FAPB 2W4BA 2OG2A 4YT5A 4OIRF 3GEHA 4MVUA 4DRIB 1ZW3A 2NG1A 2Y3BA 3HNIA 1LS4A 1YZCA 3EGDA 4G78A 2PBEA 4RDAA 4U5CE 3A9CA 3CSKA 1SF8A 3QW1A 1SR2A 1G8XA 3S27A 3MLGA 4EIYA 2PF4E 1CPRA 1QZXA 4Z9HA 1WATA 3DAFA 3ITFA 1M56C 1Y6DA 1LIHA 1RKEA 2HJ3A 3JTLO 3M1CB 1SZIA 3W2WA 2WVOA 2NSFA 2A68F 2D5RB 2R9RB 1LVKA 1Q0MA 2YEVA 3EFOA 4BG0A 4DVZA 3IEEA 4EHPA 2HS5A 1YDIA 5JVEA 1Q0KA 3EJNA 1TFKB 2HUJA 1OXBA 4JEBA 4EKWA 1V55C 3GWLA 3T6GB 1FFHA 5TJ5E 2EPOA 2TMVP 4G7ZF 4HFKB 5BQGA 2OOCA 1I4YA 3KMIA 1D1BA 1BBHA 1MMNA 4JCZA 1NU7D 3S84A 3RVZA 2YVKA 3L8JA 4GQHA 2HSQA 4KBLA 2P61A 2XXAA 2R7VA 3R2PA 4G7HF 1T6UA 1YZAA 2DI3A 3F46A 3DWWA 4XLNF 3FVYA 4A2NB 3KH2A 2NUPB 3Q6MA 3RFYA 2YLGA 1H9GA 2X0CA 2IOQA 3SEOA 4XWJA 2MYSA 2R7TA 3U9JA 2KGOA 2BE5F 3J06A 1E84A 5F28E 3DXJF 4N6HA 4AL1A 1M6TA 4JW1A 3ZC4A 4BJ6C 1TWHA 3E9VA 3B0VC 1WN0A 3GM1A 4U5EE 3SZRA 5GPGB 2XLOA 2NUTA 4OD4A 4IAOA 2IXMA 3AG1C 2ZXOA 3GM3A 2G62A 1NBBA 3LUTB 2XLDA 1ZHTA 4K7BA 4NCQA 4O6NA 3X2QC 4DVYP 2AVKA 4ONSA 5AGFA 4CBEA 4XEKA 2OEXA 3Q7GA 3FAPB 2W4MA 4B6IA 4CIPA 4R32A 3RQEA 3O10A 2ZD9A 2WZLA 1K05A 3EZHA 2EPMX 3UMHA 4YL1A 2V26A 4EBJA 3CAXA 1WOLA 2L7AA 4JTAB 4PK4A 1NZEA 2A1DD 2MHRA 3DM9B 1VLSA 3EHMA 4WJ0A 3RF3A 1O3UA 3K7DA 4C7OA 1OW7A 3C63A 2XL6A 4DRJB 3S29A 1ZU4A 2HZ8A 2J8WA 1G4US 1U89A 2W9YA 1VMAA 3IPMO 4ZLDA 4O6MA 1CGNA 4CS9C 4CJOA 1AEPA 1LE2A 4CJGA 1TWCA 2GAQA 5HSWA 4P9TA 1ZU5A 2QTVA 3UNGC 5JRAA 2EILC 3TQOA 1OCZC 2YQYA 5KYWA 3PDMP 1LKXA 1R5ID 2A6HF 3C7JA 4FESA 4IWBA 2CCYA 2Y69C 4BJ5A 1ZHXA 1NFOA 3Q7LA 2Y39A 4MNDA 3U9MA 3LNRA 4EUKB 2VCCA 4F4BA 1HY5A 2J7PD 3C62A 2IXPA 1I4ZA 3PMRA 2V3CC 3QW0A 1FNTc 4YJWA 3W8IA 3JCUQ 4HE8D 4JTCB 5EGYA 1LS1A 3EGXB 3C8GD 5CI8A 2R25A 3B0UX 1YARO 2IBFA 2P1AA 2QE9A 4N6CA 2PFDA 2AWYA 3ZSUA 2UUIA 2NPUA 4K0DA 3LEVA 2J7PA 3U8PA 4ER9A 2ZPAA 4YT4A 3ZDLA 1KNYA 1RJ9B 2IM8A 3MFNA 3RH3A 4QDLA 1ZHYA 1Q0DA 3GM2A 4NTAA 2YL1A 1BR4A 1OCOC 2NUPA 4MW8A 4U9EA 4XLPF 3LS1A 2AWCA 4PR9A 1NU9C 2LP4A 3EH2A 3QVYA 4OD5A 3FMSA 2CW0F 3TD7A 5DQZA 3LS0A 3HKKA 3VAYA 4CS8C 5A6BD 3JT1A 1TFOB 1FMWA 5DVWA 4XPXA 3UGOA 4XEVA 3U2LA 2R7WA 5B1BC 3LLIA 2Q3TA 3ATPA 1J8YF 4J7TA 3I5PA 1LM3B 1BR1A 1K04A 5L0CA 1E86A 4UDVA 2LQGA 5A6BA 1WASA 4DBQA 2UUHA 1AUEA 2GWWA 4NTBA 5JT4A 1BDJB 1RMVA 3EPVA 2H7OA 3S0XA 2VC9A 4M63A 4XPYA 1OW6A 3SP1A 5KYUB 3S28A 4HFFB 1PD1A 3X1OA 1S7ZA 1WGWA 1Z6AA 2KYHA 1A41A 4Q5SF 1M2VB 4U5HA 2XLWA 4EBKA 4ULVA 2ETSA 2GFHA 3U8VA 2WVQA 5DQTA 2OJED 2A0BA 4JC7A 3AG4C 4JEAA 4AK9A 2J0WA 3IHUA 5L3QA 3RIPA 3LESA 3T6JA 2EPNA 3FXHA 3HJCA 3L1MA 4I3MA 3NRHA 1QLEC 3B9QA 3T6BA 2JPUA 3TOLA 3W4YA 2H7VC 3DE9A 4LLCA 3FOOA 1M2OA 3GODA 5A69A 3H2VA 3V5ZA 3AG2C 2A6EF 3GEEA 3AOUA 1Y4CA 5DS4A 2LSEA 2A0UA 3SNHA 1A7VA 3AGUA 2G3VA 4RBNA 2XLMA 3C18A 3QTHA 3RQFA 3L8IA 4MVSA 1OKKA 2BC5A 3SXMA 1JMWA 1OXKA 2OCCC 1HMOA 1YLMA 2YZSA 3F47A 2KSFA 3HNLA 4GEHA 4I44A 5COGA 4OIPF 4C3DA 1YYXA 2YL0A 3O39A 2WZFA 4OIOF 4MVRA 5BQIA 5AC4A 4Q4ZF 1KU2A 3EHNA 3HTKC 1IZMA 1D0YA 1JPNA 3U3BA 4P9FA 1SMYF 3EGXA 4N06A 2OJQA 1SYQA 3I4UA 2EINC 2KW3C 3UMIA 4DBRA 5E2QA 1CGOA 4CIHA 2CGEA 5D91A 1HE9A 1T6IA 3EG9B 3VF0A 4WABA 1RJ9A 4E7ZA 1JAFA 2LFFA 2M64A 3LLKA 2ZXWC 5JSLA 3V5YA 1FAPB 1YA7O 4AX2A 2Z15A 4DRHB 1QVXA 3UMKA 4CDVA 1BZ4A 3EZIA 3N2ZB 4JZAA 3VYWA 3MYFA 1C02A 4YL0A 3S90A 2WZGA 2EPKX 4BJTA 2YRFA 4LDKA 5CI9A 2Q7RA 1QSPA 3GANA 1ORYA 2OU6A 3RQGA 4XPWA 2Y3DA 3WG7C 4BJ6A 2R7SA 3S9OA 1VYIA 2XS8A 1PD0A 1RXQA 1V4AA 2AP3A 3K1HA 3LNMB 4H4KC 4YN0B 2VASA 5L0DA 1GM5A 4J7YA 4LACB 3TK0A 1D0XA 4C3BA 1G4WR 2WVNA 4O6YA 1V54C 2P7VA 1S05A 1G5ZA 1K40A 2DB4A 4U5BE 1JRAA 1T6QA 1JPJA 1LI5A 5KYXA 1OR3A 4HEAJ 2O9XA 1CGME 5KYUA 3O55A 1ZW2A 1L3PA 1OCRC 1KTMA 2CNWA 1ZZPA 1H6GA 4IB4A 5L0GA 1FTSA 1M2VA 1NSGB 5T3TA 2B0HA 3CZ6A 1APCA 3KKBA 3POVA 3H65A 2XRHA 4LERA 3EGDB 2HKVA 4NY3A 5T1DB 1HE1A 4MVQA 4CS9A 4WGZA 2R7XA 1L7CA 4O79A 2VCAA 5E3CA 2YWAA 4JJGA 1RKEB 2WB7A 3V7OA 5B3IA 5JUAA 3IQTA 4E0IA 2BL2A 2CDQA 1H9TA 3DM5A 3K6BA 3V5XA 3CEXA 4PACA 5DS6A 1UG7A 2Q4FA 1O87A 4CDAA 3HLZA 3NMKA 2HV6A 3CQZA 4LDQA 4FX5A 2I8BA 4PJLA 1XWJA 3G50A 4Z9IA 3NKEA 1ORJA 5T3WA 4K1OA 1ZHWA
chains in the Genus database with same CATH topology
3TJ6A 1H6GA 5L0GA 1ZW3A 1RKCA 2HSQA 4P9TA 3S90A 4W8PA 4ONSA 2B0HA 5L0FA 1T01A 4PR9A 5L0JA 1QKRA 4E17A 2GDCA 2X0CA 1RKEA 1L7CA 1DOVA 5L0DA 1TR2A 1DOWA 5L0IA 1RKEB 4E18A 4EHPA 1ST6A 3MYIA 1YDIA 2L7AA 1ZVZA 1SYQA 1U6HA 3RF3A 4IGGA 5FZTA 3H2VA 5L0CA 3T6GB 3VF0A 3H2UA 2LQGA 2IBFA 1U89A 4DJ9A 3TJ5A 1XWJA 2GWWA 5L0HA 3ZDLA 4K1OA 1ZW2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TJ6 A;  1H6G A;  5L0G A;  1ZW3 A;  1RKC A;  2HSQ A;  4P9T A;  3S90 A;  4W8P A;  4ONS A;  2B0H A;  5L0F A;  1T01 A;  4PR9 A;  5L0J A;  1QKR A;  4E17 A;  2GDC A;  2X0C A;  1RKE A;  1L7C A;  1DOV A;  5L0D A;  1TR2 A;  1DOW A;  5L0I A;  1RKE B;  4E18 A;  4EHP A;  1ST6 A;  3MYI A;  1YDI A;  2L7A A;  1ZVZ A;  1SYQ A;  1U6H A;  3RF3 A;  4IGG A;  5FZT A;  3H2V A;  5L0C A;  3T6G B;  3VF0 A;  3H2U A;  2LQG A;  2IBF A;  1U89 A;  4DJ9 A;  3TJ5 A;  1XWJ A;  2GWW A;  5L0H A;  3ZDL A;  4K1O A;  1ZW2 A; 
#chains in the Genus database with same CATH topology
 1U0B B;  2RD9 A;  3RKO F;  2XL8 A;  3B0P A;  1RKC A;  2ICW G;  3IQ6 A;  1OR2 A;  3FOP A;  1JOG A;  2KQ9 A;  1VB5 A;  3PHF 2;  3ABM C;  3ZWI A;  3PCV A;  1VK5 A;  2XLH A;  1BR2 A;  4JTD B;  3OEO A;  3JYH A;  4ULW A;  3U5S A;  4Q7C A;  2Q00 A;  3VM6 A;  4NQF A;  4MVO A;  1TR2 A;  4D4N A;  2W45 A;  1A0B A;  1JR8 A;  1N1C A;  2JX0 A;  5AC5 A;  4XQ1 A;  5JS5 A;  3EG9 A;  3WOD F;  1EI7 A;  2J9V A;  3AGT A;  3FHD A;  2HMQ A;  2XLE A;  3VRC A;  1HW2 A;  3RYL A;  5A6K A;  3K1I C;  1FMV A;  2VCB A;  3RW0 A;  1YYJ A;  2QUP A;  3WAQ A;  2J9U A;  2OKU A;  4BJ1 A;  2R03 A;  3K33 A;  2Q9B A;  5KYY B;  3M4B A;  3T4R A;  2R7Q A;  1LE4 A;  3EH1 A;  2KNH A;  3EQL F;  4O7G A;  2IYL D;  256B A;  3AQC A;  4CS8 A;  3KL4 A;  3QVZ A;  4U5D E;  3B71 A;  3TJ6 A;  1MMD A;  1D1C A;  1E85 A;  4X0R A;  1RCP A;  2Q9A A;  1EKY A;  3HNJ A;  4MS2 A;  1PV3 A;  3N24 A;  1EA8 A;  1T01 A;  2YHS A;  5L0J A;  4IJJ A;  4E17 A;  4E7S A;  2A69 F;  1OW8 A;  3DAG A;  5IY5 C;  2KK1 A;  3G4Z A;  3Q6N A;  4LLE A;  3LEO A;  2EPL X;  2P0N A;  3UR3 C;  5COM A;  3JYY A;  4E18 A;  2XSE A;  2M4E A;  4A4A A;  4E0H A;  2EIJ C;  2Y3H A;  5JLI A;  3M4C A;  3DD7 A;  1XZP A;  1ORS C;  2J9W A;  2PNO A;  3NYJ A;  5FZT A;  5B1A C;  4OIN F;  3ZG1 A;  2R7O A;  3ECS A;  3GWN A;  3IQC A;  1M57 C;  1UFB A;  1OKK D;  2L81 A;  4PJJ A;  3E70 C;  3U3F A;  4YT8 A;  4EBB A;  4JVS A;  2YL3 A;  3ABK C;  2PX3 A;  1VLT A;  4P6I C;  1Q0F A;  4MVM A;  1VYK A;  3O6X A;  4FAP B;  4MVZ A;  4W8P A;  2XLV A;  4AE4 B;  2C03 A;  2HV7 A;  5HV9 A;  2XS1 A;  2YLI A;  2VH3 A;  4CDY A;  5KYW B;  3DE8 A;  4ANJ A;  2F22 A;  4CSA C;  1MMG A;  4G7O F;  2E87 A;  3DI5 A;  1TQG A;  2FFH A;  2GA0 A;  2EIK C;  4D4X A;  3HNK A;  3U2M A;  2LD6 A;  1V74 B;  1LI7 A;  2OEV A;  2HMZ A;  3SXZ A;  1A7E A;  2NSG A;  2J46 A;  1Z63 A;  1TWA A;  3ZVR A;  4PFP A;  1OCC C;  1Z23 A;  1PCX A;  2G3K A;  3K66 A;  2RSE B;  3KYI A;  3ABL C;  3M15 A;  3ZQV A;  4CSA A;  4XTK A;  2IXN A;  1C17 M;  5BQH A;  1J8M F;  5DS5 A;  3NYL A;  2L9J A;  3BRJ A;  3ZQY A;  1TKN A;  1MNE A;  5F5H A;  4H54 A;  4JJF A;  3JZ0 A;  1WWP A;  4C3E A;  3C8G B;  5JP7 A;  2YL7 A;  2ZXP A;  3AQB A;  4JE9 A;  3R7C A;  3ZTZ A;  2J45 A;  2YKZ A;  1QPU A;  5BUO A;  4U9D A;  1GS9 A;  1O5H A;  2GDC A;  1A7D A;  2WL8 A;  5F5F A;  1QQ3 A;  2XM4 A;  1DOV A;  5L0I A;  1T5O A;  2LK4 A;  1ZVZ A;  2LCH A;  1NLX A;  4KC9 A;  2R7U A;  4J32 B;  1OQC A;  2R7R A;  2CNW D;  5KYY A;  3FDQ A;  2KJG A;  1MND A;  3UGP A;  3ZTM A;  2LIG A;  4G0H A;  2J0X A;  2H8A A;  4BEM J;  1YVI A;  1IW7 F;  4JCH A;  4RD9 A;  5EK0 A;  5B3S C;  1YAU O;  1C03 A;  2OQM A;  3RVY A;  3KYJ A;  2IXO A;  1Z7Q c;  1H7I A;  1CPQ A;  1TWG A;  1B68 A;  1YJG A;  2KC3 A;  2ZXR A;  2B0J A;  2Q9C A;  1WTY A;  3DJN B;  1D0Z A;  1ZHZ A;  3SXK A;  4DXW A;  1QKR A;  3SXY A;  4YL3 A;  1NFN A;  4JRZ A;  3DMD A;  4ZLC A;  1HMD A;  1I5N A;  1D1A A;  2ASR A;  3B29 A;  4MTO A;  5KYN A;  1EQ1 A;  2R02 A;  3M79 A;  5D92 A;  4LDR A;  2Y3G A;  4FWV A;  3TOM A;  1DOW A;  2PX0 A;  3JSE O;  2R05 A;  1NG1 A;  3LAY A;  3JRT A;  3LJB A;  3MYI A;  4IAQ A;  3DKA A;  3EFO B;  2HSB A;  4IGG A;  2QY9 A;  3KPH A;  1E2X A;  3JRM O;  4U5F E;  4BEJ A;  5A6J A;  4BJ5 C;  4OIQ F;  1FFT C;  2EIM C;  2QNL A;  4GYT A;  1MQV A;  1ZYR F;  3JSZ A;  4PFO A;  4DOZ A;  4BPM A;  2PP4 A;  1Z3I X;  4EWC A;  4MTG A;  5L0H A;  3TUL A;  1R4T A;  2L6G A;  2L6F A;  4QI0 A;  3I5Q A;  4AE4 A;  2P6V A;  1VOM A;  2I15 A;  4U5G A;  2LFD A;  3L34 A;  3W2V A;  1W2W A;  2XXA B;  2HJM A;  2YLD A;  3DJU B;  3ASO C;  5FCL A;  5EHH A;  3GOR A;  4N4W A;  1F1M A;  4JUR I;  2DYR C;  3BEH A;  1GGQ A;  5E3A A;  4KNW A;  3US6 A;  5L3V A;  4I1M A;  4MQ9 F;  1VTM P;  5A6A A;  4MW3 A;  2C04 A;  3C8Z A;  5COF A;  3NDB B;  1U6H A;  1MMA A;  3G4X A;  3NYM A;  2VB6 A;  3U0C A;  4L6R A;  5E33 A;  3IQ5 A;  2CYD A;  2L6H A;  3AJM A;  2JD3 A;  3OWT A;  4Z9J A;  3ZIB A;  2D4U A;  4NTF A;  2HFI A;  3QMK A;  2XL4 A;  4WGY A;  4DJ9 A;  3W8H A;  5DLJ A;  5CIV A;  4YK5 A;  3A11 A;  2AU5 A;  2DYS C;  3MX3 A;  4JIO A;  2H7B A;  2NUT B;  3C8G A;  2MWQ A;  3L0I A;  4AL0 A;  3T9O A;  3DZA A;  2X51 A;  3K1I A;  3OA1 A;  2DGJ A;  5L0F A;  2J9B A;  1FR0 A;  4IAR A;  1Q0G A;  1HW1 A;  3ASN C;  4J30 B;  1Z5Z A;  3NMJ A;  3MBG A;  1E83 A;  3FAJ A;  4W8K A;  2QLA A;  4MTF A;  1GQA A;  5K0I A;  4I1O B;  4YWQ A;  3SYN A;  4IRU A;  1LPE A;  1ST6 A;  3AG3 C;  4JKV A;  4PJM A;  3NKD A;  1AVO B;  2XM0 A;  4PJN A;  1XZQ A;  3GEI A;  4YT2 A;  2FGY A;  4KNV A;  4CX9 A;  4QI2 A;  1YA9 A;  3H2U A;  3WHN A;  1T9K A;  3NG1 A;  3QZC A;  4NC3 A;  4CS7 A;  4C7O B;  3TJ5 A;  3NMI A;  4KI2 A;  5KYX B;  4XEF A;  3N0T A;  2FAP B;  2W4B A;  2OG2 A;  4YT5 A;  4OIR F;  3GEH A;  4MVU A;  4DRI B;  1ZW3 A;  2NG1 A;  2Y3B A;  3HNI A;  1LS4 A;  1YZC A;  3EGD A;  4G78 A;  2PBE A;  4RDA A;  4U5C E;  3A9C A;  3CSK A;  1SF8 A;  3QW1 A;  1SR2 A;  1G8X A;  3S27 A;  3MLG A;  4EIY A;  2PF4 E;  1CPR A;  1QZX A;  4Z9H A;  1WAT A;  3DAF A;  3ITF A;  1M56 C;  1Y6D A;  1LIH A;  1RKE A;  2HJ3 A;  3JTL O;  3M1C B;  1SZI A;  3W2W A;  2WVO A;  2NSF A;  2A68 F;  2D5R B;  2R9R B;  1LVK A;  1Q0M A;  2YEV A;  3EFO A;  4BG0 A;  4DVZ A;  3IEE A;  4EHP A;  2HS5 A;  1YDI A;  5JVE A;  1Q0K A;  3EJN A;  1TFK B;  2HUJ A;  1OXB A;  4JEB A;  4EKW A;  1V55 C;  3GWL A;  3T6G B;  1FFH A;  5TJ5 E;  2EPO A;  2TMV P;  4G7Z F;  4HFK B;  5BQG A;  2OOC A;  1I4Y A;  3KMI A;  1D1B A;  1BBH A;  1MMN A;  4JCZ A;  1NU7 D;  3S84 A;  3RVZ A;  2YVK A;  3L8J A;  4GQH A;  2HSQ A;  4KBL A;  2P61 A;  2XXA A;  2R7V A;  3R2P A;  4G7H F;  1T6U A;  1YZA A;  2DI3 A;  3F46 A;  3DWW A;  4XLN F;  3FVY A;  4A2N B;  3KH2 A;  2NUP B;  3Q6M A;  3RFY A;  2YLG A;  1H9G A;  2X0C A;  2IOQ A;  3SEO A;  4XWJ A;  2MYS A;  2R7T A;  3U9J A;  2KGO A;  2BE5 F;  3J06 A;  1E84 A;  5F28 E;  3DXJ F;  4N6H A;  4AL1 A;  1M6T A;  4JW1 A;  3ZC4 A;  4BJ6 C;  1TWH A;  3E9V A;  3B0V C;  1WN0 A;  3GM1 A;  4U5E E;  3SZR A;  5GPG B;  2XLO A;  2NUT A;  4OD4 A;  4IAO A;  2IXM A;  3AG1 C;  2ZXO A;  3GM3 A;  2G62 A;  1NBB A;  3LUT B;  2XLD A;  1ZHT A;  4K7B A;  4NCQ A;  4O6N A;  3X2Q C;  4DVY P;  2AVK A;  4ONS A;  5AGF A;  4CBE A;  4XEK A;  2OEX A;  3Q7G A;  3FAP B;  2W4M A;  4B6I A;  4CIP A;  4R32 A;  3RQE A;  3O10 A;  2ZD9 A;  2WZL A;  1K05 A;  3EZH A;  2EPM X;  3UMH A;  4YL1 A;  2V26 A;  4EBJ A;  3CAX A;  1WOL A;  2L7A A;  4JTA B;  4PK4 A;  1NZE A;  2A1D D;  2MHR A;  3DM9 B;  1VLS A;  3EHM A;  4WJ0 A;  3RF3 A;  1O3U A;  3K7D A;  4C7O A;  1OW7 A;  3C63 A;  2XL6 A;  4DRJ B;  3S29 A;  1ZU4 A;  2HZ8 A;  2J8W A;  1G4U S;  1U89 A;  2W9Y A;  1VMA A;  3IPM O;  4ZLD A;  4O6M A;  1CGN A;  4CS9 C;  4CJO A;  1AEP A;  1LE2 A;  4CJG A;  1TWC A;  2GAQ A;  5HSW A;  4P9T A;  1ZU5 A;  2QTV A;  3UNG C;  5JRA A;  2EIL C;  3TQO A;  1OCZ C;  2YQY A;  5KYW A;  3PDM P;  1LKX A;  1R5I D;  2A6H F;  3C7J A;  4FES A;  4IWB A;  2CCY A;  2Y69 C;  4BJ5 A;  1ZHX A;  1NFO A;  3Q7L A;  2Y39 A;  4MND A;  3U9M A;  3LNR A;  4EUK B;  2VCC A;  4F4B A;  1HY5 A;  2J7P D;  3C62 A;  2IXP A;  1I4Z A;  3PMR A;  2V3C C;  3QW0 A;  1FNT c;  4YJW A;  3W8I A;  3JCU Q;  4HE8 D;  4JTC B;  5EGY A;  1LS1 A;  3EGX B;  3C8G D;  5CI8 A;  2R25 A;  3B0U X;  1YAR O;  2IBF A;  2P1A A;  2QE9 A;  4N6C A;  2PFD A;  2AWY A;  3ZSU A;  2UUI A;  2NPU A;  4K0D A;  3LEV A;  2J7P A;  3U8P A;  4ER9 A;  2ZPA A;  4YT4 A;  3ZDL A;  1KNY A;  1RJ9 B;  2IM8 A;  3MFN A;  3RH3 A;  4QDL A;  1ZHY A;  1Q0D A;  3GM2 A;  4NTA A;  2YL1 A;  1BR4 A;  1OCO C;  2NUP A;  4MW8 A;  4U9E A;  4XLP F;  3LS1 A;  2AWC A;  4PR9 A;  1NU9 C;  2LP4 A;  3EH2 A;  3QVY A;  4OD5 A;  3FMS A;  2CW0 F;  3TD7 A;  5DQZ A;  3LS0 A;  3HKK A;  3VAY A;  4CS8 C;  5A6B D;  3JT1 A;  1TFO B;  1FMW A;  5DVW A;  4XPX A;  3UGO A;  4XEV A;  3U2L A;  2R7W A;  5B1B C;  3LLI A;  2Q3T A;  3ATP A;  1J8Y F;  4J7T A;  3I5P A;  1LM3 B;  1BR1 A;  1K04 A;  5L0C A;  1E86 A;  4UDV A;  2LQG A;  5A6B A;  1WAS A;  4DBQ A;  2UUH A;  1AUE A;  2GWW A;  4NTB A;  5JT4 A;  1BDJ B;  1RMV A;  3EPV A;  2H7O A;  3S0X A;  2VC9 A;  4M63 A;  4XPY A;  1OW6 A;  3SP1 A;  5KYU B;  3S28 A;  4HFF B;  1PD1 A;  3X1O A;  1S7Z A;  1WGW A;  1Z6A A;  2KYH A;  1A41 A;  4Q5S F;  1M2V B;  4U5H A;  2XLW A;  4EBK A;  4ULV A;  2ETS A;  2GFH A;  3U8V A;  2WVQ A;  5DQT A;  2OJE D;  2A0B A;  4JC7 A;  3AG4 C;  4JEA A;  4AK9 A;  2J0W A;  3IHU A;  5L3Q A;  3RIP A;  3LES A;  3T6J A;  2EPN A;  3FXH A;  3HJC A;  3L1M A;  4I3M A;  3NRH A;  1QLE C;  3B9Q A;  3T6B A;  2JPU A;  3TOL A;  3W4Y A;  2H7V C;  3DE9 A;  4LLC A;  3FOO A;  1M2O A;  3GOD A;  5A69 A;  3H2V A;  3V5Z A;  3AG2 C;  2A6E F;  3GEE A;  3AOU A;  1Y4C A;  5DS4 A;  2LSE A;  2A0U A;  3SNH A;  1A7V A;  3AGU A;  2G3V A;  4RBN A;  2XLM A;  3C18 A;  3QTH A;  3RQF A;  3L8I A;  4MVS A;  1OKK A;  2BC5 A;  3SXM A;  1JMW A;  1OXK A;  2OCC C;  1HMO A;  1YLM A;  2YZS A;  3F47 A;  2KSF A;  3HNL A;  4GEH A;  4I44 A;  5COG A;  4OIP F;  4C3D A;  1YYX A;  2YL0 A;  3O39 A;  2WZF A;  4OIO F;  4MVR A;  5BQI A;  5AC4 A;  4Q4Z F;  1KU2 A;  3EHN A;  3HTK C;  1IZM A;  1D0Y A;  1JPN A;  3U3B A;  4P9F A;  1SMY F;  3EGX A;  4N06 A;  2OJQ A;  1SYQ A;  3I4U A;  2EIN C;  2KW3 C;  3UMI A;  4DBR A;  5E2Q A;  1CGO A;  4CIH A;  2CGE A;  5D91 A;  1HE9 A;  1T6I A;  3EG9 B;  3VF0 A;  4WAB A;  1RJ9 A;  4E7Z A;  1JAF A;  2LFF A;  2M64 A;  3LLK A;  2ZXW C;  5JSL A;  3V5Y A;  1FAP B;  1YA7 O;  4AX2 A;  2Z15 A;  4DRH B;  1QVX A;  3UMK A;  4CDV A;  1BZ4 A;  3EZI A;  3N2Z B;  4JZA A;  3VYW A;  3MYF A;  1C02 A;  4YL0 A;  3S90 A;  2WZG A;  2EPK X;  4BJT A;  2YRF A;  4LDK A;  5CI9 A;  2Q7R A;  1QSP A;  3GAN A;  1ORY A;  2OU6 A;  3RQG A;  4XPW A;  2Y3D A;  3WG7 C;  4BJ6 A;  2R7S A;  3S9O A;  1VYI A;  2XS8 A;  1PD0 A;  1RXQ A;  1V4A A;  2AP3 A;  3K1H A;  3LNM B;  4H4K C;  4YN0 B;  2VAS A;  5L0D A;  1GM5 A;  4J7Y A;  4LAC B;  3TK0 A;  1D0X A;  4C3B A;  1G4W R;  2WVN A;  4O6Y A;  1V54 C;  2P7V A;  1S05 A;  1G5Z A;  1K40 A;  2DB4 A;  4U5B E;  1JRA A;  1T6Q A;  1JPJ A;  1LI5 A;  5KYX A;  1OR3 A;  4HEA J;  2O9X A;  1CGM E;  5KYU A;  3O55 A;  1ZW2 A;  1L3P A;  1OCR C;  1KTM A;  2CNW A;  1ZZP A;  1H6G A;  4IB4 A;  5L0G A;  1FTS A;  1M2V A;  1NSG B;  5T3T A;  2B0H A;  3CZ6 A;  1APC A;  3KKB A;  3POV A;  3H65 A;  2XRH A;  4LER A;  3EGD B;  2HKV A;  4NY3 A;  5T1D B;  1HE1 A;  4MVQ A;  4CS9 A;  4WGZ A;  2R7X A;  1L7C A;  4O79 A;  2VCA A;  5E3C A;  2YWA A;  4JJG A;  1RKE B;  2WB7 A;  3V7O A;  5B3I A;  5JUA A;  3IQT A;  4E0I A;  2BL2 A;  2CDQ A;  1H9T A;  3DM5 A;  3K6B A;  3V5X A;  3CEX A;  4PAC A;  5DS6 A;  1UG7 A;  2Q4F A;  1O87 A;  4CDA A;  3HLZ A;  3NMK A;  2HV6 A;  3CQZ A;  4LDQ A;  4FX5 A;  2I8B A;  4PJL A;  1XWJ A;  3G50 A;  4Z9I A;  3NKE A;  1ORJ A;  5T3W A;  4K1O A;  1ZHW A; 
#chains in the Genus database with same CATH homology
 3TJ6 A;  1H6G A;  5L0G A;  1ZW3 A;  1RKC A;  2HSQ A;  4P9T A;  3S90 A;  4W8P A;  4ONS A;  2B0H A;  5L0F A;  1T01 A;  4PR9 A;  5L0J A;  1QKR A;  4E17 A;  2GDC A;  2X0C A;  1RKE A;  1L7C A;  1DOV A;  5L0D A;  1TR2 A;  1DOW A;  5L0I A;  1RKE B;  4E18 A;  4EHP A;  1ST6 A;  3MYI A;  1YDI A;  2L7A A;  1ZVZ A;  1SYQ A;  1U6H A;  3RF3 A;  4IGG A;  5FZT A;  3H2V A;  5L0C A;  3T6G B;  3VF0 A;  3H2U A;  2LQG A;  2IBF A;  1U89 A;  4DJ9 A;  3TJ5 A;  1XWJ A;  2GWW A;  5L0H A;  3ZDL A;  4K1O A;  1ZW2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...