3RF3A

Shigella ipaa-vbs3 in complex with human vinculin
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
257
structure length
257
Chain Sequence
PVFHTRTIESILEPVAQQISHLVIMHEEGEVDGKAIPDLTAPVAAVQAAVSNLVRVGKETVQTTEDQILKRDMPPAFIKVENACTKLVQAAQMLQSDPYSVPARDYLIDGSRGILSGTSDLLLTFDEAEVRKIIRVCKGILEYLTVAEVVETMEDLVTYTKNLGPGMTKMAKMIDERQQELTHQEHRVMLVNSMNTVKELLPVLISAMKIFVTTKNSKNQGIEEALKNRNFTVEKMSAEINEIIRVLQLTSWDEDAW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Vinculin
publication title Novel vinculin binding site of the IpaA invasin of Shigella.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding/toxin
total genus 116
structure length 257
sequence length 257
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-04-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 3rf3A02
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 3rf3A01
3TJ5A 1YDIA 1XWJA 1ZW3A 5L0FA 1RKEB 3H2UA 5L0CA 1U89A 2GWWA 4EHPA 3MYIA 3VF0A 1DOWA 1DOVA 3RF3A 4IGGA 5L0DA 5L0JA 3TJ6A 4E17A 3S90A 2B0HA 1U6HA 2GDCA 1L7CA 5L0GA 2L7AA 2LQGA 1T01A 1ZVZA 3H2VA 4ONSA 5FZTA 1ST6A 2X0CA 2HSQA 1QKRA 5L0IA 3ZDLA 5L0HA 4P9TA 4DJ9A 1H6GA 2IBFA 3T6GB 1ZW2A 1SYQA 4K1OA 1RKCA 1RKEA 4PR9A 4W8PA 4E18A 1TR2A
chains in the Genus database with same CATH superfamily
3K66A 3UGOA 4EKWA 4J7YA 1PD1A 4PFPA 1VLSA 2YQYA 4RBNA 4WJ0A 4EUKB 1J8MF 3NMKA 4EBBA 1XZPA 5CI9A 3GWNA 2IM8A 1A41A 5CIVA 2R7RA 2NSFA 5L0GA 2HV6A 3DD7A 4K7BA 3TK0A 1T01A 4D4NA 4DRIB 4G7ZF 2WB7A 4MVQA 3EH1A 3GM1A 3JTLO 4XEKA 2XL6A 1F1MA 3C8GB 4JE9A 2F22A 2FAPB 3AQCA 4PJNA 5E3AA 4FAPB 2LCHA 3SYNA 1NSGB 4U5FE 3C8ZA 3POVA 2LK4A 1BZ4A 3IQTA 5EHHA 4G78A 3HNIA 2NG1A 1VB5A 3ASNC 2HS5A 4J30B 1NLXA 2Q00A 3EQLF 4NQFA 4OIRF 1ZW3A 3FAPB 1D1BA 3JRTA 5A6BA 3RIPA 1L3PA 3MYFA 3O10A 2J46A 3EJNA 5L0CA 4F4BA 3MYIA 4G7OF 2EIKC 4CIPA 3ZQVA 2KQ9A 2KW3C 3VRCA 1A7VA 2XSEA 3C8GA 1HW2A 4OD4A 3V7OA 1YVIA 2XLHA 5JVEA 3LUTB 3QTHA 1K40A 4CX9A 2XS1A 1NU9C 2VCCA 2R7OA 4ZLDA 3KPHA 1FAPB 2J45A 4CS9C 3CEXA 3SP1A 2NUTB 5E33A 5JT4A 1OR3A 2XLOA 2YLIA 3AGUA 5DVWA 3W8IA 2YRFA 3FAJA 4DRHB 2HFIA 3GODA 1YYXA 4W8PA 2J9BA 5KYUB 2CW0F 1LE4A 3CAXA 3O55A 1TWAA 2AWYA 3MFNA 3ITFA 4CS7A 3NMJA 1CPQA 4LLCA 1JAFA 3U3BA 2KNHA 2VH3A 2LFFA 2RD9A 2BC5A 2W9YA 1DOVA 2R03A 3FVYA 3M4BA 2GFHA 3E70C 4LACB 1O87A 1R4TA 1G8XA 4N6CA 1A7EA 3NYLA 4BJ1A 3L8JA 2P0NA 4JW1A 2QTVA 3T4RA 1L7CA 2VB6A 3M4CA 3MBGA 1Z7Qc 3TOMA 3I5QA 3VAYA 3HKKA 1M2OA 2YLGA 3T6BA 5B1AC 3JCUQ 1BBHA 1CGNA 2YKZA 4ULVA 5A69A 2PX0A 2ETSA 1A0BA 5JS5A 2QLAA 2JPUA 4DRJB 5IY5C 5KYUA 3AG4C 1CPRA 2QY9A 3OWTA 5B1BC 2VCBA 3B9QA 1T6IA 3O6XA 3PMRA 1T6UA 4IWBA 4G0HA 4PK4A 1PD0A 5JRAA 1LS1A 3B0VC 1LS4A 1OCZC 2BL2A 3C18A 1D0XA 3HNJA 3OA1A 1G5ZA 3N2ZB 2CGEA 2I8BA 2PF4E 1ZHTA 2XLVA 3MX3A 2ZXRA 4KNVA 2A0UA 3N0TA 2ZXOA 3DJUB 3VM6A 5HV9A 5L0DA 3DE8A 3ZQYA 1LPEA 2R7TA 5E3CA 1CGME 2J0WA 4LERA 1FNTc 2L7AA 3NYMA 3LS0A 4MVUA 3IEEA 4X0RA 2QUPA 4ONSA 3E9VA 1JPJA 1JMWA 3GEHA 2X0CA 2DYSC 4BJ5A 4E7SA 4NCQA 2Y3GA 2NUPB 4DBRA 3WAQA 4XLPF 4CBEA 4H4KC 3DXJF 1YJGA 3A9CA 3L0IA 2IXNA 1A7DA 1YYJA 4Z9IA 2PP4A 1NFOA 3FMSA 1YAUO 2XL8A 4IB4A 3RQFA 1QVXA 3AG2C 1MMNA 2KC3A 1CGOA 1TFOB 3H65A 1E86A 3U9MA 2A68F 3H2UA 2UUIA 3JYYA 1LKXA 3M1CB 4MVOA 4BG0A 5JUAA 2LSEA 1BDJB 4CSAC 2AVKA 1HE1A 4WGYA 5TJ5E 3EG9B 4U5EE 3IHUA 3QVYA 1SF8A 4WGZA 4XEVA 2FFHA 3PCVA 4CS8A 3PHF2 3S90A 4QI2A 2EPLX 4PJLA 5K0IA 4KI2A 5KYYB 1S7ZA 3ZTZA 5JP7A 4P9FA 2NUPA 2DGJA 1ST6A 1K04A 2OKUA 5BUOA 4AL0A 3LLIA 1ZU4A 3ZC4A 2AWCA 5L0HA 3W4YA 4CDAA 3X2QC 2IYLD 3ZG1A 4O6MA 3V5XA 1LIHA 1ORYA 4O6YA 3QMKA 3S0XA 2CYDA 1Z3IX 3ASOC 3ZSUA 1WASA 2H8AA 1ZHWA 1Z5ZA 4DXWA 1IW7F 3EG9A 4I44A 1KNYA 3JZ0A 4KBLA 3F46A 4A2NB 2YZSA 4E0IA 5FCLA 1VOMA 3S84A 5B3IA 3J06A 3AGTA 4BPMA 5KYYA 4UDVA 2OJED 1EKYA 4IJJA 3DWWA 1ORSC 1U6HA 3DAFA 3SXMA 4XQ1A 4AE4B 4RDAA 2C03A 3Q6NA 2J9VA 4DBQA 3LEOA 5COGA 5D92A 5JSLA 2XLDA 1OXBA 3SEOA 5BQHA 3ATPA 1E2XA 1WGWA 3EFOB 2R02A 4GEHA 2CNWA 4IRUA 4U9DA 3RVYA 5A6BD 3LLKA 3RYLA 4C3BA 4MW3A 3CZ6A 4ER9A 2J8WA 4GYTA 1V74B 4KNWA 4LDRA 3S29A 3U5SA 3EPVA 4W8KA 1IZMA 2EILC 2L6GA 2CDQA 4KC9A 1Z63A 1UG7A 4JEBA 4AE4A 4IGGA 3C8GD 2A6HF 2ZXWC 1EI7A 3NG1A 4O7GA 2LIGA 3C7JA 3EZIA 4JC7A 1WN0A 4XEFA 4HFKB 2OCCC 2WVOA 4MTGA 3SXKA 3EFOA 1NZEA 1FFHA 2G3KA 1OCCC 2KJGA 1O5HA 3JT1A 2P6VA 3KYIA 4MTOA 4IARA 2G3VA 1TKNA 1C02A 3LS1A 4NTAA 4U5DE 5L0IA 3U0CA 3ZDLA 3V5YA 3FHDA 1J8YF 4EWCA 2HJMA 5KYWB 1H9TA 2XLEA 1PV3A 2Q4FA 4ULWA 1EQ1A 2Y3HA 4YJWA 3RW0A 1FMVA 1AUEA 1AVOB 3C62A 1WWPA 3U9JA 3KMIA 3A11A 5BQIA 2AP3A 4U9EA 3NDBB 2YL3A 2D5RB 1I4YA 2OQMA 3EGXB 256BA 1ZU5A 2J7PA 2MWQA 3F47A 4O79A 4PJJA 4YWQA 4E0HA 4YT8A 1M6TA 5L0JA 3K1IC 2Q9BA 1W2WA 5F5HA 2B0HA 4AL1A 5HSWA 2DB4A 1LE2A 1YA7O 2R7XA 1I5NA 3UR3C 4AK9A 3DMDA 4BJ6C 4HE8D 2W4BA 1YZCA 3R2PA 2R7UA 4YL3A 4A4AA 3QW1A 5KYWA 1Q0KA 2PBEA 4MS2A 2NUTA 1K05A 1GGQA 1Q0MA 3LAYA 4P6IC 3OEOA 2A1DD 1ZHXA 2OOCA 1M56C 3KYJA 3DM5A 1JRAA 2A6EF 1NBBA 3T6GB 4PFOA 3IPMO 1OW8A 1M2VB 4MVSA 4I3MA 3JSEO 3G50A 4YL0A 3ABLC 4JTCB 5T3WA 3K1HA 1ZHZA 4N06A 3DJNB 1XWJA 4OIQF 2HSBA 2JD3A 2M64A 2PFDA 3Q7LA 5COMA 3TD7A 1FR0A 2KSFA 4YK5A 1GS9A 2Y69C 1FTSA 4CS9A 2Q7RA 3GEEA 1B68A 1QLEC 3TULA 2BE5F 3Q7GA 2GA0A 2AU5A 1Q0DA 2OJQA 1RMVA 1BR4A 1OKKA 3AQBA 2P61A 4JTDB 1U0BB 2XLMA 1V54C 3QVZA 2PNOA 2EPKX 3RVZA 4EIYA 4ZLCA 3FDQA 3EGDB 1M2VA 2OU6A 2CCYA 4DJ9A 2M4EA 4NTFA 1FMWA 4JCZA 3UMHA 4WABA 1SYQA 3HTKC 3V5ZA 1RXQA 2FGYA 3JSZA 4BJ6A 4GQHA 3UGPA 2R05A 1TWCA 1QQ3A 2I15A 3L8IA 4XWJA 1RKEB 5DQTA 2HMQA 2L6HA 2WVQA 1ORJA 5AC5A 1YARO 1OW7A 1SR2A 4PACA 3AJMA 3GANA 3IQCA 4CDVA 3SZRA 4Q7CA 1DOWA 1TWHA 3NKDA 5A6JA 4JRZA 2LP4A 3RKOF 3UMIA 5KYNA 5T1DB 2L81A 3I5PA 2EPOA 2GDCA 4YT5A 3EGDA 4Z9JA 3ABMC 1ZVZA 3DE9A 3T9OA 2R7SA 4HFFB 1BR2A 2C04A 1HMDA 1ZYRF 3G4XA 3K33A 2IXPA 2L9JA 4XPXA 1QKRA 4CDYA 5COFA 1KTMA 4H54A 3GM3A 4MVMA 2KK1A 1RJ9B 1G4WR 3RQGA 4B6IA 2D4UA 5A6AA 3FOOA 1QZXA 1UFBA 2H7BA 1JOGA 5E2QA 5JLIA 1TR2A 4K0DA 1E85A 4FWVA 3RFYA 3WG7C 3CSKA 3DM9B 2WZGA 4C3EA 2ICWG 3UNGC 4BEJA 2R7WA 2Y39A 2Y3BA 2J9WA 4YL1A 3ZTMA 3W2VA 2B0JA 2EINC 2O9XA 1WATA 2YWAA 5B3SC 4E17A 2OEXA 5F5FA 1WOLA 4G7HF 2NPUA 2V3CC 4I1MA 3KH2A 1JR8A 1MQVA 1MNEA 2MHRA 3QZCA 1ZHYA 1HY5A 2R7QA 3T6JA 2TMVP 2HSQA 2KGOA 2H7OA 2CNWD 1YA9A 4CSAA 1HW1A 3EZHA 3TOLA 4U5CE 1D0ZA 1LI7A 2YLDA 4YT2A 1D0YA 1ZW2A 3S9OA 3X1OA 3HNLA 1MNDA 4IAOA 3DZAA 4LDKA 1MMAA 2IXOA 4O6NA 1HMOA 1NG1A 1H7IA 2P1AA 1GQAA 5L3VA 1SZIA 1HE9A 4U5GA 3U2LA 1LI5A 3VF0A 4E7ZA 3KKBA 2XS8A 3MLGA 3B71A 4Q5SF 2Z15A 2YEVA 1D1AA 1VTMP 3EHMA 1R5ID 1NFNA 1Y6DA 3IQ6A 1PCXA 4OIOF 4JKVA 5L3QA 4U5BE 5T3TA 3US6A 5FZTA 4YT4A 1Y4CA 1Q0GA 1LVKA 1OQCA 2ZXPA 2YVKA 3L1MA 4MTFA 3ZVRA 1E84A 3UMKA 2Y3DA 1VK5A 2IBFA 2MYSA 1RCPA 4LLEA 4MW8A 1SMYF 5DLJA 1RKCA 1S05A 2WVNA 3ECSA 5DS5A 2XXAB 3ABKC 3NRHA 2HMZA 3GM2A 2HZ8A 1Z6AA 1YLMA 1YDIA 2QNLA 4JURI 2GAQA 2J7PD 5F28E 5GPGB 5L0FA 3U2MA 2XL4A 4RD9A 5DS4A 3B29A 4JZAA 3M79A 2UUHA 4J32B 3RQEA 3AG1C 4U5HA 3RF3A 4YN0B 4OIPF 2R7VA 4OD5A 2VASA 1OCOC 4XLNF 5A6KA 3C63A 2HJ3A 1V4AA 3L34A 3LNRA 1WTYA 2ZD9A 3DI5A 4M63A 4QI0A 4I1OB 4NC3A 2YL7A 3GORA 4XTKA 1APCA 5CI8A 4ANJA 4XPWA 2R25A 3LESA 4JEAA 4P9TA 2XXAA 2X51A 2W45A 3PDMP 3VYWA 3AOUA 4J7TA 3B0PA 1D1CA 4R32A 4LDQA 4E18A 3TJ5A 4MVRA 2ASRA 3EGXA 3AG3C 3KL4A 1XZQA 3BEHA 4BJ5C 2WZFA 1G4US 1OR2A 1TQGA 1U89A 2R9RB 2GWWA 4MNDA 3SXYA 3HLZA 1FFTC 1OKKD 2EIJC 5DS6A 1C17M 2YL0A 2W4MA 3NMIA 1O3UA 2Q9AA 3TJ6A 3RH3A 3W2WA 1I4ZA 1ZZPA 3LNMB 2OEVA 1V55C 3M15A 4N4WA 3HNKA 3FXHA 3H2VA 4CJGA 3JRMO 1Z23A 1EA8A 1KU2A 3LJBA 1N1CA 1T5OA 3SXZA 1T9KA 1TWGA 4FX5A 5BQGA 3N24A 2J0XA 2Q9CA 4JJGA 3U8PA 3W8HA 4C7OB 1OXKA 1LM3B 2WL8A 5KYXB 3G4ZA 1MMGA 4BJTA 2L6FA 4CS8C 3K1IA 2LFDA 4JCHA 1H9GA 3GEIA 3Q6MA 3S28A 4CIHA 5EK0A 3EHNA 2KYHA 3K7DA 1TFKB 4PJMA 2NSGA 2IXMA 2ZPAA 3JYHA 4EHPA 1OCRC 3U3FA 3ZWIA 4C3DA 1JPNA 4DVYP 4HEAJ 1Q0FA 2VC9A 2EIMC 2XRHA 3DKAA 2DI3A 4FESA 4QDLA 3WHNA 3IQ5A 2V26A 1T6QA 2LQGA 3I4UA 4L6RA 4JVSA 5DQZA 4DVZA 4Q4ZF 3NKEA 4C7OA 5KYXA 1VYKA 3DAGA 3WODF 3ZIBA 2XM4A 4XPYA 4NY3A 3EH2A 4IAQA 1YZAA 1C03A 2DYRC 1M57C 1VLTA 2H7VC 2HKVA 3CQZA 4DOZA 5AC4A 2VCAA 2WZLA 1RKEA 3FOPA 4PR9A 2A69F 4OINF 2RSEB 4JJFA 2JX0A 3SNHA 2OG2A 4AX2A 2PX3A 3U8VA 1QPUA 2LD6A 1GM5A 1QSPA 2IOQA 4MQ9F 3HJCA 4JTAB 2P7VA 4Z9HA 1OW6A 1VMAA 1BR1A 1NU7D 2E87A 2HUJA 3NYJA 4N6HA 3O39A 3BRJA 3K6BA 3B0UX 2G62A 2A0BA 2J9UA 2HV7A 2YHSA 1MMDA 4EBKA 4MVZA 3TQOA 2XLWA 4CJOA 3GWLA 4JIOA 1RJ9A 4D4XA 1H6GA 4EBJA 3LEVA 2EPMX 3R7CA 3S27A 1AEPA 5EGYA 2XM0A 2QE9A 2YL1A 4K1OA 4NTBA 2Q3TA 5D91A 5AGFA 1VYIA 4BEMJ 2EPNA 3QW0A 1E83A
chains in the Genus database with same CATH topology
3TJ5A 1YDIA 1XWJA 1ZW3A 5L0FA 1RKEB 3H2UA 5L0CA 1U89A 2GWWA 4EHPA 3MYIA 3VF0A 1DOWA 1DOVA 3RF3A 4IGGA 5L0DA 5L0JA 3TJ6A 4E17A 3S90A 2B0HA 1U6HA 2GDCA 1L7CA 5L0GA 2L7AA 2LQGA 1T01A 1ZVZA 3H2VA 4ONSA 5FZTA 1ST6A 2X0CA 2HSQA 1QKRA 5L0IA 3ZDLA 5L0HA 4P9TA 4DJ9A 1H6GA 2IBFA 3T6GB 1ZW2A 1SYQA 4K1OA 1RKCA 1RKEA 4PR9A 4W8PA 4E18A 1TR2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TJ5 A;  1YDI A;  1XWJ A;  1ZW3 A;  5L0F A;  1RKE B;  3H2U A;  5L0C A;  1U89 A;  2GWW A;  4EHP A;  3MYI A;  3VF0 A;  1DOW A;  1DOV A;  3RF3 A;  4IGG A;  5L0D A;  5L0J A;  3TJ6 A;  4E17 A;  3S90 A;  2B0H A;  1U6H A;  2GDC A;  1L7C A;  5L0G A;  2L7A A;  2LQG A;  1T01 A;  1ZVZ A;  3H2V A;  4ONS A;  5FZT A;  1ST6 A;  2X0C A;  2HSQ A;  1QKR A;  5L0I A;  3ZDL A;  5L0H A;  4P9T A;  4DJ9 A;  1H6G A;  2IBF A;  3T6G B;  1ZW2 A;  1SYQ A;  4K1O A;  1RKC A;  1RKE A;  4PR9 A;  4W8P A;  4E18 A;  1TR2 A; 
#chains in the Genus database with same CATH topology
 3K66 A;  3UGO A;  4EKW A;  4J7Y A;  1PD1 A;  4PFP A;  1VLS A;  2YQY A;  4RBN A;  4WJ0 A;  4EUK B;  1J8M F;  3NMK A;  4EBB A;  1XZP A;  5CI9 A;  3GWN A;  2IM8 A;  1A41 A;  5CIV A;  2R7R A;  2NSF A;  5L0G A;  2HV6 A;  3DD7 A;  4K7B A;  3TK0 A;  1T01 A;  4D4N A;  4DRI B;  4G7Z F;  2WB7 A;  4MVQ A;  3EH1 A;  3GM1 A;  3JTL O;  4XEK A;  2XL6 A;  1F1M A;  3C8G B;  4JE9 A;  2F22 A;  2FAP B;  3AQC A;  4PJN A;  5E3A A;  4FAP B;  2LCH A;  3SYN A;  1NSG B;  4U5F E;  3C8Z A;  3POV A;  2LK4 A;  1BZ4 A;  3IQT A;  5EHH A;  4G78 A;  3HNI A;  2NG1 A;  1VB5 A;  3ASN C;  2HS5 A;  4J30 B;  1NLX A;  2Q00 A;  3EQL F;  4NQF A;  4OIR F;  1ZW3 A;  3FAP B;  1D1B A;  3JRT A;  5A6B A;  3RIP A;  1L3P A;  3MYF A;  3O10 A;  2J46 A;  3EJN A;  5L0C A;  4F4B A;  3MYI A;  4G7O F;  2EIK C;  4CIP A;  3ZQV A;  2KQ9 A;  2KW3 C;  3VRC A;  1A7V A;  2XSE A;  3C8G A;  1HW2 A;  4OD4 A;  3V7O A;  1YVI A;  2XLH A;  5JVE A;  3LUT B;  3QTH A;  1K40 A;  4CX9 A;  2XS1 A;  1NU9 C;  2VCC A;  2R7O A;  4ZLD A;  3KPH A;  1FAP B;  2J45 A;  4CS9 C;  3CEX A;  3SP1 A;  2NUT B;  5E33 A;  5JT4 A;  1OR3 A;  2XLO A;  2YLI A;  3AGU A;  5DVW A;  3W8I A;  2YRF A;  3FAJ A;  4DRH B;  2HFI A;  3GOD A;  1YYX A;  4W8P A;  2J9B A;  5KYU B;  2CW0 F;  1LE4 A;  3CAX A;  3O55 A;  1TWA A;  2AWY A;  3MFN A;  3ITF A;  4CS7 A;  3NMJ A;  1CPQ A;  4LLC A;  1JAF A;  3U3B A;  2KNH A;  2VH3 A;  2LFF A;  2RD9 A;  2BC5 A;  2W9Y A;  1DOV A;  2R03 A;  3FVY A;  3M4B A;  2GFH A;  3E70 C;  4LAC B;  1O87 A;  1R4T A;  1G8X A;  4N6C A;  1A7E A;  3NYL A;  4BJ1 A;  3L8J A;  2P0N A;  4JW1 A;  2QTV A;  3T4R A;  1L7C A;  2VB6 A;  3M4C A;  3MBG A;  1Z7Q c;  3TOM A;  3I5Q A;  3VAY A;  3HKK A;  1M2O A;  2YLG A;  3T6B A;  5B1A C;  3JCU Q;  1BBH A;  1CGN A;  2YKZ A;  4ULV A;  5A69 A;  2PX0 A;  2ETS A;  1A0B A;  5JS5 A;  2QLA A;  2JPU A;  4DRJ B;  5IY5 C;  5KYU A;  3AG4 C;  1CPR A;  2QY9 A;  3OWT A;  5B1B C;  2VCB A;  3B9Q A;  1T6I A;  3O6X A;  3PMR A;  1T6U A;  4IWB A;  4G0H A;  4PK4 A;  1PD0 A;  5JRA A;  1LS1 A;  3B0V C;  1LS4 A;  1OCZ C;  2BL2 A;  3C18 A;  1D0X A;  3HNJ A;  3OA1 A;  1G5Z A;  3N2Z B;  2CGE A;  2I8B A;  2PF4 E;  1ZHT A;  2XLV A;  3MX3 A;  2ZXR A;  4KNV A;  2A0U A;  3N0T A;  2ZXO A;  3DJU B;  3VM6 A;  5HV9 A;  5L0D A;  3DE8 A;  3ZQY A;  1LPE A;  2R7T A;  5E3C A;  1CGM E;  2J0W A;  4LER A;  1FNT c;  2L7A A;  3NYM A;  3LS0 A;  4MVU A;  3IEE A;  4X0R A;  2QUP A;  4ONS A;  3E9V A;  1JPJ A;  1JMW A;  3GEH A;  2X0C A;  2DYS C;  4BJ5 A;  4E7S A;  4NCQ A;  2Y3G A;  2NUP B;  4DBR A;  3WAQ A;  4XLP F;  4CBE A;  4H4K C;  3DXJ F;  1YJG A;  3A9C A;  3L0I A;  2IXN A;  1A7D A;  1YYJ A;  4Z9I A;  2PP4 A;  1NFO A;  3FMS A;  1YAU O;  2XL8 A;  4IB4 A;  3RQF A;  1QVX A;  3AG2 C;  1MMN A;  2KC3 A;  1CGO A;  1TFO B;  3H65 A;  1E86 A;  3U9M A;  2A68 F;  3H2U A;  2UUI A;  3JYY A;  1LKX A;  3M1C B;  4MVO A;  4BG0 A;  5JUA A;  2LSE A;  1BDJ B;  4CSA C;  2AVK A;  1HE1 A;  4WGY A;  5TJ5 E;  3EG9 B;  4U5E E;  3IHU A;  3QVY A;  1SF8 A;  4WGZ A;  4XEV A;  2FFH A;  3PCV A;  4CS8 A;  3PHF 2;  3S90 A;  4QI2 A;  2EPL X;  4PJL A;  5K0I A;  4KI2 A;  5KYY B;  1S7Z A;  3ZTZ A;  5JP7 A;  4P9F A;  2NUP A;  2DGJ A;  1ST6 A;  1K04 A;  2OKU A;  5BUO A;  4AL0 A;  3LLI A;  1ZU4 A;  3ZC4 A;  2AWC A;  5L0H A;  3W4Y A;  4CDA A;  3X2Q C;  2IYL D;  3ZG1 A;  4O6M A;  3V5X A;  1LIH A;  1ORY A;  4O6Y A;  3QMK A;  3S0X A;  2CYD A;  1Z3I X;  3ASO C;  3ZSU A;  1WAS A;  2H8A A;  1ZHW A;  1Z5Z A;  4DXW A;  1IW7 F;  3EG9 A;  4I44 A;  1KNY A;  3JZ0 A;  4KBL A;  3F46 A;  4A2N B;  2YZS A;  4E0I A;  5FCL A;  1VOM A;  3S84 A;  5B3I A;  3J06 A;  3AGT A;  4BPM A;  5KYY A;  4UDV A;  2OJE D;  1EKY A;  4IJJ A;  3DWW A;  1ORS C;  1U6H A;  3DAF A;  3SXM A;  4XQ1 A;  4AE4 B;  4RDA A;  2C03 A;  3Q6N A;  2J9V A;  4DBQ A;  3LEO A;  5COG A;  5D92 A;  5JSL A;  2XLD A;  1OXB A;  3SEO A;  5BQH A;  3ATP A;  1E2X A;  1WGW A;  3EFO B;  2R02 A;  4GEH A;  2CNW A;  4IRU A;  4U9D A;  3RVY A;  5A6B D;  3LLK A;  3RYL A;  4C3B A;  4MW3 A;  3CZ6 A;  4ER9 A;  2J8W A;  4GYT A;  1V74 B;  4KNW A;  4LDR A;  3S29 A;  3U5S A;  3EPV A;  4W8K A;  1IZM A;  2EIL C;  2L6G A;  2CDQ A;  4KC9 A;  1Z63 A;  1UG7 A;  4JEB A;  4AE4 A;  4IGG A;  3C8G D;  2A6H F;  2ZXW C;  1EI7 A;  3NG1 A;  4O7G A;  2LIG A;  3C7J A;  3EZI A;  4JC7 A;  1WN0 A;  4XEF A;  4HFK B;  2OCC C;  2WVO A;  4MTG A;  3SXK A;  3EFO A;  1NZE A;  1FFH A;  2G3K A;  1OCC C;  2KJG A;  1O5H A;  3JT1 A;  2P6V A;  3KYI A;  4MTO A;  4IAR A;  2G3V A;  1TKN A;  1C02 A;  3LS1 A;  4NTA A;  4U5D E;  5L0I A;  3U0C A;  3ZDL A;  3V5Y A;  3FHD A;  1J8Y F;  4EWC A;  2HJM A;  5KYW B;  1H9T A;  2XLE A;  1PV3 A;  2Q4F A;  4ULW A;  1EQ1 A;  2Y3H A;  4YJW A;  3RW0 A;  1FMV A;  1AUE A;  1AVO B;  3C62 A;  1WWP A;  3U9J A;  3KMI A;  3A11 A;  5BQI A;  2AP3 A;  4U9E A;  3NDB B;  2YL3 A;  2D5R B;  1I4Y A;  2OQM A;  3EGX B;  256B A;  1ZU5 A;  2J7P A;  2MWQ A;  3F47 A;  4O79 A;  4PJJ A;  4YWQ A;  4E0H A;  4YT8 A;  1M6T A;  5L0J A;  3K1I C;  2Q9B A;  1W2W A;  5F5H A;  2B0H A;  4AL1 A;  5HSW A;  2DB4 A;  1LE2 A;  1YA7 O;  2R7X A;  1I5N A;  3UR3 C;  4AK9 A;  3DMD A;  4BJ6 C;  4HE8 D;  2W4B A;  1YZC A;  3R2P A;  2R7U A;  4YL3 A;  4A4A A;  3QW1 A;  5KYW A;  1Q0K A;  2PBE A;  4MS2 A;  2NUT A;  1K05 A;  1GGQ A;  1Q0M A;  3LAY A;  4P6I C;  3OEO A;  2A1D D;  1ZHX A;  2OOC A;  1M56 C;  3KYJ A;  3DM5 A;  1JRA A;  2A6E F;  1NBB A;  3T6G B;  4PFO A;  3IPM O;  1OW8 A;  1M2V B;  4MVS A;  4I3M A;  3JSE O;  3G50 A;  4YL0 A;  3ABL C;  4JTC B;  5T3W A;  3K1H A;  1ZHZ A;  4N06 A;  3DJN B;  1XWJ A;  4OIQ F;  2HSB A;  2JD3 A;  2M64 A;  2PFD A;  3Q7L A;  5COM A;  3TD7 A;  1FR0 A;  2KSF A;  4YK5 A;  1GS9 A;  2Y69 C;  1FTS A;  4CS9 A;  2Q7R A;  3GEE A;  1B68 A;  1QLE C;  3TUL A;  2BE5 F;  3Q7G A;  2GA0 A;  2AU5 A;  1Q0D A;  2OJQ A;  1RMV A;  1BR4 A;  1OKK A;  3AQB A;  2P61 A;  4JTD B;  1U0B B;  2XLM A;  1V54 C;  3QVZ A;  2PNO A;  2EPK X;  3RVZ A;  4EIY A;  4ZLC A;  3FDQ A;  3EGD B;  1M2V A;  2OU6 A;  2CCY A;  4DJ9 A;  2M4E A;  4NTF A;  1FMW A;  4JCZ A;  3UMH A;  4WAB A;  1SYQ A;  3HTK C;  3V5Z A;  1RXQ A;  2FGY A;  3JSZ A;  4BJ6 A;  4GQH A;  3UGP A;  2R05 A;  1TWC A;  1QQ3 A;  2I15 A;  3L8I A;  4XWJ A;  1RKE B;  5DQT A;  2HMQ A;  2L6H A;  2WVQ A;  1ORJ A;  5AC5 A;  1YAR O;  1OW7 A;  1SR2 A;  4PAC A;  3AJM A;  3GAN A;  3IQC A;  4CDV A;  3SZR A;  4Q7C A;  1DOW A;  1TWH A;  3NKD A;  5A6J A;  4JRZ A;  2LP4 A;  3RKO F;  3UMI A;  5KYN A;  5T1D B;  2L81 A;  3I5P A;  2EPO A;  2GDC A;  4YT5 A;  3EGD A;  4Z9J A;  3ABM C;  1ZVZ A;  3DE9 A;  3T9O A;  2R7S A;  4HFF B;  1BR2 A;  2C04 A;  1HMD A;  1ZYR F;  3G4X A;  3K33 A;  2IXP A;  2L9J A;  4XPX A;  1QKR A;  4CDY A;  5COF A;  1KTM A;  4H54 A;  3GM3 A;  4MVM A;  2KK1 A;  1RJ9 B;  1G4W R;  3RQG A;  4B6I A;  2D4U A;  5A6A A;  3FOO A;  1QZX A;  1UFB A;  2H7B A;  1JOG A;  5E2Q A;  5JLI A;  1TR2 A;  4K0D A;  1E85 A;  4FWV A;  3RFY A;  3WG7 C;  3CSK A;  3DM9 B;  2WZG A;  4C3E A;  2ICW G;  3UNG C;  4BEJ A;  2R7W A;  2Y39 A;  2Y3B A;  2J9W A;  4YL1 A;  3ZTM A;  3W2V A;  2B0J A;  2EIN C;  2O9X A;  1WAT A;  2YWA A;  5B3S C;  4E17 A;  2OEX A;  5F5F A;  1WOL A;  4G7H F;  2NPU A;  2V3C C;  4I1M A;  3KH2 A;  1JR8 A;  1MQV A;  1MNE A;  2MHR A;  3QZC A;  1ZHY A;  1HY5 A;  2R7Q A;  3T6J A;  2TMV P;  2HSQ A;  2KGO A;  2H7O A;  2CNW D;  1YA9 A;  4CSA A;  1HW1 A;  3EZH A;  3TOL A;  4U5C E;  1D0Z A;  1LI7 A;  2YLD A;  4YT2 A;  1D0Y A;  1ZW2 A;  3S9O A;  3X1O A;  3HNL A;  1MND A;  4IAO A;  3DZA A;  4LDK A;  1MMA A;  2IXO A;  4O6N A;  1HMO A;  1NG1 A;  1H7I A;  2P1A A;  1GQA A;  5L3V A;  1SZI A;  1HE9 A;  4U5G A;  3U2L A;  1LI5 A;  3VF0 A;  4E7Z A;  3KKB A;  2XS8 A;  3MLG A;  3B71 A;  4Q5S F;  2Z15 A;  2YEV A;  1D1A A;  1VTM P;  3EHM A;  1R5I D;  1NFN A;  1Y6D A;  3IQ6 A;  1PCX A;  4OIO F;  4JKV A;  5L3Q A;  4U5B E;  5T3T A;  3US6 A;  5FZT A;  4YT4 A;  1Y4C A;  1Q0G A;  1LVK A;  1OQC A;  2ZXP A;  2YVK A;  3L1M A;  4MTF A;  3ZVR A;  1E84 A;  3UMK A;  2Y3D A;  1VK5 A;  2IBF A;  2MYS A;  1RCP A;  4LLE A;  4MW8 A;  1SMY F;  5DLJ A;  1RKC A;  1S05 A;  2WVN A;  3ECS A;  5DS5 A;  2XXA B;  3ABK C;  3NRH A;  2HMZ A;  3GM2 A;  2HZ8 A;  1Z6A A;  1YLM A;  1YDI A;  2QNL A;  4JUR I;  2GAQ A;  2J7P D;  5F28 E;  5GPG B;  5L0F A;  3U2M A;  2XL4 A;  4RD9 A;  5DS4 A;  3B29 A;  4JZA A;  3M79 A;  2UUH A;  4J32 B;  3RQE A;  3AG1 C;  4U5H A;  3RF3 A;  4YN0 B;  4OIP F;  2R7V A;  4OD5 A;  2VAS A;  1OCO C;  4XLN F;  5A6K A;  3C63 A;  2HJ3 A;  1V4A A;  3L34 A;  3LNR A;  1WTY A;  2ZD9 A;  3DI5 A;  4M63 A;  4QI0 A;  4I1O B;  4NC3 A;  2YL7 A;  3GOR A;  4XTK A;  1APC A;  5CI8 A;  4ANJ A;  4XPW A;  2R25 A;  3LES A;  4JEA A;  4P9T A;  2XXA A;  2X51 A;  2W45 A;  3PDM P;  3VYW A;  3AOU A;  4J7T A;  3B0P A;  1D1C A;  4R32 A;  4LDQ A;  4E18 A;  3TJ5 A;  4MVR A;  2ASR A;  3EGX A;  3AG3 C;  3KL4 A;  1XZQ A;  3BEH A;  4BJ5 C;  2WZF A;  1G4U S;  1OR2 A;  1TQG A;  1U89 A;  2R9R B;  2GWW A;  4MND A;  3SXY A;  3HLZ A;  1FFT C;  1OKK D;  2EIJ C;  5DS6 A;  1C17 M;  2YL0 A;  2W4M A;  3NMI A;  1O3U A;  2Q9A A;  3TJ6 A;  3RH3 A;  3W2W A;  1I4Z A;  1ZZP A;  3LNM B;  2OEV A;  1V55 C;  3M15 A;  4N4W A;  3HNK A;  3FXH A;  3H2V A;  4CJG A;  3JRM O;  1Z23 A;  1EA8 A;  1KU2 A;  3LJB A;  1N1C A;  1T5O A;  3SXZ A;  1T9K A;  1TWG A;  4FX5 A;  5BQG A;  3N24 A;  2J0X A;  2Q9C A;  4JJG A;  3U8P A;  3W8H A;  4C7O B;  1OXK A;  1LM3 B;  2WL8 A;  5KYX B;  3G4Z A;  1MMG A;  4BJT A;  2L6F A;  4CS8 C;  3K1I A;  2LFD A;  4JCH A;  1H9G A;  3GEI A;  3Q6M A;  3S28 A;  4CIH A;  5EK0 A;  3EHN A;  2KYH A;  3K7D A;  1TFK B;  4PJM A;  2NSG A;  2IXM A;  2ZPA A;  3JYH A;  4EHP A;  1OCR C;  3U3F A;  3ZWI A;  4C3D A;  1JPN A;  4DVY P;  4HEA J;  1Q0F A;  2VC9 A;  2EIM C;  2XRH A;  3DKA A;  2DI3 A;  4FES A;  4QDL A;  3WHN A;  3IQ5 A;  2V26 A;  1T6Q A;  2LQG A;  3I4U A;  4L6R A;  4JVS A;  5DQZ A;  4DVZ A;  4Q4Z F;  3NKE A;  4C7O A;  5KYX A;  1VYK A;  3DAG A;  3WOD F;  3ZIB A;  2XM4 A;  4XPY A;  4NY3 A;  3EH2 A;  4IAQ A;  1YZA A;  1C03 A;  2DYR C;  1M57 C;  1VLT A;  2H7V C;  2HKV A;  3CQZ A;  4DOZ A;  5AC4 A;  2VCA A;  2WZL A;  1RKE A;  3FOP A;  4PR9 A;  2A69 F;  4OIN F;  2RSE B;  4JJF A;  2JX0 A;  3SNH A;  2OG2 A;  4AX2 A;  2PX3 A;  3U8V A;  1QPU A;  2LD6 A;  1GM5 A;  1QSP A;  2IOQ A;  4MQ9 F;  3HJC A;  4JTA B;  2P7V A;  4Z9H A;  1OW6 A;  1VMA A;  1BR1 A;  1NU7 D;  2E87 A;  2HUJ A;  3NYJ A;  4N6H A;  3O39 A;  3BRJ A;  3K6B A;  3B0U X;  2G62 A;  2A0B A;  2J9U A;  2HV7 A;  2YHS A;  1MMD A;  4EBK A;  4MVZ A;  3TQO A;  2XLW A;  4CJO A;  3GWL A;  4JIO A;  1RJ9 A;  4D4X A;  1H6G A;  4EBJ A;  3LEV A;  2EPM X;  3R7C A;  3S27 A;  1AEP A;  5EGY A;  2XM0 A;  2QE9 A;  2YL1 A;  4K1O A;  4NTB A;  2Q3T A;  5D91 A;  5AGF A;  1VYI A;  4BEM J;  2EPN A;  3QW0 A;  1E83 A; 
#chains in the Genus database with same CATH homology
 3TJ5 A;  1YDI A;  1XWJ A;  1ZW3 A;  5L0F A;  1RKE B;  3H2U A;  5L0C A;  1U89 A;  2GWW A;  4EHP A;  3MYI A;  3VF0 A;  1DOW A;  1DOV A;  3RF3 A;  4IGG A;  5L0D A;  5L0J A;  3TJ6 A;  4E17 A;  3S90 A;  2B0H A;  1U6H A;  2GDC A;  1L7C A;  5L0G A;  2L7A A;  2LQG A;  1T01 A;  1ZVZ A;  3H2V A;  4ONS A;  5FZT A;  1ST6 A;  2X0C A;  2HSQ A;  1QKR A;  5L0I A;  3ZDL A;  5L0H A;  4P9T A;  4DJ9 A;  1H6G A;  2IBF A;  3T6G B;  1ZW2 A;  1SYQ A;  4K1O A;  1RKC A;  1RKE A;  4PR9 A;  4W8P A;  4E18 A;  1TR2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...