3RF3A

Shigella ipaa-vbs3 in complex with human vinculin
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
257
structure length
257
Chain Sequence
b'PVFHTRTIESILEPVAQQISHLVIMHEEGEVDGKAIPDLTAPVAAVQAAVSNLVRVGKETVQTTEDQILKRDMPPAFIKVENACTKLVQAAQMLQSDPYSVPARDYLIDGSRGILSGTSDLLLTFDEAEVRKIIRVCKGILEYLTVAEVVETMEDLVTYTKNLGPGMTKMAKMIDERQQELTHQEHRVMLVNSMNTVKELLPVLISAMKIFVTTKNSKNQGIEEALKNRNFTVEKMSAEINEIIRVLQLTSWDEDAW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Vinculin
publication title Novel vinculin binding site of the IpaA invasin of Shigella.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding/toxin
total genus 116
structure length 257
sequence length 257
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-04-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 3rf3A02
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 3rf3A01
3H2VA 3MYIA 1T01A 1ST6A 3ZDLA 1U89A 1U6HA 1ZW3A 4K1OA 1ZW2A 4IGGA 5L0HA 3S90A 1L7CA 2L7AA 4ONSA 2IBFA 2X0CA 5L0CA 5L0FA 4DJ9A 2LQGA 1ZVZA 5L0DA 2B0HA 3T6GB 3TJ6A 4W8PA 1XWJA 5FZTA 1RKCA 1YDIA 3VF0A 5L0IA 2GWWA 4P9TA 1H6GA 2GDCA 4E17A 4E18A 3TJ5A 2HSQA 3H2UA 1QKRA 4EHPA 1DOVA 4PR9A 5L0JA 1SYQA 1RKEB 1DOWA 1RKEA 3RF3A 5L0GA 1TR2A
chains in the Genus database with same CATH superfamily
4KBLA 1G4US 4D4XA 2TMVP 2EIJC 3JTLO 2O9XA 5B1BC 1T6IA 5KYWA 1U89A 1ZW3A 2AP3A 3FAPB 1OW8A 2YRFA 2WL8A 2P0NA 4U9EA 2D5RB 2YL7A 5AGFA 2YLIA 3NYLA 4GYTA 1YYXA 3SNHA 1TWHA 5COGA 5F5HA 2HV6A 3TJ6A 3U2MA 4XEVA 3DI5A 4YJWA 1ZU5A 2R7QA 4OD4A 2LP4A 1FMVA 3EG9A 2A0BA 2VC9A 5KYUA 3IHUA 2DYSC 1HMDA 2Q9CA 4MW3A 2J0XA 5IY5C 3JSZA 3HNKA 1JOGA 3I5QA 3LJBA 2J8WA 4CS8A 1XZPA 4H4KC 5HV9A 2A0UA 3RH3A 4LDKA 4MTGA 3RQFA 4UDVA 4OIOF 2MYSA 1KNYA 2VCBA 1D1BA 1T01A 1UFBA 4Q4ZF 5A6KA 3QMKA 2IXNA 3M1CB 2CYDA 3UNGC 5L0HA 4Z9IA 3S90A 1C03A 2YLDA 4NCQA 5B1AC 5A69A 3B0PA 2VCAA 1GGQA 2HSBA 3G50A 4JTAB 2Y3DA 3UMKA 1TFKB 1O87A 2GA0A 1ZVZA 2FGYA 1A7DA 3NRHA 1LI7A 2W9YA 3C8ZA 4BEJA 3TD7A 1IW7F 3CZ6A 1D1AA 1LKXA 1MMDA 2XLWA 4JW1A 4IARA 4O6YA 3VF0A 1QVXA 3OEOA 4AX2A 3SEOA 5A6JA 3HJCA 4JEAA 1K04A 1I4YA 5GPGB 5A6BA 1OCZC 2QUPA 3AGUA 3SZRA 2OJED 3AG4C 1D0YA 2KQ9A 3NKDA 1RJ9B 3NYMA 4HE8D 4JCZA 2YVKA 1NLXA 1D0XA 3S9OA 1EI7A 2PF4E 1QQ3A 2YQYA 3S84A 2OEVA 3M79A 4YK5A 5TJ5E 5DS4A 3U8VA 3ZDLA 2R05A 2P1AA 2Q3TA 3EFOB 3F46A 4IWBA 2P7VA 4LDRA 1ZU4A 1E83A 1Z5ZA 1TFOB 4CS9C 3U3FA 2LQGA 4B6IA 3VYWA 1FTSA 2Q00A 4RBNA 2WZFA 4CDYA 3POVA 2X51A 4BG0A 1HW1A 2KSFA 2KJGA 1OQCA 2B0JA 1BR4A 2I15A 2NUPA 1Z7Qc 1NU9C 3AQCA 3O6XA 4U5FE 1K40A 1HE1A 1ZYRF 2ZXRA 2G3KA 3JRMO 1YARO 3K1IA 4EHPA 3ABMC 1TQGA 3DE8A 3DJNB 3NMIA 4A4AA 5JLIA 4C7OB 4QI2A 4N06A 3KPHA 3KYJA 3B29A 4KNWA 2W4BA 4EBJA 2R7XA 4J7TA 4DRHB 3Q6NA 1LS4A 3J06A 1BBHA 3X2QC 3MYIA 3AG3C 5F5FA 3L8JA 4K0DA 4NY3A 3EGXB 3KKBA 5BQIA 2NUTA 3LNRA 4JURI 1AEPA 2EPMX 3EZIA 4RDAA 2BE5F 4U5HA 4CSAA 1A7VA 4W8PA 3GEIA 2D4UA 3FMSA 5DS6A 3MLGA 2HJMA 1WASA 5JT4A 1W2WA 3PCVA 3FOOA 3LEVA 4I44A 2EPOA 3W4YA 4XLNF 3DZAA 1MNEA 3GODA 2J45A 3TJ5A 1KTMA 5D91A 4CS7A 3A9CA 1ZHZA 4IB4A 5L0JA 1M2VB 4MNDA 4YT2A 4EWCA 1DOWA 3UMHA 3UGOA 2R7VA 2QTVA 2C04A 1T6QA 1D1CA 3C18A 4AE4A 3M15A 2VH3A 3B0VC 4BJ6C 1TKNA 3DWWA 1ZHTA 1K05A 1XZQA 2JX0A 4RD9A 3U2LA 4O6MA 3RYLA 4I3MA 3QW1A 2A6HF 3MX3A 4YL1A 3VM6A 5AC5A 3U0CA 3FDQA 3HNJA 4E7SA 1PV3A 5KYXB 5FCLA 1PD0A 2FFHA 4DBRA 5L0CA 2H7OA 1MMGA 2UUHA 1OCCC 2IXPA 3S29A 1FFTC 4YL3A 2LSEA 3HTKC 3Q6MA 3SYNA 2V3CC 1NBBA 1LI5A 5L0IA 1KU2A 3G4ZA 4DBQA 2XXAB 1YAUO 2ZD9A 4JCHA 1ORJA 3LESA 4U5BE 2GDCA 1HE9A 2I8BA 3RQEA 3TQOA 2PBEA 3V7OA 2ZPAA 3C8GA 3G4XA 3H2UA 3UR3C 3ZTMA 1DOVA 3S27A 4PR9A 3RIPA 2VB6A 5L3QA 4HFKB 4PJLA 1RKEB 2WVOA 2YLGA 1ZHYA 2A6EF 4WGZA 3B71A 1RMVA 1QSPA 1M6TA 3JYYA 5EGYA 2WVNA 4CJOA 2BL2A 1SMYF 3V5YA 3LEOA 4I1MA 1I5NA 2MHRA 3NG1A 4NTAA 1JAFA 4J30B 2ZXPA 1E85A 2ASRA 1E84A 3ABKC 4DJ9A 2A69F 4HEAJ 4CJGA 2UUIA 1WATA 1TWCA 2Y3GA 5HSWA 2EILC 2R7UA 3JCUQ 4Z9JA 1Y4CA 2LCHA 3C8GD 3EHNA 4GQHA 4BJ5C 3KYIA 3EGDB 2QY9A 3Q7LA 2LFDA 2H7VC 3SXZA 1QKRA 4C3EA 5T1DB 5L3VA 4NTFA 2ICWG 5CI9A 3O55A 2CW0F 3IEEA 2HMZA 4P9FA 3EJNA 4JKVA 3H2VA 2EIKC 1QZXA 4DOZA 4L6RA 5DVWA 3H65A 3PMRA 5JUAA 1YA7O 4JC7A 2H8AA 3ZVRA 4BPMA 1BZ4A 3GM2A 3US6A 3W2WA 3VRCA 4BJTA 2J46A 2QLAA 4MVZA 2F22A 1VB5A 3ZIBA 2J9BA 3L8IA 1OKKA 3T4RA 3UGPA 5L0DA 2V26A 3T6GB 3ECSA 2C03A 3GM3A 3U8PA 3ZC4A 5KYNA 3M4BA 4WABA 1I4ZA 3WHNA 2KK1A 2R9RB 1G4WR 2R7WA 1ZHXA 1V74B 4DRIB 5KYYB 1FMWA 3GWNA 2IM8A 2XLHA 3JRTA 1MNDA 2OQMA 1PCXA 1Z6AA 5D92A 3CSKA 5B3IA 3ABLC 1F1MA 1SYQA 4O79A 1J8MF 3I5PA 4WGYA 3IQ5A 3X1OA 2A1DD 1WTYA 1OW6A 2OG2A 3SP1A 4A2NB 3T9OA 4EIYA 5KYWB 3EGXA 3DM9B 3NMKA 3MYFA 5B3SC 4XWJA 3C7JA 1OKKD 2QE9A 1EA8A 2IBFA 1VMAA 3ZTZA 4N4WA 4CBEA 1HMOA 2KC3A 2L6GA 5BQHA 3EG9B 4F4BA 2LD6A 1AUEA 2L6HA 1Z23A 1BDJB 2LK4A 1WN0A 4MTOA 1MQVA 2DYRC 3EZHA 4DRJB 4BJ1A 4CDAA 2HFIA 1FNTc 3JSEO 2YWAA 1JMWA 1LM3B 2XSEA 2XLMA 2ETSA 1ZZPA 4PJMA 2J9UA 3KL4A 5K0IA 1NU7D 2AWYA 4EKWA 2EINC 1ST6A 2EIMC 3LNMB 2XLVA 1YVIA 3CAXA 4XLPF 1M56C 2XRHA 3KMIA 4XQ1A 4XPYA 1TWAA 3DKAA 4LLCA 1A41A 2XL8A 1B68A 3N24A 5E33A 3RQGA 3RVYA 4I1OB 1NFOA 2M64A 3DJUB 4IJJA 3V5ZA 2L9JA 1FFHA 5T3TA 1M57C 2KW3C 1XWJA 3AG1C 4ZLCA 4CS8C 2EPLX 1RKCA 3LS0A 2R7RA 4XTKA 3AOUA 1Q0MA 2GWWA 4FX5A 4DVZA 3HNLA 2XXAA 1A0BA 3ZQVA 4U5CE 4E7ZA 4FWVA 5COMA 2GAQA 3K33A 1APCA 1VTMP 3IQ6A 1Z3IX 2FAPB 3NMJA 2XM4A 2ZXOA 5F28E 1RKEA 1S05A 1EQ1A 3HNIA 4E0HA 2AVKA 4CIPA 4QI0A 4O6NA 1E86A 2W4MA 1PD1A 1JPJA 4AK9A 2Y69C 5JS5A 3W8IA 4PFOA 1Q0KA 1R5ID 3M4CA 3SXYA 1YLMA 4PK4A 2PFDA 4ONSA 4JEBA 4JE9A 4O7GA 4CDVA 4EBBA 1FR0A 1JR8A 1N1CA 1IZMA 2B0HA 3C62A 1T6UA 1OR2A 4YN0B 2E87A 5BUOA 1R4TA 3ZG1A 1CPQA 2NUPB 4MQ9F 2HV7A 3GEEA 1VOMA 3ZQYA 2RD9A 4JZAA 2MWQA 2KNHA 3EQLF 2Q7RA 2WVQA 3FHDA 4XPXA 3EGDA 5EK0A 2Z15A 3EHMA 1LS1A 4MVMA 2R7OA 1O3UA 4U5DE 4U5EE 1H9TA 4LERA 2OCCC 4G7HF 2Y39A 1YA9A 4OIRF 4MS2A 1WWPA 2CGEA 2IYLD 2NUTB 2G3VA 3U5SA 4C3DA 5CIVA 1OR3A 2VCCA 2HS5A 1U6HA 2Q9AA 3AGTA 4IAQA 1NZEA 3TOMA 2CNWD 4YWQA 2ZXWC 5JP7A 2L7AA 4YT8A 5CI8A 3HKKA 5L0FA 2XLEA 2YZSA 3DD7A 1U0BB 2Y3BA 2XLDA 3K1IC 3R2PA 4PJNA 4BEMJ 4AL0A 2A68F 1V54C 1YDIA 1LPEA 2NG1A 1VYKA 1LVKA 3GORA 3GWLA 3OWTA 3R7CA 4JVSA 2M4EA 5KYYA 4CS9A 2YHSA 4IRUA 5E2QA 3L1MA 4E0IA 2EPNA 4YT4A 2KGOA 4R32A 4N6HA 4Q7CA 4G7ZF 3FAJA 2J9WA 3GEHA 3MFNA 4YT5A 4P6IC 2RSEB 3UMIA 1RJ9A 1YZCA 5AC4A 5BQGA 3HLZA 2Y3HA 3W2VA 2DGJA 4CSAC 3WAQA 4W8KA 1G5ZA 4CIHA 4N6CA 4XPWA 4G0HA 1JPNA 1GM5A 2HUJA 3U9JA 1C17M 2J0WA 2R03A 1O5HA 1OCRC 1V55C 3EFOA 2WZLA 3RVZA 3PDMP 1OW7A 2OJQA 1SR2A 2NSFA 3ZSUA 2W45A 4Z9HA 5T3WA 5JVEA 1Q0GA 2PX0A 4YL0A 3LLKA 1C02A 2P6VA 1ZHWA 2WZGA 3I4UA 3T6JA 3T6BA 3IQCA 4FESA 3C8GB 3K66A 4E18A 2R7TA 3FXHA 1CPRA 2LIGA 4MVQA 4CX9A 5DLJA 4AL1A 1RCPA 4ULVA 1T5OA 2L6FA 1D0ZA 2GFHA 2XM0A 4LACB 1CGOA 1QPUA 4KC9A 4C7OA 3S0XA 3VAYA 3U3BA 2G62A 4K1OA 1ZW2A 4MTFA 4OD5A 4PFPA 2PP4A 2Q9BA 2NPUA 2OU6A 3GM1A 2DB4A 3DE9A 4JJGA 4JJFA 4BJ6A 2AWCA 1NG1A 3S28A 1Z63A 2BC5A 3EPVA 1RXQA 2HJ3A 3DMDA 3LUTB 3QZCA 4M63A 4PACA 4U5GA 5COFA 5A6AA 4ZLDA 3JT1A 2OOCA 5KYUB 3B9QA 4X0RA 1J8YF 1TWGA 3QTHA 3V5XA 1ORYA 2J7PA 5E3AA 2HSQA 3PHF2 1L3PA 4MVOA 3RFYA 2HZ8A 2XS8A 5DQZA 1GQAA 4J32B 4NQFA 4EBKA 3RF3A 4MVSA 2LFFA 2QNLA 3SXMA 1M2VA 2Q4FA 1TR2A 3JYHA 4WJ0A 2XL4A 3DAFA 1SF8A 4DXWA 4GEHA 4H54A 4K7BA 4FAPB 3LAYA 4IGGA 2AU5A 3K7DA 2HKVA 1OXBA 1AVOB 1HY5A 3ASOC 2OEXA 3L0IA 4ANJA 1VK5A 3DAGA 2XS1A 3K1HA 4EUKB 5DS5A 1T9KA 3U9MA 5KYXA 3DM5A 4XEFA 3EH1A 4MW8A 4Q5SF 3KH2A 2R7SA 2P61A 1BR2A 1OCOC 4G7OF 4JIOA 3IPMO 4ULWA 2KYHA 1G8XA 3O39A 2HMQA 3IQTA 2EPKX 5A6BD 1Q0FA 2L81A 2J7PD 1JRAA 3QVYA 4JTCB 3WG7C 1WGWA 4D4NA 2WB7A 1LIHA 1BR1A 3AG2C 2YL3A 3QW0A 3B0UX 1H9GA 3W8HA 1GS9A 5L0GA 2DI3A 3E9VA 3RKOF 1V4AA 4KI2A 3Q7GA 4BJ5A 3TULA 3FVYA 1A7EA 3BRJA 4LLEA 2YL1A 4QDLA 1UG7A 4IAOA 4ER9A 3LS1A 1S7ZA 2CDQA 2JD3A 2XL6A 3JZ0A 4PJJA 5JRAA 3GANA 1CGME 4U9DA 3WODF 4G78A 1FAPB 2JPUA 1MMNA 1L7CA 1SZIA 2IXMA 3O10A 3ASNC 3OA1A 4OIQF 2CNWA 1YJGA 1VYIA 3AQBA 5DQTA 3C63A 1VLSA 1EKYA 3TK0A 1E2XA 4HFFB 1WOLA 2YL0A 3E70C 1MMAA 256BA 3CQZA 4JRZA 2R02A 3N0TA 4MVUA 4P9TA 1YZAA 1M2OA 2NSGA 1OXKA 4E17A 4KNVA 1Q0DA 3MBGA 3ATPA 1Y6DA 5EHHA 4XEKA 3K6BA 4JTDB 2YEVA 3A11A 1YYJA 3TOLA 2IOQA 1HW2A 2IXOA 3F47A 3L34A 1NFNA 5E3CA 3CEXA 1LE4A 3QVZA 4J7YA 4OINF 3SXKA 4LDQA 2CCYA 2R25A 2X0CA 1CGNA 3ZWIA 3EH2A 4NTBA 1LE2A 2YKZA 3LLIA 3NKEA 5JSLA 5FZTA 2PX3A 1NSGB 3NYJA 2J9VA 1QLEC 4C3BA 3DXJF 1H7IA 3N2ZB 3ITFA 3NDBB 2XLOA 3FOPA 1H6GA 3BEHA 4DVYP 2OKUA 2H7BA 3RW0A 3AJMA 1ORSC 2VASA 4MVRA 4OIPF 4NC3A 2PNOA 1VLTA 4AE4B
chains in the Genus database with same CATH topology
3H2VA 3MYIA 1T01A 1ST6A 3ZDLA 1U89A 1U6HA 1ZW3A 4K1OA 1ZW2A 4IGGA 5L0HA 3S90A 1L7CA 2L7AA 4ONSA 2IBFA 2X0CA 5L0CA 5L0FA 4DJ9A 2LQGA 1ZVZA 5L0DA 2B0HA 3T6GB 3TJ6A 4W8PA 1XWJA 5FZTA 1RKCA 1YDIA 3VF0A 5L0IA 2GWWA 4P9TA 1H6GA 2GDCA 4E17A 4E18A 3TJ5A 2HSQA 3H2UA 1QKRA 4EHPA 1DOVA 4PR9A 5L0JA 1SYQA 1RKEB 1DOWA 1RKEA 3RF3A 5L0GA 1TR2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H2V A;  3MYI A;  1T01 A;  1ST6 A;  3ZDL A;  1U89 A;  1U6H A;  1ZW3 A;  4K1O A;  1ZW2 A;  4IGG A;  5L0H A;  3S90 A;  1L7C A;  2L7A A;  4ONS A;  2IBF A;  2X0C A;  5L0C A;  5L0F A;  4DJ9 A;  2LQG A;  1ZVZ A;  5L0D A;  2B0H A;  3T6G B;  3TJ6 A;  4W8P A;  1XWJ A;  5FZT A;  1RKC A;  1YDI A;  3VF0 A;  5L0I A;  2GWW A;  4P9T A;  1H6G A;  2GDC A;  4E17 A;  4E18 A;  3TJ5 A;  2HSQ A;  3H2U A;  1QKR A;  4EHP A;  1DOV A;  4PR9 A;  5L0J A;  1SYQ A;  1RKE B;  1DOW A;  1RKE A;  3RF3 A;  5L0G A;  1TR2 A; 
#chains in the Genus database with same CATH topology
 4KBL A;  1G4U S;  4D4X A;  2TMV P;  2EIJ C;  3JTL O;  2O9X A;  5B1B C;  1T6I A;  5KYW A;  1U89 A;  1ZW3 A;  2AP3 A;  3FAP B;  1OW8 A;  2YRF A;  2WL8 A;  2P0N A;  4U9E A;  2D5R B;  2YL7 A;  5AGF A;  2YLI A;  3NYL A;  4GYT A;  1YYX A;  3SNH A;  1TWH A;  5COG A;  5F5H A;  2HV6 A;  3TJ6 A;  3U2M A;  4XEV A;  3DI5 A;  4YJW A;  1ZU5 A;  2R7Q A;  4OD4 A;  2LP4 A;  1FMV A;  3EG9 A;  2A0B A;  2VC9 A;  5KYU A;  3IHU A;  2DYS C;  1HMD A;  2Q9C A;  4MW3 A;  2J0X A;  5IY5 C;  3JSZ A;  3HNK A;  1JOG A;  3I5Q A;  3LJB A;  2J8W A;  4CS8 A;  1XZP A;  4H4K C;  5HV9 A;  2A0U A;  3RH3 A;  4LDK A;  4MTG A;  3RQF A;  4UDV A;  4OIO F;  2MYS A;  1KNY A;  2VCB A;  1D1B A;  1T01 A;  1UFB A;  4Q4Z F;  5A6K A;  3QMK A;  2IXN A;  3M1C B;  2CYD A;  3UNG C;  5L0H A;  4Z9I A;  3S90 A;  1C03 A;  2YLD A;  4NCQ A;  5B1A C;  5A69 A;  3B0P A;  2VCA A;  1GGQ A;  2HSB A;  3G50 A;  4JTA B;  2Y3D A;  3UMK A;  1TFK B;  1O87 A;  2GA0 A;  1ZVZ A;  2FGY A;  1A7D A;  3NRH A;  1LI7 A;  2W9Y A;  3C8Z A;  4BEJ A;  3TD7 A;  1IW7 F;  3CZ6 A;  1D1A A;  1LKX A;  1MMD A;  2XLW A;  4JW1 A;  4IAR A;  4O6Y A;  3VF0 A;  1QVX A;  3OEO A;  4AX2 A;  3SEO A;  5A6J A;  3HJC A;  4JEA A;  1K04 A;  1I4Y A;  5GPG B;  5A6B A;  1OCZ C;  2QUP A;  3AGU A;  3SZR A;  2OJE D;  3AG4 C;  1D0Y A;  2KQ9 A;  3NKD A;  1RJ9 B;  3NYM A;  4HE8 D;  4JCZ A;  2YVK A;  1NLX A;  1D0X A;  3S9O A;  1EI7 A;  2PF4 E;  1QQ3 A;  2YQY A;  3S84 A;  2OEV A;  3M79 A;  4YK5 A;  5TJ5 E;  5DS4 A;  3U8V A;  3ZDL A;  2R05 A;  2P1A A;  2Q3T A;  3EFO B;  3F46 A;  4IWB A;  2P7V A;  4LDR A;  1ZU4 A;  1E83 A;  1Z5Z A;  1TFO B;  4CS9 C;  3U3F A;  2LQG A;  4B6I A;  3VYW A;  1FTS A;  2Q00 A;  4RBN A;  2WZF A;  4CDY A;  3POV A;  2X51 A;  4BG0 A;  1HW1 A;  2KSF A;  2KJG A;  1OQC A;  2B0J A;  1BR4 A;  2I15 A;  2NUP A;  1Z7Q c;  1NU9 C;  3AQC A;  3O6X A;  4U5F E;  1K40 A;  1HE1 A;  1ZYR F;  2ZXR A;  2G3K A;  3JRM O;  1YAR O;  3K1I A;  4EHP A;  3ABM C;  1TQG A;  3DE8 A;  3DJN B;  3NMI A;  4A4A A;  5JLI A;  4C7O B;  4QI2 A;  4N06 A;  3KPH A;  3KYJ A;  3B29 A;  4KNW A;  2W4B A;  4EBJ A;  2R7X A;  4J7T A;  4DRH B;  3Q6N A;  1LS4 A;  3J06 A;  1BBH A;  3X2Q C;  3MYI A;  3AG3 C;  5F5F A;  3L8J A;  4K0D A;  4NY3 A;  3EGX B;  3KKB A;  5BQI A;  2NUT A;  3LNR A;  4JUR I;  1AEP A;  2EPM X;  3EZI A;  4RDA A;  2BE5 F;  4U5H A;  4CSA A;  1A7V A;  4W8P A;  3GEI A;  2D4U A;  3FMS A;  5DS6 A;  3MLG A;  2HJM A;  1WAS A;  5JT4 A;  1W2W A;  3PCV A;  3FOO A;  3LEV A;  4I44 A;  2EPO A;  3W4Y A;  4XLN F;  3DZA A;  1MNE A;  3GOD A;  2J45 A;  3TJ5 A;  1KTM A;  5D91 A;  4CS7 A;  3A9C A;  1ZHZ A;  4IB4 A;  5L0J A;  1M2V B;  4MND A;  4YT2 A;  4EWC A;  1DOW A;  3UMH A;  3UGO A;  2R7V A;  2QTV A;  2C04 A;  1T6Q A;  1D1C A;  3C18 A;  4AE4 A;  3M15 A;  2VH3 A;  3B0V C;  4BJ6 C;  1TKN A;  3DWW A;  1ZHT A;  1K05 A;  1XZQ A;  2JX0 A;  4RD9 A;  3U2L A;  4O6M A;  3RYL A;  4I3M A;  3QW1 A;  2A6H F;  3MX3 A;  4YL1 A;  3VM6 A;  5AC5 A;  3U0C A;  3FDQ A;  3HNJ A;  4E7S A;  1PV3 A;  5KYX B;  5FCL A;  1PD0 A;  2FFH A;  4DBR A;  5L0C A;  2H7O A;  1MMG A;  2UUH A;  1OCC C;  2IXP A;  3S29 A;  1FFT C;  4YL3 A;  2LSE A;  3HTK C;  3Q6M A;  3SYN A;  2V3C C;  1NBB A;  1LI5 A;  5L0I A;  1KU2 A;  3G4Z A;  4DBQ A;  2XXA B;  1YAU O;  2ZD9 A;  4JCH A;  1ORJ A;  3LES A;  4U5B E;  2GDC A;  1HE9 A;  2I8B A;  3RQE A;  3TQO A;  2PBE A;  3V7O A;  2ZPA A;  3C8G A;  3G4X A;  3H2U A;  3UR3 C;  3ZTM A;  1DOV A;  3S27 A;  4PR9 A;  3RIP A;  2VB6 A;  5L3Q A;  4HFK B;  4PJL A;  1RKE B;  2WVO A;  2YLG A;  1ZHY A;  2A6E F;  4WGZ A;  3B71 A;  1RMV A;  1QSP A;  1M6T A;  3JYY A;  5EGY A;  2WVN A;  4CJO A;  2BL2 A;  1SMY F;  3V5Y A;  3LEO A;  4I1M A;  1I5N A;  2MHR A;  3NG1 A;  4NTA A;  1JAF A;  4J30 B;  2ZXP A;  1E85 A;  2ASR A;  1E84 A;  3ABK C;  4DJ9 A;  2A69 F;  4HEA J;  4CJG A;  2UUI A;  1WAT A;  1TWC A;  2Y3G A;  5HSW A;  2EIL C;  2R7U A;  3JCU Q;  4Z9J A;  1Y4C A;  2LCH A;  3C8G D;  3EHN A;  4GQH A;  4BJ5 C;  3KYI A;  3EGD B;  2QY9 A;  3Q7L A;  2LFD A;  2H7V C;  3SXZ A;  1QKR A;  4C3E A;  5T1D B;  5L3V A;  4NTF A;  2ICW G;  5CI9 A;  3O55 A;  2CW0 F;  3IEE A;  2HMZ A;  4P9F A;  3EJN A;  4JKV A;  3H2V A;  2EIK C;  1QZX A;  4DOZ A;  4L6R A;  5DVW A;  3H65 A;  3PMR A;  5JUA A;  1YA7 O;  4JC7 A;  2H8A A;  3ZVR A;  4BPM A;  1BZ4 A;  3GM2 A;  3US6 A;  3W2W A;  3VRC A;  4BJT A;  2J46 A;  2QLA A;  4MVZ A;  2F22 A;  1VB5 A;  3ZIB A;  2J9B A;  3L8I A;  1OKK A;  3T4R A;  3UGP A;  5L0D A;  2V26 A;  3T6G B;  3ECS A;  2C03 A;  3GM3 A;  3U8P A;  3ZC4 A;  5KYN A;  3M4B A;  4WAB A;  1I4Z A;  3WHN A;  2KK1 A;  2R9R B;  1G4W R;  2R7W A;  1ZHX A;  1V74 B;  4DRI B;  5KYY B;  1FMW A;  3GWN A;  2IM8 A;  2XLH A;  3JRT A;  1MND A;  2OQM A;  1PCX A;  1Z6A A;  5D92 A;  3CSK A;  5B3I A;  3ABL C;  1F1M A;  1SYQ A;  4O79 A;  1J8M F;  3I5P A;  4WGY A;  3IQ5 A;  3X1O A;  2A1D D;  1WTY A;  1OW6 A;  2OG2 A;  3SP1 A;  4A2N B;  3T9O A;  4EIY A;  5KYW B;  3EGX A;  3DM9 B;  3NMK A;  3MYF A;  5B3S C;  4XWJ A;  3C7J A;  1OKK D;  2QE9 A;  1EA8 A;  2IBF A;  1VMA A;  3ZTZ A;  4N4W A;  4CBE A;  1HMO A;  2KC3 A;  2L6G A;  5BQH A;  3EG9 B;  4F4B A;  2LD6 A;  1AUE A;  2L6H A;  1Z23 A;  1BDJ B;  2LK4 A;  1WN0 A;  4MTO A;  1MQV A;  2DYR C;  3EZH A;  4DRJ B;  4BJ1 A;  4CDA A;  2HFI A;  1FNT c;  3JSE O;  2YWA A;  1JMW A;  1LM3 B;  2XSE A;  2XLM A;  2ETS A;  1ZZP A;  4PJM A;  2J9U A;  3KL4 A;  5K0I A;  1NU7 D;  2AWY A;  4EKW A;  2EIN C;  1ST6 A;  2EIM C;  3LNM B;  2XLV A;  1YVI A;  3CAX A;  4XLP F;  1M56 C;  2XRH A;  3KMI A;  4XQ1 A;  4XPY A;  1TWA A;  3DKA A;  4LLC A;  1A41 A;  2XL8 A;  1B68 A;  3N24 A;  5E33 A;  3RQG A;  3RVY A;  4I1O B;  1NFO A;  2M64 A;  3DJU B;  4IJJ A;  3V5Z A;  2L9J A;  1FFH A;  5T3T A;  1M57 C;  2KW3 C;  1XWJ A;  3AG1 C;  4ZLC A;  4CS8 C;  2EPL X;  1RKC A;  3LS0 A;  2R7R A;  4XTK A;  3AOU A;  1Q0M A;  2GWW A;  4FX5 A;  4DVZ A;  3HNL A;  2XXA A;  1A0B A;  3ZQV A;  4U5C E;  4E7Z A;  4FWV A;  5COM A;  2GAQ A;  3K33 A;  1APC A;  1VTM P;  3IQ6 A;  1Z3I X;  2FAP B;  3NMJ A;  2XM4 A;  2ZXO A;  5F28 E;  1RKE A;  1S05 A;  1EQ1 A;  3HNI A;  4E0H A;  2AVK A;  4CIP A;  4QI0 A;  4O6N A;  1E86 A;  2W4M A;  1PD1 A;  1JPJ A;  4AK9 A;  2Y69 C;  5JS5 A;  3W8I A;  4PFO A;  1Q0K A;  1R5I D;  3M4C A;  3SXY A;  1YLM A;  4PK4 A;  2PFD A;  4ONS A;  4JEB A;  4JE9 A;  4O7G A;  4CDV A;  4EBB A;  1FR0 A;  1JR8 A;  1N1C A;  1IZM A;  2B0H A;  3C62 A;  1T6U A;  1OR2 A;  4YN0 B;  2E87 A;  5BUO A;  1R4T A;  3ZG1 A;  1CPQ A;  2NUP B;  4MQ9 F;  2HV7 A;  3GEE A;  1VOM A;  3ZQY A;  2RD9 A;  4JZA A;  2MWQ A;  2KNH A;  3EQL F;  2Q7R A;  2WVQ A;  3FHD A;  4XPX A;  3EGD A;  5EK0 A;  2Z15 A;  3EHM A;  1LS1 A;  4MVM A;  2R7O A;  1O3U A;  4U5D E;  4U5E E;  1H9T A;  4LER A;  2OCC C;  4G7H F;  2Y39 A;  1YA9 A;  4OIR F;  4MS2 A;  1WWP A;  2CGE A;  2IYL D;  2NUT B;  2G3V A;  3U5S A;  4C3D A;  5CIV A;  1OR3 A;  2VCC A;  2HS5 A;  1U6H A;  2Q9A A;  3AGT A;  4IAQ A;  1NZE A;  3TOM A;  2CNW D;  4YWQ A;  2ZXW C;  5JP7 A;  2L7A A;  4YT8 A;  5CI8 A;  3HKK A;  5L0F A;  2XLE A;  2YZS A;  3DD7 A;  1U0B B;  2Y3B A;  2XLD A;  3K1I C;  3R2P A;  4PJN A;  4BEM J;  4AL0 A;  2A68 F;  1V54 C;  1YDI A;  1LPE A;  2NG1 A;  1VYK A;  1LVK A;  3GOR A;  3GWL A;  3OWT A;  3R7C A;  4JVS A;  2M4E A;  5KYY A;  4CS9 A;  2YHS A;  4IRU A;  5E2Q A;  3L1M A;  4E0I A;  2EPN A;  4YT4 A;  2KGO A;  4R32 A;  4N6H A;  4Q7C A;  4G7Z F;  3FAJ A;  2J9W A;  3GEH A;  3MFN A;  4YT5 A;  4P6I C;  2RSE B;  3UMI A;  1RJ9 A;  1YZC A;  5AC4 A;  5BQG A;  3HLZ A;  2Y3H A;  3W2V A;  2DGJ A;  4CSA C;  3WAQ A;  4W8K A;  1G5Z A;  4CIH A;  4N6C A;  4XPW A;  4G0H A;  1JPN A;  1GM5 A;  2HUJ A;  3U9J A;  1C17 M;  2J0W A;  2R03 A;  1O5H A;  1OCR C;  1V55 C;  3EFO A;  2WZL A;  3RVZ A;  3PDM P;  1OW7 A;  2OJQ A;  1SR2 A;  2NSF A;  3ZSU A;  2W45 A;  4Z9H A;  5T3W A;  5JVE A;  1Q0G A;  2PX0 A;  4YL0 A;  3LLK A;  1C02 A;  2P6V A;  1ZHW A;  2WZG A;  3I4U A;  3T6J A;  3T6B A;  3IQC A;  4FES A;  3C8G B;  3K66 A;  4E18 A;  2R7T A;  3FXH A;  1CPR A;  2LIG A;  4MVQ A;  4CX9 A;  5DLJ A;  4AL1 A;  1RCP A;  4ULV A;  1T5O A;  2L6F A;  1D0Z A;  2GFH A;  2XM0 A;  4LAC B;  1CGO A;  1QPU A;  4KC9 A;  4C7O A;  3S0X A;  3VAY A;  3U3B A;  2G62 A;  4K1O A;  1ZW2 A;  4MTF A;  4OD5 A;  4PFP A;  2PP4 A;  2Q9B A;  2NPU A;  2OU6 A;  3GM1 A;  2DB4 A;  3DE9 A;  4JJG A;  4JJF A;  4BJ6 A;  2AWC A;  1NG1 A;  3S28 A;  1Z63 A;  2BC5 A;  3EPV A;  1RXQ A;  2HJ3 A;  3DMD A;  3LUT B;  3QZC A;  4M63 A;  4PAC A;  4U5G A;  5COF A;  5A6A A;  4ZLD A;  3JT1 A;  2OOC A;  5KYU B;  3B9Q A;  4X0R A;  1J8Y F;  1TWG A;  3QTH A;  3V5X A;  1ORY A;  2J7P A;  5E3A A;  2HSQ A;  3PHF 2;  1L3P A;  4MVO A;  3RFY A;  2HZ8 A;  2XS8 A;  5DQZ A;  1GQA A;  4J32 B;  4NQF A;  4EBK A;  3RF3 A;  4MVS A;  2LFF A;  2QNL A;  3SXM A;  1M2V A;  2Q4F A;  1TR2 A;  3JYH A;  4WJ0 A;  2XL4 A;  3DAF A;  1SF8 A;  4DXW A;  4GEH A;  4H54 A;  4K7B A;  4FAP B;  3LAY A;  4IGG A;  2AU5 A;  3K7D A;  2HKV A;  1OXB A;  1AVO B;  1HY5 A;  3ASO C;  2OEX A;  3L0I A;  4ANJ A;  1VK5 A;  3DAG A;  2XS1 A;  3K1H A;  4EUK B;  5DS5 A;  1T9K A;  3U9M A;  5KYX A;  3DM5 A;  4XEF A;  3EH1 A;  4MW8 A;  4Q5S F;  3KH2 A;  2R7S A;  2P61 A;  1BR2 A;  1OCO C;  4G7O F;  4JIO A;  3IPM O;  4ULW A;  2KYH A;  1G8X A;  3O39 A;  2HMQ A;  3IQT A;  2EPK X;  5A6B D;  1Q0F A;  2L81 A;  2J7P D;  1JRA A;  3QVY A;  4JTC B;  3WG7 C;  1WGW A;  4D4N A;  2WB7 A;  1LIH A;  1BR1 A;  3AG2 C;  2YL3 A;  3QW0 A;  3B0U X;  1H9G A;  3W8H A;  1GS9 A;  5L0G A;  2DI3 A;  3E9V A;  3RKO F;  1V4A A;  4KI2 A;  3Q7G A;  4BJ5 A;  3TUL A;  3FVY A;  1A7E A;  3BRJ A;  4LLE A;  2YL1 A;  4QDL A;  1UG7 A;  4IAO A;  4ER9 A;  3LS1 A;  1S7Z A;  2CDQ A;  2JD3 A;  2XL6 A;  3JZ0 A;  4PJJ A;  5JRA A;  3GAN A;  1CGM E;  4U9D A;  3WOD F;  4G78 A;  1FAP B;  2JPU A;  1MMN A;  1L7C A;  1SZI A;  2IXM A;  3O10 A;  3ASN C;  3OA1 A;  4OIQ F;  2CNW A;  1YJG A;  1VYI A;  3AQB A;  5DQT A;  3C63 A;  1VLS A;  1EKY A;  3TK0 A;  1E2X A;  4HFF B;  1WOL A;  2YL0 A;  3E70 C;  1MMA A;  256B A;  3CQZ A;  4JRZ A;  2R02 A;  3N0T A;  4MVU A;  4P9T A;  1YZA A;  1M2O A;  2NSG A;  1OXK A;  4E17 A;  4KNV A;  1Q0D A;  3MBG A;  3ATP A;  1Y6D A;  5EHH A;  4XEK A;  3K6B A;  4JTD B;  2YEV A;  3A11 A;  1YYJ A;  3TOL A;  2IOQ A;  1HW2 A;  2IXO A;  3F47 A;  3L34 A;  1NFN A;  5E3C A;  3CEX A;  1LE4 A;  3QVZ A;  4J7Y A;  4OIN F;  3SXK A;  4LDQ A;  2CCY A;  2R25 A;  2X0C A;  1CGN A;  3ZWI A;  3EH2 A;  4NTB A;  1LE2 A;  2YKZ A;  3LLI A;  3NKE A;  5JSL A;  5FZT A;  2PX3 A;  1NSG B;  3NYJ A;  2J9V A;  1QLE C;  4C3B A;  3DXJ F;  1H7I A;  3N2Z B;  3ITF A;  3NDB B;  2XLO A;  3FOP A;  1H6G A;  3BEH A;  4DVY P;  2OKU A;  2H7B A;  3RW0 A;  3AJM A;  1ORS C;  2VAS A;  4MVR A;  4OIP F;  4NC3 A;  2PNO A;  1VLT A;  4AE4 B; 
#chains in the Genus database with same CATH homology
 3H2V A;  3MYI A;  1T01 A;  1ST6 A;  3ZDL A;  1U89 A;  1U6H A;  1ZW3 A;  4K1O A;  1ZW2 A;  4IGG A;  5L0H A;  3S90 A;  1L7C A;  2L7A A;  4ONS A;  2IBF A;  2X0C A;  5L0C A;  5L0F A;  4DJ9 A;  2LQG A;  1ZVZ A;  5L0D A;  2B0H A;  3T6G B;  3TJ6 A;  4W8P A;  1XWJ A;  5FZT A;  1RKC A;  1YDI A;  3VF0 A;  5L0I A;  2GWW A;  4P9T A;  1H6G A;  2GDC A;  4E17 A;  4E18 A;  3TJ5 A;  2HSQ A;  3H2U A;  1QKR A;  4EHP A;  1DOV A;  4PR9 A;  5L0J A;  1SYQ A;  1RKE B;  1DOW A;  1RKE A;  3RF3 A;  5L0G A;  1TR2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...