3RF3A

Shigella ipaa-vbs3 in complex with human vinculin
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
257
structure length
257
Chain Sequence
b'PVFHTRTIESILEPVAQQISHLVIMHEEGEVDGKAIPDLTAPVAAVQAAVSNLVRVGKETVQTTEDQILKRDMPPAFIKVENACTKLVQAAQMLQSDPYSVPARDYLIDGSRGILSGTSDLLLTFDEAEVRKIIRVCKGILEYLTVAEVVETMEDLVTYTKNLGPGMTKMAKMIDERQQELTHQEHRVMLVNSMNTVKELLPVLISAMKIFVTTKNSKNQGIEEALKNRNFTVEKMSAEINEIIRVLQLTSWDEDAW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Vinculin
molecule tags Protein binding/toxin
source organism Homo sapiens
publication title Novel vinculin binding site of the IpaA invasin of Shigella.
pubmed doi rcsb
total genus 116
structure length 257
sequence length 257
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-04-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 3rf3A02
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 3rf3A01
1RKEB 3TJ6A 3MYIA 1ST6A 2X0CA 3ZDLA 1ZW2A 4DJ9A 5L0JA 2GWWA 5L0GA 4PR9A 4EHPA 1DOWA 1T01A 2B0HA 3T6GB 4E18A 1DOVA 1YDIA 2GDCA 4P9TA 4E17A 1RKEA 1L7CA 1XWJA 1U6HA 2L7AA 4K1OA 3H2VA 1H6GA 4IGGA 4ONSA 5L0DA 5FZTA 3VF0A 3TJ5A 1TR2A 1ZW3A 1U89A 3RF3A 5L0IA 1QKRA 3H2UA 2HSQA 4W8PA 5L0FA 5L0CA 1SYQA 2IBFA 1RKCA 3S90A 1ZVZA 2LQGA 5L0HA
chains in the Genus database with same CATH superfamily
1AUEA 1YLMA 4WGYA 4IARA 1O5HA 4BEJA 4QDLA 1ZU4A 4BPMA 1D1AA 1T6IA 4JTAB 4OD5A 3SXMA 5JRAA 1PD0A 5KYXA 2HMZA 2HFIA 1DOWA 3K6BA 3VYWA 3ZTZA 3U5SA 2C04A 3JZ0A 3AG1C 4E17A 1K40A 3RQEA 5AC5A 2XLEA 3GM1A 2P6VA 3MX3A 3M1CB 1VLSA 3O39A 1OCCC 1GS9A 2IM8A 1RJ9B 1WASA 2IOQA 2X51A 2QNLA 2ZXWC 3MYFA 3NYMA 2QE9A 4JZAA 4RD9A 1VOMA 3X1OA 2VCAA 3AG3C 1XZQA 4E7ZA 3HLZA 1LPEA 3MBGA 1UG7A 5L3QA 4N6HA 1ZHYA 2EIKC 3AQCA 1LM3B 5D91A 4MVMA 3TJ5A 4EIYA 2WZLA 5L3VA 4HFKB 4U9DA 1WN0A 4FESA 2L6GA 2EPLX 2LP4A 1NG1A 4KNVA 4I3MA 4MVSA 3IQCA 4WABA 2CW0F 1YYJA 2J45A 2OEXA 4O79A 1M57C 2J9UA 5DQZA 5KYWB 2KYHA 1BR1A 3G4ZA 3B29A 5KYXB 3EHMA 3KKBA 1GM5A 1YAUO 2UUHA 4XPYA 3VM6A 4E0HA 3A9CA 1H7IA 2R05A 3ITFA 1ZHTA 3K66A 4PK4A 4WGZA 5T3WA 5JSLA 3KPHA 2DB4A 1NZEA 2XS1A 1T01A 2G62A 3DM5A 3I5PA 4PJLA 1PCXA 3NMJA 1APCA 1YDIA 4GYTA 3EGXA 1PD1A 1WGWA 4YWQA 2R7UA 2IXNA 2CCYA 2D5RB 1XWJA 3M15A 1U6HA 1E84A 3JYYA 2NSGA 3U9JA 5JVEA 4U5CE 4ULWA 3OEOA 4BJ6C 2A68F 1CPQA 3E9VA 4CS8C 1FNTc 1SR2A 4N06A 2YVKA 3N24A 4O6YA 4OINF 5BQIA 4WJ0A 1M2VB 4DOZA 1OCRC 2YLIA 5CIVA 5D92A 2VC9A 5JT4A 2AP3A 4C7OB 4G7HF 1YJGA 2Q00A 3BEHA 4XLNF 3TJ6A 2P7VA 3QW0A 4MVZA 3US6A 2YL0A 3ZVRA 1WATA 3NYLA 2NUTA 3RVYA 3TULA 1NSGB 3EHNA 4N4WA 4XEKA 2WL8A 5A6KA 1A0BA 1L3PA 4BJTA 4I1OB 1Y6DA 4MS2A 4DVZA 2J9BA 4YL3A 3GWNA 3ABKC 1PV3A 1VMAA 2YEVA 3F46A 1TFKB 3AG2C 4BJ5C 5CI8A 4ZLDA 2R7RA 2VCBA 5JUAA 1EQ1A 3VF0A 1OXKA 2XL8A 1K04A 4XQ1A 4RDAA 1JOGA 1EKYA 2XLMA 1G8XA 5T1DB 4RBNA 2JPUA 1G4US 3DZAA 4NTFA 1MMGA 3LUTB 3RW0A 3TOLA 4Z9HA 4U9EA 2NUTB 4U5DE 1NFOA 2J9WA 2NPUA 2QLAA 1A7EA 4U5HA 2ZD9A 3FVYA 4OIRF 4LLEA 1M2VA 4XWJA 2J7PA 4JURI 3ZDLA 2TMVP 2H7OA 4XLPF 1FR0A 1OQCA 3DJUB 2I8BA 3N2ZB 2LFDA 2XL4A 5A6JA 3U0CA 3O55A 3X2QC 5DS5A 1LS4A 4DRHB 3QVZA 1HW2A 4Q7CA 2HZ8A 3UGOA 3PCVA 1OKKA 3WODF 4IGGA 5E3AA 3RFYA 4C7OA 5FZTA 2F22A 3EJNA 4J7TA 4CDAA 2ZXOA 4EWCA 2AVKA 2AWCA 3I4UA 1YVIA 2WZGA 4GQHA 1ZYRF 4OD4A 5L0IA 2WVOA 2EIMC 4YK5A 3UMIA 5A6BA 4OIQF 4BG0A 3S84A 2Z15A 4DRJB 1VTMP 2L81A 3EFOA 3RQFA 2A0BA 2YL7A 2R7QA 1T6UA 3C8ZA 3HKKA 3NDBB 1MQVA 1RKEB 2IXOA 5HV9A 4XTKA 1NFNA 3U9MA 3EG9B 1KNYA 4PFPA 2L9JA 4PR9A 3CQZA 3IPMO 2KQ9A 2W9YA 4JJGA 1LVKA 1ORYA 1Q0GA 2HJMA 3EGDA 4BEMJ 1RJ9A 5COGA 1QQ3A 4MW3A 3SYNA 3T4RA 4BJ5A 4DBRA 1L7CA 4E7SA 2ICWG 3BRJA 1D0ZA 2PF4E 2FGYA 5DLJA 4PJNA 4IB4A 1CGNA 4UDVA 3HJCA 1NLXA 1O87A 1E83A 2A69F 2HV7A 4NTAA 3Q7GA 2OQMA 3CSKA 4NY3A 1OW6A 2LK4A 1Q0MA 4LDQA 2XLDA 1BDJB 1E85A 3AQBA 2LD6A 3JSEO 1K05A 2KW3C 4U5EE 4XEFA 2NUPB 5K0IA 3EGXB 4B6IA 3U2LA 3O10A 3DM9B 1LE4A 4YT2A 2J46A 2WB7A 1FTSA 4J7YA 4O7GA 4F4BA 4JKVA 5FCLA 4A4AA 1M56C 2M4EA 3AOUA 2R7SA 3U8VA 3Q7LA 2OG2A 3H2VA 3NMKA 2KJGA 4K1OA 3WG7C 3PDMP 4PJJA 1QVXA 3EGDB 3C62A 4JJFA 2Q7RA 3OWTA 4A2NB 3DMDA 5B3IA 1Z6AA 5F5HA 4G78A 3ZC4A 4JTCB 3H65A 3AG4C 5A6AA 1RKCA 3GEHA 2LQGA 4AE4A 4LACB 1TWCA 2PX0A 3LS0A 2R7VA 3DJNB 2W4BA 1F1MA 3JCUQ 2FFHA 1R5ID 4K7BA 4ZLCA 5KYYA 1Z23A 2I15A 1UFBA 4YN0B 2OU6A 4U5GA 2R03A 2Q9AA 3ZQVA 1DOVA 2MHRA 1O3UA 2DGJA 3O6XA 3JRTA 4LERA 3PHF2 2M64A 3K1HA 3GM2A 1A7VA 4AX2A 3LNMB 4KBLA 4CS9A 3S28A 2XSEA 2HKVA 1VLTA 2Y3DA 3KYIA 1M2OA 2PNOA 1YZAA 4XPXA 3A11A 3DKAA 1YA7O 3W4YA 3JTLO 4ULVA 2E87A 3WHNA 3KH2A 4G0HA 1TWHA 2XRHA 4AE4B 1OCOC 2XS8A 3ZTMA 4ER9A 2MYSA 3GORA 1OR2A 4LDRA 3S90A 2XLHA 3KL4A 3F47A 2KSFA 5L0HA 2YL1A 5JLIA 3FMSA 4IRUA 4HEAJ 3EZHA 4PACA 1QLEC 3MFNA 1ZW2A 1GGQA 3G50A 1HE9A 2ASRA 2Y3GA 2GWWA 3LEVA 4EBKA 3RKOF 4MVOA 3SP1A 2DYRC 2DI3A 3ECSA 2YWAA 3NKEA 3SEOA 1JR8A 2R02A 3E70C 2A6HF 3W8IA 4BJ1A 4FX5A 1KTMA 1W2WA 2YL3A 3HNJA 4AK9A 3C63A 3T6BA 4YL0A 2WVNA 3TK0A 5EGYA 1J8MF 1H6GA 2P61A 3FXHA 3HNIA 3C7JA 2IXPA 3M4BA 5AGFA 1C17M 3IQTA 3K1IC 1JMWA 2ZPAA 3RVZA 3ZG1A 1WTYA 1XZPA 2PBEA 2HUJA 3GEEA 2CGEA 4IAOA 4CX9A 1NBBA 2MWQA 2NG1A 3GWLA 3IQ6A 2A1DD 3L8JA 1MNDA 3HNKA 1SZIA 2HV6A 2J7PD 5EK0A 2X0CA 1Q0DA 5BQHA 2R7XA 2Y3BA 3CZ6A 3U8PA 2L6FA 3V5XA 1A7DA 4MVQA 2BE5F 4C3BA 5L0GA 2R7TA 3EPVA 3T6GB 1YARO 4KI2A 2J9VA 4QI0A 1C02A 3EH1A 3T9OA 1Q0FA 3Q6MA 1QPUA 3Q6NA 3EZIA 2CDQA 2W4MA 1OKKD 2H7VC 2L7AA 1I4YA 4HFFB 2H7BA 1MMAA 4R32A 4CJGA 1Q0KA 4YL1A 3RQGA 2HSBA 1ZW3A 4JVSA 2ZXRA 2LFFA 2XL6A 3SZRA 3PMRA 3ASOC 2XLVA 1V54C 2P1AA 3JRMO 3ZIBA 1YYXA 4DRIB 1ZVZA 3KYJA 3S27A 4AL0A 3ZSUA 4FAPB 2Y3HA 5DQTA 1S05A 3G4XA 1ST6A 1Z3IX 3ASNC 5L0JA 2EIJC 3GODA 3HNLA 3B0PA 4P9FA 5T3TA 4EHPA 4G7OF 2D4UA 4I44A 5KYUB 2OKUA 2HMQA 3C18A 1RXQA 1YZCA 4DXWA 2EPOA 1IZMA 4D4XA 3M4CA 2ZXPA 4PFOA 4Z9IA 2Q9BA 1HMOA 1T6QA 3DAFA 3W2VA 3DWWA 4MVRA 2QUPA 3LJBA 2JD3A 3JSZA 2KGOA 1D1CA 1ORSC 1CGME 2A0UA 1M6TA 3FHDA 5A69A 4CJOA 4O6MA 3RF3A 1TWGA 2LIGA 2HSQA 5B1AC 1SMYF 4Z9JA 2OJQA 2QY9A 2J0XA 4CDVA 1HY5A 2C03A 4EUKB 3NRHA 2WVQA 4IAQA 1HE1A 1QSPA 4J30B 4YT8A 5BUOA 3GM3A 3QZCA 4OIOF 1D0XA 2R7WA 2HJ3A 4JEBA 4MTOA 3I5QA 1Z63A 4AL1A 1D1BA 4LLCA 1NU9C 1ORJA 3JT1A 4EKWA 4U5FE 1SF8A 2LCHA 2YLDA 4P9TA 4IWBA 1TWAA 4MTFA 4U5BE 2V26A 1A41A 4XEVA 5TJ5E 4DVYP 5L0DA 1TQGA 1FFHA 1V55C 1CPRA 3VRCA 3GEIA 3V5ZA 1ZZPA 5COFA 2FAPB 1QZXA 2VH3A 3DD7A 1H9GA 3UMHA 4YJWA 4C3EA 3RIPA 2V3CC 3RYLA 1IW7F 3AGUA 3H2UA 3CEXA 1E86A 1HMDA 4JCHA 2WZFA 3SNHA 4JW1A 2Q9CA 4FWVA 5COMA 3S9OA 2HS5A 1G4WR 3GANA 4HE8D 1LI7A 2YQYA 4JE9A 2KK1A 4ONSA 3ZWIA 4G7ZF 3ZQYA 4GEHA 1RMVA 3K1IA 4CSAC 1OW7A 2B0HA 4Q5SF 3SXKA 3NYJA 2GDCA 5DVWA 3U3FA 4Q4ZF 4JTDB 3POVA 1EI7A 4X0RA 3L8IA 3B9QA 1R4TA 3AGTA 1BR4A 4NTBA 1ZHZA 3QTHA 3CAXA 4QI2A 3DE8A 3UNGC 2YRFA 3ABLC 2IYLD 3QVYA 3TQOA 2EINC 1V74B 2L6HA 1FFTC 3L34A 5EHHA 2R25A 5L0CA 1LE2A 2RD9A 3L1MA 2XXAB 1H9TA 4MQ9F 2GAQA 4NQFA 2AU5A 1MMDA 5JP7A 1S7ZA 4YT5A 3MYIA 2PX3A 1EA8A 1T9KA 2CYDA 2EPMX 5HSWA 3EH2A 1KU2A 2LSEA 4N6CA 3QW1A 3UMKA 2DYSC 4NCQA 3DE9A 2ETSA 3LESA 1C03A 4J32B 5F28E 4IJJA 2G3KA 2EPKX 3K33A 4ANJA 4CIHA 4CS9C 3FAPB 4H4KC 3W2WA 5DS4A 1E2XA 3V7OA 5E2QA 4W8KA 2BL2A 5KYWA 1I4ZA 1TR2A 3FOPA 1ZHXA 4E0IA 4CIPA 1U0BB 2OEVA 1QKRA 3RH3A 3L0IA 3B0VC 4XPWA 2JX0A 1JPJA 1WOLA 2GFHA 4O6NA 3AJMA 1CGOA 3B0UX 5F5FA 1OW8A 4D4NA 2Q3TA 3IHUA 1LKXA 5KYUA 4L6RA 2XLOA 4CSAA 3B71A 4BJ6A 5GPGB 2AWYA 4CS8A 1FMVA 2XM0A 1BZ4A 4P6IC 1ZU5A 2J0WA 5IY5C 3FDQA 1OXBA 2CNWA 1LI5A 3EFOB 4DBQA 3ABMC 4MTGA 1J8YF 1MNEA 4MNDA 4K0DA 1RKEA 4NC3A 4CBEA 1TKNA 4OIPF 1Z7Qc 3FOOA 2Y39A 3S0XA 3DAGA 1RCPA 3LS1A 2PP4A 4C3DA 1NU7D 3C8GD 3LLIA 2RSEB 1MMNA 1U89A 5E3CA 3V5YA 256BA 4JCZA 2XM4A 5B3SC 3R2PA 2XLWA 1SYQA 2O9XA 4MW8A 4PJMA 1BR2A 3S29A 3W8HA 2UUIA 3R7CA 3J06A 5KYYB 5KYNA 1G5ZA 2EPNA 2NSFA 2GA0A 3DXJF 2A6EF 1I5NA 3UR3C 2VASA 1ZHWA 3N0TA 1YA9A 1T5OA 2CNWD 2XXAA 2VB6A 3HTKC 3ATPA 1Y4CA 3LNRA 4KNWA 3NKDA 3TD7A 3KMIA 3LEOA 1VYKA 1AEPA 4JC7A 1JRAA 2R9RB 1FAPB 2YKZA 3NG1A 3EG9A 3OA1A 5DS6A 4H54A 3TOMA 3U2MA 5BQGA 1BBHA 2KC3A 3C8GA 1OR3A 4EBBA 2NUPA 1N1CA 4W8PA 3SXZA 1JAFA 1FMWA 5A6BD 2J8WA 1LIHA 1JPNA 2YHSA 1D0YA 3C8GB 4LDKA 2W45A 4CS7A 3SXYA 5JS5A 4KC9A 2YLGA 1Z5ZA 3M79A 1GQAA 3LAYA 4YT4A 2R7OA 2IXMA 2P0NA 1LS1A 3DI5A 2PFDA 3K7DA 3LLKA 1VB5A 4JEAA 4JIOA 4DJ9A 2H8AA 4JRZA 3UGPA 1HW1A 3IEEA 4E18A 3FAJA 1TFOB 2OOCA 2Q4FA 3T6JA 1OCZC 3EQLF 4MVUA 3JYHA 3QMKA 1V4AA 2OCCC 2VCCA 2YZSA 2QTVA 3NMIA 1WWPA 4I1MA 5CI9A 5AC4A 2BC5A 3MLGA 2G3VA 1AVOB 1VK5A 2Y69C 4EBJA 1VYIA 3IQ5A 1B68A 2OJED 5B1BC 3U3BA 4CDYA 5E33A 5L0FA 3VAYA 2IBFA 3WAQA 4M63A 2B0JA 2EILC 2KNHA
chains in the Genus database with same CATH topology
1RKEB 3TJ6A 3MYIA 1ST6A 2X0CA 3ZDLA 1ZW2A 4DJ9A 5L0JA 2GWWA 5L0GA 4PR9A 4EHPA 1DOWA 1T01A 2B0HA 3T6GB 4E18A 1DOVA 1YDIA 2GDCA 4P9TA 4E17A 1RKEA 1L7CA 1XWJA 1U6HA 2L7AA 4K1OA 3H2VA 1H6GA 4IGGA 4ONSA 5L0DA 5FZTA 3VF0A 3TJ5A 1TR2A 1ZW3A 1U89A 3RF3A 5L0IA 1QKRA 3H2UA 2HSQA 4W8PA 5L0FA 5L0CA 1SYQA 2IBFA 1RKCA 3S90A 1ZVZA 2LQGA 5L0HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RKE B;  3TJ6 A;  3MYI A;  1ST6 A;  2X0C A;  3ZDL A;  1ZW2 A;  4DJ9 A;  5L0J A;  2GWW A;  5L0G A;  4PR9 A;  4EHP A;  1DOW A;  1T01 A;  2B0H A;  3T6G B;  4E18 A;  1DOV A;  1YDI A;  2GDC A;  4P9T A;  4E17 A;  1RKE A;  1L7C A;  1XWJ A;  1U6H A;  2L7A A;  4K1O A;  3H2V A;  1H6G A;  4IGG A;  4ONS A;  5L0D A;  5FZT A;  3VF0 A;  3TJ5 A;  1TR2 A;  1ZW3 A;  1U89 A;  3RF3 A;  5L0I A;  1QKR A;  3H2U A;  2HSQ A;  4W8P A;  5L0F A;  5L0C A;  1SYQ A;  2IBF A;  1RKC A;  3S90 A;  1ZVZ A;  2LQG A;  5L0H A; 
#chains in the Genus database with same CATH topology
 1AUE A;  1YLM A;  4WGY A;  4IAR A;  1O5H A;  4BEJ A;  4QDL A;  1ZU4 A;  4BPM A;  1D1A A;  1T6I A;  4JTA B;  4OD5 A;  3SXM A;  5JRA A;  1PD0 A;  5KYX A;  2HMZ A;  2HFI A;  1DOW A;  3K6B A;  3VYW A;  3ZTZ A;  3U5S A;  2C04 A;  3JZ0 A;  3AG1 C;  4E17 A;  1K40 A;  3RQE A;  5AC5 A;  2XLE A;  3GM1 A;  2P6V A;  3MX3 A;  3M1C B;  1VLS A;  3O39 A;  1OCC C;  1GS9 A;  2IM8 A;  1RJ9 B;  1WAS A;  2IOQ A;  2X51 A;  2QNL A;  2ZXW C;  3MYF A;  3NYM A;  2QE9 A;  4JZA A;  4RD9 A;  1VOM A;  3X1O A;  2VCA A;  3AG3 C;  1XZQ A;  4E7Z A;  3HLZ A;  1LPE A;  3MBG A;  1UG7 A;  5L3Q A;  4N6H A;  1ZHY A;  2EIK C;  3AQC A;  1LM3 B;  5D91 A;  4MVM A;  3TJ5 A;  4EIY A;  2WZL A;  5L3V A;  4HFK B;  4U9D A;  1WN0 A;  4FES A;  2L6G A;  2EPL X;  2LP4 A;  1NG1 A;  4KNV A;  4I3M A;  4MVS A;  3IQC A;  4WAB A;  2CW0 F;  1YYJ A;  2J45 A;  2OEX A;  4O79 A;  1M57 C;  2J9U A;  5DQZ A;  5KYW B;  2KYH A;  1BR1 A;  3G4Z A;  3B29 A;  5KYX B;  3EHM A;  3KKB A;  1GM5 A;  1YAU O;  2UUH A;  4XPY A;  3VM6 A;  4E0H A;  3A9C A;  1H7I A;  2R05 A;  3ITF A;  1ZHT A;  3K66 A;  4PK4 A;  4WGZ A;  5T3W A;  5JSL A;  3KPH A;  2DB4 A;  1NZE A;  2XS1 A;  1T01 A;  2G62 A;  3DM5 A;  3I5P A;  4PJL A;  1PCX A;  3NMJ A;  1APC A;  1YDI A;  4GYT A;  3EGX A;  1PD1 A;  1WGW A;  4YWQ A;  2R7U A;  2IXN A;  2CCY A;  2D5R B;  1XWJ A;  3M15 A;  1U6H A;  1E84 A;  3JYY A;  2NSG A;  3U9J A;  5JVE A;  4U5C E;  4ULW A;  3OEO A;  4BJ6 C;  2A68 F;  1CPQ A;  3E9V A;  4CS8 C;  1FNT c;  1SR2 A;  4N06 A;  2YVK A;  3N24 A;  4O6Y A;  4OIN F;  5BQI A;  4WJ0 A;  1M2V B;  4DOZ A;  1OCR C;  2YLI A;  5CIV A;  5D92 A;  2VC9 A;  5JT4 A;  2AP3 A;  4C7O B;  4G7H F;  1YJG A;  2Q00 A;  3BEH A;  4XLN F;  3TJ6 A;  2P7V A;  3QW0 A;  4MVZ A;  3US6 A;  2YL0 A;  3ZVR A;  1WAT A;  3NYL A;  2NUT A;  3RVY A;  3TUL A;  1NSG B;  3EHN A;  4N4W A;  4XEK A;  2WL8 A;  5A6K A;  1A0B A;  1L3P A;  4BJT A;  4I1O B;  1Y6D A;  4MS2 A;  4DVZ A;  2J9B A;  4YL3 A;  3GWN A;  3ABK C;  1PV3 A;  1VMA A;  2YEV A;  3F46 A;  1TFK B;  3AG2 C;  4BJ5 C;  5CI8 A;  4ZLD A;  2R7R A;  2VCB A;  5JUA A;  1EQ1 A;  3VF0 A;  1OXK A;  2XL8 A;  1K04 A;  4XQ1 A;  4RDA A;  1JOG A;  1EKY A;  2XLM A;  1G8X A;  5T1D B;  4RBN A;  2JPU A;  1G4U S;  3DZA A;  4NTF A;  1MMG A;  3LUT B;  3RW0 A;  3TOL A;  4Z9H A;  4U9E A;  2NUT B;  4U5D E;  1NFO A;  2J9W A;  2NPU A;  2QLA A;  1A7E A;  4U5H A;  2ZD9 A;  3FVY A;  4OIR F;  4LLE A;  1M2V A;  4XWJ A;  2J7P A;  4JUR I;  3ZDL A;  2TMV P;  2H7O A;  4XLP F;  1FR0 A;  1OQC A;  3DJU B;  2I8B A;  3N2Z B;  2LFD A;  2XL4 A;  5A6J A;  3U0C A;  3O55 A;  3X2Q C;  5DS5 A;  1LS4 A;  4DRH B;  3QVZ A;  1HW2 A;  4Q7C A;  2HZ8 A;  3UGO A;  3PCV A;  1OKK A;  3WOD F;  4IGG A;  5E3A A;  3RFY A;  4C7O A;  5FZT A;  2F22 A;  3EJN A;  4J7T A;  4CDA A;  2ZXO A;  4EWC A;  2AVK A;  2AWC A;  3I4U A;  1YVI A;  2WZG A;  4GQH A;  1ZYR F;  4OD4 A;  5L0I A;  2WVO A;  2EIM C;  4YK5 A;  3UMI A;  5A6B A;  4OIQ F;  4BG0 A;  3S84 A;  2Z15 A;  4DRJ B;  1VTM P;  2L81 A;  3EFO A;  3RQF A;  2A0B A;  2YL7 A;  2R7Q A;  1T6U A;  3C8Z A;  3HKK A;  3NDB B;  1MQV A;  1RKE B;  2IXO A;  5HV9 A;  4XTK A;  1NFN A;  3U9M A;  3EG9 B;  1KNY A;  4PFP A;  2L9J A;  4PR9 A;  3CQZ A;  3IPM O;  2KQ9 A;  2W9Y A;  4JJG A;  1LVK A;  1ORY A;  1Q0G A;  2HJM A;  3EGD A;  4BEM J;  1RJ9 A;  5COG A;  1QQ3 A;  4MW3 A;  3SYN A;  3T4R A;  4BJ5 A;  4DBR A;  1L7C A;  4E7S A;  2ICW G;  3BRJ A;  1D0Z A;  2PF4 E;  2FGY A;  5DLJ A;  4PJN A;  4IB4 A;  1CGN A;  4UDV A;  3HJC A;  1NLX A;  1O87 A;  1E83 A;  2A69 F;  2HV7 A;  4NTA A;  3Q7G A;  2OQM A;  3CSK A;  4NY3 A;  1OW6 A;  2LK4 A;  1Q0M A;  4LDQ A;  2XLD A;  1BDJ B;  1E85 A;  3AQB A;  2LD6 A;  3JSE O;  1K05 A;  2KW3 C;  4U5E E;  4XEF A;  2NUP B;  5K0I A;  3EGX B;  4B6I A;  3U2L A;  3O10 A;  3DM9 B;  1LE4 A;  4YT2 A;  2J46 A;  2WB7 A;  1FTS A;  4J7Y A;  4O7G A;  4F4B A;  4JKV A;  5FCL A;  4A4A A;  1M56 C;  2M4E A;  3AOU A;  2R7S A;  3U8V A;  3Q7L A;  2OG2 A;  3H2V A;  3NMK A;  2KJG A;  4K1O A;  3WG7 C;  3PDM P;  4PJJ A;  1QVX A;  3EGD B;  3C62 A;  4JJF A;  2Q7R A;  3OWT A;  4A2N B;  3DMD A;  5B3I A;  1Z6A A;  5F5H A;  4G78 A;  3ZC4 A;  4JTC B;  3H65 A;  3AG4 C;  5A6A A;  1RKC A;  3GEH A;  2LQG A;  4AE4 A;  4LAC B;  1TWC A;  2PX0 A;  3LS0 A;  2R7V A;  3DJN B;  2W4B A;  1F1M A;  3JCU Q;  2FFH A;  1R5I D;  4K7B A;  4ZLC A;  5KYY A;  1Z23 A;  2I15 A;  1UFB A;  4YN0 B;  2OU6 A;  4U5G A;  2R03 A;  2Q9A A;  3ZQV A;  1DOV A;  2MHR A;  1O3U A;  2DGJ A;  3O6X A;  3JRT A;  4LER A;  3PHF 2;  2M64 A;  3K1H A;  3GM2 A;  1A7V A;  4AX2 A;  3LNM B;  4KBL A;  4CS9 A;  3S28 A;  2XSE A;  2HKV A;  1VLT A;  2Y3D A;  3KYI A;  1M2O A;  2PNO A;  1YZA A;  4XPX A;  3A11 A;  3DKA A;  1YA7 O;  3W4Y A;  3JTL O;  4ULV A;  2E87 A;  3WHN A;  3KH2 A;  4G0H A;  1TWH A;  2XRH A;  4AE4 B;  1OCO C;  2XS8 A;  3ZTM A;  4ER9 A;  2MYS A;  3GOR A;  1OR2 A;  4LDR A;  3S90 A;  2XLH A;  3KL4 A;  3F47 A;  2KSF A;  5L0H A;  2YL1 A;  5JLI A;  3FMS A;  4IRU A;  4HEA J;  3EZH A;  4PAC A;  1QLE C;  3MFN A;  1ZW2 A;  1GGQ A;  3G50 A;  1HE9 A;  2ASR A;  2Y3G A;  2GWW A;  3LEV A;  4EBK A;  3RKO F;  4MVO A;  3SP1 A;  2DYR C;  2DI3 A;  3ECS A;  2YWA A;  3NKE A;  3SEO A;  1JR8 A;  2R02 A;  3E70 C;  2A6H F;  3W8I A;  4BJ1 A;  4FX5 A;  1KTM A;  1W2W A;  2YL3 A;  3HNJ A;  4AK9 A;  3C63 A;  3T6B A;  4YL0 A;  2WVN A;  3TK0 A;  5EGY A;  1J8M F;  1H6G A;  2P61 A;  3FXH A;  3HNI A;  3C7J A;  2IXP A;  3M4B A;  5AGF A;  1C17 M;  3IQT A;  3K1I C;  1JMW A;  2ZPA A;  3RVZ A;  3ZG1 A;  1WTY A;  1XZP A;  2PBE A;  2HUJ A;  3GEE A;  2CGE A;  4IAO A;  4CX9 A;  1NBB A;  2MWQ A;  2NG1 A;  3GWL A;  3IQ6 A;  2A1D D;  3L8J A;  1MND A;  3HNK A;  1SZI A;  2HV6 A;  2J7P D;  5EK0 A;  2X0C A;  1Q0D A;  5BQH A;  2R7X A;  2Y3B A;  3CZ6 A;  3U8P A;  2L6F A;  3V5X A;  1A7D A;  4MVQ A;  2BE5 F;  4C3B A;  5L0G A;  2R7T A;  3EPV A;  3T6G B;  1YAR O;  4KI2 A;  2J9V A;  4QI0 A;  1C02 A;  3EH1 A;  3T9O A;  1Q0F A;  3Q6M A;  1QPU A;  3Q6N A;  3EZI A;  2CDQ A;  2W4M A;  1OKK D;  2H7V C;  2L7A A;  1I4Y A;  4HFF B;  2H7B A;  1MMA A;  4R32 A;  4CJG A;  1Q0K A;  4YL1 A;  3RQG A;  2HSB A;  1ZW3 A;  4JVS A;  2ZXR A;  2LFF A;  2XL6 A;  3SZR A;  3PMR A;  3ASO C;  2XLV A;  1V54 C;  2P1A A;  3JRM O;  3ZIB A;  1YYX A;  4DRI B;  1ZVZ A;  3KYJ A;  3S27 A;  4AL0 A;  3ZSU A;  4FAP B;  2Y3H A;  5DQT A;  1S05 A;  3G4X A;  1ST6 A;  1Z3I X;  3ASN C;  5L0J A;  2EIJ C;  3GOD A;  3HNL A;  3B0P A;  4P9F A;  5T3T A;  4EHP A;  4G7O F;  2D4U A;  4I44 A;  5KYU B;  2OKU A;  2HMQ A;  3C18 A;  1RXQ A;  1YZC A;  4DXW A;  2EPO A;  1IZM A;  4D4X A;  3M4C A;  2ZXP A;  4PFO A;  4Z9I A;  2Q9B A;  1HMO A;  1T6Q A;  3DAF A;  3W2V A;  3DWW A;  4MVR A;  2QUP A;  3LJB A;  2JD3 A;  3JSZ A;  2KGO A;  1D1C A;  1ORS C;  1CGM E;  2A0U A;  1M6T A;  3FHD A;  5A69 A;  4CJO A;  4O6M A;  3RF3 A;  1TWG A;  2LIG A;  2HSQ A;  5B1A C;  1SMY F;  4Z9J A;  2OJQ A;  2QY9 A;  2J0X A;  4CDV A;  1HY5 A;  2C03 A;  4EUK B;  3NRH A;  2WVQ A;  4IAQ A;  1HE1 A;  1QSP A;  4J30 B;  4YT8 A;  5BUO A;  3GM3 A;  3QZC A;  4OIO F;  1D0X A;  2R7W A;  2HJ3 A;  4JEB A;  4MTO A;  3I5Q A;  1Z63 A;  4AL1 A;  1D1B A;  4LLC A;  1NU9 C;  1ORJ A;  3JT1 A;  4EKW A;  4U5F E;  1SF8 A;  2LCH A;  2YLD A;  4P9T A;  4IWB A;  1TWA A;  4MTF A;  4U5B E;  2V26 A;  1A41 A;  4XEV A;  5TJ5 E;  4DVY P;  5L0D A;  1TQG A;  1FFH A;  1V55 C;  1CPR A;  3VRC A;  3GEI A;  3V5Z A;  1ZZP A;  5COF A;  2FAP B;  1QZX A;  2VH3 A;  3DD7 A;  1H9G A;  3UMH A;  4YJW A;  4C3E A;  3RIP A;  2V3C C;  3RYL A;  1IW7 F;  3AGU A;  3H2U A;  3CEX A;  1E86 A;  1HMD A;  4JCH A;  2WZF A;  3SNH A;  4JW1 A;  2Q9C A;  4FWV A;  5COM A;  3S9O A;  2HS5 A;  1G4W R;  3GAN A;  4HE8 D;  1LI7 A;  2YQY A;  4JE9 A;  2KK1 A;  4ONS A;  3ZWI A;  4G7Z F;  3ZQY A;  4GEH A;  1RMV A;  3K1I A;  4CSA C;  1OW7 A;  2B0H A;  4Q5S F;  3SXK A;  3NYJ A;  2GDC A;  5DVW A;  3U3F A;  4Q4Z F;  4JTD B;  3POV A;  1EI7 A;  4X0R A;  3L8I A;  3B9Q A;  1R4T A;  3AGT A;  1BR4 A;  4NTB A;  1ZHZ A;  3QTH A;  3CAX A;  4QI2 A;  3DE8 A;  3UNG C;  2YRF A;  3ABL C;  2IYL D;  3QVY A;  3TQO A;  2EIN C;  1V74 B;  2L6H A;  1FFT C;  3L34 A;  5EHH A;  2R25 A;  5L0C A;  1LE2 A;  2RD9 A;  3L1M A;  2XXA B;  1H9T A;  4MQ9 F;  2GAQ A;  4NQF A;  2AU5 A;  1MMD A;  5JP7 A;  1S7Z A;  4YT5 A;  3MYI A;  2PX3 A;  1EA8 A;  1T9K A;  2CYD A;  2EPM X;  5HSW A;  3EH2 A;  1KU2 A;  2LSE A;  4N6C A;  3QW1 A;  3UMK A;  2DYS C;  4NCQ A;  3DE9 A;  2ETS A;  3LES A;  1C03 A;  4J32 B;  5F28 E;  4IJJ A;  2G3K A;  2EPK X;  3K33 A;  4ANJ A;  4CIH A;  4CS9 C;  3FAP B;  4H4K C;  3W2W A;  5DS4 A;  1E2X A;  3V7O A;  5E2Q A;  4W8K A;  2BL2 A;  5KYW A;  1I4Z A;  1TR2 A;  3FOP A;  1ZHX A;  4E0I A;  4CIP A;  1U0B B;  2OEV A;  1QKR A;  3RH3 A;  3L0I A;  3B0V C;  4XPW A;  2JX0 A;  1JPJ A;  1WOL A;  2GFH A;  4O6N A;  3AJM A;  1CGO A;  3B0U X;  5F5F A;  1OW8 A;  4D4N A;  2Q3T A;  3IHU A;  1LKX A;  5KYU A;  4L6R A;  2XLO A;  4CSA A;  3B71 A;  4BJ6 A;  5GPG B;  2AWY A;  4CS8 A;  1FMV A;  2XM0 A;  1BZ4 A;  4P6I C;  1ZU5 A;  2J0W A;  5IY5 C;  3FDQ A;  1OXB A;  2CNW A;  1LI5 A;  3EFO B;  4DBQ A;  3ABM C;  4MTG A;  1J8Y F;  1MNE A;  4MND A;  4K0D A;  1RKE A;  4NC3 A;  4CBE A;  1TKN A;  4OIP F;  1Z7Q c;  3FOO A;  2Y39 A;  3S0X A;  3DAG A;  1RCP A;  3LS1 A;  2PP4 A;  4C3D A;  1NU7 D;  3C8G D;  3LLI A;  2RSE B;  1MMN A;  1U89 A;  5E3C A;  3V5Y A;  256B A;  4JCZ A;  2XM4 A;  5B3S C;  3R2P A;  2XLW A;  1SYQ A;  2O9X A;  4MW8 A;  4PJM A;  1BR2 A;  3S29 A;  3W8H A;  2UUI A;  3R7C A;  3J06 A;  5KYY B;  5KYN A;  1G5Z A;  2EPN A;  2NSF A;  2GA0 A;  3DXJ F;  2A6E F;  1I5N A;  3UR3 C;  2VAS A;  1ZHW A;  3N0T A;  1YA9 A;  1T5O A;  2CNW D;  2XXA A;  2VB6 A;  3HTK C;  3ATP A;  1Y4C A;  3LNR A;  4KNW A;  3NKD A;  3TD7 A;  3KMI A;  3LEO A;  1VYK A;  1AEP A;  4JC7 A;  1JRA A;  2R9R B;  1FAP B;  2YKZ A;  3NG1 A;  3EG9 A;  3OA1 A;  5DS6 A;  4H54 A;  3TOM A;  3U2M A;  5BQG A;  1BBH A;  2KC3 A;  3C8G A;  1OR3 A;  4EBB A;  2NUP A;  1N1C A;  4W8P A;  3SXZ A;  1JAF A;  1FMW A;  5A6B D;  2J8W A;  1LIH A;  1JPN A;  2YHS A;  1D0Y A;  3C8G B;  4LDK A;  2W45 A;  4CS7 A;  3SXY A;  5JS5 A;  4KC9 A;  2YLG A;  1Z5Z A;  3M79 A;  1GQA A;  3LAY A;  4YT4 A;  2R7O A;  2IXM A;  2P0N A;  1LS1 A;  3DI5 A;  2PFD A;  3K7D A;  3LLK A;  1VB5 A;  4JEA A;  4JIO A;  4DJ9 A;  2H8A A;  4JRZ A;  3UGP A;  1HW1 A;  3IEE A;  4E18 A;  3FAJ A;  1TFO B;  2OOC A;  2Q4F A;  3T6J A;  1OCZ C;  3EQL F;  4MVU A;  3JYH A;  3QMK A;  1V4A A;  2OCC C;  2VCC A;  2YZS A;  2QTV A;  3NMI A;  1WWP A;  4I1M A;  5CI9 A;  5AC4 A;  2BC5 A;  3MLG A;  2G3V A;  1AVO B;  1VK5 A;  2Y69 C;  4EBJ A;  1VYI A;  3IQ5 A;  1B68 A;  2OJE D;  5B1B C;  3U3B A;  4CDY A;  5E33 A;  5L0F A;  3VAY A;  2IBF A;  3WAQ A;  4M63 A;  2B0J A;  2EIL C;  2KNH A; 
#chains in the Genus database with same CATH homology
 1RKE B;  3TJ6 A;  3MYI A;  1ST6 A;  2X0C A;  3ZDL A;  1ZW2 A;  4DJ9 A;  5L0J A;  2GWW A;  5L0G A;  4PR9 A;  4EHP A;  1DOW A;  1T01 A;  2B0H A;  3T6G B;  4E18 A;  1DOV A;  1YDI A;  2GDC A;  4P9T A;  4E17 A;  1RKE A;  1L7C A;  1XWJ A;  1U6H A;  2L7A A;  4K1O A;  3H2V A;  1H6G A;  4IGG A;  4ONS A;  5L0D A;  5FZT A;  3VF0 A;  3TJ5 A;  1TR2 A;  1ZW3 A;  1U89 A;  3RF3 A;  5L0I A;  1QKR A;  3H2U A;  2HSQ A;  4W8P A;  5L0F A;  5L0C A;  1SYQ A;  2IBF A;  1RKC A;  3S90 A;  1ZVZ A;  2LQG A;  5L0H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...