3RF3A

Shigella ipaa-vbs3 in complex with human vinculin
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
257
structure length
257
Chain Sequence
PVFHTRTIESILEPVAQQISHLVIMHEEGEVDGKAIPDLTAPVAAVQAAVSNLVRVGKETVQTTEDQILKRDMPPAFIKVENACTKLVQAAQMLQSDPYSVPARDYLIDGSRGILSGTSDLLLTFDEAEVRKIIRVCKGILEYLTVAEVVETMEDLVTYTKNLGPGMTKMAKMIDERQQELTHQEHRVMLVNSMNTVKELLPVLISAMKIFVTTKNSKNQGIEEALKNRNFTVEKMSAEINEIIRVLQLTSWDEDAW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Novel vinculin binding site of the IpaA invasin of Shigella.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding/toxin
molecule keywords Vinculin
total genus 116
structure length 257
sequence length 257
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-04-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 3rf3A02
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 3rf3A01
4E18A 2HSQA 3ZDLA 5L0HA 2LQGA 3S90A 1T01A 2IBFA 1H6GA 1RKCA 3TJ5A 1RKEB 1L7CA 5L0GA 3H2VA 2X0CA 4EHPA 4ONSA 3VF0A 3H2UA 1TR2A 4PR9A 1ST6A 1QKRA 1RKEA 2B0HA 3RF3A 3TJ6A 4P9TA 1XWJA 1ZW2A 2GDCA 5L0FA 3MYIA 5L0DA 1DOVA 4E17A 5L0CA 1YDIA 4IGGA 3T6GB 5L0JA 1U6HA 4K1OA 2GWWA 5FZTA 2L7AA 1DOWA 1U89A 4W8PA 1ZW3A 4DJ9A 1ZVZA 5L0IA 1SYQA
chains in the Genus database with same CATH superfamily
3L8JA 3GEIA 3ZDLA 1O87A 3FAPB 1T5OA 1Y6DA 2LQGA 2A68F 3NMKA 2ZPAA 1ZYRF 1LM3B 2OU6A 3US6A 1H9GA 1VLTA 1TWCA 3N2ZB 4CX9A 3GEHA 3UGPA 3ZSUA 4DRJB 2LK4A 3B9QA 1G5ZA 3R2PA 3S84A 4LACB 2B0HA 1ZHZA 1D0YA 3LLIA 1XWJA 2QY9A 4FESA 4OIPF 1D0ZA 4N06A 1OQCA 2LP4A 3HLZA 2F22A 1QVXA 5EGYA 5HSWA 3AQCA 3EG9A 1LKXA 3IQ6A 2P6VA 4IGGA 1MNDA 2TMVP 5F5FA 3MFNA 3I5PA 4IRUA 2VCAA 3U9MA 2EINC 4OD5A 5DS5A 4JC7A 4R32A 1ORJA 1V55C 5F5HA 1GS9A 1YA9A 1C03A 5COFA 1ZW3A 2QNLA 3U5SA 2W4BA 3EQLF 4CJGA 4PACA 4CSAC 4U5HA 2PX0A 3UMKA 5BQHA 5A69A 2NUTB 3LNRA 4I1OB 2Y3DA 3W8HA 3FMSA 4O7GA 1VLSA 2HKVA 2QLAA 1NG1A 3AG2C 3C8GB 3SXMA 2VCBA 1TFKB 2IXPA 4RD9A 2J9VA 3E70C 2W4MA 2J45A 2O9XA 3L34A 1WATA 1Q0MA 2HV6A 2ICWG 4U9DA 1MMNA 1TKNA 1TQGA 3JYHA 2AWCA 4MVMA 3RFYA 3U2MA 1L3PA 2D5RB 5JRAA 2OQMA 2R05A 3FAJA 4K1OA 2BC5A 1T6QA 2XL8A 4JTCB 3U2LA 3S29A 2NUPA 1U89A 1S05A 1FMVA 3L1MA 2W9YA 2Z15A 2LSEA 2Q7RA 3RVZA 4QI2A 3ECSA 2LD6A 3ATPA 2OJQA 4IB4A 1FMWA 3S28A 3C63A 2QE9A 1JAFA 1HMOA 4BJ6C 1L7CA 4C3EA 4MS2A 1H9TA 5COGA 1I4ZA 3A9CA 1CGME 3C62A 4AL1A 3SYNA 5L3VA 2KK1A 4BEMJ 3BRJA 3H2UA 3IQTA 3RF3A 1VMAA 5KYYA 1V74B 4L6RA 5GPGB 1KU2A 1RJ9A 2BL2A 2YVKA 4NQFA 1AEPA 4A4AA 4CS8C 4E17A 5KYYB 2M64A 2OG2A 5DVWA 2HMZA 2GA0A 2J0WA 3W8IA 3X2QC 3T4RA 1UG7A 4MTGA 2WL8A 2Y39A 2XS1A 1SZIA 1JMWA 1RCPA 3TK0A 5DS4A 2Q9AA 1U0BB 1YVIA 2OCCC 3LS0A 3LUTB 1TWGA 3FHDA 4MVUA 3H65A 1JPJA 4PJMA 4WGZA 5F28E 4CDAA 1D1BA 1D1AA 3DAFA 3LNMB 4ER9A 4Z9JA 5KYWB 2KC3A 1SYQA 1GQAA 2VC9A 3O55A 2R7RA 2HSQA 3S27A 5L0HA 3ZC4A 2QTVA 1QLEC 1ORYA 4CS9A 4YT4A 3QVZA 2Y3BA 4P6IC 1NBBA 2KYHA 3V5YA 3PDMP 2YHSA 3C7JA 3HNIA 5DQTA 1QPUA 1OCZC 2EPOA 3DE8A 3GODA 3MYFA 4FWVA 4EIYA 5KYUA 1BZ4A 1EKYA 1M57C 5JP7A 1AVOB 4MVSA 1Z7Qc 3JTLO 3PMRA 5L0DA 1OXKA 1W2WA 1SF8A 1HW1A 2EPLX 1BDJB 1KNYA 3ABLC 3KMIA 3QW1A 1RXQA 3DAGA 3U8PA 2QUPA 3GM3A 3U8VA 3J06A 1HE9A 4XWJA 5DS6A 2J9WA 3DWWA 5COMA 3JSEO 2EIKC 2JD3A 1LI7A 2Q3TA 2IXMA 3E9VA 3W2WA 2L6FA 1I4YA 3F46A 1A7VA 2ZD9A 2HJMA 2KNHA 2NUTA 1GM5A 1S7ZA 2ZXOA 1OKKA 2J8WA 3ASNC 4JIOA 4LLEA 2IBFA 3FOOA 2Y3GA 2V26A 3C8GA 1FTSA 2AWYA 3AG1C 3T9OA 3QW0A 4EBBA 3BEHA 1ST6A 4QI0A 1FNTc 1LS4A 3DE9A 3NG1A 4N6HA 4AE4B 1D1CA 1E86A 3L8IA 3MYIA 5A6JA 4QDLA 5T1DB 3RYLA 2EILC 2IM8A 4YN0B 3ZG1A 3ZVRA 5AC5A 256BA 2CYDA 2LIGA 3KYJA 3ZWIA 3M4CA 3K6BA 5B3IA 2E87A 5L0JA 4YJWA 3A11A 1NSGB 2B0JA 4IJJA 3NYJA 3IEEA 4KI2A 4MNDA 5KYNA 1V4AA 2R7VA 4G78A 2ZXRA 2WVNA 4JJFA 5TJ5E 4IAQA 3DI5A 2WZFA 2YLIA 1B68A 1A7EA 4GEHA 1VB5A 4MVRA 3WHNA 2OOCA 1VK5A 1ZU4A 2DB4A 3EJNA 3O39A 1MQVA 2RSEB 2X0CA 2L9JA 3VF0A 2KGOA 4AE4A 1QKRA 3GM2A 4FX5A 3KKBA 4PJJA 4EKWA 3FXHA 3HNJA 1TWHA 1EQ1A 1Z6AA 3ZTZA 3MBGA 3KL4A 3DXJF 3EFOA 4Z9HA 1YDIA 5BQGA 3DMDA 3B71A 3NYMA 4MVZA 3T6GB 1XZPA 3LEOA 3EFOB 2GWWA 2XLMA 3KH2A 2R7QA 4JEBA 1DOWA 1G8XA 2Q9CA 4ANJA 3JYYA 4U9EA 2LFFA 2R25A 3OEOA 4IWBA 2XLDA 4U5DE 3VM6A 1E85A 2WB7A 4JRZA 3UMHA 4G7ZF 1LE4A 2W45A 4BJ6A 5L3QA 2PF4E 1MMGA 1CGNA 1H6GA 3RVYA 1QQ3A 1HMDA 2EPNA 2HJ3A 2VCCA 1BR4A 1K04A 2I15A 5KYUB 3EG9B 3GEEA 2R7SA 1K40A 4ULVA 1FFTC 1G4US 4N4WA 3S0XA 4N6CA 3DJUB 1ZHXA 4J7YA 2CW0F 2R7TA 2IOQA 4OIOF 3B0PA 4WJ0A 3ZTMA 2KJGA 3POVA 1CPQA 2NSFA 4Z9IA 3WODF 1JOGA 1PD0A 3EGXA 4XLNF 3QVYA 4DVZA 4MW3A 1C17M 3ABKC 4Q7CA 3EGDB 3VAYA 1BBHA 2BE5F 3V5XA 1M6TA 2J7PA 3UMIA 2A69F 3CQZA 2YZSA 3DKAA 3S9OA 3U9JA 4J30B 2GAQA 2WZLA 5EHHA 1RMVA 3ABMC 4CS9C 3HTKC 3S90A 1A7DA 4DVYP 1ORSC 3SXZA 4IAOA 1Q0FA 1RKCA 4NTAA 2P0NA 2L81A 4BJTA 1YZCA 3QZCA 3EHMA 1NLXA 4U5BE 1MNEA 1R5ID 4RBNA 2PFDA 1JPNA 1OCOC 4KBLA 4PFPA 1YYXA 3IQ5A 2IYLD 2JPUA 2CCYA 1WN0A 2C04A 2J9UA 3LLKA 3GANA 4K0DA 5JSLA 4CIPA 3DZAA 5JT4A 2P61A 2XS8A 1BR1A 1U6HA 2XM4A 3G4XA 3FVYA 5EK0A 3X1OA 1IZMA 4CJOA 2Y3HA 4XTKA 4F4BA 3FDQA 4PJLA 4W8KA 2OEXA 3RW0A 3SXKA 2Y69C 3F47A 4MW8A 2DYRC 1ZU5A 2R02A 2YWAA 1M2VB 3MX3A 3N24A 2KQ9A 3N0TA 3NKEA 4MTOA 4XLPF 4JVSA 3LAYA 4K7BA 2HS5A 4M63A 3KPHA 4MVOA 3U0CA 2GFHA 4J32B 2R7OA 2J46A 3LEVA 1BR2A 3NMJA 4C3BA 4EHPA 1WOLA 3EH2A 3AQBA 3LESA 5T3TA 3HJCA 4JTAB 4GQHA 4XEKA 2R03A 3TULA 4C7OB 4DRIB 4CBEA 1O3UA 3FOPA 1NFNA 3K33A 2XXAA 5KYXA 1C02A 1GGQA 2YLGA 4LDQA 4C7OA 3HKKA 3CAXA 2AP3A 3M4BA 4JURI 5BUOA 1O5HA 4OIQF 3M79A 4KNVA 2XL6A 1OW8A 1LPEA 2J7PD 3LS1A 4MVQA 1H7IA 2L7AA 5FZTA 4BJ1A 2ZXWC 4MTFA 3RQFA 3ZQVA 2J0XA 4ZLCA 1WWPA 2NG1A 2LFDA 4I3MA 2EIMC 3EGDA 2R7XA 2YKZA 1G4WR 1FFHA 2VASA 1WTYA 3IPMO 4KNWA 4XPWA 4XQ1A 4CDYA 2A0UA 2DGJA 1OXBA 1VYKA 2YL3A 3GM1A 3Q7GA 3TJ5A 5L0GA 4Q4ZF 2KSFA 4C3DA 4UDVA 1Q0DA 1APCA 2G62A 3B29A 3JCUQ 3DJNB 1J8MF 1Z23A 1TWAA 2OJED 3NMIA 2ETSA 1CGOA 2WZGA 5D92A 2XSEA 1RJ9B 5E2QA 5L0FA 3G50A 4HE8D 4DBRA 1YARO 4E7ZA 2V3CC 3UR3C 1FAPB 3NDBB 2AU5A 3AJMA 4U5GA 4E0IA 3GORA 2EPMX 4WGYA 4YL1A 3SNHA 3RKOF 1E84A 4O6YA 4O6MA 4CSAA 2G3KA 3R7CA 2XLHA 4YL0A 4JJGA 3U3FA 5JUAA 3JRMO 1ZZPA 4O79A 2NSGA 4XPYA 2DI3A 2YQYA 2H7VC 3H2VA 4JZAA 2PNOA 4D4XA 3OWTA 3MLGA 3V7OA 2P7VA 4J7TA 3K66A 3TJ6A 4DRHB 4Q5SF 4ZLDA 2M4EA 3AOUA 2MWQA 3CEXA 2VH3A 1K05A 4O6NA 2YL0A 3Q6MA 2YRFA 2R7UA 5CIVA 3K1IA 4EBJA 3K1IC 1IW7F 5A6BD 2WVOA 3ZQYA 2L6HA 5A6BA 1JR8A 2Q4FA 1VTMP 3C18A 3K7DA 4DXWA 2CNWD 1OKKD 4W8PA 2XLOA 4FAPB 3V5ZA 1M2VA 4PK4A 5L0IA 1NU7D 2IXNA 1LIHA 3W2VA 5AGFA 2WVQA 4B6IA 3C8ZA 1MMAA 4PFOA 2MYSA 3RQGA 4A2NB 3L0IA 5JLIA 4MQ9F 2D4UA 4NTBA 1NU9C 4G7OF 2DYSC 3DM5A 2A1DD 3I4UA 2PBEA 2A6HF 2C03A 2XXAB 3SXYA 4LERA 2CNWA 2GDCA 3O10A 3OA1A 2A6EF 1Z3IX 4WABA 4NCQA 1LS1A 3IQCA 4NTFA 3QMKA 5E3CA 3EPVA 2AVKA 1V54C 1ZHTA 1NFOA 4HFFB 4NC3A 3TOMA 5B3SC 2I8BA 2H7BA 4CS7A 4BJ5A 4KC9A 4IARA 3SEOA 5A6KA 4EUKB 4BJ5C 4H4KC 1YYJA 3SZRA 1LI5A 2IXOA 3W4YA 3HNLA 2A0BA 1AUEA 3JRTA 1RKEB 3U3BA 1PCXA 4E0HA 2FGYA 2Q9BA 3O6XA 3Q6NA 2L6GA 4ONSA 3WAQA 2HMQA 3AGUA 4E7SA 1RKEA 1Q0GA 1R4TA 2KW3C 4OINF 3G4ZA 2EIJC 1JRAA 5B1AC 2P1AA 1KTMA 3EHNA 2R9RB 4LLCA 3QTHA 3RIPA 2OKUA 2ZXPA 1N1CA 2G3VA 2XRHA 4JCZA 4AX2A 4I1MA 4YWQA 3CZ6A 2EPKX 2ASRA 5K0IA 3HNKA 2RD9A 3GWLA 4I44A 1T6UA 3RH3A 4YT2A 1ZVZA 4AL0A 4HEAJ 4E18A 1LVKA 2Q00A 3EZHA 2UUHA 4P9FA 1WASA 1UFBA 3UNGC 3EH1A 1HW2A 4G0HA 2R7WA 1TR2A 4H54A 1QSPA 3PHF2 4RDAA 4CDVA 3NRHA 4JKVA 3TD7A 1YJGA 1ZHWA 1OR2A 5B1BC 1OCRC 4EWCA 1DOVA 5IY5C 4G7HF 5KYXB 4OIRF 1LE2A 3AGTA 1SMYF 4JE9A 4OD4A 4NY3A 1E83A 4CS8A 4HFKB 3VYWA 3B0UX 4GYTA 2HSBA 4YT8A 1OR3A 2PX3A 1D0XA 3JZ0A 5KYWA 1ZHYA 3RQEA 1E2XA 1TFOB 3CSKA 3M1CB 4XPXA 1FR0A 5JVEA 1F1MA 1YAUO 1T01A 3NYLA 1PV3A 2YLDA 1OW6A 4XEVA 5CI8A 4PJNA 1QZXA 3AG4C 5BQIA 2XLVA 3WG7C 3UGOA 3TOLA 3IHUA 3ASOC 1ZW2A 2LCHA 4D4NA 1OCCC 1I5NA 2VB6A 3C8GD 1CPRA 5L0CA 1EA8A 1Z63A 4DBQA 4BG0A 2JX0A 4XEFA 1A0BA 3PCVA 2UUIA 1T9KA 2FAPB 2YL1A 3B0VC 4U5CE 2YEVA 1Q0KA 3Q7LA 1HY5A 2HV7A 2X51A 1Z5ZA 5T3WA 2CGEA 5A6AA 2NUPB 4X0RA 4BEJA 1YLMA 4YT5A 4BPMA 1PD1A 3JSZA 5FCLA 2HUJA 4CIHA 1SR2A 2FFHA 5HV9A 2YL7A 4JEAA 4DOZA 2MHRA 3M15A 3ZIBA 4EBKA 4U5FE 4AK9A 2H8AA 3DD7A 5CI9A 1J8YF 1VOMA 1T6IA 2XL4A 4JCHA 3SP1A 2OEVA 2NPUA 3AG3C 3I5QA 1HE1A 1MMDA 2CDQA 1NZEA 4PR9A 1M2OA 4P9TA 4ULWA 2J9BA 2H7OA 2XLEA 3DM9B 4YL3A 5E3AA 5DLJA 2PP4A 3ITFA 5JS5A 3GWNA 3VRCA 1Y4CA 1XZQA 2XM0A 4JW1A 3KYIA 5E33A 3NKDA 5AC4A 1VYIA 3EZIA 1YZAA 3EGXB 1YA7O 1WGWA 2HZ8A 3JT1A 4YK5A 5D91A 3T6JA 3T6BA 1OW7A 1EI7A 4JTDB 4U5EE 3K1HA 1A41A 2HFIA 4LDRA 4LDKA 2XLWA 3LJBA 4DJ9A 1M56C 5DQZA 3TQOA
chains in the Genus database with same CATH topology
4E18A 2HSQA 3ZDLA 5L0HA 2LQGA 3S90A 1T01A 2IBFA 1H6GA 1RKCA 3TJ5A 1RKEB 1L7CA 5L0GA 3H2VA 2X0CA 4EHPA 4ONSA 3VF0A 3H2UA 1TR2A 4PR9A 1ST6A 1QKRA 1RKEA 2B0HA 3RF3A 3TJ6A 4P9TA 1XWJA 1ZW2A 2GDCA 5L0FA 3MYIA 5L0DA 1DOVA 4E17A 5L0CA 1YDIA 4IGGA 3T6GB 5L0JA 1U6HA 4K1OA 2GWWA 5FZTA 2L7AA 1DOWA 1U89A 4W8PA 1ZW3A 4DJ9A 1ZVZA 5L0IA 1SYQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4E18 A;  2HSQ A;  3ZDL A;  5L0H A;  2LQG A;  3S90 A;  1T01 A;  2IBF A;  1H6G A;  1RKC A;  3TJ5 A;  1RKE B;  1L7C A;  5L0G A;  3H2V A;  2X0C A;  4EHP A;  4ONS A;  3VF0 A;  3H2U A;  1TR2 A;  4PR9 A;  1ST6 A;  1QKR A;  1RKE A;  2B0H A;  3RF3 A;  3TJ6 A;  4P9T A;  1XWJ A;  1ZW2 A;  2GDC A;  5L0F A;  3MYI A;  5L0D A;  1DOV A;  4E17 A;  5L0C A;  1YDI A;  4IGG A;  3T6G B;  5L0J A;  1U6H A;  4K1O A;  2GWW A;  5FZT A;  2L7A A;  1DOW A;  1U89 A;  4W8P A;  1ZW3 A;  4DJ9 A;  1ZVZ A;  5L0I A;  1SYQ A; 
#chains in the Genus database with same CATH topology
 3L8J A;  3GEI A;  3ZDL A;  1O87 A;  3FAP B;  1T5O A;  1Y6D A;  2LQG A;  2A68 F;  3NMK A;  2ZPA A;  1ZYR F;  1LM3 B;  2OU6 A;  3US6 A;  1H9G A;  1VLT A;  1TWC A;  3N2Z B;  4CX9 A;  3GEH A;  3UGP A;  3ZSU A;  4DRJ B;  2LK4 A;  3B9Q A;  1G5Z A;  3R2P A;  3S84 A;  4LAC B;  2B0H A;  1ZHZ A;  1D0Y A;  3LLI A;  1XWJ A;  2QY9 A;  4FES A;  4OIP F;  1D0Z A;  4N06 A;  1OQC A;  2LP4 A;  3HLZ A;  2F22 A;  1QVX A;  5EGY A;  5HSW A;  3AQC A;  3EG9 A;  1LKX A;  3IQ6 A;  2P6V A;  4IGG A;  1MND A;  2TMV P;  5F5F A;  3MFN A;  3I5P A;  4IRU A;  2VCA A;  3U9M A;  2EIN C;  4OD5 A;  5DS5 A;  4JC7 A;  4R32 A;  1ORJ A;  1V55 C;  5F5H A;  1GS9 A;  1YA9 A;  1C03 A;  5COF A;  1ZW3 A;  2QNL A;  3U5S A;  2W4B A;  3EQL F;  4CJG A;  4PAC A;  4CSA C;  4U5H A;  2PX0 A;  3UMK A;  5BQH A;  5A69 A;  2NUT B;  3LNR A;  4I1O B;  2Y3D A;  3W8H A;  3FMS A;  4O7G A;  1VLS A;  2HKV A;  2QLA A;  1NG1 A;  3AG2 C;  3C8G B;  3SXM A;  2VCB A;  1TFK B;  2IXP A;  4RD9 A;  2J9V A;  3E70 C;  2W4M A;  2J45 A;  2O9X A;  3L34 A;  1WAT A;  1Q0M A;  2HV6 A;  2ICW G;  4U9D A;  1MMN A;  1TKN A;  1TQG A;  3JYH A;  2AWC A;  4MVM A;  3RFY A;  3U2M A;  1L3P A;  2D5R B;  5JRA A;  2OQM A;  2R05 A;  3FAJ A;  4K1O A;  2BC5 A;  1T6Q A;  2XL8 A;  4JTC B;  3U2L A;  3S29 A;  2NUP A;  1U89 A;  1S05 A;  1FMV A;  3L1M A;  2W9Y A;  2Z15 A;  2LSE A;  2Q7R A;  3RVZ A;  4QI2 A;  3ECS A;  2LD6 A;  3ATP A;  2OJQ A;  4IB4 A;  1FMW A;  3S28 A;  3C63 A;  2QE9 A;  1JAF A;  1HMO A;  4BJ6 C;  1L7C A;  4C3E A;  4MS2 A;  1H9T A;  5COG A;  1I4Z A;  3A9C A;  1CGM E;  3C62 A;  4AL1 A;  3SYN A;  5L3V A;  2KK1 A;  4BEM J;  3BRJ A;  3H2U A;  3IQT A;  3RF3 A;  1VMA A;  5KYY A;  1V74 B;  4L6R A;  5GPG B;  1KU2 A;  1RJ9 A;  2BL2 A;  2YVK A;  4NQF A;  1AEP A;  4A4A A;  4CS8 C;  4E17 A;  5KYY B;  2M64 A;  2OG2 A;  5DVW A;  2HMZ A;  2GA0 A;  2J0W A;  3W8I A;  3X2Q C;  3T4R A;  1UG7 A;  4MTG A;  2WL8 A;  2Y39 A;  2XS1 A;  1SZI A;  1JMW A;  1RCP A;  3TK0 A;  5DS4 A;  2Q9A A;  1U0B B;  1YVI A;  2OCC C;  3LS0 A;  3LUT B;  1TWG A;  3FHD A;  4MVU A;  3H65 A;  1JPJ A;  4PJM A;  4WGZ A;  5F28 E;  4CDA A;  1D1B A;  1D1A A;  3DAF A;  3LNM B;  4ER9 A;  4Z9J A;  5KYW B;  2KC3 A;  1SYQ A;  1GQA A;  2VC9 A;  3O55 A;  2R7R A;  2HSQ A;  3S27 A;  5L0H A;  3ZC4 A;  2QTV A;  1QLE C;  1ORY A;  4CS9 A;  4YT4 A;  3QVZ A;  2Y3B A;  4P6I C;  1NBB A;  2KYH A;  3V5Y A;  3PDM P;  2YHS A;  3C7J A;  3HNI A;  5DQT A;  1QPU A;  1OCZ C;  2EPO A;  3DE8 A;  3GOD A;  3MYF A;  4FWV A;  4EIY A;  5KYU A;  1BZ4 A;  1EKY A;  1M57 C;  5JP7 A;  1AVO B;  4MVS A;  1Z7Q c;  3JTL O;  3PMR A;  5L0D A;  1OXK A;  1W2W A;  1SF8 A;  1HW1 A;  2EPL X;  1BDJ B;  1KNY A;  3ABL C;  3KMI A;  3QW1 A;  1RXQ A;  3DAG A;  3U8P A;  2QUP A;  3GM3 A;  3U8V A;  3J06 A;  1HE9 A;  4XWJ A;  5DS6 A;  2J9W A;  3DWW A;  5COM A;  3JSE O;  2EIK C;  2JD3 A;  1LI7 A;  2Q3T A;  2IXM A;  3E9V A;  3W2W A;  2L6F A;  1I4Y A;  3F46 A;  1A7V A;  2ZD9 A;  2HJM A;  2KNH A;  2NUT A;  1GM5 A;  1S7Z A;  2ZXO A;  1OKK A;  2J8W A;  3ASN C;  4JIO A;  4LLE A;  2IBF A;  3FOO A;  2Y3G A;  2V26 A;  3C8G A;  1FTS A;  2AWY A;  3AG1 C;  3T9O A;  3QW0 A;  4EBB A;  3BEH A;  1ST6 A;  4QI0 A;  1FNT c;  1LS4 A;  3DE9 A;  3NG1 A;  4N6H A;  4AE4 B;  1D1C A;  1E86 A;  3L8I A;  3MYI A;  5A6J A;  4QDL A;  5T1D B;  3RYL A;  2EIL C;  2IM8 A;  4YN0 B;  3ZG1 A;  3ZVR A;  5AC5 A;  256B A;  2CYD A;  2LIG A;  3KYJ A;  3ZWI A;  3M4C A;  3K6B A;  5B3I A;  2E87 A;  5L0J A;  4YJW A;  3A11 A;  1NSG B;  2B0J A;  4IJJ A;  3NYJ A;  3IEE A;  4KI2 A;  4MND A;  5KYN A;  1V4A A;  2R7V A;  4G78 A;  2ZXR A;  2WVN A;  4JJF A;  5TJ5 E;  4IAQ A;  3DI5 A;  2WZF A;  2YLI A;  1B68 A;  1A7E A;  4GEH A;  1VB5 A;  4MVR A;  3WHN A;  2OOC A;  1VK5 A;  1ZU4 A;  2DB4 A;  3EJN A;  3O39 A;  1MQV A;  2RSE B;  2X0C A;  2L9J A;  3VF0 A;  2KGO A;  4AE4 A;  1QKR A;  3GM2 A;  4FX5 A;  3KKB A;  4PJJ A;  4EKW A;  3FXH A;  3HNJ A;  1TWH A;  1EQ1 A;  1Z6A A;  3ZTZ A;  3MBG A;  3KL4 A;  3DXJ F;  3EFO A;  4Z9H A;  1YDI A;  5BQG A;  3DMD A;  3B71 A;  3NYM A;  4MVZ A;  3T6G B;  1XZP A;  3LEO A;  3EFO B;  2GWW A;  2XLM A;  3KH2 A;  2R7Q A;  4JEB A;  1DOW A;  1G8X A;  2Q9C A;  4ANJ A;  3JYY A;  4U9E A;  2LFF A;  2R25 A;  3OEO A;  4IWB A;  2XLD A;  4U5D E;  3VM6 A;  1E85 A;  2WB7 A;  4JRZ A;  3UMH A;  4G7Z F;  1LE4 A;  2W45 A;  4BJ6 A;  5L3Q A;  2PF4 E;  1MMG A;  1CGN A;  1H6G A;  3RVY A;  1QQ3 A;  1HMD A;  2EPN A;  2HJ3 A;  2VCC A;  1BR4 A;  1K04 A;  2I15 A;  5KYU B;  3EG9 B;  3GEE A;  2R7S A;  1K40 A;  4ULV A;  1FFT C;  1G4U S;  4N4W A;  3S0X A;  4N6C A;  3DJU B;  1ZHX A;  4J7Y A;  2CW0 F;  2R7T A;  2IOQ A;  4OIO F;  3B0P A;  4WJ0 A;  3ZTM A;  2KJG A;  3POV A;  1CPQ A;  2NSF A;  4Z9I A;  3WOD F;  1JOG A;  1PD0 A;  3EGX A;  4XLN F;  3QVY A;  4DVZ A;  4MW3 A;  1C17 M;  3ABK C;  4Q7C A;  3EGD B;  3VAY A;  1BBH A;  2BE5 F;  3V5X A;  1M6T A;  2J7P A;  3UMI A;  2A69 F;  3CQZ A;  2YZS A;  3DKA A;  3S9O A;  3U9J A;  4J30 B;  2GAQ A;  2WZL A;  5EHH A;  1RMV A;  3ABM C;  4CS9 C;  3HTK C;  3S90 A;  1A7D A;  4DVY P;  1ORS C;  3SXZ A;  4IAO A;  1Q0F A;  1RKC A;  4NTA A;  2P0N A;  2L81 A;  4BJT A;  1YZC A;  3QZC A;  3EHM A;  1NLX A;  4U5B E;  1MNE A;  1R5I D;  4RBN A;  2PFD A;  1JPN A;  1OCO C;  4KBL A;  4PFP A;  1YYX A;  3IQ5 A;  2IYL D;  2JPU A;  2CCY A;  1WN0 A;  2C04 A;  2J9U A;  3LLK A;  3GAN A;  4K0D A;  5JSL A;  4CIP A;  3DZA A;  5JT4 A;  2P61 A;  2XS8 A;  1BR1 A;  1U6H A;  2XM4 A;  3G4X A;  3FVY A;  5EK0 A;  3X1O A;  1IZM A;  4CJO A;  2Y3H A;  4XTK A;  4F4B A;  3FDQ A;  4PJL A;  4W8K A;  2OEX A;  3RW0 A;  3SXK A;  2Y69 C;  3F47 A;  4MW8 A;  2DYR C;  1ZU5 A;  2R02 A;  2YWA A;  1M2V B;  3MX3 A;  3N24 A;  2KQ9 A;  3N0T A;  3NKE A;  4MTO A;  4XLP F;  4JVS A;  3LAY A;  4K7B A;  2HS5 A;  4M63 A;  3KPH A;  4MVO A;  3U0C A;  2GFH A;  4J32 B;  2R7O A;  2J46 A;  3LEV A;  1BR2 A;  3NMJ A;  4C3B A;  4EHP A;  1WOL A;  3EH2 A;  3AQB A;  3LES A;  5T3T A;  3HJC A;  4JTA B;  4GQH A;  4XEK A;  2R03 A;  3TUL A;  4C7O B;  4DRI B;  4CBE A;  1O3U A;  3FOP A;  1NFN A;  3K33 A;  2XXA A;  5KYX A;  1C02 A;  1GGQ A;  2YLG A;  4LDQ A;  4C7O A;  3HKK A;  3CAX A;  2AP3 A;  3M4B A;  4JUR I;  5BUO A;  1O5H A;  4OIQ F;  3M79 A;  4KNV A;  2XL6 A;  1OW8 A;  1LPE A;  2J7P D;  3LS1 A;  4MVQ A;  1H7I A;  2L7A A;  5FZT A;  4BJ1 A;  2ZXW C;  4MTF A;  3RQF A;  3ZQV A;  2J0X A;  4ZLC A;  1WWP A;  2NG1 A;  2LFD A;  4I3M A;  2EIM C;  3EGD A;  2R7X A;  2YKZ A;  1G4W R;  1FFH A;  2VAS A;  1WTY A;  3IPM O;  4KNW A;  4XPW A;  4XQ1 A;  4CDY A;  2A0U A;  2DGJ A;  1OXB A;  1VYK A;  2YL3 A;  3GM1 A;  3Q7G A;  3TJ5 A;  5L0G A;  4Q4Z F;  2KSF A;  4C3D A;  4UDV A;  1Q0D A;  1APC A;  2G62 A;  3B29 A;  3JCU Q;  3DJN B;  1J8M F;  1Z23 A;  1TWA A;  2OJE D;  3NMI A;  2ETS A;  1CGO A;  2WZG A;  5D92 A;  2XSE A;  1RJ9 B;  5E2Q A;  5L0F A;  3G50 A;  4HE8 D;  4DBR A;  1YAR O;  4E7Z A;  2V3C C;  3UR3 C;  1FAP B;  3NDB B;  2AU5 A;  3AJM A;  4U5G A;  4E0I A;  3GOR A;  2EPM X;  4WGY A;  4YL1 A;  3SNH A;  3RKO F;  1E84 A;  4O6Y A;  4O6M A;  4CSA A;  2G3K A;  3R7C A;  2XLH A;  4YL0 A;  4JJG A;  3U3F A;  5JUA A;  3JRM O;  1ZZP A;  4O79 A;  2NSG A;  4XPY A;  2DI3 A;  2YQY A;  2H7V C;  3H2V A;  4JZA A;  2PNO A;  4D4X A;  3OWT A;  3MLG A;  3V7O A;  2P7V A;  4J7T A;  3K66 A;  3TJ6 A;  4DRH B;  4Q5S F;  4ZLD A;  2M4E A;  3AOU A;  2MWQ A;  3CEX A;  2VH3 A;  1K05 A;  4O6N A;  2YL0 A;  3Q6M A;  2YRF A;  2R7U A;  5CIV A;  3K1I A;  4EBJ A;  3K1I C;  1IW7 F;  5A6B D;  2WVO A;  3ZQY A;  2L6H A;  5A6B A;  1JR8 A;  2Q4F A;  1VTM P;  3C18 A;  3K7D A;  4DXW A;  2CNW D;  1OKK D;  4W8P A;  2XLO A;  4FAP B;  3V5Z A;  1M2V A;  4PK4 A;  5L0I A;  1NU7 D;  2IXN A;  1LIH A;  3W2V A;  5AGF A;  2WVQ A;  4B6I A;  3C8Z A;  1MMA A;  4PFO A;  2MYS A;  3RQG A;  4A2N B;  3L0I A;  5JLI A;  4MQ9 F;  2D4U A;  4NTB A;  1NU9 C;  4G7O F;  2DYS C;  3DM5 A;  2A1D D;  3I4U A;  2PBE A;  2A6H F;  2C03 A;  2XXA B;  3SXY A;  4LER A;  2CNW A;  2GDC A;  3O10 A;  3OA1 A;  2A6E F;  1Z3I X;  4WAB A;  4NCQ A;  1LS1 A;  3IQC A;  4NTF A;  3QMK A;  5E3C A;  3EPV A;  2AVK A;  1V54 C;  1ZHT A;  1NFO A;  4HFF B;  4NC3 A;  3TOM A;  5B3S C;  2I8B A;  2H7B A;  4CS7 A;  4BJ5 A;  4KC9 A;  4IAR A;  3SEO A;  5A6K A;  4EUK B;  4BJ5 C;  4H4K C;  1YYJ A;  3SZR A;  1LI5 A;  2IXO A;  3W4Y A;  3HNL A;  2A0B A;  1AUE A;  3JRT A;  1RKE B;  3U3B A;  1PCX A;  4E0H A;  2FGY A;  2Q9B A;  3O6X A;  3Q6N A;  2L6G A;  4ONS A;  3WAQ A;  2HMQ A;  3AGU A;  4E7S A;  1RKE A;  1Q0G A;  1R4T A;  2KW3 C;  4OIN F;  3G4Z A;  2EIJ C;  1JRA A;  5B1A C;  2P1A A;  1KTM A;  3EHN A;  2R9R B;  4LLC A;  3QTH A;  3RIP A;  2OKU A;  2ZXP A;  1N1C A;  2G3V A;  2XRH A;  4JCZ A;  4AX2 A;  4I1M A;  4YWQ A;  3CZ6 A;  2EPK X;  2ASR A;  5K0I A;  3HNK A;  2RD9 A;  3GWL A;  4I44 A;  1T6U A;  3RH3 A;  4YT2 A;  1ZVZ A;  4AL0 A;  4HEA J;  4E18 A;  1LVK A;  2Q00 A;  3EZH A;  2UUH A;  4P9F A;  1WAS A;  1UFB A;  3UNG C;  3EH1 A;  1HW2 A;  4G0H A;  2R7W A;  1TR2 A;  4H54 A;  1QSP A;  3PHF 2;  4RDA A;  4CDV A;  3NRH A;  4JKV A;  3TD7 A;  1YJG A;  1ZHW A;  1OR2 A;  5B1B C;  1OCR C;  4EWC A;  1DOV A;  5IY5 C;  4G7H F;  5KYX B;  4OIR F;  1LE2 A;  3AGT A;  1SMY F;  4JE9 A;  4OD4 A;  4NY3 A;  1E83 A;  4CS8 A;  4HFK B;  3VYW A;  3B0U X;  4GYT A;  2HSB A;  4YT8 A;  1OR3 A;  2PX3 A;  1D0X A;  3JZ0 A;  5KYW A;  1ZHY A;  3RQE A;  1E2X A;  1TFO B;  3CSK A;  3M1C B;  4XPX A;  1FR0 A;  5JVE A;  1F1M A;  1YAU O;  1T01 A;  3NYL A;  1PV3 A;  2YLD A;  1OW6 A;  4XEV A;  5CI8 A;  4PJN A;  1QZX A;  3AG4 C;  5BQI A;  2XLV A;  3WG7 C;  3UGO A;  3TOL A;  3IHU A;  3ASO C;  1ZW2 A;  2LCH A;  4D4N A;  1OCC C;  1I5N A;  2VB6 A;  3C8G D;  1CPR A;  5L0C A;  1EA8 A;  1Z63 A;  4DBQ A;  4BG0 A;  2JX0 A;  4XEF A;  1A0B A;  3PCV A;  2UUI A;  1T9K A;  2FAP B;  2YL1 A;  3B0V C;  4U5C E;  2YEV A;  1Q0K A;  3Q7L A;  1HY5 A;  2HV7 A;  2X51 A;  1Z5Z A;  5T3W A;  2CGE A;  5A6A A;  2NUP B;  4X0R A;  4BEJ A;  1YLM A;  4YT5 A;  4BPM A;  1PD1 A;  3JSZ A;  5FCL A;  2HUJ A;  4CIH A;  1SR2 A;  2FFH A;  5HV9 A;  2YL7 A;  4JEA A;  4DOZ A;  2MHR A;  3M15 A;  3ZIB A;  4EBK A;  4U5F E;  4AK9 A;  2H8A A;  3DD7 A;  5CI9 A;  1J8Y F;  1VOM A;  1T6I A;  2XL4 A;  4JCH A;  3SP1 A;  2OEV A;  2NPU A;  3AG3 C;  3I5Q A;  1HE1 A;  1MMD A;  2CDQ A;  1NZE A;  4PR9 A;  1M2O A;  4P9T A;  4ULW A;  2J9B A;  2H7O A;  2XLE A;  3DM9 B;  4YL3 A;  5E3A A;  5DLJ A;  2PP4 A;  3ITF A;  5JS5 A;  3GWN A;  3VRC A;  1Y4C A;  1XZQ A;  2XM0 A;  4JW1 A;  3KYI A;  5E33 A;  3NKD A;  5AC4 A;  1VYI A;  3EZI A;  1YZA A;  3EGX B;  1YA7 O;  1WGW A;  2HZ8 A;  3JT1 A;  4YK5 A;  5D91 A;  3T6J A;  3T6B A;  1OW7 A;  1EI7 A;  4JTD B;  4U5E E;  3K1H A;  1A41 A;  2HFI A;  4LDR A;  4LDK A;  2XLW A;  3LJB A;  4DJ9 A;  1M56 C;  5DQZ A;  3TQO A; 
#chains in the Genus database with same CATH homology
 4E18 A;  2HSQ A;  3ZDL A;  5L0H A;  2LQG A;  3S90 A;  1T01 A;  2IBF A;  1H6G A;  1RKC A;  3TJ5 A;  1RKE B;  1L7C A;  5L0G A;  3H2V A;  2X0C A;  4EHP A;  4ONS A;  3VF0 A;  3H2U A;  1TR2 A;  4PR9 A;  1ST6 A;  1QKR A;  1RKE A;  2B0H A;  3RF3 A;  3TJ6 A;  4P9T A;  1XWJ A;  1ZW2 A;  2GDC A;  5L0F A;  3MYI A;  5L0D A;  1DOV A;  4E17 A;  5L0C A;  1YDI A;  4IGG A;  3T6G B;  5L0J A;  1U6H A;  4K1O A;  2GWW A;  5FZT A;  2L7A A;  1DOW A;  1U89 A;  4W8P A;  1ZW3 A;  4DJ9 A;  1ZVZ A;  5L0I A;  1SYQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...