3RF3A

Shigella ipaa-vbs3 in complex with human vinculin
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
257
structure length
257
Chain Sequence
PVFHTRTIESILEPVAQQISHLVIMHEEGEVDGKAIPDLTAPVAAVQAAVSNLVRVGKETVQTTEDQILKRDMPPAFIKVENACTKLVQAAQMLQSDPYSVPARDYLIDGSRGILSGTSDLLLTFDEAEVRKIIRVCKGILEYLTVAEVVETMEDLVTYTKNLGPGMTKMAKMIDERQQELTHQEHRVMLVNSMNTVKELLPVLISAMKIFVTTKNSKNQGIEEALKNRNFTVEKMSAEINEIIRVLQLTSWDEDAW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding/toxin
molecule keywords Vinculin
publication title Novel vinculin binding site of the IpaA invasin of Shigella.
pubmed doi rcsb
source organism Homo sapiens
total genus 116
structure length 257
sequence length 257
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-04-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 3rf3A02
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 3rf3A01
3H2UA 1L7CA 1XWJA 1ST6A 4EHPA 1ZW3A 2IBFA 1T01A 3VF0A 3MYIA 4ONSA 5L0CA 1YDIA 1DOWA 5L0JA 1ZVZA 2GWWA 2B0HA 2L7AA 1TR2A 1H6GA 3ZDLA 1ZW2A 4IGGA 4W8PA 4DJ9A 4K1OA 5L0DA 5L0GA 3TJ5A 3H2VA 3RF3A 3S90A 1RKCA 5L0FA 5L0HA 2X0CA 1DOVA 2LQGA 3T6GB 4PR9A 5L0IA 1QKRA 1SYQA 1U6HA 2GDCA 1RKEA 5FZTA 3TJ6A 4E17A 1U89A 4P9TA 4E18A 2HSQA 1RKEB
chains in the Genus database with same CATH superfamily
3L8JA 3O39A 4U5BE 1QSPA 2NUPA 5L0CA 3VAYA 2HKVA 2R05A 2Z15A 3L1MA 1IZMA 4U5FE 2Y3HA 1I5NA 1MMAA 3NKDA 2Y69C 1S05A 1ZYRF 5JLIA 2Q9AA 2CCYA 1G4WR 2CW0F 1Y6DA 2V26A 3LNMB 4K0DA 4E0HA 4XLPF 4AE4B 3DZAA 1ZW2A 4U5DE 3U8VA 3IEEA 2C04A 1W2WA 4H54A 1VK5A 1OW7A 4E0IA 4ER9A 1NU9C 1QQ3A 2EPLX 2IM8A 3ZQYA 3S84A 1CGOA 1FNTc 1A7VA 5AGFA 4WGZA 1EQ1A 4M63A 3UGOA 2IXPA 2TMVP 2HZ8A 3U0CA 3US6A 2OQMA 1JPJA 2HMZA 3QTHA 5FZTA 1A0BA 1BR2A 1D1BA 4BJ1A 5EGYA 1RKEB 4YT5A 3DJNB 4JVSA 2EPNA 1F1MA 1HY5A 1E85A 5HV9A 1MMNA 1TWHA 2YL0A 3WG7C 4BJTA 2R7XA 3DWWA 2OCCC 2PF4E 4IB4A 3E70C 4MQ9F 4U5CE 4I3MA 3EGDB 1I4YA 2HUJA 5E2QA 3LNRA 2L6FA 3N24A 4KI2A 3ITFA 4DRHB 4G7OF 2XXAA 1FTSA 2RD9A 4MVRA 1GGQA 3SEOA 3EPVA 1RKCA 2OEVA 5BUOA 5KYXB 5IY5C 3LUTB 1U0BB 3GODA 2YL7A 2A6EF 4YT4A 2J9UA 4IAOA 1BZ4A 1BBHA 4PR9A 3F46A 4DVZA 1SYQA 2VC9A 1NZEA 3EHMA 4XEFA 2NG1A 3TOLA 4KNVA 5JSLA 4DBQA 3GWLA 2W45A 1Z3IX 4JTAB 1L7CA 1YARO 2XLDA 4XLNF 4XQ1A 1TQGA 4AL0A 4FESA 1WTYA 3LS1A 4BEMJ 5JP7A 1MNEA 5B1BC 1DOWA 3ABLC 3QZCA 2CYDA 5E3AA 1E83A 4BJ5A 2Y3BA 1TR2A 3JRTA 3M79A 1H6GA 5F28E 2KYHA 4N6CA 1JRAA 4AE4A 2NSGA 1O5HA 3HNIA 4PJMA 3I5PA 4YJWA 3SNHA 2NUTA 3W2VA 2V3CC 2OG2A 5HSWA 3NYMA 3W2WA 3ASOC 1BR1A 5KYUB 1LVKA 1OQCA 3IQCA 4JCHA 3EFOB 4EBKA 1C03A 2NSFA 2Y39A 2XL8A 3KH2A 4Z9IA 4G7ZF 2R7UA 3DE8A 3G4ZA 1RJ9A 3ABKC 3JSZA 4WABA 3W8IA 1O87A 1T6IA 3ATPA 1H7IA 4CS7A 3QVZA 4U5GA 1ZHTA 3CZ6A 4C3EA 1ST6A 2GA0A 3VF0A 4E7ZA 5KYNA 3K1HA 1QPUA 2NUPB 3PDMP 5COMA 1D1AA 1VYIA 5L3QA 4N4WA 2M4EA 2WVQA 3T6JA 3RVYA 3ECSA 3HNJA 1YJGA 2HFIA 4B6IA 4O7GA 3B0VC 5EK0A 1LIHA 2R7SA 1G5ZA 4DOZA 1OCOC 4L6RA 2XLMA 1LE2A 3AGTA 4PJLA 3JSEO 3R7CA 5L0GA 1YAUO 3RF3A 1VOMA 5DS6A 3G50A 3AOUA 2QTVA 3QW1A 5KYWA 3ASNC 3GEEA 3LAYA 1NBBA 4Q4ZF 1B68A 3RVZA 3KYJA 1Y4CA 2J0WA 4CS9C 4LDQA 3GM3A 2A68F 3FXHA 4E18A 3NDBB 2P1AA 1OR3A 3RH3A 3GANA 1NSGB 1FMVA 3C8GA 3FAPB 3O6XA 4KNWA 1LI7A 2J8WA 5T3TA 4JIOA 2Q00A 4Z9HA 4HFFB 1ZVZA 2WL8A 3M1CB 3ZWIA 4C3BA 4EWCA 4ANJA 1H9TA 1EA8A 1PD1A 4XTKA 2VCCA 4IRUA 3C63A 1V4AA 2LIGA 3S0XA 3WODF 1YZCA 2XS1A 3TD7A 4OIOF 2G62A 2KK1A 4U5EE 1LI5A 5D92A 2IXMA 5AC4A 2H7VC 3Q6MA 3OEOA 2XXAB 5D91A 2P0NA 2HSBA 3AG3C 2JX0A 2WB7A 3G4XA 3GM1A 4JEBA 4OIRF 3PHF2 3B29A 3SXYA 1AVOB 1CPQA 3AG2C 1YVIA 1A7DA 2PBEA 3FMSA 4JTCB 3B0PA 4JZAA 3EQLF 3EJNA 4LERA 1A41A 4O6NA 4PK4A 3V7OA 3SYNA 2XM0A 1ZHXA 3TQOA 3QVYA 4CX9A 4Q5SF 2LFFA 2EPMX 1XWJA 3H2UA 3DD7A 2Q9BA 2EIKC 4JKVA 3AJMA 4MTGA 1WOLA 4QI0A 1NFNA 3RYLA 3NMIA 3SXMA 4YT8A 1M56C 3IQ6A 5E33A 3LS0A 4DVYP 4QI2A 2EIMC 2WZLA 4K7BA 1M2VA 4MTOA 4HFKB 1SZIA 3N2ZB 4MW3A 2R7OA 3TK0A 1WWPA 2YZSA 2W9YA 4CIPA 1TFKB 2A0UA 3C8GD 5B3SC 2P7VA 4H4KC 1L3PA 1ORSC 1SMYF 1MQVA 1NU7D 1ZU4A 2NUTB 3H2VA 3EG9A 2VCBA 3HNKA 3K7DA 4FWVA 2R7VA 1DOVA 4DXWA 1T5OA 4J32B 3UMHA 3UR3C 3ZQVA 1JAFA 3FDQA 4DRJB 1VTMP 4YK5A 4P9TA 3T9OA 2BC5A 3N0TA 2FAPB 1RJ9B 1MMDA 1CPRA 2RSEB 2ICWG 3AG1C 3HLZA 4I1MA 3U8PA 3KL4A 1WGWA 3LLKA 4Z9JA 2XRHA 3CAXA 4GYTA 3U3FA 4LDKA 2OKUA 2L6HA 5F5HA 2Q7RA 3UNGC 2E87A 4BPMA 1YZAA 4A4AA 4C7OA 2IXNA 1GS9A 1Z7Qc 1MMGA 5KYYA 1HE9A 1D0XA 2ETSA 4GEHA 4CS8C 1R5ID 2YLIA 3MFNA 4GQHA 2Q3TA 2XLWA 5KYWB 3CSKA 3OA1A 3A11A 4CSAC 3GEIA 2L6GA 3SP1A 3S27A 1FR0A 3SZRA 4XPXA 2L81A 1H9GA 4JTDB 4A2NB 1GQAA 1C02A 5L0FA 4JJFA 1BDJB 2NPUA 3F47A 4LLCA 4CIHA 1Z23A 1YYJA 3S28A 1OXKA 3TOMA 3JTLO 3C8GB 2YEVA 1ORJA 4DBRA 3FOOA 3M4BA 3K1IC 5DVWA 3O10A 1VLSA 5L0JA 2J45A 2Q9CA 1QLEC 1J8MF 3NYJA 1OCZC 1KU2A 4NTFA 4WGYA 5GPGB 3U2MA 1K05A 4F4BA 5JS5A 4XWJA 2YLDA 1UG7A 2QNLA 3JT1A 1NLXA 2MHRA 4RD9A 1PV3A 4MVOA 3RKOF 4J7TA 3HTKC 2R7TA 5L0HA 4U9EA 4CJOA 3H65A 3NMKA 4AX2A 3V5XA 4AL1A 2YVKA 3DAFA 4CS9A 5L0IA 5TJ5E 4OIQF 1LPEA 3IPMO 3NYLA 4NY3A 2ASRA 3AQCA 5FCLA 3C62A 3RQFA 1CGNA 4PJNA 2Y3DA 2IBFA 2MYSA 1ZZPA 3C7JA 2F22A 1BR4A 2JPUA 4I1OB 3WHNA 1LS4A 4MTFA 4G7HF 3FAJA 3VYWA 1OW8A 1PD0A 4PJJA 2GWWA 1TWGA 3MBGA 1FAPB 5CI8A 1AEPA 2BE5F 2GAQA 2BL2A 4D4NA 3ABMC 2CNWA 4NCQA 3SXKA 256BA 5L3VA 2KNHA 1LS1A 2I15A 2LCHA 2VB6A 2YHSA 3DE9A 4PACA 5A69A 1M2VB 3S29A 3AQBA 4K1OA 2WZFA 2L9JA 3LLIA 3S90A 3CEXA 1KNYA 3NMJA 4W8KA 3AGUA 3JYYA 3K66A 1LM3B 1XZQA 1YLMA 3EG9B 2WVOA 1SR2A 1NFOA 2OEXA 2QY9A 1Z5ZA 3JRMO 3KYIA 2KW3C 1U6HA 3TJ6A 4G78A 3DM5A 2KQ9A 1JOGA 1OCCC 4CBEA 2PNOA 3EHNA 2W4MA 2XSEA 2KSFA 3FHDA 4LDRA 2XLEA 5K0IA 2YLGA 4EHPA 4FAPB 1YA7O 1E84A 1S7ZA 2HV6A 4U5HA 4RBNA 3B0UX 2LD6A 2UUHA 1RMVA 1RXQA 1TWAA 3LEOA 3OWTA 2A0BA 1V74B 2A6HF 4J7YA 3SXZA 1YA9A 1ORYA 2D5RB 2DGJA 4CJGA 1HE1A 3X2QC 4DJ9A 2DYRC 1V54C 4IARA 5L0DA 4C7OB 3TJ5A 5BQIA 1NG1A 5KYYB 1JR8A 2I8BA 2GFHA 3NRHA 4HE8D 4JURI 4LLEA 3X1OA 1Z63A 1E2XA 2CNWD 1K04A 5DS5A 3ZSUA 1Q0KA 2VH3A 3V5ZA 4YT2A 3L34A 2A69F 1C17M 3BRJA 2H7BA 2R9RB 2XLOA 3ZG1A 5JT4A 1HW1A 4Q7CA 2PX0A 5A6BA 1T01A 2W4BA 3NG1A 1EI7A 5DLJA 1SF8A 2PX3A 2Q4FA 3W4YA 1HMOA 3RQEA 4BJ6C 4PFOA 4EIYA 2AWCA 5F5FA 1OW6A 2QLAA 3MX3A 4ULVA 1JPNA 2KJGA 4OD5A 3GM2A 3RW0A 2J9WA 3RQGA 4IGGA 2JD3A 1G4US 1FMWA 4J30B 4CS8A 2FFHA 5BQHA 2QE9A 5COFA 4P6IC 1PCXA 2YWAA 2A1DD 4LACB 5DQZA 4ZLCA 4CSAA 2VCAA 5COGA 3U9JA 4FX5A 1D1CA 2HS5A 2H8AA 1M6TA 2LQGA 3HJCA 3K6BA 3U9MA 2LP4A 2R7RA 2R7WA 1M2OA 4E17A 3S9OA 1TFOB 4PFPA 4MVZA 1OXBA 1U89A 1FFTC 4W8PA 1XZPA 3UMIA 2Y3GA 5E3CA 4O79A 1VB5A 2B0JA 2CDQA 3TULA 4UDVA 1QZXA 1CGME 2PFDA 1E86A 3EGXA 5JUAA 1T6QA 1ZW3A 3K1IA 2EIJC 4EKWA 3MYIA 4EBJA 3DAGA 3MLGA 2EILC 5CIVA 1TKNA 4OIPF 4ZLDA 2IXOA 1KTMA 3KPHA 2G3VA 4MNDA 1Z6AA 3U2LA 3GWNA 1FFHA 3C18A 3IHUA 4D4XA 3K33A 4NQFA 4U9DA 3VM6A 4BEJA 1Q0GA 5A6BD 1UFBA 2HMQA 1T6UA 5T3WA 2XS8A 3EH2A 2YRFA 2J46A 2M64A 2MWQA 2YL3A 2FGYA 1VMAA 3RIPA 3DKAA 4CDYA 3Q7LA 1OKKD 2DYSC 1QKRA 3EZHA 2DI3A 2ZXWC 1HW2A 2H7OA 3NKEA 4JRZA 1LE4A 3A9CA 4MW8A 3ZC4A 3UGPA 4MVMA 3IQ5A 3I4UA 4O6YA 5A6JA 3E9VA 1YDIA 4KC9A 4OD4A 3PMRA 1Q0MA 4XEKA 3W8HA 3LESA 2P6VA 1I4ZA 3Q6NA 5AC5A 1OR2A 3U5SA 1RCPA 1ZHZA 2J9BA 1MNDA 2XM4A 1M57C 2ZXRA 1HMDA 1O3UA 3I5QA 3JYHA 3LEVA 4JCZA 2IYLD 2J9VA 4E7SA 3DI5A 3ZTMA 3BEHA 1D0ZA 2WZGA 1Q0DA 2KGOA 3L0IA 3MYFA 3B9QA 3M4CA 2GDCA 4WJ0A 2R7QA 4IAQA 1K40A 1V55C 2OJED 2G3KA 3QW0A 2P61A 1LKXA 1OCRC 2XL6A 5JVEA 3O55A 2XLVA 2LSEA 4G0HA 2YKZA 1IW7F 4C3DA 4QDLA 4CDAA 4JC7A 2DB4A 2B0HA 1Q0FA 1WATA 2ZXPA 5EHHA 1N1CA 4NC3A 1WN0A 2J7PA 2XLHA 2X51A 1J8YF 3CQZA 1VLTA 3KMIA 3DXJF 2AU5A 4X0RA 3RFYA 3LJBA 4MVUA 3GORA 5BQGA 3AG4C 4JEAA 4YN0B 2PP4A 3ZIBA 1VYKA 2YL1A 3M15A 3Q7GA 4YL3A 2YQYA 3L8IA 5DS4A 2ZXOA 3B71A 5T1DB 1RKEA 3FOPA 4EUKB 1R4TA 4P9FA 1ZHYA 2O9XA 3KKBA 3U3BA 5B3IA 4R32A 4NTBA 4YL0A 4YWQA 4BJ6A 2QUPA 2XL4A 3EGXB 4EBBA 4RDAA 4XPYA 3EGDA 5B1AC 3T4RA 2L7AA 4IJJA 5A6AA 2EPOA 2R25A 3FVYA 2ZPAA 2EPKX 1YYXA 1QVXA 1TWCA 2R03A 2OOCA 3EH1A 4HEAJ 4KBLA 3JZ0A 4MVQA 2HJ3A 4BJ5C 3R2PA 2LK4A 5KYXA 4JJGA 4BG0A 3IQTA 2KC3A 4XPWA 2HV7A 4ULWA 2WVNA 2UUIA 3C8ZA 3GEHA 1A7EA 4N06A 2AWYA 1G8XA 4AK9A 2J7PD 5A6KA 3DMDA 4DRIB 3ZTZA 2X0CA 1GM5A 1D0YA 2EINC 4OINF 3UMKA 4JE9A 3T6BA 4MVSA 4ONSA 1AUEA 2AP3A 2OJQA 3HKKA 1T9KA 2IOQA 2OU6A 2HJMA 4XEVA 3ZVRA 3QMKA 5CI9A 4I44A 4JW1A 4NTAA 5DQTA 2ZD9A 1WASA 4N6HA 1OKKA 5JRAA 2VASA 4YL1A 3ZDLA 2D4UA 1APCA 3PCVA 3EZIA 2LFDA 2AVKA 3J06A 3DJUB 2C03A 5KYUA 1JMWA 4O6MA 3DM9B 3VRCA 4IWBA 3EFOA 4MS2A 1ZHWA 3V5YA 3POVA 3T6GB 3HNLA 1EKYA 3JCUQ 2CGEA 2J0XA 3WAQA 2R02A 1ZU5A 2HSQA 4CDVA
chains in the Genus database with same CATH topology
3H2UA 1L7CA 1XWJA 1ST6A 4EHPA 1ZW3A 2IBFA 1T01A 3VF0A 3MYIA 4ONSA 5L0CA 1YDIA 1DOWA 5L0JA 1ZVZA 2GWWA 2B0HA 2L7AA 1TR2A 1H6GA 3ZDLA 1ZW2A 4IGGA 4W8PA 4DJ9A 4K1OA 5L0DA 5L0GA 3TJ5A 3H2VA 3RF3A 3S90A 1RKCA 5L0FA 5L0HA 2X0CA 1DOVA 2LQGA 3T6GB 4PR9A 5L0IA 1QKRA 1SYQA 1U6HA 2GDCA 1RKEA 5FZTA 3TJ6A 4E17A 1U89A 4P9TA 4E18A 2HSQA 1RKEB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H2U A;  1L7C A;  1XWJ A;  1ST6 A;  4EHP A;  1ZW3 A;  2IBF A;  1T01 A;  3VF0 A;  3MYI A;  4ONS A;  5L0C A;  1YDI A;  1DOW A;  5L0J A;  1ZVZ A;  2GWW A;  2B0H A;  2L7A A;  1TR2 A;  1H6G A;  3ZDL A;  1ZW2 A;  4IGG A;  4W8P A;  4DJ9 A;  4K1O A;  5L0D A;  5L0G A;  3TJ5 A;  3H2V A;  3RF3 A;  3S90 A;  1RKC A;  5L0F A;  5L0H A;  2X0C A;  1DOV A;  2LQG A;  3T6G B;  4PR9 A;  5L0I A;  1QKR A;  1SYQ A;  1U6H A;  2GDC A;  1RKE A;  5FZT A;  3TJ6 A;  4E17 A;  1U89 A;  4P9T A;  4E18 A;  2HSQ A;  1RKE B; 
#chains in the Genus database with same CATH topology
 3L8J A;  3O39 A;  4U5B E;  1QSP A;  2NUP A;  5L0C A;  3VAY A;  2HKV A;  2R05 A;  2Z15 A;  3L1M A;  1IZM A;  4U5F E;  2Y3H A;  1I5N A;  1MMA A;  3NKD A;  2Y69 C;  1S05 A;  1ZYR F;  5JLI A;  2Q9A A;  2CCY A;  1G4W R;  2CW0 F;  1Y6D A;  2V26 A;  3LNM B;  4K0D A;  4E0H A;  4XLP F;  4AE4 B;  3DZA A;  1ZW2 A;  4U5D E;  3U8V A;  3IEE A;  2C04 A;  1W2W A;  4H54 A;  1VK5 A;  1OW7 A;  4E0I A;  4ER9 A;  1NU9 C;  1QQ3 A;  2EPL X;  2IM8 A;  3ZQY A;  3S84 A;  1CGO A;  1FNT c;  1A7V A;  5AGF A;  4WGZ A;  1EQ1 A;  4M63 A;  3UGO A;  2IXP A;  2TMV P;  2HZ8 A;  3U0C A;  3US6 A;  2OQM A;  1JPJ A;  2HMZ A;  3QTH A;  5FZT A;  1A0B A;  1BR2 A;  1D1B A;  4BJ1 A;  5EGY A;  1RKE B;  4YT5 A;  3DJN B;  4JVS A;  2EPN A;  1F1M A;  1HY5 A;  1E85 A;  5HV9 A;  1MMN A;  1TWH A;  2YL0 A;  3WG7 C;  4BJT A;  2R7X A;  3DWW A;  2OCC C;  2PF4 E;  4IB4 A;  3E70 C;  4MQ9 F;  4U5C E;  4I3M A;  3EGD B;  1I4Y A;  2HUJ A;  5E2Q A;  3LNR A;  2L6F A;  3N24 A;  4KI2 A;  3ITF A;  4DRH B;  4G7O F;  2XXA A;  1FTS A;  2RD9 A;  4MVR A;  1GGQ A;  3SEO A;  3EPV A;  1RKC A;  2OEV A;  5BUO A;  5KYX B;  5IY5 C;  3LUT B;  1U0B B;  3GOD A;  2YL7 A;  2A6E F;  4YT4 A;  2J9U A;  4IAO A;  1BZ4 A;  1BBH A;  4PR9 A;  3F46 A;  4DVZ A;  1SYQ A;  2VC9 A;  1NZE A;  3EHM A;  4XEF A;  2NG1 A;  3TOL A;  4KNV A;  5JSL A;  4DBQ A;  3GWL A;  2W45 A;  1Z3I X;  4JTA B;  1L7C A;  1YAR O;  2XLD A;  4XLN F;  4XQ1 A;  1TQG A;  4AL0 A;  4FES A;  1WTY A;  3LS1 A;  4BEM J;  5JP7 A;  1MNE A;  5B1B C;  1DOW A;  3ABL C;  3QZC A;  2CYD A;  5E3A A;  1E83 A;  4BJ5 A;  2Y3B A;  1TR2 A;  3JRT A;  3M79 A;  1H6G A;  5F28 E;  2KYH A;  4N6C A;  1JRA A;  4AE4 A;  2NSG A;  1O5H A;  3HNI A;  4PJM A;  3I5P A;  4YJW A;  3SNH A;  2NUT A;  3W2V A;  2V3C C;  2OG2 A;  5HSW A;  3NYM A;  3W2W A;  3ASO C;  1BR1 A;  5KYU B;  1LVK A;  1OQC A;  3IQC A;  4JCH A;  3EFO B;  4EBK A;  1C03 A;  2NSF A;  2Y39 A;  2XL8 A;  3KH2 A;  4Z9I A;  4G7Z F;  2R7U A;  3DE8 A;  3G4Z A;  1RJ9 A;  3ABK C;  3JSZ A;  4WAB A;  3W8I A;  1O87 A;  1T6I A;  3ATP A;  1H7I A;  4CS7 A;  3QVZ A;  4U5G A;  1ZHT A;  3CZ6 A;  4C3E A;  1ST6 A;  2GA0 A;  3VF0 A;  4E7Z A;  5KYN A;  3K1H A;  1QPU A;  2NUP B;  3PDM P;  5COM A;  1D1A A;  1VYI A;  5L3Q A;  4N4W A;  2M4E A;  2WVQ A;  3T6J A;  3RVY A;  3ECS A;  3HNJ A;  1YJG A;  2HFI A;  4B6I A;  4O7G A;  3B0V C;  5EK0 A;  1LIH A;  2R7S A;  1G5Z A;  4DOZ A;  1OCO C;  4L6R A;  2XLM A;  1LE2 A;  3AGT A;  4PJL A;  3JSE O;  3R7C A;  5L0G A;  1YAU O;  3RF3 A;  1VOM A;  5DS6 A;  3G50 A;  3AOU A;  2QTV A;  3QW1 A;  5KYW A;  3ASN C;  3GEE A;  3LAY A;  1NBB A;  4Q4Z F;  1B68 A;  3RVZ A;  3KYJ A;  1Y4C A;  2J0W A;  4CS9 C;  4LDQ A;  3GM3 A;  2A68 F;  3FXH A;  4E18 A;  3NDB B;  2P1A A;  1OR3 A;  3RH3 A;  3GAN A;  1NSG B;  1FMV A;  3C8G A;  3FAP B;  3O6X A;  4KNW A;  1LI7 A;  2J8W A;  5T3T A;  4JIO A;  2Q00 A;  4Z9H A;  4HFF B;  1ZVZ A;  2WL8 A;  3M1C B;  3ZWI A;  4C3B A;  4EWC A;  4ANJ A;  1H9T A;  1EA8 A;  1PD1 A;  4XTK A;  2VCC A;  4IRU A;  3C63 A;  1V4A A;  2LIG A;  3S0X A;  3WOD F;  1YZC A;  2XS1 A;  3TD7 A;  4OIO F;  2G62 A;  2KK1 A;  4U5E E;  1LI5 A;  5D92 A;  2IXM A;  5AC4 A;  2H7V C;  3Q6M A;  3OEO A;  2XXA B;  5D91 A;  2P0N A;  2HSB A;  3AG3 C;  2JX0 A;  2WB7 A;  3G4X A;  3GM1 A;  4JEB A;  4OIR F;  3PHF 2;  3B29 A;  3SXY A;  1AVO B;  1CPQ A;  3AG2 C;  1YVI A;  1A7D A;  2PBE A;  3FMS A;  4JTC B;  3B0P A;  4JZA A;  3EQL F;  3EJN A;  4LER A;  1A41 A;  4O6N A;  4PK4 A;  3V7O A;  3SYN A;  2XM0 A;  1ZHX A;  3TQO A;  3QVY A;  4CX9 A;  4Q5S F;  2LFF A;  2EPM X;  1XWJ A;  3H2U A;  3DD7 A;  2Q9B A;  2EIK C;  4JKV A;  3AJM A;  4MTG A;  1WOL A;  4QI0 A;  1NFN A;  3RYL A;  3NMI A;  3SXM A;  4YT8 A;  1M56 C;  3IQ6 A;  5E33 A;  3LS0 A;  4DVY P;  4QI2 A;  2EIM C;  2WZL A;  4K7B A;  1M2V A;  4MTO A;  4HFK B;  1SZI A;  3N2Z B;  4MW3 A;  2R7O A;  3TK0 A;  1WWP A;  2YZS A;  2W9Y A;  4CIP A;  1TFK B;  2A0U A;  3C8G D;  5B3S C;  2P7V A;  4H4K C;  1L3P A;  1ORS C;  1SMY F;  1MQV A;  1NU7 D;  1ZU4 A;  2NUT B;  3H2V A;  3EG9 A;  2VCB A;  3HNK A;  3K7D A;  4FWV A;  2R7V A;  1DOV A;  4DXW A;  1T5O A;  4J32 B;  3UMH A;  3UR3 C;  3ZQV A;  1JAF A;  3FDQ A;  4DRJ B;  1VTM P;  4YK5 A;  4P9T A;  3T9O A;  2BC5 A;  3N0T A;  2FAP B;  1RJ9 B;  1MMD A;  1CPR A;  2RSE B;  2ICW G;  3AG1 C;  3HLZ A;  4I1M A;  3U8P A;  3KL4 A;  1WGW A;  3LLK A;  4Z9J A;  2XRH A;  3CAX A;  4GYT A;  3U3F A;  4LDK A;  2OKU A;  2L6H A;  5F5H A;  2Q7R A;  3UNG C;  2E87 A;  4BPM A;  1YZA A;  4A4A A;  4C7O A;  2IXN A;  1GS9 A;  1Z7Q c;  1MMG A;  5KYY A;  1HE9 A;  1D0X A;  2ETS A;  4GEH A;  4CS8 C;  1R5I D;  2YLI A;  3MFN A;  4GQH A;  2Q3T A;  2XLW A;  5KYW B;  3CSK A;  3OA1 A;  3A11 A;  4CSA C;  3GEI A;  2L6G A;  3SP1 A;  3S27 A;  1FR0 A;  3SZR A;  4XPX A;  2L81 A;  1H9G A;  4JTD B;  4A2N B;  1GQA A;  1C02 A;  5L0F A;  4JJF A;  1BDJ B;  2NPU A;  3F47 A;  4LLC A;  4CIH A;  1Z23 A;  1YYJ A;  3S28 A;  1OXK A;  3TOM A;  3JTL O;  3C8G B;  2YEV A;  1ORJ A;  4DBR A;  3FOO A;  3M4B A;  3K1I C;  5DVW A;  3O10 A;  1VLS A;  5L0J A;  2J45 A;  2Q9C A;  1QLE C;  1J8M F;  3NYJ A;  1OCZ C;  1KU2 A;  4NTF A;  4WGY A;  5GPG B;  3U2M A;  1K05 A;  4F4B A;  5JS5 A;  4XWJ A;  2YLD A;  1UG7 A;  2QNL A;  3JT1 A;  1NLX A;  2MHR A;  4RD9 A;  1PV3 A;  4MVO A;  3RKO F;  4J7T A;  3HTK C;  2R7T A;  5L0H A;  4U9E A;  4CJO A;  3H65 A;  3NMK A;  4AX2 A;  3V5X A;  4AL1 A;  2YVK A;  3DAF A;  4CS9 A;  5L0I A;  5TJ5 E;  4OIQ F;  1LPE A;  3IPM O;  3NYL A;  4NY3 A;  2ASR A;  3AQC A;  5FCL A;  3C62 A;  3RQF A;  1CGN A;  4PJN A;  2Y3D A;  2IBF A;  2MYS A;  1ZZP A;  3C7J A;  2F22 A;  1BR4 A;  2JPU A;  4I1O B;  3WHN A;  1LS4 A;  4MTF A;  4G7H F;  3FAJ A;  3VYW A;  1OW8 A;  1PD0 A;  4PJJ A;  2GWW A;  1TWG A;  3MBG A;  1FAP B;  5CI8 A;  1AEP A;  2BE5 F;  2GAQ A;  2BL2 A;  4D4N A;  3ABM C;  2CNW A;  4NCQ A;  3SXK A;  256B A;  5L3V A;  2KNH A;  1LS1 A;  2I15 A;  2LCH A;  2VB6 A;  2YHS A;  3DE9 A;  4PAC A;  5A69 A;  1M2V B;  3S29 A;  3AQB A;  4K1O A;  2WZF A;  2L9J A;  3LLI A;  3S90 A;  3CEX A;  1KNY A;  3NMJ A;  4W8K A;  3AGU A;  3JYY A;  3K66 A;  1LM3 B;  1XZQ A;  1YLM A;  3EG9 B;  2WVO A;  1SR2 A;  1NFO A;  2OEX A;  2QY9 A;  1Z5Z A;  3JRM O;  3KYI A;  2KW3 C;  1U6H A;  3TJ6 A;  4G78 A;  3DM5 A;  2KQ9 A;  1JOG A;  1OCC C;  4CBE A;  2PNO A;  3EHN A;  2W4M A;  2XSE A;  2KSF A;  3FHD A;  4LDR A;  2XLE A;  5K0I A;  2YLG A;  4EHP A;  4FAP B;  1YA7 O;  1E84 A;  1S7Z A;  2HV6 A;  4U5H A;  4RBN A;  3B0U X;  2LD6 A;  2UUH A;  1RMV A;  1RXQ A;  1TWA A;  3LEO A;  3OWT A;  2A0B A;  1V74 B;  2A6H F;  4J7Y A;  3SXZ A;  1YA9 A;  1ORY A;  2D5R B;  2DGJ A;  4CJG A;  1HE1 A;  3X2Q C;  4DJ9 A;  2DYR C;  1V54 C;  4IAR A;  5L0D A;  4C7O B;  3TJ5 A;  5BQI A;  1NG1 A;  5KYY B;  1JR8 A;  2I8B A;  2GFH A;  3NRH A;  4HE8 D;  4JUR I;  4LLE A;  3X1O A;  1Z63 A;  1E2X A;  2CNW D;  1K04 A;  5DS5 A;  3ZSU A;  1Q0K A;  2VH3 A;  3V5Z A;  4YT2 A;  3L34 A;  2A69 F;  1C17 M;  3BRJ A;  2H7B A;  2R9R B;  2XLO A;  3ZG1 A;  5JT4 A;  1HW1 A;  4Q7C A;  2PX0 A;  5A6B A;  1T01 A;  2W4B A;  3NG1 A;  1EI7 A;  5DLJ A;  1SF8 A;  2PX3 A;  2Q4F A;  3W4Y A;  1HMO A;  3RQE A;  4BJ6 C;  4PFO A;  4EIY A;  2AWC A;  5F5F A;  1OW6 A;  2QLA A;  3MX3 A;  4ULV A;  1JPN A;  2KJG A;  4OD5 A;  3GM2 A;  3RW0 A;  2J9W A;  3RQG A;  4IGG A;  2JD3 A;  1G4U S;  1FMW A;  4J30 B;  4CS8 A;  2FFH A;  5BQH A;  2QE9 A;  5COF A;  4P6I C;  1PCX A;  2YWA A;  2A1D D;  4LAC B;  5DQZ A;  4ZLC A;  4CSA A;  2VCA A;  5COG A;  3U9J A;  4FX5 A;  1D1C A;  2HS5 A;  2H8A A;  1M6T A;  2LQG A;  3HJC A;  3K6B A;  3U9M A;  2LP4 A;  2R7R A;  2R7W A;  1M2O A;  4E17 A;  3S9O A;  1TFO B;  4PFP A;  4MVZ A;  1OXB A;  1U89 A;  1FFT C;  4W8P A;  1XZP A;  3UMI A;  2Y3G A;  5E3C A;  4O79 A;  1VB5 A;  2B0J A;  2CDQ A;  3TUL A;  4UDV A;  1QZX A;  1CGM E;  2PFD A;  1E86 A;  3EGX A;  5JUA A;  1T6Q A;  1ZW3 A;  3K1I A;  2EIJ C;  4EKW A;  3MYI A;  4EBJ A;  3DAG A;  3MLG A;  2EIL C;  5CIV A;  1TKN A;  4OIP F;  4ZLD A;  2IXO A;  1KTM A;  3KPH A;  2G3V A;  4MND A;  1Z6A A;  3U2L A;  3GWN A;  1FFH A;  3C18 A;  3IHU A;  4D4X A;  3K33 A;  4NQF A;  4U9D A;  3VM6 A;  4BEJ A;  1Q0G A;  5A6B D;  1UFB A;  2HMQ A;  1T6U A;  5T3W A;  2XS8 A;  3EH2 A;  2YRF A;  2J46 A;  2M64 A;  2MWQ A;  2YL3 A;  2FGY A;  1VMA A;  3RIP A;  3DKA A;  4CDY A;  3Q7L A;  1OKK D;  2DYS C;  1QKR A;  3EZH A;  2DI3 A;  2ZXW C;  1HW2 A;  2H7O A;  3NKE A;  4JRZ A;  1LE4 A;  3A9C A;  4MW8 A;  3ZC4 A;  3UGP A;  4MVM A;  3IQ5 A;  3I4U A;  4O6Y A;  5A6J A;  3E9V A;  1YDI A;  4KC9 A;  4OD4 A;  3PMR A;  1Q0M A;  4XEK A;  3W8H A;  3LES A;  2P6V A;  1I4Z A;  3Q6N A;  5AC5 A;  1OR2 A;  3U5S A;  1RCP A;  1ZHZ A;  2J9B A;  1MND A;  2XM4 A;  1M57 C;  2ZXR A;  1HMD A;  1O3U A;  3I5Q A;  3JYH A;  3LEV A;  4JCZ A;  2IYL D;  2J9V A;  4E7S A;  3DI5 A;  3ZTM A;  3BEH A;  1D0Z A;  2WZG A;  1Q0D A;  2KGO A;  3L0I A;  3MYF A;  3B9Q A;  3M4C A;  2GDC A;  4WJ0 A;  2R7Q A;  4IAQ A;  1K40 A;  1V55 C;  2OJE D;  2G3K A;  3QW0 A;  2P61 A;  1LKX A;  1OCR C;  2XL6 A;  5JVE A;  3O55 A;  2XLV A;  2LSE A;  4G0H A;  2YKZ A;  1IW7 F;  4C3D A;  4QDL A;  4CDA A;  4JC7 A;  2DB4 A;  2B0H A;  1Q0F A;  1WAT A;  2ZXP A;  5EHH A;  1N1C A;  4NC3 A;  1WN0 A;  2J7P A;  2XLH A;  2X51 A;  1J8Y F;  3CQZ A;  1VLT A;  3KMI A;  3DXJ F;  2AU5 A;  4X0R A;  3RFY A;  3LJB A;  4MVU A;  3GOR A;  5BQG A;  3AG4 C;  4JEA A;  4YN0 B;  2PP4 A;  3ZIB A;  1VYK A;  2YL1 A;  3M15 A;  3Q7G A;  4YL3 A;  2YQY A;  3L8I A;  5DS4 A;  2ZXO A;  3B71 A;  5T1D B;  1RKE A;  3FOP A;  4EUK B;  1R4T A;  4P9F A;  1ZHY A;  2O9X A;  3KKB A;  3U3B A;  5B3I A;  4R32 A;  4NTB A;  4YL0 A;  4YWQ A;  4BJ6 A;  2QUP A;  2XL4 A;  3EGX B;  4EBB A;  4RDA A;  4XPY A;  3EGD A;  5B1A C;  3T4R A;  2L7A A;  4IJJ A;  5A6A A;  2EPO A;  2R25 A;  3FVY A;  2ZPA A;  2EPK X;  1YYX A;  1QVX A;  1TWC A;  2R03 A;  2OOC A;  3EH1 A;  4HEA J;  4KBL A;  3JZ0 A;  4MVQ A;  2HJ3 A;  4BJ5 C;  3R2P A;  2LK4 A;  5KYX A;  4JJG A;  4BG0 A;  3IQT A;  2KC3 A;  4XPW A;  2HV7 A;  4ULW A;  2WVN A;  2UUI A;  3C8Z A;  3GEH A;  1A7E A;  4N06 A;  2AWY A;  1G8X A;  4AK9 A;  2J7P D;  5A6K A;  3DMD A;  4DRI B;  3ZTZ A;  2X0C A;  1GM5 A;  1D0Y A;  2EIN C;  4OIN F;  3UMK A;  4JE9 A;  3T6B A;  4MVS A;  4ONS A;  1AUE A;  2AP3 A;  2OJQ A;  3HKK A;  1T9K A;  2IOQ A;  2OU6 A;  2HJM A;  4XEV A;  3ZVR A;  3QMK A;  5CI9 A;  4I44 A;  4JW1 A;  4NTA A;  5DQT A;  2ZD9 A;  1WAS A;  4N6H A;  1OKK A;  5JRA A;  2VAS A;  4YL1 A;  3ZDL A;  2D4U A;  1APC A;  3PCV A;  3EZI A;  2LFD A;  2AVK A;  3J06 A;  3DJU B;  2C03 A;  5KYU A;  1JMW A;  4O6M A;  3DM9 B;  3VRC A;  4IWB A;  3EFO A;  4MS2 A;  1ZHW A;  3V5Y A;  3POV A;  3T6G B;  3HNL A;  1EKY A;  3JCU Q;  2CGE A;  2J0X A;  3WAQ A;  2R02 A;  1ZU5 A;  2HSQ A;  4CDV A; 
#chains in the Genus database with same CATH homology
 3H2U A;  1L7C A;  1XWJ A;  1ST6 A;  4EHP A;  1ZW3 A;  2IBF A;  1T01 A;  3VF0 A;  3MYI A;  4ONS A;  5L0C A;  1YDI A;  1DOW A;  5L0J A;  1ZVZ A;  2GWW A;  2B0H A;  2L7A A;  1TR2 A;  1H6G A;  3ZDL A;  1ZW2 A;  4IGG A;  4W8P A;  4DJ9 A;  4K1O A;  5L0D A;  5L0G A;  3TJ5 A;  3H2V A;  3RF3 A;  3S90 A;  1RKC A;  5L0F A;  5L0H A;  2X0C A;  1DOV A;  2LQG A;  3T6G B;  4PR9 A;  5L0I A;  1QKR A;  1SYQ A;  1U6H A;  2GDC A;  1RKE A;  5FZT A;  3TJ6 A;  4E17 A;  1U89 A;  4P9T A;  4E18 A;  2HSQ A;  1RKE B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...