4ULVA

Cytochrome c prime from shewanella frigidimarina
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
128
structure length
128
Chain Sequence
NFEEPADAIEYRQAAFGLIAYNFGDMGAMLKGKKPFDAAVFSTRADNVAALSKIPHEGFIAGSDKGDTEALAKIWQDKADFDSKMTAFQDNAAALAVAAKSSDQNNIKQAFANTGKSCKGCHDVYKKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords CYTOCHROME C, CLASS II
publication title Conformational Control of the Binding of Diatomic Gases to Cytochrome C'.
pubmed doi rcsb
source organism Shewanella frigidimarina
total genus 55
structure length 128
sequence length 128
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01322 Cytochrom_C_2 Cytochrome C'
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 4ulvA00
3QVZA 1NBBA 2BC5A 1CGNA 2YKZA 5JRAA 3HNKA 3M4BA 4WGYA 2YLGA 1RCPA 1MQVA 1E85A 3QW0A 3QW1A 4NC3A 4IAQA 2XLWA 5JUAA 3NMKA 2YL1A 2YLDA 4N6HA 1LM3B 3HNJA 2QLAA 3DE9A 3VRCA 3QVYA 3NMJA 3L1MA 4CJOA 5JS5A 1M6TA 5JVEA 1E84A 4JKVA 1QQ3A 2YL7A 1GQAA 2XLHA 1E83A 1EKYA 1JAFA 2CCYA 4CDYA 4JE9A 4CIPA 3TOLA 4WGZA 2J8WA 1CPRA 3IQ6A 4D4NA 1YYXA 3C62A 4ER9A 3ZWIA 4EIYA 4CDVA 2YL0A 3U8PA 1QPUA 2YLIA 3NMIA 2YL3A 1BBHA 4D4XA 3C63A 1E86A 3DE8A 1S05A 1CGOA 4N4WA 3M79A 3FOOA 3HNIA 4CJGA 3HNLA 1APCA 5JP7A 4U9EA 3ZTZA 256BA 3ZQYA 4JEBA 5AGFA 3ZQVA 1YYJA 5JT4A 3ZTMA 4U9DA 2J9BA 2XLEA 5JSLA 2XLVA 5JLIA 2XL6A 2XLOA 4CDAA 5B3IA 3M15A 2XLMA 4L6RA 2XM4A 1A7VA 1YZAA 2XM0A 3TOMA 4CX9A 1YZCA 4JEAA 4ULVA 3M4CA 2XLDA 2XL8A 4IB4A 1CPQA 3IQ5A 4IARA 3FOPA
chains in the Genus database with same CATH superfamily
3SXMA 3H2UA 4O6MA 2G3VA 3GEIA 3Q7GA 1NBBA 1TKNA 1CGNA 2IOQA 1OCCC 3KH2A 5JRAA 2J7PD 3HNKA 3I5QA 4WGYA 1KTMA 1FTSA 2ASRA 2YLGA 1MQVA 2IYLD 1L7CA 3EQLF 4ANJA 5K0IA 3QW0A 4N06A 4NC3A 1U0BB 1TQGA 4IAQA 1U6HA 1TFOB 3M1CB 1PV3A 3RVYA 2RSEB 3KPHA 5KYXA 1EQ1A 2XSEA 3NMKA 2L6HA 4NCQA 2YLDA 4BJ6C 4Q4ZF 2CYDA 1T6IA 1YVIA 3G50A 1TWHA 3HNJA 3LNMB 1FFHA 3JYYA 4B6IA 4DVZA 1SF8A 3ASNC 4OIRF 2QLAA 3EGDB 4O7GA 4U5HA 4U5EE 2PNOA 3DE9A 4K7BA 5E3CA 4N6CA 4AE4A 4F4BA 3AJMA 4OINF 3NMJA 4DRHB 1YLMA 1JRAA 4J32B 1C17M 1XZQA 2HMZA 2KGOA 3HKKA 3QZCA 3ECSA 4MS2A 1B68A 4I44A 3VAYA 4JVSA 1Z63A 5DLJA 3ABMC 2HV6A 1LS4A 4ONSA 4PJMA 1D0YA 2OKUA 1GGQA 4H54A 4NY3A 2HMQA 2L6FA 2Q9AA 2Y3DA 4I1MA 4J30B 2UUHA 2ZPAA 3LNRA 4FESA 5AC4A 3B29A 4U5BE 2XXAA 2CCYA 2HUJA 2WZLA 4YK5A 1OXBA 3NYJA 3W2VA 4DVYP 2M64A 1QZXA 4JURI 5L0JA 3EG9B 4WGZA 3TOLA 4DRJB 1CPRA 4PFOA 4HE8D 4XEFA 1OCOC 3K33A 4PJNA 4K0DA 3Q6MA 4HFKB 2NG1A 4MW8A 3WAQA 1O87A 3FVYA 3K1IA 5L0FA 1VOMA 2YL0A 1JPNA 1E2XA 2YZSA 4JIOA 3ZC4A 1VYKA 4CS7A 2KNHA 1HMDA 2YLIA 1Y6DA 3RYLA 5BQHA 3NMIA 4QI2A 1VLTA 2NPUA 3ASOC 3U0CA 1H9GA 3C63A 3NYMA 3JYHA 3TD7A 1LKXA 4YT8A 1PD1A 4N4WA 4YJWA 3V5ZA 2R7UA 3AQCA 1ORYA 2Q9BA 1JMWA 4DJ9A 3HNLA 3RFYA 1APCA 3UNGC 1TWAA 1NZEA 1SR2A 3T6BA 2CNWD 2H7BA 3EPVA 2IBFA 4K1OA 2TMVP 3A9CA 1J8YF 2PX3A 3H65A 3LEOA 4KBLA 3T9OA 3ZSUA 4KC9A 4BJ5C 3S28A 4G78A 1S7ZA 2R7OA 3GANA 5AGFA 4I3MA 3W8HA 4BPMA 4BG0A 1PD0A 4O6YA 5L0IA 2Z15A 2OOCA 4IAOA 1JR8A 1C03A 2GAQA 3DWWA 1Z5ZA 1WTYA 3GM1A 1AUEA 3B0UX 1QKRA 5AC5A 1FFTC 1YA7O 4YT4A 4NQFA 3Q7LA 3GWNA 5BUOA 3A11A 1LI5A 2XL4A 3X2QC 4CBEA 2D5RB 2EPNA 3SXKA 5L3VA 2LSEA 2XLMA 4U5CE 4U5FE 5B1BC 2KK1A 4QI0A 4CS8C 5T3WA 3SNHA 3N24A 3L8JA 4MW3A 1LPEA 1A7VA 1IW7F 2DB4A 2R7QA 3TOMA 4XEKA 2R7WA 3RF3A 3MLGA 3EFOB 1HE1A 5HV9A 4EHPA 2WZGA 3KL4A 1BDJB 3ZIBA 1BZ4A 1XZPA 3O6XA 3B9QA 1U89A 2G62A 2FAPB 5A6BA 1MMGA 3B0VC 2LQGA 5DQTA 3FAJA 3WODF 2QE9A 3QVZA 1AEPA 3VYWA 2HJ3A 2YKZA 2CDQA 5KYYB 3UGPA 1ZW2A 2C04A 2QY9A 3AG1C 3AG3C 3X1OA 2AVKA 3DMDA 5EK0A 2PP4A 2VH3A 5KYUA 2YWAA 3PCVA 1NSGB 3O10A 2BL2A 3KMIA 4PJLA 2A68F 2P0NA 1A7DA 5E2QA 1LI7A 3R7CA 5EGYA 1UFBA 1A7EA 1DOVA 2KSFA 2YQYA 2IXOA 3U2MA 2HSQA 3UGOA 1H9TA 3ZG1A 2WVOA 1Q0KA 1TWGA 1T9KA 3EH1A 1OXKA 2KW3C 3QVYA 4MVMA 5GPGB 3BRJA 5DS5A 2GFHA 4G7HF 3L1MA 3NYLA 4AX2A 2J45A 1M6TA 2X0CA 4MTFA 1OW6A 1T01A 4EKWA 5KYNA 1E84A 2L81A 4P6IC 1ZHZA 4JKVA 1EA8A 4G7OF 2PBEA 4BJ6A 3R2PA 5KYWA 4LERA 4LLEA 4BJ1A 4Q5SF 1QQ3A 1HE9A 4P9FA 1O5HA 1RXQA 3CAXA 4C7OA 1G4US 2WZFA 4OD4A 1Q0FA 1H7IA 2R7XA 2F22A 2MWQA 2BE5F 2XS1A 1JAFA 5COMA 3S29A 1HW2A 2OJED 4LDKA 1GM5A 3DXJF 3ABLC 3TK0A 4CIPA 3T4RA 3S90A 3WG7C 2R03A 3DD7A 2G3KA 3IQ6A 3ITFA 3EHNA 4D4NA 4RDAA 3VM6A 4DRIB 2EINC 1YYXA 4FWVA 4W8KA 2A6EF 3RH3A 3EZHA 1ZYRF 3ZWIA 4MQ9F 1D0ZA 3QTHA 1OW7A 5CIVA 3U8PA 3RQEA 1SZIA 2L7AA 1QPUA 3LESA 3C8GB 3DAGA 2YL3A 5L0CA 3RQFA 1ORSC 1GS9A 4BEMJ 3G4XA 4GEHA 4JCHA 1RJ9A 2HKVA 2XS8A 2HJMA 3KKBA 1BR1A 4DXWA 3IQCA 1R4TA 4PK4A 1M2VA 5E3AA 3TJ6A 4RD9A 3ZQYA 2UUIA 3S27A 4YT2A 5DS4A 3DJNB 2DI3A 1HW1A 3LS0A 1QVXA 1Z23A 3E9VA 2W4BA 4LDRA 4OD5A 3N2ZB 4JTDB 4DOZA 1V4AA 3PDMP 3MYFA 3LLKA 1VYIA 1L3PA 2PF4E 2OEXA 2L9JA 3LLIA 3T6JA 5EHHA 3ZTMA 3U9JA 1D1AA 5L3QA 4XLNF 3EGXA 2A0BA 2YVKA 2XLEA 3GWLA 2JPUA 2VC9A 4MVZA 2NUTA 1HMOA 3U9MA 4HEAJ 1TWCA 2EIMC 2NSGA 3O55A 4MVSA 2LK4A 2XLOA 5COGA 2V3CC 1V54C 4JJFA 5B3IA 3M15A 4UDVA 3CQZA 1OKKA 4PACA 3MYIA 4OIOF 1ZHWA 4BJ5A 1YARO 2J46A 4L6RA 2VCAA 4MNDA 4U5GA 4CIHA 2ETSA 2W9YA 2XM0A 4IJJA 3FXHA 2HFIA 4JEAA 4ULVA 4YL0A 3S84A 2C03A 1RKEA 2HV7A 3US6A 2LFFA 2KQ9A 1BR2A 2XL8A 4Z9HA 3V5YA 4ZLCA 3N0TA 4E0IA 1CPQA 3IQ5A 5KYXB 2KYHA 5F5FA 1PCXA 2R02A 1TFKB 2P7VA 3W2WA 3KYIA 4DBQA 1VMAA 3U3BA 2PFDA 3LAYA 1OW8A 4JW1A 4CS8A 1RCPA 4AE4B 1O3UA 5D91A 1E85A 3QW1A 4LACB 4CS9C 5A6BD 1AVOB 2CGEA 2XLWA 5E33A 2ZXPA 2Y3BA 1MNDA 1ZU5A 4XEVA 3U5SA 3SXZA 4N6HA 2EPMX 1K04A 4HFFB 2E87A 2JX0A 4FAPB 4OIPF 2HSBA 1M57C 1CGME 2W45A 4J7TA 2O9XA 3VRCA 2M4EA 1Y4CA 3NDBB 3L0IA 3NKEA 4PFPA 3EHMA 3JSZA 4WABA 4WJ0A 4CJOA 5A69A 4E18A 5JS5A 4KI2A 1R5ID 3GODA 2XXAB 1FMWA 3PMRA 4Q7CA 3IEEA 4YWQA 3IPMO 3RIPA 1ZW3A 2IXMA 3EGDA 4JCZA 3B0PA 4C3BA 3U8VA 4C3EA 1T6QA 2YL7A 1V55C 1E83A 5HSWA 5BQIA 2NSFA 1OCRC 3C8GA 1EKYA 1D1BA 2EIJC 1TR2A 2HS5A 3QMKA 1C02A 3UMIA 3IQTA 2ICWG 4G0HA 1OCZC 1YAUO 2J8WA 2AU5A 3TULA 3POVA 1QLEC 2H8AA 4XLPF 4IGGA 2Y39A 2NUPB 3UMKA 2EPLX 3C62A 4ER9A 2GWWA 3JT1A 3C8ZA 2V26A 4E7SA 1VLSA 5L0DA 3EJNA 3GEHA 4D4XA 5BQGA 1NU7D 3DE8A 3EG9A 1W2WA 1CGOA 4XTKA 2GA0A 3M79A 3I4UA 3FOOA 5JP7A 1SMYF 1I4ZA 2ZD9A 3K1HA 4U9EA 2DYSC 3SP1A 256BA 4LDQA 1WOLA 2L6GA 4EWCA 1LIHA 2J9VA 4M63A 3SXYA 4JZAA 2VCBA 2AWYA 3ABKC 3AGTA 3MBGA 3ZQVA 1ZHXA 1YYJA 2J9WA 3TQOA 1LS1A 3B71A 3LUTB 1DOWA 1J8MF 4XQ1A 4DBRA 3RKOF 3W4YA 5JT4A 1K05A 2Q00A 5DVWA 3AOUA 2OU6A 4MVUA 2OCCC 2W4MA 2AWCA 3EH2A 2J0XA 2XLVA 1RMVA 3W8IA 2X51A 1ST6A 4CSAC 4EBKA 3K7DA 3OA1A 4ULWA 2XL6A 5JLIA 2WL8A 3H2VA 2DYRC 1FMVA 1K40A 3C18A 3MFNA 4YN0B 5FCLA 3G4ZA 4MVQA 2WVQA 3GEEA 2EPOA 2R7SA 1YZAA 2VB6A 3C7JA 3DKAA 1T5OA 1WASA 3JCUQ 3JRTA 1Z6AA 1UG7A 2LD6A 5COFA 5D92A 3T6GB 4C3DA 1FR0A 1YZCA 2QTVA 4R32A 3F46A 1OKKD 5FZTA 2J7PA 4BEJA 2A6HF 2H7OA 2XRHA 5KYUB 4OIQF 3WHNA 4NTFA 2I15A 2D4UA 1LE4A 1M56C 4MTGA 1NFNA 4P9TA 1D0XA 4IARA 4AL1A 3O39A 3JSEO 5F28E 3SYNA 3FOPA 3CEXA 2Q7RA 1A0BA 1YA9A 4EBJA 2BC5A 4PR9A 4KNVA 2IXNA 3M4BA 3EFOA 2PX0A 4O6NA 4A2NB 3HLZA 4KNWA 4XPXA 3U2LA 1I5NA 3ATPA 3DAFA 4JTCB 1WWPA 1KNYA 5JUAA 2AP3A 1EI7A 3DJUB 1MNEA 4JRZA 3L8IA 2YL1A 4IRUA 1ZZPA 1HY5A 4J7YA 4RBNA 5A6JA 1MMDA 1LM3B 3CSKA 4E17A 3HTKC 1NG1A 2FFHA 3NRHA 4GQHA 3PHF2 3KYJA 3IHUA 5KYYA 2MYSA 2P61A 2P1AA 5KYWB 1ZHYA 4YT5A 3CZ6A 4FX5A 2IM8A 5DS6A 3OWTA 3DM5A 2ZXWC 3AG4C 5A6KA 2H7VC 4E7ZA 4C7OB 3AQBA 4JC7A 3FHDA 2Y69C 2YHSA 3DM9B 1H6GA 3K6BA 4JTAB 4MVRA 4EUKB 3Q6NA 5CI9A 2RD9A 4CS9A 5JVEA 1IZMA 2LFDA 2Q3TA 4Z9IA 2OQMA 3MX3A 2KJGA 1G8XA 3LS1A 4IWBA 3K1IC 2R05A 3S9OA 2YEVA 2HZ8A 1Q0MA 1YJGA 2NUPA 1N1CA 4Z9JA 3JRMO 1G4WR 2WB7A 2J0WA 1GQAA 2XLHA 1QSPA 3RVZA 5IY5C 4LLCA 4XPWA 2EILC 3TJ5A 2R7VA 2Q9CA 2VCCA 4MVOA 3RW0A 3JTLO 4MTOA 5T1DB 2EIKC 4CDYA 4JE9A 4YL3A 1KU2A 2ZXRA 2DGJA 1SYQA 1OQCA 5A6AA 1RJ9B 1VK5A 2JD3A 3BEHA 3GM2A 1JOGA 4NTAA 3I5PA 4A4AA 4X0RA 3LEVA 3SEOA 1ZHTA 1M2VB 4H4KC 3ZDLA 4EIYA 2A69F 3C8GD 5F5HA 2Y3HA 4CDVA 2CNWA 2Y3GA 1BR4A 3NG1A 4O79A 1F1MA 2R7TA 1BBHA 3S0XA 2I8BA 1ORJA 1E86A 3DZAA 2CW0F 1S05A 4XPYA 3JZ0A 2A1DD 1Z7Qc 3VF0A 1ZVZA 2P6VA 2YRFA 3HNIA 4NTBA 4CJGA 2EPKX 3RQGA 3SZRA 5B1AC 4E0HA 4GYTA 3UR3C 3GORA 1MMNA 3EGXB 3EZIA 3V5XA 3K66A 3ZTZA 4EBBA 3FAPB 2R25A 2OJQA 1A41A 2NUTB 1T6UA 2B0JA 4JEBA 2LCHA 1VTMP 2VASA 1Q0GA 1Q0DA 1NFOA 3LJBA 1RKCA 3ZVRA 5L0GA 1Z3IX 3F47A 3J06A 3L34A 4G7ZF 3UMHA 2OEVA 4U9DA 4BJTA 2Q4FA 2OG2A 2GDCA 1ZU4A 1XWJA 2J9BA 2LIGA 2LP4A 1NU9C 1OR3A 1LE2A 2ZXOA 3AG2C 4QDLA 5JSLA 1NLXA 4I1OB 5T3TA 4YL1A 1FNTc 3V7OA 1RKEB 2B0HA 4CDAA 1YDIA 1D1CA 1WATA 3FMSA 5L0HA 2WVNA 1LVKA 3DI5A 1M2OA 1WGWA 2KC3A 3GM3A 3FDQA 3HJCA 2MHRA 2J9UA 1G5ZA 2A0UA 2R9RB 2XM4A 4AL0A 4ZLDA 4AK9A 4U5DE 4CX9A 1FAPB 4XWJA 2IXPA 1OR2A 3OEOA 3U3FA 5TJ5E 1MMAA 3M4CA 3E70C 1VB5A 5DQZA 5B3SC 5CI8A 4PJJA 1WN0A 2XLDA 4IB4A 2R7RA 1V74B 1I4YA 3AGUA 4W8PA 4JJGA 2QUPA 4CSAA 2FGYA 1JPJA 2QNLA 3NKDA
chains in the Genus database with same CATH topology
3QVZA 1NBBA 2BC5A 1CGNA 2YKZA 5JRAA 3HNKA 3M4BA 4WGYA 2YLGA 1RCPA 1MQVA 1E85A 3QW0A 3QW1A 4NC3A 4IAQA 2XLWA 5JUAA 3NMKA 2YL1A 2YLDA 4N6HA 1LM3B 3HNJA 2QLAA 3DE9A 3VRCA 3QVYA 3NMJA 3L1MA 4CJOA 5JS5A 1M6TA 5JVEA 1E84A 4JKVA 1QQ3A 2YL7A 1GQAA 2XLHA 1E83A 1EKYA 1JAFA 2CCYA 4CDYA 4JE9A 4CIPA 3TOLA 4WGZA 2J8WA 1CPRA 3IQ6A 4D4NA 1YYXA 3C62A 4ER9A 3ZWIA 4EIYA 4CDVA 2YL0A 3U8PA 1QPUA 2YLIA 3NMIA 2YL3A 1BBHA 4D4XA 3C63A 1E86A 3DE8A 1S05A 1CGOA 4N4WA 3M79A 3FOOA 3HNIA 4CJGA 3HNLA 1APCA 5JP7A 4U9EA 3ZTZA 256BA 3ZQYA 4JEBA 5AGFA 3ZQVA 1YYJA 5JT4A 3ZTMA 4U9DA 2J9BA 2XLEA 5JSLA 2XLVA 5JLIA 2XL6A 2XLOA 4CDAA 5B3IA 3M15A 2XLMA 4L6RA 2XM4A 1A7VA 1YZAA 2XM0A 3TOMA 4CX9A 1YZCA 4JEAA 4ULVA 3M4CA 2XLDA 2XL8A 4IB4A 1CPQA 3IQ5A 4IARA 3FOPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QVZ A;  1NBB A;  2BC5 A;  1CGN A;  2YKZ A;  5JRA A;  3HNK A;  3M4B A;  4WGY A;  2YLG A;  1RCP A;  1MQV A;  1E85 A;  3QW0 A;  3QW1 A;  4NC3 A;  4IAQ A;  2XLW A;  5JUA A;  3NMK A;  2YL1 A;  2YLD A;  4N6H A;  1LM3 B;  3HNJ A;  2QLA A;  3DE9 A;  3VRC A;  3QVY A;  3NMJ A;  3L1M A;  4CJO A;  5JS5 A;  1M6T A;  5JVE A;  1E84 A;  4JKV A;  1QQ3 A;  2YL7 A;  1GQA A;  2XLH A;  1E83 A;  1EKY A;  1JAF A;  2CCY A;  4CDY A;  4JE9 A;  4CIP A;  3TOL A;  4WGZ A;  2J8W A;  1CPR A;  3IQ6 A;  4D4N A;  1YYX A;  3C62 A;  4ER9 A;  3ZWI A;  4EIY A;  4CDV A;  2YL0 A;  3U8P A;  1QPU A;  2YLI A;  3NMI A;  2YL3 A;  1BBH A;  4D4X A;  3C63 A;  1E86 A;  3DE8 A;  1S05 A;  1CGO A;  4N4W A;  3M79 A;  3FOO A;  3HNI A;  4CJG A;  3HNL A;  1APC A;  5JP7 A;  4U9E A;  3ZTZ A;  256B A;  3ZQY A;  4JEB A;  5AGF A;  3ZQV A;  1YYJ A;  5JT4 A;  3ZTM A;  4U9D A;  2J9B A;  2XLE A;  5JSL A;  2XLV A;  5JLI A;  2XL6 A;  2XLO A;  4CDA A;  5B3I A;  3M15 A;  2XLM A;  4L6R A;  2XM4 A;  1A7V A;  1YZA A;  2XM0 A;  3TOM A;  4CX9 A;  1YZC A;  4JEA A;  4ULV A;  3M4C A;  2XLD A;  2XL8 A;  4IB4 A;  1CPQ A;  3IQ5 A;  4IAR A;  3FOP A; 
#chains in the Genus database with same CATH topology
 3SXM A;  3H2U A;  4O6M A;  2G3V A;  3GEI A;  3Q7G A;  1NBB A;  1TKN A;  1CGN A;  2IOQ A;  1OCC C;  3KH2 A;  5JRA A;  2J7P D;  3HNK A;  3I5Q A;  4WGY A;  1KTM A;  1FTS A;  2ASR A;  2YLG A;  1MQV A;  2IYL D;  1L7C A;  3EQL F;  4ANJ A;  5K0I A;  3QW0 A;  4N06 A;  4NC3 A;  1U0B B;  1TQG A;  4IAQ A;  1U6H A;  1TFO B;  3M1C B;  1PV3 A;  3RVY A;  2RSE B;  3KPH A;  5KYX A;  1EQ1 A;  2XSE A;  3NMK A;  2L6H A;  4NCQ A;  2YLD A;  4BJ6 C;  4Q4Z F;  2CYD A;  1T6I A;  1YVI A;  3G50 A;  1TWH A;  3HNJ A;  3LNM B;  1FFH A;  3JYY A;  4B6I A;  4DVZ A;  1SF8 A;  3ASN C;  4OIR F;  2QLA A;  3EGD B;  4O7G A;  4U5H A;  4U5E E;  2PNO A;  3DE9 A;  4K7B A;  5E3C A;  4N6C A;  4AE4 A;  4F4B A;  3AJM A;  4OIN F;  3NMJ A;  4DRH B;  1YLM A;  1JRA A;  4J32 B;  1C17 M;  1XZQ A;  2HMZ A;  2KGO A;  3HKK A;  3QZC A;  3ECS A;  4MS2 A;  1B68 A;  4I44 A;  3VAY A;  4JVS A;  1Z63 A;  5DLJ A;  3ABM C;  2HV6 A;  1LS4 A;  4ONS A;  4PJM A;  1D0Y A;  2OKU A;  1GGQ A;  4H54 A;  4NY3 A;  2HMQ A;  2L6F A;  2Q9A A;  2Y3D A;  4I1M A;  4J30 B;  2UUH A;  2ZPA A;  3LNR A;  4FES A;  5AC4 A;  3B29 A;  4U5B E;  2XXA A;  2CCY A;  2HUJ A;  2WZL A;  4YK5 A;  1OXB A;  3NYJ A;  3W2V A;  4DVY P;  2M64 A;  1QZX A;  4JUR I;  5L0J A;  3EG9 B;  4WGZ A;  3TOL A;  4DRJ B;  1CPR A;  4PFO A;  4HE8 D;  4XEF A;  1OCO C;  3K33 A;  4PJN A;  4K0D A;  3Q6M A;  4HFK B;  2NG1 A;  4MW8 A;  3WAQ A;  1O87 A;  3FVY A;  3K1I A;  5L0F A;  1VOM A;  2YL0 A;  1JPN A;  1E2X A;  2YZS A;  4JIO A;  3ZC4 A;  1VYK A;  4CS7 A;  2KNH A;  1HMD A;  2YLI A;  1Y6D A;  3RYL A;  5BQH A;  3NMI A;  4QI2 A;  1VLT A;  2NPU A;  3ASO C;  3U0C A;  1H9G A;  3C63 A;  3NYM A;  3JYH A;  3TD7 A;  1LKX A;  4YT8 A;  1PD1 A;  4N4W A;  4YJW A;  3V5Z A;  2R7U A;  3AQC A;  1ORY A;  2Q9B A;  1JMW A;  4DJ9 A;  3HNL A;  3RFY A;  1APC A;  3UNG C;  1TWA A;  1NZE A;  1SR2 A;  3T6B A;  2CNW D;  2H7B A;  3EPV A;  2IBF A;  4K1O A;  2TMV P;  3A9C A;  1J8Y F;  2PX3 A;  3H65 A;  3LEO A;  4KBL A;  3T9O A;  3ZSU A;  4KC9 A;  4BJ5 C;  3S28 A;  4G78 A;  1S7Z A;  2R7O A;  3GAN A;  5AGF A;  4I3M A;  3W8H A;  4BPM A;  4BG0 A;  1PD0 A;  4O6Y A;  5L0I A;  2Z15 A;  2OOC A;  4IAO A;  1JR8 A;  1C03 A;  2GAQ A;  3DWW A;  1Z5Z A;  1WTY A;  3GM1 A;  1AUE A;  3B0U X;  1QKR A;  5AC5 A;  1FFT C;  1YA7 O;  4YT4 A;  4NQF A;  3Q7L A;  3GWN A;  5BUO A;  3A11 A;  1LI5 A;  2XL4 A;  3X2Q C;  4CBE A;  2D5R B;  2EPN A;  3SXK A;  5L3V A;  2LSE A;  2XLM A;  4U5C E;  4U5F E;  5B1B C;  2KK1 A;  4QI0 A;  4CS8 C;  5T3W A;  3SNH A;  3N24 A;  3L8J A;  4MW3 A;  1LPE A;  1A7V A;  1IW7 F;  2DB4 A;  2R7Q A;  3TOM A;  4XEK A;  2R7W A;  3RF3 A;  3MLG A;  3EFO B;  1HE1 A;  5HV9 A;  4EHP A;  2WZG A;  3KL4 A;  1BDJ B;  3ZIB A;  1BZ4 A;  1XZP A;  3O6X A;  3B9Q A;  1U89 A;  2G62 A;  2FAP B;  5A6B A;  1MMG A;  3B0V C;  2LQG A;  5DQT A;  3FAJ A;  3WOD F;  2QE9 A;  3QVZ A;  1AEP A;  3VYW A;  2HJ3 A;  2YKZ A;  2CDQ A;  5KYY B;  3UGP A;  1ZW2 A;  2C04 A;  2QY9 A;  3AG1 C;  3AG3 C;  3X1O A;  2AVK A;  3DMD A;  5EK0 A;  2PP4 A;  2VH3 A;  5KYU A;  2YWA A;  3PCV A;  1NSG B;  3O10 A;  2BL2 A;  3KMI A;  4PJL A;  2A68 F;  2P0N A;  1A7D A;  5E2Q A;  1LI7 A;  3R7C A;  5EGY A;  1UFB A;  1A7E A;  1DOV A;  2KSF A;  2YQY A;  2IXO A;  3U2M A;  2HSQ A;  3UGO A;  1H9T A;  3ZG1 A;  2WVO A;  1Q0K A;  1TWG A;  1T9K A;  3EH1 A;  1OXK A;  2KW3 C;  3QVY A;  4MVM A;  5GPG B;  3BRJ A;  5DS5 A;  2GFH A;  4G7H F;  3L1M A;  3NYL A;  4AX2 A;  2J45 A;  1M6T A;  2X0C A;  4MTF A;  1OW6 A;  1T01 A;  4EKW A;  5KYN A;  1E84 A;  2L81 A;  4P6I C;  1ZHZ A;  4JKV A;  1EA8 A;  4G7O F;  2PBE A;  4BJ6 A;  3R2P A;  5KYW A;  4LER A;  4LLE A;  4BJ1 A;  4Q5S F;  1QQ3 A;  1HE9 A;  4P9F A;  1O5H A;  1RXQ A;  3CAX A;  4C7O A;  1G4U S;  2WZF A;  4OD4 A;  1Q0F A;  1H7I A;  2R7X A;  2F22 A;  2MWQ A;  2BE5 F;  2XS1 A;  1JAF A;  5COM A;  3S29 A;  1HW2 A;  2OJE D;  4LDK A;  1GM5 A;  3DXJ F;  3ABL C;  3TK0 A;  4CIP A;  3T4R A;  3S90 A;  3WG7 C;  2R03 A;  3DD7 A;  2G3K A;  3IQ6 A;  3ITF A;  3EHN A;  4D4N A;  4RDA A;  3VM6 A;  4DRI B;  2EIN C;  1YYX A;  4FWV A;  4W8K A;  2A6E F;  3RH3 A;  3EZH A;  1ZYR F;  3ZWI A;  4MQ9 F;  1D0Z A;  3QTH A;  1OW7 A;  5CIV A;  3U8P A;  3RQE A;  1SZI A;  2L7A A;  1QPU A;  3LES A;  3C8G B;  3DAG A;  2YL3 A;  5L0C A;  3RQF A;  1ORS C;  1GS9 A;  4BEM J;  3G4X A;  4GEH A;  4JCH A;  1RJ9 A;  2HKV A;  2XS8 A;  2HJM A;  3KKB A;  1BR1 A;  4DXW A;  3IQC A;  1R4T A;  4PK4 A;  1M2V A;  5E3A A;  3TJ6 A;  4RD9 A;  3ZQY A;  2UUI A;  3S27 A;  4YT2 A;  5DS4 A;  3DJN B;  2DI3 A;  1HW1 A;  3LS0 A;  1QVX A;  1Z23 A;  3E9V A;  2W4B A;  4LDR A;  4OD5 A;  3N2Z B;  4JTD B;  4DOZ A;  1V4A A;  3PDM P;  3MYF A;  3LLK A;  1VYI A;  1L3P A;  2PF4 E;  2OEX A;  2L9J A;  3LLI A;  3T6J A;  5EHH A;  3ZTM A;  3U9J A;  1D1A A;  5L3Q A;  4XLN F;  3EGX A;  2A0B A;  2YVK A;  2XLE A;  3GWL A;  2JPU A;  2VC9 A;  4MVZ A;  2NUT A;  1HMO A;  3U9M A;  4HEA J;  1TWC A;  2EIM C;  2NSG A;  3O55 A;  4MVS A;  2LK4 A;  2XLO A;  5COG A;  2V3C C;  1V54 C;  4JJF A;  5B3I A;  3M15 A;  4UDV A;  3CQZ A;  1OKK A;  4PAC A;  3MYI A;  4OIO F;  1ZHW A;  4BJ5 A;  1YAR O;  2J46 A;  4L6R A;  2VCA A;  4MND A;  4U5G A;  4CIH A;  2ETS A;  2W9Y A;  2XM0 A;  4IJJ A;  3FXH A;  2HFI A;  4JEA A;  4ULV A;  4YL0 A;  3S84 A;  2C03 A;  1RKE A;  2HV7 A;  3US6 A;  2LFF A;  2KQ9 A;  1BR2 A;  2XL8 A;  4Z9H A;  3V5Y A;  4ZLC A;  3N0T A;  4E0I A;  1CPQ A;  3IQ5 A;  5KYX B;  2KYH A;  5F5F A;  1PCX A;  2R02 A;  1TFK B;  2P7V A;  3W2W A;  3KYI A;  4DBQ A;  1VMA A;  3U3B A;  2PFD A;  3LAY A;  1OW8 A;  4JW1 A;  4CS8 A;  1RCP A;  4AE4 B;  1O3U A;  5D91 A;  1E85 A;  3QW1 A;  4LAC B;  4CS9 C;  5A6B D;  1AVO B;  2CGE A;  2XLW A;  5E33 A;  2ZXP A;  2Y3B A;  1MND A;  1ZU5 A;  4XEV A;  3U5S A;  3SXZ A;  4N6H A;  2EPM X;  1K04 A;  4HFF B;  2E87 A;  2JX0 A;  4FAP B;  4OIP F;  2HSB A;  1M57 C;  1CGM E;  2W45 A;  4J7T A;  2O9X A;  3VRC A;  2M4E A;  1Y4C A;  3NDB B;  3L0I A;  3NKE A;  4PFP A;  3EHM A;  3JSZ A;  4WAB A;  4WJ0 A;  4CJO A;  5A69 A;  4E18 A;  5JS5 A;  4KI2 A;  1R5I D;  3GOD A;  2XXA B;  1FMW A;  3PMR A;  4Q7C A;  3IEE A;  4YWQ A;  3IPM O;  3RIP A;  1ZW3 A;  2IXM A;  3EGD A;  4JCZ A;  3B0P A;  4C3B A;  3U8V A;  4C3E A;  1T6Q A;  2YL7 A;  1V55 C;  1E83 A;  5HSW A;  5BQI A;  2NSF A;  1OCR C;  3C8G A;  1EKY A;  1D1B A;  2EIJ C;  1TR2 A;  2HS5 A;  3QMK A;  1C02 A;  3UMI A;  3IQT A;  2ICW G;  4G0H A;  1OCZ C;  1YAU O;  2J8W A;  2AU5 A;  3TUL A;  3POV A;  1QLE C;  2H8A A;  4XLP F;  4IGG A;  2Y39 A;  2NUP B;  3UMK A;  2EPL X;  3C62 A;  4ER9 A;  2GWW A;  3JT1 A;  3C8Z A;  2V26 A;  4E7S A;  1VLS A;  5L0D A;  3EJN A;  3GEH A;  4D4X A;  5BQG A;  1NU7 D;  3DE8 A;  3EG9 A;  1W2W A;  1CGO A;  4XTK A;  2GA0 A;  3M79 A;  3I4U A;  3FOO A;  5JP7 A;  1SMY F;  1I4Z A;  2ZD9 A;  3K1H A;  4U9E A;  2DYS C;  3SP1 A;  256B A;  4LDQ A;  1WOL A;  2L6G A;  4EWC A;  1LIH A;  2J9V A;  4M63 A;  3SXY A;  4JZA A;  2VCB A;  2AWY A;  3ABK C;  3AGT A;  3MBG A;  3ZQV A;  1ZHX A;  1YYJ A;  2J9W A;  3TQO A;  1LS1 A;  3B71 A;  3LUT B;  1DOW A;  1J8M F;  4XQ1 A;  4DBR A;  3RKO F;  3W4Y A;  5JT4 A;  1K05 A;  2Q00 A;  5DVW A;  3AOU A;  2OU6 A;  4MVU A;  2OCC C;  2W4M A;  2AWC A;  3EH2 A;  2J0X A;  2XLV A;  1RMV A;  3W8I A;  2X51 A;  1ST6 A;  4CSA C;  4EBK A;  3K7D A;  3OA1 A;  4ULW A;  2XL6 A;  5JLI A;  2WL8 A;  3H2V A;  2DYR C;  1FMV A;  1K40 A;  3C18 A;  3MFN A;  4YN0 B;  5FCL A;  3G4Z A;  4MVQ A;  2WVQ A;  3GEE A;  2EPO A;  2R7S A;  1YZA A;  2VB6 A;  3C7J A;  3DKA A;  1T5O A;  1WAS A;  3JCU Q;  3JRT A;  1Z6A A;  1UG7 A;  2LD6 A;  5COF A;  5D92 A;  3T6G B;  4C3D A;  1FR0 A;  1YZC A;  2QTV A;  4R32 A;  3F46 A;  1OKK D;  5FZT A;  2J7P A;  4BEJ A;  2A6H F;  2H7O A;  2XRH A;  5KYU B;  4OIQ F;  3WHN A;  4NTF A;  2I15 A;  2D4U A;  1LE4 A;  1M56 C;  4MTG A;  1NFN A;  4P9T A;  1D0X A;  4IAR A;  4AL1 A;  3O39 A;  3JSE O;  5F28 E;  3SYN A;  3FOP A;  3CEX A;  2Q7R A;  1A0B A;  1YA9 A;  4EBJ A;  2BC5 A;  4PR9 A;  4KNV A;  2IXN A;  3M4B A;  3EFO A;  2PX0 A;  4O6N A;  4A2N B;  3HLZ A;  4KNW A;  4XPX A;  3U2L A;  1I5N A;  3ATP A;  3DAF A;  4JTC B;  1WWP A;  1KNY A;  5JUA A;  2AP3 A;  1EI7 A;  3DJU B;  1MNE A;  4JRZ A;  3L8I A;  2YL1 A;  4IRU A;  1ZZP A;  1HY5 A;  4J7Y A;  4RBN A;  5A6J A;  1MMD A;  1LM3 B;  3CSK A;  4E17 A;  3HTK C;  1NG1 A;  2FFH A;  3NRH A;  4GQH A;  3PHF 2;  3KYJ A;  3IHU A;  5KYY A;  2MYS A;  2P61 A;  2P1A A;  5KYW B;  1ZHY A;  4YT5 A;  3CZ6 A;  4FX5 A;  2IM8 A;  5DS6 A;  3OWT A;  3DM5 A;  2ZXW C;  3AG4 C;  5A6K A;  2H7V C;  4E7Z A;  4C7O B;  3AQB A;  4JC7 A;  3FHD A;  2Y69 C;  2YHS A;  3DM9 B;  1H6G A;  3K6B A;  4JTA B;  4MVR A;  4EUK B;  3Q6N A;  5CI9 A;  2RD9 A;  4CS9 A;  5JVE A;  1IZM A;  2LFD A;  2Q3T A;  4Z9I A;  2OQM A;  3MX3 A;  2KJG A;  1G8X A;  3LS1 A;  4IWB A;  3K1I C;  2R05 A;  3S9O A;  2YEV A;  2HZ8 A;  1Q0M A;  1YJG A;  2NUP A;  1N1C A;  4Z9J A;  3JRM O;  1G4W R;  2WB7 A;  2J0W A;  1GQA A;  2XLH A;  1QSP A;  3RVZ A;  5IY5 C;  4LLC A;  4XPW A;  2EIL C;  3TJ5 A;  2R7V A;  2Q9C A;  2VCC A;  4MVO A;  3RW0 A;  3JTL O;  4MTO A;  5T1D B;  2EIK C;  4CDY A;  4JE9 A;  4YL3 A;  1KU2 A;  2ZXR A;  2DGJ A;  1SYQ A;  1OQC A;  5A6A A;  1RJ9 B;  1VK5 A;  2JD3 A;  3BEH A;  3GM2 A;  1JOG A;  4NTA A;  3I5P A;  4A4A A;  4X0R A;  3LEV A;  3SEO A;  1ZHT A;  1M2V B;  4H4K C;  3ZDL A;  4EIY A;  2A69 F;  3C8G D;  5F5H A;  2Y3H A;  4CDV A;  2CNW A;  2Y3G A;  1BR4 A;  3NG1 A;  4O79 A;  1F1M A;  2R7T A;  1BBH A;  3S0X A;  2I8B A;  1ORJ A;  1E86 A;  3DZA A;  2CW0 F;  1S05 A;  4XPY A;  3JZ0 A;  2A1D D;  1Z7Q c;  3VF0 A;  1ZVZ A;  2P6V A;  2YRF A;  3HNI A;  4NTB A;  4CJG A;  2EPK X;  3RQG A;  3SZR A;  5B1A C;  4E0H A;  4GYT A;  3UR3 C;  3GOR A;  1MMN A;  3EGX B;  3EZI A;  3V5X A;  3K66 A;  3ZTZ A;  4EBB A;  3FAP B;  2R25 A;  2OJQ A;  1A41 A;  2NUT B;  1T6U A;  2B0J A;  4JEB A;  2LCH A;  1VTM P;  2VAS A;  1Q0G A;  1Q0D A;  1NFO A;  3LJB A;  1RKC A;  3ZVR A;  5L0G A;  1Z3I X;  3F47 A;  3J06 A;  3L34 A;  4G7Z F;  3UMH A;  2OEV A;  4U9D A;  4BJT A;  2Q4F A;  2OG2 A;  2GDC A;  1ZU4 A;  1XWJ A;  2J9B A;  2LIG A;  2LP4 A;  1NU9 C;  1OR3 A;  1LE2 A;  2ZXO A;  3AG2 C;  4QDL A;  5JSL A;  1NLX A;  4I1O B;  5T3T A;  4YL1 A;  1FNT c;  3V7O A;  1RKE B;  2B0H A;  4CDA A;  1YDI A;  1D1C A;  1WAT A;  3FMS A;  5L0H A;  2WVN A;  1LVK A;  3DI5 A;  1M2O A;  1WGW A;  2KC3 A;  3GM3 A;  3FDQ A;  3HJC A;  2MHR A;  2J9U A;  1G5Z A;  2A0U A;  2R9R B;  2XM4 A;  4AL0 A;  4ZLD A;  4AK9 A;  4U5D E;  4CX9 A;  1FAP B;  4XWJ A;  2IXP A;  1OR2 A;  3OEO A;  3U3F A;  5TJ5 E;  1MMA A;  3M4C A;  3E70 C;  1VB5 A;  5DQZ A;  5B3S C;  5CI8 A;  4PJJ A;  1WN0 A;  2XLD A;  4IB4 A;  2R7R A;  1V74 B;  1I4Y A;  3AGU A;  4W8P A;  4JJG A;  2QUP A;  4CSA A;  2FGY A;  1JPJ A;  2QNL A;  3NKD A; 
#chains in the Genus database with same CATH homology
 3QVZ A;  1NBB A;  2BC5 A;  1CGN A;  2YKZ A;  5JRA A;  3HNK A;  3M4B A;  4WGY A;  2YLG A;  1RCP A;  1MQV A;  1E85 A;  3QW0 A;  3QW1 A;  4NC3 A;  4IAQ A;  2XLW A;  5JUA A;  3NMK A;  2YL1 A;  2YLD A;  4N6H A;  1LM3 B;  3HNJ A;  2QLA A;  3DE9 A;  3VRC A;  3QVY A;  3NMJ A;  3L1M A;  4CJO A;  5JS5 A;  1M6T A;  5JVE A;  1E84 A;  4JKV A;  1QQ3 A;  2YL7 A;  1GQA A;  2XLH A;  1E83 A;  1EKY A;  1JAF A;  2CCY A;  4CDY A;  4JE9 A;  4CIP A;  3TOL A;  4WGZ A;  2J8W A;  1CPR A;  3IQ6 A;  4D4N A;  1YYX A;  3C62 A;  4ER9 A;  3ZWI A;  4EIY A;  4CDV A;  2YL0 A;  3U8P A;  1QPU A;  2YLI A;  3NMI A;  2YL3 A;  1BBH A;  4D4X A;  3C63 A;  1E86 A;  3DE8 A;  1S05 A;  1CGO A;  4N4W A;  3M79 A;  3FOO A;  3HNI A;  4CJG A;  3HNL A;  1APC A;  5JP7 A;  4U9E A;  3ZTZ A;  256B A;  3ZQY A;  4JEB A;  5AGF A;  3ZQV A;  1YYJ A;  5JT4 A;  3ZTM A;  4U9D A;  2J9B A;  2XLE A;  5JSL A;  2XLV A;  5JLI A;  2XL6 A;  2XLO A;  4CDA A;  5B3I A;  3M15 A;  2XLM A;  4L6R A;  2XM4 A;  1A7V A;  1YZA A;  2XM0 A;  3TOM A;  4CX9 A;  1YZC A;  4JEA A;  4ULV A;  3M4C A;  2XLD A;  2XL8 A;  4IB4 A;  1CPQ A;  3IQ5 A;  4IAR A;  3FOP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...