4ULVA

Cytochrome c prime from shewanella frigidimarina
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
128
structure length
128
Chain Sequence
NFEEPADAIEYRQAAFGLIAYNFGDMGAMLKGKKPFDAAVFSTRADNVAALSKIPHEGFIAGSDKGDTEALAKIWQDKADFDSKMTAFQDNAAALAVAAKSSDQNNIKQAFANTGKSCKGCHDVYKKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformational Control of the Binding of Diatomic Gases to Cytochrome C'.
pubmed doi rcsb
source organism Shewanella frigidimarina
molecule tags Electron transport
molecule keywords CYTOCHROME C, CLASS II
total genus 55
structure length 128
sequence length 128
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01322 Cytochrom_C_2 Cytochrome C'
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 4ulvA00
4JEAA 4U9EA 5JSLA 4ULVA 1BBHA 1CPRA 3QW0A 5B3IA 4IAQA 1NBBA 3QW1A 4CDYA 2XLHA 1YYXA 1MQVA 3M79A 2YL7A 4N6HA 3QVZA 2YL0A 3IQ5A 3FOOA 2XLDA 3IQ6A 4JE9A 256BA 1YYJA 3L1MA 3HNIA 1APCA 2XLEA 2XM4A 5JUAA 5JT4A 3ZQVA 3DE8A 4U9DA 5JRAA 1GQAA 3HNLA 4ER9A 3M4BA 2XL8A 3C62A 1YZAA 1A7VA 4IARA 4NC3A 2XLWA 2CCYA 1E85A 3NMKA 3HNJA 3HNKA 4WGZA 4D4NA 2YLGA 3ZWIA 4IB4A 3U8PA 3ZQYA 2J8WA 2XLMA 1M6TA 2YKZA 3ZTZA 3ZTMA 2XLVA 2QLAA 4CX9A 4JEBA 3NMIA 1E83A 4CJOA 3FOPA 4CDAA 1CGOA 1QQ3A 2J9BA 2XL6A 2YL1A 3M4CA 4CIPA 1JAFA 4WGYA 4D4XA 4L6RA 4CJGA 4EIYA 1LM3B 5JP7A 5JS5A 4JKVA 5AGFA 3TOLA 2XLOA 5JLIA 4N4WA 1E86A 1RCPA 3DE9A 3C63A 1S05A 2YL3A 5JVEA 2YLDA 2BC5A 1E84A 3VRCA 1CGNA 1QPUA 1CPQA 3TOMA 1EKYA 2YLIA 3M15A 1YZCA 4CDVA 3NMJA 2XM0A 3QVYA
chains in the Genus database with same CATH superfamily
3FXHA 3UMIA 1Z6AA 2J7PA 4U9EA 2J9VA 4C7OA 1BZ4A 2NG1A 4ULVA 3U5SA 1LVKA 4BEMJ 4YT4A 2YZSA 3K66A 5B3IA 3FMSA 3AGTA 2R03A 3C8GA 3B0VC 1Q0FA 4NCQA 3RQFA 1TQGA 2WB7A 2PF4E 3HTKC 1H6GA 4ONSA 3B71A 2P6VA 3AG1C 2Y39A 4J32B 5L0IA 4N6HA 2R7RA 1FFTC 3JSEO 1M2VA 1M57C 2J9UA 2VCCA 3NKEA 4FWVA 2EPNA 5A6KA 1A7EA 2JX0A 1LS1A 2HSQA 4CS8A 1WGWA 2Q9CA 2UUHA 3WODF 1QVXA 3L8IA 4A2NB 2CNWA 3JZ0A 3FAPB 1TKNA 4H54A 1Z5ZA 1K40A 2D5RB 2QY9A 2EPLX 4NTFA 4E0HA 2WZLA 3DJUB 4GQHA 4XEVA 5JUAA 5JT4A 1VOMA 2Y3HA 5L0JA 1VLSA 1ZU5A 1NU7D 2G3KA 4MVOA 4XWJA 3POVA 5JRAA 1CGME 1GQAA 3EQLF 4JTAB 4J30B 1JR8A 2XL8A 3C62A 3AJMA 4ANJA 1TFOB 1A7VA 5KYUA 4PFOA 2OQMA 3T6BA 4EBJA 2XLWA 1JOGA 1VK5A 2KYHA 3WHNA 5COMA 2HV6A 2HV7A 4G78A 3LJBA 3ABKC 3GWLA 3LEVA 4CS9C 2GAQA 2JD3A 1HE1A 3G4ZA 4K0DA 4RBNA 3W2VA 3EHNA 2E87A 5E3CA 3U8PA 5KYUB 4LDRA 3VM6A 3ZQYA 1KU2A 3TQOA 1M6TA 3R7CA 1T01A 5DQTA 4BEJA 1T9KA 2Y3GA 3Q7GA 4IGGA 3ZTZA 3MBGA 5KYYA 1TWCA 3U2LA 2V3CC 2XLVA 2PX3A 2B0HA 3ZSUA 5FCLA 4UDVA 3NMIA 4CJOA 3ASNC 2HZ8A 3RW0A 3UMHA 2JPUA 1G8XA 2BL2A 3RH3A 3W8IA 2J7PD 4YK5A 3OEOA 3U0CA 4EBKA 1ZHTA 3EG9B 5DQZA 1AVOB 5DS5A 1AUEA 2B0JA 2H8AA 1PV3A 3EHMA 2P0NA 2FAPB 4CIPA 4MVRA 4KNVA 4G7OF 5B3SC 1FNTc 4D4XA 1D1AA 3GANA 2KSFA 4LDQA 1FMVA 5T3WA 3EH2A 4WJ0A 3KMIA 3JRMO 1Q0DA 1GGQA 3VAYA 1RJ9B 1BDJB 1M2OA 5JP7A 2QUPA 3LNRA 5AGFA 3BRJA 1HW2A 3B0UX 5COFA 1RCPA 2J45A 1RKCA 4XPYA 5L0FA 1ORYA 3KPHA 4O79A 3TK0A 4E0IA 3B29A 1S05A 1F1MA 4HE8D 1E2XA 1R4TA 1EA8A 2AWYA 4LLCA 4W8KA 3W2WA 2UUIA 2BC5A 5JVEA 3LLKA 2CYDA 2R9RB 4OINF 2H7VC 1C17M 1OKKA 2A6EF 2PNOA 1FFHA 4DRIB 3PHF2 3DI5A 1WN0A 3TOMA 1EKYA 4O7GA 2YLIA 1T6QA 4AL1A 5L0GA 5L3VA 5B1BC 3QMKA 3AQBA 3I5QA 1YZCA 3EFOB 3DJNB 1C03A 3LAYA 1OQCA 3NMJA 2WVQA 3US6A 3TULA 3TJ5A 2DB4A 4JJFA 1A0BA 4CS8C 1W2WA 3V5XA 3C8ZA 4EKWA 3L34A 1TWGA 2D4UA 2W4BA 4Z9HA 1R5ID 4JEAA 3DAGA 1B68A 4BJ6C 1CPRA 1D0ZA 3IQTA 3RFYA 3CSKA 3SXMA 3FDQA 3NG1A 4PJMA 5A6JA 1NBBA 2XS8A 4E7SA 2X0CA 1SZIA 2A0BA 2XLHA 4JJGA 4CSAC 4IWBA 4FX5A 1MMDA 2IXOA 4YN0B 4PK4A 2R7WA 4YL3A 3SXZA 2Q00A 1MQVA 2CGEA 2L9JA 1V54C 2IXNA 2ZXOA 3UMKA 4EWCA 3FOOA 1PCXA 2XLDA 3B9QA 3IQ6A 2VASA 3AGUA 2ZXPA 3AOUA 2NUPA 5DVWA 4JCHA 1NG1A 4PJLA 1A7DA 2X51A 3L1MA 5BUOA 4QI2A 1OW7A 3LESA 3PMRA 4HEAJ 2V26A 2VCAA 3FAJA 1APCA 3K1HA 2ZXWC 2PFDA 2IBFA 4M63A 4U5EE 3ZG1A 1RMVA 2NPUA 5KYNA 4QDLA 3TJ6A 2R7VA 4U9DA 4MS2A 3HNLA 3V7OA 5A6BD 2XXAA 4EHPA 3Q6NA 1D0XA 1YA9A 3C8GB 4JIOA 4YT5A 3L0IA 5A6AA 1Z3IX 3UGPA 2CCYA 1ZW2A 1V4AA 2WZGA 1QLEC 3UR3C 1GM5A 1T5OA 2KNHA 3L8JA 4WGZA 3RKOF 2LSEA 4XEFA 2LFFA 5AC4A 1LS4A 4E7ZA 1ZHXA 4KBLA 1I5NA 2Z15A 1YARO 1PD0A 3LLIA 2Y69C 2XLMA 3NRHA 3U3BA 1J8MF 1ZVZA 2L81A 3AG4C 3U8VA 5L3QA 2R7OA 1ZHZA 3AG3C 3DXJF 3NYJA 3ZTMA 1WOLA 1XZQA 1OR3A 3AQCA 4JEBA 2R7TA 1JPJA 4PJJA 3MYIA 2IXMA 3K1IA 2Y3DA 4PFPA 3C18A 3G50A 1QQ3A 4XLNF 4MTOA 2J9BA 2VB6A 1A41A 4PACA 2R05A 3ASOC 4B6IA 3KH2A 4MVZA 5BQGA 3JCUQ 3S9OA 1JAFA 2W4MA 2J0WA 2ZXRA 3B0PA 1OCRC 2XL4A 3I5PA 3OA1A 2DYSC 3CAXA 1Z7Qc 4MQ9F 1HMOA 4C7OB 3W8HA 4CIHA 1LM3B 2WL8A 4JC7A 3QTHA 2NUTA 5A69A 2GFHA 2LCHA 1V74B 5KYXB 2ASRA 4HFKB 3MYFA 4JKVA 2YHSA 3KYIA 3LEOA 3SEOA 3SNHA 1SF8A 2ZD9A 2KGOA 3GM2A 3RIPA 4MVSA 4DJ9A 3J06A 4NTBA 5D92A 3DE9A 2P1AA 3C63A 1U89A 4JTDB 4AE4A 1JPNA 2PP4A 1WATA 2IM8A 1IW7F 4MVMA 2HMQA 3X2QC 1OXKA 4XPXA 5L0DA 4A4AA 2G3VA 3ZIBA 4OIOF 4MVUA 3H2VA 3IQCA 4JZAA 2M4EA 1RXQA 2MYSA 4JTCB 1WTYA 1ORJA 1K05A 1WASA 1NSGB 2KK1A 2L6HA 3MX3A 1D1BA 4U5DE 4CS9A 4FAPB 2VCBA 1S7ZA 1OCOC 4YT8A 1FAPB 3SZRA 5DS6A 5A6BA 3H65A 5EGYA 1AEPA 4O6YA 1NZEA 4RDAA 5D91A 4ZLCA 5F5FA 2EIJC 1NFOA 1SR2A 2GDCA 1ZZPA 1BBHA 1LIHA 3N0TA 1TWHA 3GM3A 3W4YA 2TMVP 3O55A 5K0IA 1OW8A 1GS9A 3JYHA 4IJJA 4P6IC 3QW1A 4C3BA 1IZMA 3ATPA 3IPMO 1JMWA 4HFFB 1NLXA 4QI0A 2NSGA 4P9TA 3M79A 2AU5A 3O10A 1LE2A 2YL7A 5CI9A 5FZTA 1VLTA 4DOZA 4NTAA 1G5ZA 3BEHA 4LACB 4JE9A 2R25A 1Q0KA 1D0YA 1O5HA 3ABMC 5T1DB 1UFBA 1ZYRF 256BA 4J7YA 2XXAB 3VYWA 2CDQA 3HJCA 3DKAA 1LPEA 4GYTA 4EUKB 2GA0A 4JW1A 3T6GB 4BJ6A 1T6UA 3A9CA 3KKBA 1SYQA 2XLEA 2XM4A 3DZAA 3ECSA 3T4RA 2W9YA 4H4KC 2Q9BA 4KNWA 3ZQVA 3RF3A 2J9WA 3R2PA 3T9OA 3V5ZA 1KNYA 1MNEA 1O3UA 2KC3A 2Y3BA 3O39A 2ZPAA 1LI5A 2KW3C 3A11A 3EGDB 3F47A 1YZAA 1T6IA 3I4UA 1HE9A 4U5CE 3ZVRA 4BG0A 1U6HA 2C04A 4IARA 4NC3A 3M1CB 4BJ1A 4XLPF 4MW3A 1N1CA 4E18A 2HS5A 4NQFA 5L0CA 1RKEA 4YT2A 3NMKA 3UGOA 4OD5A 2A6HF 4R32A 3Q7LA 4W8PA 3SP1A 1BR2A 2HFIA 4D4NA 5L0HA 2R7XA 5EK0A 3EZIA 2OJQA 3ZDLA 1MMNA 3V5YA 3Q6MA 2EINC 3GEIA 1EI7A 2J8WA 3S84A 2OJED 2KQ9A 1OXBA 3QZCA 2YKZA 2VH3A 5BQIA 4DRHB 1I4YA 1YVIA 2EIMC 3WG7C 1L3PA 3GODA 4OD4A 3SXYA 1MMAA 4EBBA 4YWQA 2AVKA 5HSWA 4ZLDA 3DM5A 3M4BA 3FOPA 3SYNA 2G62A 2QNLA 5CI8A 1CGOA 5GPGB 4XEKA 4CDAA 2LD6A 1DOVA 3JRTA 4OIPF 5E3AA 2XL6A 2YL1A 4X0RA 4CBEA 2A69F 2L7AA 3GM1A 1YAUO 1NU9C 3M4CA 4U5BE 1QSPA 4DBQA 2OEVA 3ZC4A 2H7OA 3X1OA 3CZ6A 1OCCC 2A68F 2WVNA 3LS1A 3MLGA 3NYLA 4L6RA 5T3TA 4JCZA 3TD7A 3PDMP 4YL1A 4G7ZF 1YDIA 2NUTB 3DM9B 3GORA 3KL4A 3LS0A 2Q4FA 3E9VA 4OIRF 3LNMB 2IXPA 2L6FA 4XQ1A 2HKVA 5DLJA 5JLIA 2OU6A 4NY3A 2LP4A 5EHHA 1M56C 4I1MA 3C7JA 2YQYA 3OWTA 5TJ5E 4U5HA 1E84A 4U5FE 3VRCA 1CGNA 1QPUA 2HJ3A 2OKUA 1QZXA 4CSAA 1CPQA 2EPOA 1QKRA 5COGA 3S28A 4BJ5A 4IAOA 2YRFA 3JYYA 4KI2A 2QTVA 3M15A 1ZW3A 1SMYF 5DS4A 1ZU4A 1H9GA 3RVZA 3T6JA 1ORSC 4C3DA 5IY5C 1UG7A 1O87A 1LE4A 2YEVA 2XM0A 3CQZA 3K33A 3EJNA 2I8BA 3HKKA 4LDKA 4XPWA 5F28E 2EIKC 2HSBA 4I1OB 2NUPB 3IEEA 2PX0A 4MW8A 2EPKX 1WWPA 1V55C 2O9XA 2PBEA 2W45A 4JVSA 3JTLO 2HMZA 3H2UA 5JSLA 2AP3A 5BQHA 3JSZA 1RKEB 4K1OA 4MTGA 1PD1A 1NFNA 2IYLD 2ETSA 4Q7CA 3QW0A 4RD9A 4F4BA 4IAQA 2MWQA 3CEXA 4Z9IA 4OIQF 1Y6DA 4CDYA 1MMGA 2A1DD 2XSEA 3G4XA 1YYXA 5AC5A 4KC9A 2R7QA 3NYMA 1H7IA 4C3EA 3WAQA 1ZHWA 2DGJA 4N6CA 1VMAA 3QVZA 2YL0A 3IQ5A 1H9TA 2AWCA 1M2VB 3DAFA 4G7HF 1K04A 4AX2A 4IRUA 2MHRA 1YA7O 3S27A 4BJTA 2OOCA 5B1AC 4O6NA 3DD7A 3NDBB 1YYJA 2L6GA 4K7BA 3AG2C 3N2ZB 3HNIA 4LLEA 2Q3TA 3RVYA 2Q9AA 2YWAA 3IHUA 1MNDA 4LERA 1Q0GA 1BR1A 1FMWA 2LK4A 3DE8A 3EG9A 2OCCC 2XRHA 1OCZC 1YJGA 1Z23A 2KJGA 2WZFA 4MVQA 2QE9A 2OG2A 3GEEA 4U5GA 1BR4A 3FHDA 3N24A 4AE4B 3KYJA 1EQ1A 2DI3A 2LQGA 1L7CA 3EFOA 1JRAA 3EPVA 3GEHA 2R02A 4O6MA 4YJWA 1FTSA 3RQGA 1E85A 3HNJA 3HNKA 2NSFA 4YL0A 2YLGA 1FR0A 4N06A 4DVYP 3ZWIA 2EPMX 4PJNA 1OR2A 3ABLC 4IB4A 1OW6A 5HV9A 1VTMP 2H7BA 1ST6A 2YVKA 2RSEB 4BJ5C 1LKXA 1J8YF 2LIGA 2M64A 3C8GD 3LUTB 4FESA 3U9MA 2CW0F 4GEHA 2A0UA 2OEXA 2QLAA 4CX9A 2R7SA 2J0XA 3EZHA 1TWAA 4DBRA 1VYIA 1E83A 2ICWG 1XWJA 4DXWA 2CNWD 4G0HA 3HLZA 2R7UA 2P61A 1G4WR 3UNGC 2IOQA 3K1IC 3PCVA 3S0XA 5E2QA 4E17A 4DVZA 3E70C 3DWWA 3VF0A 2J46A 3RQEA 3EGXB 4MNDA 4CS7A 4Q5SF 3EGXA 1D1CA 3NKDA 4I44A 2HUJA 2WVOA 4WGYA 2BE5F 1VB5A 1OKKD 4CJGA 1YLMA 2FGYA 2DYRC 3JT1A 4PR9A 4Z9JA 3RYLA 1HW1A 4EIYA 5KYYB 1KTMA 3S29A 5KYWA 5JS5A 4WABA 3S90A 3TOLA 2XLOA 4N4WA 1VYKA 1E86A 1XZPA 5E33A 4AK9A 4P9FA 2F22A 2VC9A 2YL3A 4JURI 1Y4CA 1RJ9A 1DOWA 3K6BA 3O6XA 1HMDA 1ZHYA 5KYWB 1TR2A 2YLDA 3DMDA 1HY5A 2RD9A 3FVYA 2XS1A 2HJMA 3MFNA 1LI7A 3EGDA 5F5HA 1Q0MA 3F46A 2I15A 4I3MA 2LFDA 4BPMA 3ITFA 1I4ZA 2Q7RA 3SXKA 5CIVA 2GWWA 2FFHA 3EH1A 3K7DA 3U9JA 4ER9A 4ULWA 1C02A 5KYXA 2C03A 4CDVA 1Z63A 1G4US 3GWNA 4XTKA 4Q4ZF 4JRZA 2EILC 4DRJB 3QVYA 3U2MA 2P7VA 1TFKB 1U0BB 4J7TA 3U3FA 4MTFA 4AL0A
chains in the Genus database with same CATH topology
4JEAA 4U9EA 5JSLA 4ULVA 1BBHA 1CPRA 3QW0A 5B3IA 4IAQA 1NBBA 3QW1A 4CDYA 2XLHA 1YYXA 1MQVA 3M79A 2YL7A 4N6HA 3QVZA 2YL0A 3IQ5A 3FOOA 2XLDA 3IQ6A 4JE9A 256BA 1YYJA 3L1MA 3HNIA 1APCA 2XLEA 2XM4A 5JUAA 5JT4A 3ZQVA 3DE8A 4U9DA 5JRAA 1GQAA 3HNLA 4ER9A 3M4BA 2XL8A 3C62A 1YZAA 1A7VA 4IARA 4NC3A 2XLWA 2CCYA 1E85A 3NMKA 3HNJA 3HNKA 4WGZA 4D4NA 2YLGA 3ZWIA 4IB4A 3U8PA 3ZQYA 2J8WA 2XLMA 1M6TA 2YKZA 3ZTZA 3ZTMA 2XLVA 2QLAA 4CX9A 4JEBA 3NMIA 1E83A 4CJOA 3FOPA 4CDAA 1CGOA 1QQ3A 2J9BA 2XL6A 2YL1A 3M4CA 4CIPA 1JAFA 4WGYA 4D4XA 4L6RA 4CJGA 4EIYA 1LM3B 5JP7A 5JS5A 4JKVA 5AGFA 3TOLA 2XLOA 5JLIA 4N4WA 1E86A 1RCPA 3DE9A 3C63A 1S05A 2YL3A 5JVEA 2YLDA 2BC5A 1E84A 3VRCA 1CGNA 1QPUA 1CPQA 3TOMA 1EKYA 2YLIA 3M15A 1YZCA 4CDVA 3NMJA 2XM0A 3QVYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JEA A;  4U9E A;  5JSL A;  4ULV A;  1BBH A;  1CPR A;  3QW0 A;  5B3I A;  4IAQ A;  1NBB A;  3QW1 A;  4CDY A;  2XLH A;  1YYX A;  1MQV A;  3M79 A;  2YL7 A;  4N6H A;  3QVZ A;  2YL0 A;  3IQ5 A;  3FOO A;  2XLD A;  3IQ6 A;  4JE9 A;  256B A;  1YYJ A;  3L1M A;  3HNI A;  1APC A;  2XLE A;  2XM4 A;  5JUA A;  5JT4 A;  3ZQV A;  3DE8 A;  4U9D A;  5JRA A;  1GQA A;  3HNL A;  4ER9 A;  3M4B A;  2XL8 A;  3C62 A;  1YZA A;  1A7V A;  4IAR A;  4NC3 A;  2XLW A;  2CCY A;  1E85 A;  3NMK A;  3HNJ A;  3HNK A;  4WGZ A;  4D4N A;  2YLG A;  3ZWI A;  4IB4 A;  3U8P A;  3ZQY A;  2J8W A;  2XLM A;  1M6T A;  2YKZ A;  3ZTZ A;  3ZTM A;  2XLV A;  2QLA A;  4CX9 A;  4JEB A;  3NMI A;  1E83 A;  4CJO A;  3FOP A;  4CDA A;  1CGO A;  1QQ3 A;  2J9B A;  2XL6 A;  2YL1 A;  3M4C A;  4CIP A;  1JAF A;  4WGY A;  4D4X A;  4L6R A;  4CJG A;  4EIY A;  1LM3 B;  5JP7 A;  5JS5 A;  4JKV A;  5AGF A;  3TOL A;  2XLO A;  5JLI A;  4N4W A;  1E86 A;  1RCP A;  3DE9 A;  3C63 A;  1S05 A;  2YL3 A;  5JVE A;  2YLD A;  2BC5 A;  1E84 A;  3VRC A;  1CGN A;  1QPU A;  1CPQ A;  3TOM A;  1EKY A;  2YLI A;  3M15 A;  1YZC A;  4CDV A;  3NMJ A;  2XM0 A;  3QVY A; 
#chains in the Genus database with same CATH topology
 3FXH A;  3UMI A;  1Z6A A;  2J7P A;  4U9E A;  2J9V A;  4C7O A;  1BZ4 A;  2NG1 A;  4ULV A;  3U5S A;  1LVK A;  4BEM J;  4YT4 A;  2YZS A;  3K66 A;  5B3I A;  3FMS A;  3AGT A;  2R03 A;  3C8G A;  3B0V C;  1Q0F A;  4NCQ A;  3RQF A;  1TQG A;  2WB7 A;  2PF4 E;  3HTK C;  1H6G A;  4ONS A;  3B71 A;  2P6V A;  3AG1 C;  2Y39 A;  4J32 B;  5L0I A;  4N6H A;  2R7R A;  1FFT C;  3JSE O;  1M2V A;  1M57 C;  2J9U A;  2VCC A;  3NKE A;  4FWV A;  2EPN A;  5A6K A;  1A7E A;  2JX0 A;  1LS1 A;  2HSQ A;  4CS8 A;  1WGW A;  2Q9C A;  2UUH A;  3WOD F;  1QVX A;  3L8I A;  4A2N B;  2CNW A;  3JZ0 A;  3FAP B;  1TKN A;  4H54 A;  1Z5Z A;  1K40 A;  2D5R B;  2QY9 A;  2EPL X;  4NTF A;  4E0H A;  2WZL A;  3DJU B;  4GQH A;  4XEV A;  5JUA A;  5JT4 A;  1VOM A;  2Y3H A;  5L0J A;  1VLS A;  1ZU5 A;  1NU7 D;  2G3K A;  4MVO A;  4XWJ A;  3POV A;  5JRA A;  1CGM E;  1GQA A;  3EQL F;  4JTA B;  4J30 B;  1JR8 A;  2XL8 A;  3C62 A;  3AJM A;  4ANJ A;  1TFO B;  1A7V A;  5KYU A;  4PFO A;  2OQM A;  3T6B A;  4EBJ A;  2XLW A;  1JOG A;  1VK5 A;  2KYH A;  3WHN A;  5COM A;  2HV6 A;  2HV7 A;  4G78 A;  3LJB A;  3ABK C;  3GWL A;  3LEV A;  4CS9 C;  2GAQ A;  2JD3 A;  1HE1 A;  3G4Z A;  4K0D A;  4RBN A;  3W2V A;  3EHN A;  2E87 A;  5E3C A;  3U8P A;  5KYU B;  4LDR A;  3VM6 A;  3ZQY A;  1KU2 A;  3TQO A;  1M6T A;  3R7C A;  1T01 A;  5DQT A;  4BEJ A;  1T9K A;  2Y3G A;  3Q7G A;  4IGG A;  3ZTZ A;  3MBG A;  5KYY A;  1TWC A;  3U2L A;  2V3C C;  2XLV A;  2PX3 A;  2B0H A;  3ZSU A;  5FCL A;  4UDV A;  3NMI A;  4CJO A;  3ASN C;  2HZ8 A;  3RW0 A;  3UMH A;  2JPU A;  1G8X A;  2BL2 A;  3RH3 A;  3W8I A;  2J7P D;  4YK5 A;  3OEO A;  3U0C A;  4EBK A;  1ZHT A;  3EG9 B;  5DQZ A;  1AVO B;  5DS5 A;  1AUE A;  2B0J A;  2H8A A;  1PV3 A;  3EHM A;  2P0N A;  2FAP B;  4CIP A;  4MVR A;  4KNV A;  4G7O F;  5B3S C;  1FNT c;  4D4X A;  1D1A A;  3GAN A;  2KSF A;  4LDQ A;  1FMV A;  5T3W A;  3EH2 A;  4WJ0 A;  3KMI A;  3JRM O;  1Q0D A;  1GGQ A;  3VAY A;  1RJ9 B;  1BDJ B;  1M2O A;  5JP7 A;  2QUP A;  3LNR A;  5AGF A;  3BRJ A;  1HW2 A;  3B0U X;  5COF A;  1RCP A;  2J45 A;  1RKC A;  4XPY A;  5L0F A;  1ORY A;  3KPH A;  4O79 A;  3TK0 A;  4E0I A;  3B29 A;  1S05 A;  1F1M A;  4HE8 D;  1E2X A;  1R4T A;  1EA8 A;  2AWY A;  4LLC A;  4W8K A;  3W2W A;  2UUI A;  2BC5 A;  5JVE A;  3LLK A;  2CYD A;  2R9R B;  4OIN F;  2H7V C;  1C17 M;  1OKK A;  2A6E F;  2PNO A;  1FFH A;  4DRI B;  3PHF 2;  3DI5 A;  1WN0 A;  3TOM A;  1EKY A;  4O7G A;  2YLI A;  1T6Q A;  4AL1 A;  5L0G A;  5L3V A;  5B1B C;  3QMK A;  3AQB A;  3I5Q A;  1YZC A;  3EFO B;  3DJN B;  1C03 A;  3LAY A;  1OQC A;  3NMJ A;  2WVQ A;  3US6 A;  3TUL A;  3TJ5 A;  2DB4 A;  4JJF A;  1A0B A;  4CS8 C;  1W2W A;  3V5X A;  3C8Z A;  4EKW A;  3L34 A;  1TWG A;  2D4U A;  2W4B A;  4Z9H A;  1R5I D;  4JEA A;  3DAG A;  1B68 A;  4BJ6 C;  1CPR A;  1D0Z A;  3IQT A;  3RFY A;  3CSK A;  3SXM A;  3FDQ A;  3NG1 A;  4PJM A;  5A6J A;  1NBB A;  2XS8 A;  4E7S A;  2X0C A;  1SZI A;  2A0B A;  2XLH A;  4JJG A;  4CSA C;  4IWB A;  4FX5 A;  1MMD A;  2IXO A;  4YN0 B;  4PK4 A;  2R7W A;  4YL3 A;  3SXZ A;  2Q00 A;  1MQV A;  2CGE A;  2L9J A;  1V54 C;  2IXN A;  2ZXO A;  3UMK A;  4EWC A;  3FOO A;  1PCX A;  2XLD A;  3B9Q A;  3IQ6 A;  2VAS A;  3AGU A;  2ZXP A;  3AOU A;  2NUP A;  5DVW A;  4JCH A;  1NG1 A;  4PJL A;  1A7D A;  2X51 A;  3L1M A;  5BUO A;  4QI2 A;  1OW7 A;  3LES A;  3PMR A;  4HEA J;  2V26 A;  2VCA A;  3FAJ A;  1APC A;  3K1H A;  2ZXW C;  2PFD A;  2IBF A;  4M63 A;  4U5E E;  3ZG1 A;  1RMV A;  2NPU A;  5KYN A;  4QDL A;  3TJ6 A;  2R7V A;  4U9D A;  4MS2 A;  3HNL A;  3V7O A;  5A6B D;  2XXA A;  4EHP A;  3Q6N A;  1D0X A;  1YA9 A;  3C8G B;  4JIO A;  4YT5 A;  3L0I A;  5A6A A;  1Z3I X;  3UGP A;  2CCY A;  1ZW2 A;  1V4A A;  2WZG A;  1QLE C;  3UR3 C;  1GM5 A;  1T5O A;  2KNH A;  3L8J A;  4WGZ A;  3RKO F;  2LSE A;  4XEF A;  2LFF A;  5AC4 A;  1LS4 A;  4E7Z A;  1ZHX A;  4KBL A;  1I5N A;  2Z15 A;  1YAR O;  1PD0 A;  3LLI A;  2Y69 C;  2XLM A;  3NRH A;  3U3B A;  1J8M F;  1ZVZ A;  2L81 A;  3AG4 C;  3U8V A;  5L3Q A;  2R7O A;  1ZHZ A;  3AG3 C;  3DXJ F;  3NYJ A;  3ZTM A;  1WOL A;  1XZQ A;  1OR3 A;  3AQC A;  4JEB A;  2R7T A;  1JPJ A;  4PJJ A;  3MYI A;  2IXM A;  3K1I A;  2Y3D A;  4PFP A;  3C18 A;  3G50 A;  1QQ3 A;  4XLN F;  4MTO A;  2J9B A;  2VB6 A;  1A41 A;  4PAC A;  2R05 A;  3ASO C;  4B6I A;  3KH2 A;  4MVZ A;  5BQG A;  3JCU Q;  3S9O A;  1JAF A;  2W4M A;  2J0W A;  2ZXR A;  3B0P A;  1OCR C;  2XL4 A;  3I5P A;  3OA1 A;  2DYS C;  3CAX A;  1Z7Q c;  4MQ9 F;  1HMO A;  4C7O B;  3W8H A;  4CIH A;  1LM3 B;  2WL8 A;  4JC7 A;  3QTH A;  2NUT A;  5A69 A;  2GFH A;  2LCH A;  1V74 B;  5KYX B;  2ASR A;  4HFK B;  3MYF A;  4JKV A;  2YHS A;  3KYI A;  3LEO A;  3SEO A;  3SNH A;  1SF8 A;  2ZD9 A;  2KGO A;  3GM2 A;  3RIP A;  4MVS A;  4DJ9 A;  3J06 A;  4NTB A;  5D92 A;  3DE9 A;  2P1A A;  3C63 A;  1U89 A;  4JTD B;  4AE4 A;  1JPN A;  2PP4 A;  1WAT A;  2IM8 A;  1IW7 F;  4MVM A;  2HMQ A;  3X2Q C;  1OXK A;  4XPX A;  5L0D A;  4A4A A;  2G3V A;  3ZIB A;  4OIO F;  4MVU A;  3H2V A;  3IQC A;  4JZA A;  2M4E A;  1RXQ A;  2MYS A;  4JTC B;  1WTY A;  1ORJ A;  1K05 A;  1WAS A;  1NSG B;  2KK1 A;  2L6H A;  3MX3 A;  1D1B A;  4U5D E;  4CS9 A;  4FAP B;  2VCB A;  1S7Z A;  1OCO C;  4YT8 A;  1FAP B;  3SZR A;  5DS6 A;  5A6B A;  3H65 A;  5EGY A;  1AEP A;  4O6Y A;  1NZE A;  4RDA A;  5D91 A;  4ZLC A;  5F5F A;  2EIJ C;  1NFO A;  1SR2 A;  2GDC A;  1ZZP A;  1BBH A;  1LIH A;  3N0T A;  1TWH A;  3GM3 A;  3W4Y A;  2TMV P;  3O55 A;  5K0I A;  1OW8 A;  1GS9 A;  3JYH A;  4IJJ A;  4P6I C;  3QW1 A;  4C3B A;  1IZM A;  3ATP A;  3IPM O;  1JMW A;  4HFF B;  1NLX A;  4QI0 A;  2NSG A;  4P9T A;  3M79 A;  2AU5 A;  3O10 A;  1LE2 A;  2YL7 A;  5CI9 A;  5FZT A;  1VLT A;  4DOZ A;  4NTA A;  1G5Z A;  3BEH A;  4LAC B;  4JE9 A;  2R25 A;  1Q0K A;  1D0Y A;  1O5H A;  3ABM C;  5T1D B;  1UFB A;  1ZYR F;  256B A;  4J7Y A;  2XXA B;  3VYW A;  2CDQ A;  3HJC A;  3DKA A;  1LPE A;  4GYT A;  4EUK B;  2GA0 A;  4JW1 A;  3T6G B;  4BJ6 A;  1T6U A;  3A9C A;  3KKB A;  1SYQ A;  2XLE A;  2XM4 A;  3DZA A;  3ECS A;  3T4R A;  2W9Y A;  4H4K C;  2Q9B A;  4KNW A;  3ZQV A;  3RF3 A;  2J9W A;  3R2P A;  3T9O A;  3V5Z A;  1KNY A;  1MNE A;  1O3U A;  2KC3 A;  2Y3B A;  3O39 A;  2ZPA A;  1LI5 A;  2KW3 C;  3A11 A;  3EGD B;  3F47 A;  1YZA A;  1T6I A;  3I4U A;  1HE9 A;  4U5C E;  3ZVR A;  4BG0 A;  1U6H A;  2C04 A;  4IAR A;  4NC3 A;  3M1C B;  4BJ1 A;  4XLP F;  4MW3 A;  1N1C A;  4E18 A;  2HS5 A;  4NQF A;  5L0C A;  1RKE A;  4YT2 A;  3NMK A;  3UGO A;  4OD5 A;  2A6H F;  4R32 A;  3Q7L A;  4W8P A;  3SP1 A;  1BR2 A;  2HFI A;  4D4N A;  5L0H A;  2R7X A;  5EK0 A;  3EZI A;  2OJQ A;  3ZDL A;  1MMN A;  3V5Y A;  3Q6M A;  2EIN C;  3GEI A;  1EI7 A;  2J8W A;  3S84 A;  2OJE D;  2KQ9 A;  1OXB A;  3QZC A;  2YKZ A;  2VH3 A;  5BQI A;  4DRH B;  1I4Y A;  1YVI A;  2EIM C;  3WG7 C;  1L3P A;  3GOD A;  4OD4 A;  3SXY A;  1MMA A;  4EBB A;  4YWQ A;  2AVK A;  5HSW A;  4ZLD A;  3DM5 A;  3M4B A;  3FOP A;  3SYN A;  2G62 A;  2QNL A;  5CI8 A;  1CGO A;  5GPG B;  4XEK A;  4CDA A;  2LD6 A;  1DOV A;  3JRT A;  4OIP F;  5E3A A;  2XL6 A;  2YL1 A;  4X0R A;  4CBE A;  2A69 F;  2L7A A;  3GM1 A;  1YAU O;  1NU9 C;  3M4C A;  4U5B E;  1QSP A;  4DBQ A;  2OEV A;  3ZC4 A;  2H7O A;  3X1O A;  3CZ6 A;  1OCC C;  2A68 F;  2WVN A;  3LS1 A;  3MLG A;  3NYL A;  4L6R A;  5T3T A;  4JCZ A;  3TD7 A;  3PDM P;  4YL1 A;  4G7Z F;  1YDI A;  2NUT B;  3DM9 B;  3GOR A;  3KL4 A;  3LS0 A;  2Q4F A;  3E9V A;  4OIR F;  3LNM B;  2IXP A;  2L6F A;  4XQ1 A;  2HKV A;  5DLJ A;  5JLI A;  2OU6 A;  4NY3 A;  2LP4 A;  5EHH A;  1M56 C;  4I1M A;  3C7J A;  2YQY A;  3OWT A;  5TJ5 E;  4U5H A;  1E84 A;  4U5F E;  3VRC A;  1CGN A;  1QPU A;  2HJ3 A;  2OKU A;  1QZX A;  4CSA A;  1CPQ A;  2EPO A;  1QKR A;  5COG A;  3S28 A;  4BJ5 A;  4IAO A;  2YRF A;  3JYY A;  4KI2 A;  2QTV A;  3M15 A;  1ZW3 A;  1SMY F;  5DS4 A;  1ZU4 A;  1H9G A;  3RVZ A;  3T6J A;  1ORS C;  4C3D A;  5IY5 C;  1UG7 A;  1O87 A;  1LE4 A;  2YEV A;  2XM0 A;  3CQZ A;  3K33 A;  3EJN A;  2I8B A;  3HKK A;  4LDK A;  4XPW A;  5F28 E;  2EIK C;  2HSB A;  4I1O B;  2NUP B;  3IEE A;  2PX0 A;  4MW8 A;  2EPK X;  1WWP A;  1V55 C;  2O9X A;  2PBE A;  2W45 A;  4JVS A;  3JTL O;  2HMZ A;  3H2U A;  5JSL A;  2AP3 A;  5BQH A;  3JSZ A;  1RKE B;  4K1O A;  4MTG A;  1PD1 A;  1NFN A;  2IYL D;  2ETS A;  4Q7C A;  3QW0 A;  4RD9 A;  4F4B A;  4IAQ A;  2MWQ A;  3CEX A;  4Z9I A;  4OIQ F;  1Y6D A;  4CDY A;  1MMG A;  2A1D D;  2XSE A;  3G4X A;  1YYX A;  5AC5 A;  4KC9 A;  2R7Q A;  3NYM A;  1H7I A;  4C3E A;  3WAQ A;  1ZHW A;  2DGJ A;  4N6C A;  1VMA A;  3QVZ A;  2YL0 A;  3IQ5 A;  1H9T A;  2AWC A;  1M2V B;  3DAF A;  4G7H F;  1K04 A;  4AX2 A;  4IRU A;  2MHR A;  1YA7 O;  3S27 A;  4BJT A;  2OOC A;  5B1A C;  4O6N A;  3DD7 A;  3NDB B;  1YYJ A;  2L6G A;  4K7B A;  3AG2 C;  3N2Z B;  3HNI A;  4LLE A;  2Q3T A;  3RVY A;  2Q9A A;  2YWA A;  3IHU A;  1MND A;  4LER A;  1Q0G A;  1BR1 A;  1FMW A;  2LK4 A;  3DE8 A;  3EG9 A;  2OCC C;  2XRH A;  1OCZ C;  1YJG A;  1Z23 A;  2KJG A;  2WZF A;  4MVQ A;  2QE9 A;  2OG2 A;  3GEE A;  4U5G A;  1BR4 A;  3FHD A;  3N24 A;  4AE4 B;  3KYJ A;  1EQ1 A;  2DI3 A;  2LQG A;  1L7C A;  3EFO A;  1JRA A;  3EPV A;  3GEH A;  2R02 A;  4O6M A;  4YJW A;  1FTS A;  3RQG A;  1E85 A;  3HNJ A;  3HNK A;  2NSF A;  4YL0 A;  2YLG A;  1FR0 A;  4N06 A;  4DVY P;  3ZWI A;  2EPM X;  4PJN A;  1OR2 A;  3ABL C;  4IB4 A;  1OW6 A;  5HV9 A;  1VTM P;  2H7B A;  1ST6 A;  2YVK A;  2RSE B;  4BJ5 C;  1LKX A;  1J8Y F;  2LIG A;  2M64 A;  3C8G D;  3LUT B;  4FES A;  3U9M A;  2CW0 F;  4GEH A;  2A0U A;  2OEX A;  2QLA A;  4CX9 A;  2R7S A;  2J0X A;  3EZH A;  1TWA A;  4DBR A;  1VYI A;  1E83 A;  2ICW G;  1XWJ A;  4DXW A;  2CNW D;  4G0H A;  3HLZ A;  2R7U A;  2P61 A;  1G4W R;  3UNG C;  2IOQ A;  3K1I C;  3PCV A;  3S0X A;  5E2Q A;  4E17 A;  4DVZ A;  3E70 C;  3DWW A;  3VF0 A;  2J46 A;  3RQE A;  3EGX B;  4MND A;  4CS7 A;  4Q5S F;  3EGX A;  1D1C A;  3NKD A;  4I44 A;  2HUJ A;  2WVO A;  4WGY A;  2BE5 F;  1VB5 A;  1OKK D;  4CJG A;  1YLM A;  2FGY A;  2DYR C;  3JT1 A;  4PR9 A;  4Z9J A;  3RYL A;  1HW1 A;  4EIY A;  5KYY B;  1KTM A;  3S29 A;  5KYW A;  5JS5 A;  4WAB A;  3S90 A;  3TOL A;  2XLO A;  4N4W A;  1VYK A;  1E86 A;  1XZP A;  5E33 A;  4AK9 A;  4P9F A;  2F22 A;  2VC9 A;  2YL3 A;  4JUR I;  1Y4C A;  1RJ9 A;  1DOW A;  3K6B A;  3O6X A;  1HMD A;  1ZHY A;  5KYW B;  1TR2 A;  2YLD A;  3DMD A;  1HY5 A;  2RD9 A;  3FVY A;  2XS1 A;  2HJM A;  3MFN A;  1LI7 A;  3EGD A;  5F5H A;  1Q0M A;  3F46 A;  2I15 A;  4I3M A;  2LFD A;  4BPM A;  3ITF A;  1I4Z A;  2Q7R A;  3SXK A;  5CIV A;  2GWW A;  2FFH A;  3EH1 A;  3K7D A;  3U9J A;  4ER9 A;  4ULW A;  1C02 A;  5KYX A;  2C03 A;  4CDV A;  1Z63 A;  1G4U S;  3GWN A;  4XTK A;  4Q4Z F;  4JRZ A;  2EIL C;  4DRJ B;  3QVY A;  3U2M A;  2P7V A;  1TFK B;  1U0B B;  4J7T A;  3U3F A;  4MTF A;  4AL0 A; 
#chains in the Genus database with same CATH homology
 4JEA A;  4U9E A;  5JSL A;  4ULV A;  1BBH A;  1CPR A;  3QW0 A;  5B3I A;  4IAQ A;  1NBB A;  3QW1 A;  4CDY A;  2XLH A;  1YYX A;  1MQV A;  3M79 A;  2YL7 A;  4N6H A;  3QVZ A;  2YL0 A;  3IQ5 A;  3FOO A;  2XLD A;  3IQ6 A;  4JE9 A;  256B A;  1YYJ A;  3L1M A;  3HNI A;  1APC A;  2XLE A;  2XM4 A;  5JUA A;  5JT4 A;  3ZQV A;  3DE8 A;  4U9D A;  5JRA A;  1GQA A;  3HNL A;  4ER9 A;  3M4B A;  2XL8 A;  3C62 A;  1YZA A;  1A7V A;  4IAR A;  4NC3 A;  2XLW A;  2CCY A;  1E85 A;  3NMK A;  3HNJ A;  3HNK A;  4WGZ A;  4D4N A;  2YLG A;  3ZWI A;  4IB4 A;  3U8P A;  3ZQY A;  2J8W A;  2XLM A;  1M6T A;  2YKZ A;  3ZTZ A;  3ZTM A;  2XLV A;  2QLA A;  4CX9 A;  4JEB A;  3NMI A;  1E83 A;  4CJO A;  3FOP A;  4CDA A;  1CGO A;  1QQ3 A;  2J9B A;  2XL6 A;  2YL1 A;  3M4C A;  4CIP A;  1JAF A;  4WGY A;  4D4X A;  4L6R A;  4CJG A;  4EIY A;  1LM3 B;  5JP7 A;  5JS5 A;  4JKV A;  5AGF A;  3TOL A;  2XLO A;  5JLI A;  4N4W A;  1E86 A;  1RCP A;  3DE9 A;  3C63 A;  1S05 A;  2YL3 A;  5JVE A;  2YLD A;  2BC5 A;  1E84 A;  3VRC A;  1CGN A;  1QPU A;  1CPQ A;  3TOM A;  1EKY A;  2YLI A;  3M15 A;  1YZC A;  4CDV A;  3NMJ A;  2XM0 A;  3QVY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...