3RH3A

Crystal structure of an uncharacterized duf3829-like protein (bt_1908) from bacteroides thetaiotaomicron vpi-5482 at 2.10 a resolution
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
256
structure length
239
Chain Sequence
TEELDDASKVINYYHMSLAVLRHVANAKDINAVLGYMEQTGTAELLDPGDYFNPEVRQNLKQNYAGLFNVRTQFYDNFNKFLAYKKSKDTAKTAQLLDENYKLSVELSEYKQVIFDILSPLTEQAESELLADEPLKDQIMAMRKMSGTVQSIMNLYSRKHAMDGVRIDLKMAELEKELKAAEKIPAVTGYDEELKNFQSFLSTVKSFMNDMQKARSKGAYSDKEYQAMSEAYEYGLSVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of an Uncharacterized DUF3829-like protein (BT_1908) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution
rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized DUF3829-like protein
total genus 89
structure length 239
sequence length 256
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-04-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.820 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3rh3A02
1.20.120.930 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3rh3A01
3RH3A 4YJWA 3IEEA
chains in the Genus database with same CATH superfamily
4G7HF 3GEEA 3ANWA 3HKEE 5A69A 3HKDE 2JJ9A 4TUYE 1ORYA 5HAXA 4QDLA 3CWZB 2R03A 4JC7A 4ZS2A 3U2MA 3MFNA 4P1NA 3EQLF 3RYLA 3FZKB 4DRIB 3FZLB 4H63V 3L8IA 4MVOA 5LGNB 1A41A 2EPNA 1X79A 1FNTc 1HG2A 4CJOA 3M4CA 3KYIA 3H3AA 2RD9A 1B7TA 5HXEA 3RRWA 2LOPA 2J62A 2UU9T 2YEVC 2G0UA 3ZJ2A 3E22E 3B13A 3JC6D 1CGOA 4TNVA 2HUJA 1OWAA 3IQ6A 4TZ4C 2BKPA 3HNKA 1FJGT 1R4TA 4QX7B 2IHR1 3RH3A 4ZZCA 1FAPB 2CWOA 1UK5A 3C4WA 4EUKB 3V7OA 2HPLA 4LF5T 3O9XA 2R7WA 3EFOB 3EG9B 2WZGA 3KV4A 3EDUA 2B0JA 3SWHA 4ZLCA 4OIQF 1OR2A 4QWNB 4TV8E 1ZHWA 3PUSA 3HKKA 2WZIA 2XM4A 3U9MA 1I4ZA 2XLOA 2J8WA 5JTGA 1M62A 2LRKA 3KKBA 1ZHZA 3MX3A 1D1CA 5FCLA 4AISA 4AI6A 3ONXA 3A11A 1M6TA 4ILUA 5AQPB 4HEAJ 5JR9A 2W9YA 1TQGA 1RCPA 4ER9A 2A72A 4PK5A 4AL1A 4YFSA 5FL0A 4LERA 3CK6A 3RQGA 4G2AA 2P61A 4AQYT 3SS1A 4FESA 4NXMT 4JI2T 3ASOC 3Q7GA 2CLYC 3NWIA 3DJBA 4HFDA 1HNXT 5F5FA 4P6IC 3LDQB 3OTOT 4ULWA 4WBOA 2K24A 5KYUB 4JKVA 4UEMA 2Y48B 2JPFA 2VQET 3QUJA 4CXWA 4LMJA 5J0ZA 2A6HF 2WVQA 1WN0A 1KNZA 1ZYRF 4DVDA 1YW0A 1FEWA 4BPMA 1Z5ZA 3BQLA 4I44A 4YTMA 1QLBA 4GQHA 2W00A 5KDMC 4OX9T 2X9HA 5A6KA 2H89A 3ZN1B 3E08A 4YSXA 3S4UA 2D5UA 1Q0FA 5AQRB 2ACZA 2A1DD 3AJMA 3UMIA 5M4YA 4IE4A 2YHSA 1PCXA 2YKSA 3Q5EA 4IDNA 5FL1A 3VAYA 4A4AA 5JUAA 2LP4A 4XEVA 4O79A 2PBEA 2CXDA 3IQCA 5F28E 5IY5C 5C3JA 3AG4C 3JCUQ 5HCJA 1ZVZA 2E9XC 3M65A 4JI7T 1J5WA 3J7Yq 4TWFA 3MYIA 1YKEB 3P50A 1BR4A 4OFZA 3TLTA 2R9RB 2GA0A 3N9MA 4AKGA 3ZDLA 5KXJA 3UQ4A 2W0GA 1LVFA 1KEYA 2V7IA 4DUYT 3WG7C 3JAFA 1LVKA 4WBNE 3WAJA 3RIFA 1U89A 5JDHA 4YL1A 2DLRA 1MNEA 2XRHA 4U5DE 2I0MA 3DI5A 3S90A 4P0AA 5FKYA 1K05A 2C5JA 2FJEA 5LG3A 2LSJA 2WZLA 1OXKA 2XJ7A 5DQWA 4KC9A 4WYVA 1I94T 4E0IA 1PD1A 4LMKA 2P6VA 2Y3GA 2J0XA 3ZSSA 4U7YA 2MPKA 4JBWF 4MW8A 2IXNA 3JC6C 4WGZA 4N4WA 3EAMA 2NW8A 3VR8A 2VL8A 2WM9A 2W66A 2X0HA 1JMWA 2EIJC 3GEIA 2E8IA 2MBGA 2PNOA 3RW0A 2M6BA 1QZXA 3PUYF 3V5YA 1LI7A 2YINA 2EPLX 3I0OA 1YXRA 2LK4A 5KYXA 3VR9A 4DJ9A 4U2YA 5LXTE 1JOGA 4DXWA 2Y39A 2QLAA 4GKJT 1GQEA 2Y8DA 2W45A 3OYZA 3I9WA 4HWDA 5GONE 3PUVF 3JSZA 3BQIA 4XTKA 1L3PA 4EBBA 3HTKC 4HFKB 2WAUA 3JAEA 2IW5B 2R7TA 3KDSE 1BR0A 3RYIE 4CS9A 3AE7A 2PP4A 1Z3IX 4BJMA 1EQ1A 2WBLA 4YHHT 3NMIA 2LEHA 4G7ZF 4C3EA 1U5PA 3ZMTB 2TMVP 5B1AC 2AP3A 2ASRA 3UFEA 3V5ZA 2YVKA 4AQFC 3QB5A 2XQ8A 1HE9A 1LE2A 3SXMA 3U3IA 4NTBA 5JLIA 2A0UA 3SYNA 4H9PC 1MMAA 3C63A 3RI5A 1T6UA 2OEXA 4HEAA 3ZCIA 1EKYA 3ZMSB 4BJ5C 1WLXA 3HNIA 2WWUA 3AGTA 2YRFA 2UUHA 3ABVA 4W8KA 1J5ET 2WMOA 5DLJA 1CPRA 4LF9T 4E7SA 3NBXX 3AEAA 4I55E 1Y01A 4MVMA 2CHOA 1XDOA 2IDOB 1QPUA 1H9GA 5HXRA 2ODUA 5HXSA 256BA 3MZKB 4IL4A 1YA7O 1OXZA 1TWAA 5HEGA 3NYMA 4PW8A 3H65A 3RKOF 2NOXA 3AA1B 5CA0E 2R7VA 1X9BA 3JYHA 2G3VA 3C62A 3BQKA 3X1DA 3A5XA 2XLEA 4O2BE 3NDBB 4H63H 3W2VA 2BKNA 3PUWF 2XQ5A 3S84A 3ZN0B 4N6CA 1T6IA 3I4UA 1XNQT 3LK3B 4L0RA 2LLYA 1CGNA 2LSEA 3EZIA 4EBJA 2XASB 2A9UA 2N1GA 2CEAA 4H9NC 2XY8B 1N33T 4AX2A 3RGLA 3ZTMA 3EZHA 1BBHA 4AKLA 4AIUA 4K0KT 1FFTC 1ZOYA 4TX5A 1FTSA 3NMJA 5ABFA 4Q7CA 3R7CA 5AQOB 2L6FA 2IIUA 3CX8B 2IM8A 1AVOB 3CIRA 4CIPA 2PTFA 5BQGA 4CZZB 2CYDA 1JAFA 3AVSA 2BG9C 4DV6T 4QI0A 3UUXB 4ONSA 3B9QA 4DO0A 5F3JA 3FZFB 1HY5A 2Q9QA 1ZZPA 3N5LA 2Q9QB 3J9X1 3LK42 5ADXL 2R7XA 1VYIA 3O6XA 5TJ5E 2EHOB 2BBHA 2RSEB 1V74B 2X0YA 5JR9C 3EHNA 3Q5XA 2HFIA 5KYWB 4MFRA 3M3ZB 1ZV4X 2X9YA 1E85A 3JRMO 2UXXB 2V6YA 3HA4A 5HSWA 4KMCA 2L9QA 3IHUA 4LLCA 3HNJA 1T8BA 4IDZA 4E18A 2YU2A 4UVCB 1E83A 4MALA 5CA1E 2Q3TA 4N6HA 3KINB 1M57C 1ORJA 4EKWA 4UDVA 2LT3A 1HNZT 4LF4T 2OJQA 5KYYA 3DE8A 3P4QA 5A1LA 1Q0GA 1V55C 2J7PA 1VLTA 5E2QA 4JW1A 3SRZA 3RHWA 3C98B 5DQVA 2XQYA 3C64A 4X0RA 2J9BA 4PJJA 3HJCA 4COFA 3RQEA 2IBFA 4ZHQE 4YJ3E 5ABGA 2LHRA 4EOZB 1FMVA 4U5CE 5AQTB 3GWNA 2DGJA 1A0BA 1NG1A 2B76A 3RF1A 4OIOF 3NRYA 2NTYA 1VCTA 5DS5A 4WGYA 4ZEYA 1TWGA 2XM0A 3N9QA 2R25A 4DVZA 5BR8T 1G73A 2XTLA 2EPOA 4ULVA 4KP3C 4C7OB 3X1OA 3SFEA 2D5RB 3NKDA 3ZYKA 2J46A 1NU7D 3R2PA 3DP7A 3VYWA 4DR3T 1O87A 4CI1B 3W15B 3AG3C 3KV6A 2VKJA 3IBPA 5AQFB 1YZAA 5L0IA 3RKGA 2XQ3A 2AWYA 3VM6A 3LBXB 3NVOA 2OQMA 4XBFB 1VMAA 1JNZA 2ZXRA 4ISSA 3VRAA 4JRZA 2LSGA 3N24A 1OXBA 5FXZA 5COMA 5KX5E 4GYRA 4P9FA 2WZFA 1K04A 3HNLA 1V4AA 2D2SA 5IYZE 4DNDA 4LFBT 2VWAA 4D4NA 2Y3BA 2E9XB 3V5UA 1HF8A 4G78A 4ILBA 3LUTB 1QKRA 2ODVA 4MVQA 1SR2A 4L5GA 5L3DB 4CS7A 4JZAA 4U3CA 2BG9E 1FFHA 3DKAA 3CQCB 3NZQA 1WCRA 3N9LA 1D0YA 4MVZA 2ZXPA 4JV5T 4QH5A 1O3UA 1MIWA 3RIUA 4U33A 5E33A 3D0TA 1S05A 2IUBA 3WAKA 5JR9B 2VQFT 5KYNA 4MW3A 2D9DA 4DV7T 4V1Av 3JADA 4KHZF 3QVYA 1J8MF 5TAOA 4HKAA 1NAFA 3I1AA 2PF4E 2R02A 2XS1A 4MVUA 4G0HA 2J0WA 1B68A 5F5WA 5LYJE 3KBTA 5HCMA 3AE8A 4IAQA 5D91A 3W2WA 3ZG1A 4QXBB 3O1HA 3EG9A 3RLFF 4OD4A 2C04A 3TJ5A 4UXNB 3PHF2 3ZMUB 3ABLC 5T1DB 2AXDS 5LBMA 4O4JE 1TFOB 1E2XA 1HR0T 2CXLA 1U0BB 3N0TA 4G63A 4F8HA 2FJBA 3Q5WA 4HFIA 5DVWA 2QTVA 1YLMA 3LG7A 2WVNA 2D0UA 1J8YF 3U8VA 2CE7A 3O55A 1T7SA 2WDRA 3T6BA 5J2TE 2L6GA 2DNXA 1Z7Qc 4A56A 1IBKT 2J9WA 2LSYA 3T1HT 3UFGA 3K66A 1M2VA 3H2UA 4U31A 4U5HA 1D1AA 3IF8B 3EJNA 2IXPA 2Q00A 5LHHB 2L8KA 3RC3A 3TKLB 5AQJB 2MAWA 3RYHE 1NLXA 4O8SA 1WR0A 2YL3A 2FGYA 1HFAA 2C5KT 4DV1T 2SPCA 1KNYA 3ZMZB 4U2ZA 2KYHA 4DRJB 4PK6A 4DR1T 1WWPA 1D1BA 4JYAT 2IAKA 4NQFA 5JVEA 1GQAA 3U8PA 1EI7A 5L4EA 3SNHA 3UR3C 3L09A 4IHJE 3P7IA 5AQKB 5LJMA 2ETSA 2UXNB 4X1IE 5L0DA 2CRBA 2BS2A 1NENA 3VRBA 5LP6E 3H37A 3PMRA 2VKOA 5AQMB 4GK0E 2A0BA 2M64A 4XQ1A 3I5PA 3RQFA 4XLPF 1NFNA 4PNIA 4U7IA 4NTFA 1D0ZA 2OEVA 4Z91A 5L3GB 3M79A 1M7KA 5E0OA 3DAGA 1OW7A 2QY9A 2BBJA 2LSKA 2H88A 3E0ZA 1MMDA 3UGOA 3FDQA 3UUNA 4CJGA 3FXDB 2YWAA 3QZCA 1VLSA 2KINB 1Y4CA 2CWYA 2ZD9A 4JI5T 4ZOLE 4ASKA 2LKGA 1IW7F 3ZQYA 4J7YA 3K7DA 1OCOC 3OBVE 1XMQT 2D0TA 4OD5A 3KVAA 3DJNB 1UUSA 1XZYA 3NKZA 4CQIA 4YT0A 5KYUA 1I4YA 1SZIA 2KNHA 4MTGA 3PJAJ 2LHNA 4JI0T 2HMZA 3O10A 3PU3A 1QQ3A 2CDQA 2BG9A 2O9XA 4IE5A 5C8YE 4QI2A 2YLDA 3RC8A 3P4SA 4TWDA 1NFOA 1T01A 4J7TA 2J1DG 3SOLA 2KJGA 1RJ9B 3ZC4A 3RFYA 4C3BA 1PV3A 3FVYA 3ZSUA 4YN0B 2DWKA 1H7IA 5CFBA 4BEMJ 5L0GA 2WB5A 4DIDB 5LJNA 2XSEA 2L6HA 4ZXLA 2JD3A 2Q9BA 4ZI2D 3K8PC 2R7UA 4C91A 1Z8UA 2KNDA 2QRXA 2CM0A 3FAPB 4BAYB 1G8XA 1WRDA 4DR2T 4DV3T 2QA7A 3OA1A 3AEBA 5AC4A 3ZMVB 1C17M 1A7VA 1U6HA 4EZHA 4EEBA 1OCRC 3K3OA 5A6JA 5L3EB 2YOEA 5FYMA 4P0BA 4IB4A 2XXAA 2X67A 2DYRC 2UXDT 4OK0A 1M2OA 1N1CA 2ES0A 4HWHA 1A7DA 4AKRB 2ZXWC 3ZVRA 4CDAA 2CLYB 3QC9A 1TR2A 2NUTB 1IZMA 5HXCA 2XL4A 4K0DA 1LI5A 3K3NA 5IHYA 2VURA 3RIAA 5FMNA 2NG1A 3G50A 2QUPA 2BE5F 3MK7C 3QMKA 3LLKA 4MLKA 4O6YA 3AAIA 2WWVA 1R8IA 3FXEB 3SXKA 3MACA 1VYKA 1HX1B 1KK7A 1YKHB 4GEHA 3HKBE 2OKUA 4U5GA 5LNKA 5LOVE 4UF0A 4UIGA 2MYSA 1QVXA 4J2CA 3ZT6A 1DU2A 3JZ0A 5CJ5A 4HFEA 3K6BA 1YQ4A 4I0UA 2KT9A 2FAPB 2HJ3A 3ZPOA 1BZ4A 3K1HA 2CXFA 1YQ3A 2OJED 3HKCE 3T6GB 4ZLDA 1ZW3A 3HL6A 4KBMB 1KNPA 1E1HB 2EIMC 1FR0A 2XAJB 3L8JA 5JDQA 2W63A 5LGTB 4DRHB 3JT1A 1WATA 3B0UX 1VTMP 1ST6A 3JRTA 3QVZA 2H7BA 3R84B 5BMVE 2K9AA 4ZZBA 4IARA 2CCQA 1Y6DA 2XAQB 1G4WR 2H7OA 3AA6B 3EPVA 3ETUA 4IAOA 5HYAA 4LACB 4KUMB 1ZU4A 2YL1A 3QW1A 1FMWA 1WOLA 2J4GA 1MQVA 3Q7LA 5LMNT 1VK5A 4YTNA 4C90A 3PUQA 2A69F 2Q7RA 3PDYA 4CDVA 2PX0A 3RIUC 3TLVA 1YVIA 2XSAA 1H9TA 1W09A 2J47A 3QB5K 4KX6A 1Z63A 5DS4A 4ILCA 4GYTA 4XAXB 3ZLIA 2JQKA 3CQGB 3UU4A 3BEHA 4YK5A 5DABA 2HSBA 4NC3A 3LSVA 3MA9A 2YN6A 2K5BB 3NYLA 3ZC0A 5AQHB 1A7EA 5CB4E 1E86A 3RRCA 1CPQA 3TLSA 1W0AA 1RKCA 3LNMB 2LSIA 1NBBA 3SFDA 4B6IA 2XM2A 4Z90A 3FOPA 2VKDA 4B3ST 2BDEA 2F22A 5LGUB 4JURI 4PJLA 4MVSA 3EGDB 3OVUA 3T6JA 1OEDB 2QNLA 2X0CA 3W8IA 3VU7H 2OCCC 1M56C 2X51A 1FIOA 5AFUL 1EZ3A 2V7JA 3LESA 3C50A 4YSZA 1JRAA 2VVNA 1SHZC 3KFWX 4U74A 4X1KE 1MMNA 2YKZA 3GA8A 4X1YE 1OR3A 3K33A 4KI0F 2ZPAA 3WHNA 4IDQA 3AE1A 3K3QC 3P4PA 2XL8A 4QX8B 4U72A 2EILC 2JMHA 1V54C 2A3DA 4YL0A 3N2ZB 1H7CA 4A2NB 4MTFA 3PE0A 3PV0F 2L3LA 3SEOA 2LM9A 4YSYA 5CGMA 2HJMA 2IMLA 3ESLA 3F47A 3EHZA 4PJMA 4GIWA 1LRZA 2RA1A 3CX6B 1KFYA 1XNRT 1G5ZA 2XUEA 2E9XD 2JIWA 3PUZF 4PAGA 1NU9C 2B0HA 1SE7A 2H7VC 4ADZA 1OW8A 4U5BE 3E9VA 5B1BC 2Y6XA 5LBQB 4D4XA 2GWWA 4IREA 3GEHA 1XWJA 5EZYE 2IC9A 4CX9A 3NZPA 4IGGA 3F57A 3OEOA 4FX5A 4DR5T 3DWWA 3F46A 3JYYA 2ACXA 4J30B 4DMWA 5JP7A 2YDQA 2Q9CA 4JEBA 2AWCA 3S0XA 2XAGB 2YLIA 2KC3A 1UX5A 3U9JA 4UR9A 4IRUA 5KYXB 1Z0PA 2NUPB 3CAXA 4YLHA 4KI2A 5L0JA 4HWFA 2LKHA 1HMDA 3BRJA 2XXAB 4JEUB 3EGDA 3W4YA 4WJ0A 5T3TA 3WODF 3N9PA 4DBQA 3EH1A 3RVYA 3L34A 3U5SA 4I43B 5HV9A 4JEAA 2V8SV 3Q2MA 5J1GA 1Z23A 4GYSA 4HE8D 4CI3B 2BC5A 2V5DA 2WU5A 1HMOA 3POVA 3LJCA 3A8YC 1G4US 3S28A 2WU2A 4AKHA 3MBGA 3SZRA 4QH4A 2HHHT 3RYFE 1OW6A 1HCIA 4DV4T 4YWQA 4H9RC 1DOVA 1YARO 3NKEA 2XLHA 5KYYB 3S29A 3G06A 3TQOA 2HN1A 4OYKA 1UG7A 5JDGA 4CS8A 3HLZA 2CW0F 4X65T 2W61A 3MXZA 2BL2A 5JDNA 2R7QA 2XLWA 1ZP0A 2WB7A 3HR0A 2OLTA 1ZHXA 2V7MA 3GM3A 1XDPA 3A7MA 3KVBA 3ZCJA 2Y3DA 4NXNT 3ZC1A 2J9VA 4EIWA 4DOZA 2N2NA 2XQ6A 5AQNB 4YJWA 3ZKRA 2LQGA 2EHOC 2EINC 1YYJA 2AE9A 5LB7B 4LDQA 1KU2A 4NTAA 4MBQA 4A98A 2A68F 2KW3C 5A6AA 1ZKEA 4CIHA 1YZCA 1UGOA 2JQHA 3AEDA 2K3WA 3AE9A 5A6BD 4ILAA 3ZEFB 1XZPA 1HX8A 4NIQA 2HS5A 4K1OA 5FXVA 1VOMA 2I15A 5L2LA 1IAPA 1MNDA 4JI8T 4IDOA 2RPAA 5E3AA 2I59A 4AE4B 3ONLC 3EABA 1OQCA 3EGXA 4CBEA 2YLGA 5AQSB 3KBUA 2DL1A 2E87A 2P9BA 4WNKA 5L3BB 3UNGC 2CCYA 5JDMA 4N06A 2Y69C 3K1SA 3H2VA 4UF0B 3M4BA 2Q4FA 3HI2A 3TLWA 2BKOA 1PD0A 3I0QA 2GFHA 1IZNB 5AQQB 5KMGP 1XZQA 4CSAC 2GDCA 1HS7A 4LF6T 1HG5A 3LFMA 2MHRA 3QW0A 1ZHTA 5H6RB 2YK0A 3NYJA 4JJGA 3FHDA 3ZT7A 5L4HA 3I5QA 1QLEC 4IWBA 4YXDA 3AA0B 4HE8A 3P4WA 4F6RC 4NY3A 5EHHA 4MQ9F 2P0NA 4JE9A 3EFOA 4Q4ZF 2UUCT 5B3IA 4E7ZA 1Z6AA 5AQLB 2W4MA 1VB5A 3OKQA 3T1YT 3C7JA 5FVKA 5JSLA 3H3MA 4FI5A 1ZHYA 4TWHA 1OEDA 2PG8A 3FB2A 3F31A 2VKHA 3PUAA 2EPKX 3AE6A 3UU3A 3AXJA 5L3VA 3OYXA 4P9TA 1T9KA 1QSPA 2A6EF 3LJBA 3DM9B 3AE3A 4HWIB 1BR1A 4MTOA 4MNDA 1RJ9A 4LDKA 1XWMA 2XQ4A 4I50E 3ITFA 4B6XA 4YJ2E 4H9OC 2K48A 3FHNA 4L9IA 5HEOA 3C4XA 4O6NA 1IJ5A 2NPUA 2JQQA 2V7KA 4IE7A 4QHOA 5ETWA 3O4XE 3C8GA 4QH1A 3FBLA 3PU8A 5FY1A 3O39A 3DM5A 3AE5A 4Q25A 2X9XA 2CMRA 4EYUA 3U2LA 5E3CA 2PX3A 4O2AE 3AB3B 3ECSA 4OINF 5C2TA 4J32B 2E5VA 5BUOA 4U5FE 3SP1A 4JIOA 4C3DA 4KNVA 2GK9A 5EK3A 5JRAA 3P4RA 2BZBA 2XZEA 2DYSC 5ABEA 3MJXA 4HGAA 3L8RA 4HFVA 1WYCA 4JUYA 2I8BA 3LAYA 2IXMA 3AG2C 2VASA 3M1CB 5COGA 2DCFA 2MWQA 1N34T 4BG0A 2G62A 1I5NA 4EZ4A 5ABFB 2KSFA 2YQYA 3NG1A 2WQYA 5HXHA 2NR4A 2QYWA 2P7VA 1YD8G 3EHMA 3I9YA 4AKIA 1LKXA 2CNWD 5EK2A 1MIYA 1AUEA 2JPUA 3JTLO 2Y3HA 1KNRA 2YZSA 2N9DA 3B57A 1CGME 4N78D 1YYXA 3N2KE 4O4LE 3EDVA 3US6A 4U5EE 4GKKT 2KQ9A 5LCYA 4EB6E 4EV6A 4NUUA 1Q0KA 4KBLA 1NWMX 2IYLD 4LLEA 5FP3A 3RYCE 3EUHA 3P8CD 4PFOA 4RDAA 2XQAA 3G4ZA 1W0BA 4JJFA 2OV9A 3AEEA 3ZSTA 5FY0A 1T6QA 4Z9HA 4WABA 4PFPA 4PK4A 1Q0MA 3KV9A 3ABMC 2C0SA 4C7OA 5LA6E 2IOQA 5DQZA 3K1IA 3OJAA 1T5OA 4YY3T 3U3BA 4YT8A 3AAEB 3VHLA 2I6HA 1C03A 3M15A 2RP4A 4XEKA 1XMOT 4L6RA 3JSEO 2KGOA 4RBNA 3T4RA 3TD7A 4HWCA 3ZJ1A 2FJAA 3CPZA 1S94A 4DV0T 3S27A 4HFHA 1LS4A 2HPJA 4YT2A 4I4TE 3IHRA 2R7SA 3PUGA 4IE6A 3RF3A 5F5HA 4I1MA 2QVAA 2B1EA 1RKEA 4EYYR 2PFDA 4UV8B 3AEFA 1TWHA 1TFKB 2V1DB 4JLEA 1LM3B 5IUXA 5CI8A 3DJUB 5JS5A 1O3XA 3FBZA 2XQ7A 3PURA 3IEEA 3GANA 2WL8A 2XS8A 5FXWA 2A2FX 3AAAB 4CI2B 4P09A 2XAFB 5JH7E 4UVAB 5EGYA 1NSGB 2JX0A 3U3FA 1T98A 5LMUT 3UMHA 4EGWA 5LHIB 3VKGA 1L0VA 2IXOA 3LS0A 4CS8C 4NPPA 4UVBB 4X62T 3FAJA 2E2AA 1SYQA 2H8AA 2NUPA 4XPYA 2AU5A 4HTEA 3FOOA 3BK9A 1TKNA 2OU6A 3CQZA 1WGWA 4JI6T 2EHOA 2KLQA 4JTDB 4X20E 1O5HA 3IQ5A 4BJ1A 2V7LA 4QXHB 1SUMB 5FXXA 2WMNA 2CBJA 4PR9A 3KH2A 2CPTA 1YA9A 4Z8XA 3FZHB 4OHFA 4A97A 4H9SE 3PTRB 3UULA 2VH3A 2HKVA 3EI0A 4EWCA 2FFHA 5L3CB 1WASA 4X5TA 2FBWA 3DE9A 4BJTA 2PJQA 1JPNA 3B0PA 2E9XA 3CKDA 4WZXA 2VCAA 2KK1A 2NW9A 3NRXA 2GAQA 2CNWA 2KWHA 1SF8A 4Z9JA 3Q6MA 4DV5T 4ZS3A 2LCHA 3PJAA 1N32T 4O6MA 3RVZA 3ATPA 4XLNF 2XAHB 2UXBT 4BA9A 4EHPA 3B5MA 5T3WA 5FNVE 2KSRA 4CN1A 1OKKD 2R05A 3IQTA 3RKOA 2XHEB 3QNUA 3UGPA 4O4HE 4WW0A 4CXXA 3TLUA 4QKNA 5CIVA 5HWXA 3AOUA 4O7GA 3FMSA 2WDVA 4CSAA 3DXJF 1MMGA 1ORSC 1M2VB 3UUMA 4ISTA 5JDLA 2NSFA 1RXQA 3EVYA 3T9OA 3CX7B 4BJ6A 3L3PA 4LFAT 4KHPT 1T72A 2LFFA 5AGFA 3AECA 5DJQC 2Q9QD 2G3KA 1W9RA 3MLGA 3RQWA 4X66T 4IIJE 2ZM2A 4RD9A 3TOMA 3C18A 4TNWA 1APCA 2XSBA 1RKEB 4K7BA 4ZI3D 2XL6A 2ZXOA 1YJGA 5D92A 4LF7T 2PFVA 2W2UA 1OCZC 2XM1A 3CMLA 1I6ZA 2EPMX 2DB4A 3CSKA 1UURA 4M1PA 3B71A 5ABHA 3ZQVA 1OEDC 3DAFA 2J7PD 5FVLA 2JMKA 4AL0A 3IPMO 4IDPA 5LG4A 3KPHA 3GWLA 5FZTA 5DS6A 2YDSA 2H3RA 2VVSA 3QK6A 2CGEA 1E84A 2CA5A 3QOFA 3AE2A 1YAUO 4ERRA 5CI9A 3L39A 4HFBA 4OIPF 4PACA 1SA0E 3VF0A 2W4BA 1RMVA 2BS4A 4M63A 2X68A 1VRBA 2AVKA 3V5SA 4ZI2C 3EH2A 3CVRA 3UQ7A 4FAPB 3SXZA 5GPGB 1BDJB 2NSGA 2LM2A 2YU1A 3RPUA 4GOUA 2V6YB 4EAHA 4U9DA 4XWJA 2L81A 1LS1A 3LEOA 5JT4A 3C8ZA 5L0CA 2LD6A 4AK9A 2QE9A 4BJNA 4FWVA 3N9OA 4CS9C 5AQIB 2CHNA 5L3FB 4I1OB 2DHRA 1OKKA 5JVDE 4Z9IA 3ZWIA 2C03A 2X0LB 5JRCB 1L7CA 5LHGB 4NCQA 1HW1A 4AQFA 3DMDA 3AG1C 1C02A 1YDIA 3G4XA 1WTYA 4LDRA 2DI4A 4DR7T 1DOWA 3DZAA 2UUAT 1UCUA 2Q9AA 1IBLT 2YEVA 2LRLA 3ZIBA 2VC9A 5BQIA 4JI1T 3R6NA 1IJ6A 2C5IT 4R32A 4BJ5A 3F2EA 2NP9A 5DQTA 2PBIA 1K40A 3UU6A 2HSQA 4H54A 3GORA 5L3QA 5JDFA 4YTPA 5JREA 3NMKA 5EK0A 4EBKA 1OCCC 2OG2A 2JRKA 5L47A 1HTJF 2HZ8A 5JRCA 4LMLA 1J1JA 2EHOD 4JEHB 2R7RA 2W62A 2LFDA 1MIVA 1S7ZA 1GM5A 1HE1A 2QGSA 2UXCT 3TULA 2HMQA 3KYJA 4O4IE 1GGQA 1R5ID 4DBRA 2KZ7B 2M6IA 3WAQA 4HFCA 2Z15A 5L0FA 1U4QA 3GN5B 4JTCB 3Q6NA 5J2UE 2IC6A 4LFCT 3C8GD 2LIGA 5AC5A 5K0IA 1KF6A 4ANJA 3O1IA 4B3MT 2VK9A 3E70C 2W4XA 1UX4A 1ZEEA 2HN2A 3N2OA 2R6GF 2LE8A 1W2WA 3LLIA 1Y64B 2YL0A 4DR6T 3OWTA 3J06A 2NWBA 1IBMT 3LBXA 3C8GB 3ABKC 2ZM6T 1ZU5A 3AA7B 4U9EA 3MYFA 4HN9A 3ASNC 1N36T 2VCBA 3CQXC 4AQGA 1NZEA 3UU5A 4EEDA 3K1IC 1CHUA 3Q9DA 2HV6A 2WS3A 3GMIA 3AQBA 2BVLA 2M67A 2L9JA 3W8HA 3AGUA 4DUZT 1F1MA 5H6QB 3TOLA 5B3SC 2UUIA 3AXJB 3ETVA 2YL7A 4EXTA 5COFA 2VL0A 2WDQA 2WZHA 4UV9B 2D4UA 3L1MA 4FJOA 1HNWT 2J9UA 4EIYA 1SMYF 4OIRF 2FUPA 3ZYLA 2Q9QC 4AXPA 4DVYP 3JCFA 1HW2A 3N2GE 2LJLA 4NUVA 3ZYMA 5AQVB 4A5XA 1VCSA 4DMVA 3DD7A 4I3MA 2DI3A 4E0HA 3U0CA 1CUNA 1JPJA 3ZT5A 2LOSA 3UUBA 4IT4A 1WR6A 3PDMP 3UT5E 4PJNA 5AQUB 3KV5A 3KMIA 1NEKA 2OA5A 2OOCA 5AQGB 4B3RT 3S9OA 4ZI7E 2E5LT 2ZMAA 1JR8A 4MVRA 4IE0A 4K0UA 4IJJA 3KL4A 4IL9A 2W67A 4CDYA 5L0HA 2HV7A 4YHJA 2MOZA 2VB6A 1LIHA 2ZM0A 2NUTA 5IWAT 4XPXA 1WYBA 1KTMA 4DR4T 3PUXF 2R7OA 3X2QC 5HEHA 2XQ9A 4B3TT 4F4BA 2HH7A 3OPCA 5HWYA 3EGXB 3L0IA 1H6GA 3LEVA 1US7B 5F8PA 4XEFA 3TK0A 4JTAB 3MKDA 2ICWG 3AQCA 2UUBT 2KWIB 2WSSV 4JI4T 2J45A 4JCHA 2X9WA 3A9CA 2XLDA 4QXCB 3B0VC 2X66A 2FJDA 3Q5DA 3PCVA 3NRHA 3AEGA 4CN6A 4TV9E 2V6XA 4YL3A 1BR2A 3UMKA 2DWGA 1Q0DA 1LE4A 4JVSA 3GWHA 1E7PA 1S35A 3UU8A 1QSDA 5A6BA 5EK4A 4X64T 2ZLYA 2V3CC 1AEPA 1LPEA 2V5CA 1AJ3A 2CBIA 4LF8T 3VRCA 3WI3A 3CZ6A 2L7AA 2YDRA 2XLMA 4JCZA 4E17A 3RX6A 1OEDE 3AVRA 4MS2A 4BEJA 2KMFA 3VKHA 2P1AA 2NW7A 3UTKA 3IA3A 2MTQA 4W8PA 3FXHA 2Z6EA 3TJ6A 4Q5SF 3RQUA 3C51A 1V9DA 3GM2A 4HFFB 4BJ6C 4YT4A 1QUUA 3V5XA 3GN5A 3AE4A 1E2AA 3CEXA 3C4ZA 5HEJA 2WCAA 4G7OF 3LK2B 2NTXA 2VCCA 4MHCA 2XLVA 1WFDA 2WVOA 5BQHA 2JQ9A 2BS3A 3O1JA 1ZW2A 3U78A 3RIPA 3LS1A 4KNWA 3LNRA 2M4EA 2BG9B 4TN7B 1ZHCA 3N9NA 1EA8A 1JNRA 3ONJA 5FY7A 3B29A 3ANWB 3ZTZA 1UFBA 1D0XA 4XZCA 2BVMA 3DTOA 4CXYA 4UELA 2F4VT 3GODA 3SXYA 4AE4A 2WP9A 2KXPB 2ZM8A 4CN4A 4DV2T 2EIKC 2XPKA 5KYWA 4H9QC 1TWCA 4YT5A 3FZMB 3T8OA 2V26A 4XPWA 3GM1A 4OYJA 4IGUA 4H4KC 4JI3T 4ZI3C 3QTHA 1GS9A 5HEUA 2WY2A 4GK5E 5JQGE
chains in the Genus database with same CATH topology
4ZHQE 4G7HF 1M56C 4YJ3E 2X51A 1FIOA 3ANWA 1EZ3A 2V7JA 3HKEE 5AFUL 3C50A 2NUPA 3LESA 3HKDE 4HTEA 1SHZC 3KFWX 4U74A 2JJ9A 3BK9A 2LHRA 4TUYE 1FMVA 4EOZB 1TKNA 5HAXA 3CQZA 4QDLA 4U5CE 1WGWA 2DGJA 3CWZB 4X1KE 2EHOA 1MMNA 2KLQA 1NG1A 3GA8A 4X20E 1O5HA 4BJ1A 4X1YE 2V7LA 4QXHB 3NRYA 4OIOF 4ZS2A 2NTYA 3UMIA 3K33A 2ZPAA 3EQLF 5FXXA 2WMNA 3RYLA 5DS5A 3K3QC 1TWGA 4H63V 4QX8B 4U72A 5LGNB 3N9QA 3KH2A 2EILC 1X79A 1HG2A 4Z8XA 2JMHA 4DVZA 3H3AA 1B7TA 5HXEA 2A3DA 2LOPA 1G73A 2XTLA 4H9SE 3PTRB 4KP3C 4OHFA 3RRWA 3UULA 2VH3A 3N2ZB 1H7CA 3X1OA 4A2NB 4EWCA 2FFHA 5L3CB 2YEVC 2G0UA 3ZJ2A 3PE0A 2D5RB 3NKDA 3E22E 3ZYKA 3B13A 2L3LA 2J46A 3JC6D 1NU7D 3DP7A 3SEOA 3VYWA 1OWAA 2LM9A 1O87A 4CI1B 4BJTA 2PJQA 3W15B 3AG3C 4TZ4C 1JPNA 4C3BA 3KV6A 3B0PA 3ESLA 2VKJA 2E9XA 3IBPA 3F47A 4PJMA 3CKDA 4GIWA 2NW9A 1LRZA 2RA1A 3CX6B 3NRXA 4QX7B 2CNWA 2KWHA 1SF8A 3Q6MA 3RH3A 2CWOA 3LBXB 4ZS3A 4O6MA 2XUEA 2E9XD 3C4WA 4XBFB 1VMAA 4XLNF 2XAHB 4PAGA 1NU9C 3V7OA 2HPLA 4BA9A 2ZXRA 2H7VC 5T3WA 4ISSA 5FNVE 4ADZA 1OKKD 3E9VA 4U5BE 5B1BC 3RKOA 2LSGA 2XHEB 2Y6XA 5LBQB 3O9XA 3N24A 2R7WA 3UGPA 4O4HE 4WW0A 4CXXA 3EFOB 5FXZA 3EG9B 5KX5E 4GYRA 4QKNA 2WZGA 2WZFA 3KV4A 3EDUA 5HWXA 4O7GA 2D2SA 5IYZE 4DNDA 2VWAA 5EZYE 3SWHA 2B0JA 2IC9A 2Y3BA 4CSAA 3NZPA 3DXJF 4ZLCA 2E9XB 3V5UA 3F57A 3OEOA 4OIQF 1HF8A 1ZHWA 4QWNB 1MMGA 4TV8E 3PUSA 4FX5A 1M2VB 2ODVA 3UUMA 4ISTA 2ACXA 5JDLA 3F46A 4J30B 4L5GA 3EVYA 5L3DB 4CS7A 4DMWA 3CX7B 4JZAA 2Q9CA 4BJ6A 3S0XA 3L3PA 2XAGB 1FFHA 3CQCB 5DJQC 2G3KA 1UX5A 2Q9QD 3KKBA 1ZHZA 3MLGA 4IRUA 1Z0PA 3NZQA 3N9LA 1D1CA 3MX3A 5KYXB 1D0YA 2NUPB 4IIJE 2ZM2A 4AI6A 2ZXPA 3ONXA 4RD9A 5FCLA 4YLHA 1MIWA 4KI2A 4ILUA 5E33A 3D0TA 4HEAJ 3WAKA 5JR9B 4K7BA 5KYNA 4ZI3D 5JR9A 2W9YA 2ZXOA 5D92A 4V1Av 2PFVA 1OCZC 2XXAB 2A72A 4JEUB 3CMLA 1J8MF 5TAOA 4HKAA 4PK5A 3CSKA 1NAFA 3I1AA 4YFSA 3EGDA 4M1PA 4WJ0A 5T3TA 3WODF 3N9PA 4DBQA 2PF4E 3EH1A 4LERA 3DAFA 4G0HA 2J0WA 2J7PD 4I43B 4G2AA 3L34A 2JMKA 3Q2MA 5J1GA 5LYJE 1Z23A 3KBTA 4GYSA 4HE8D 4BJ5A 5LG4A 3SS1A 4CI3B 4FESA 5D91A 3ASOC 3W2WA 3POVA 3ZG1A 3LJCA 3Q7GA 5DS6A 3S28A 2H3RA 4QXBB 2CLYC 3QK6A 4AKHA 2CGEA 3SZRA 3DJBA 2CA5A 5CI9A 4ERRA 3O1HA 3RYFE 3EG9A 5F5FA 4P6IC 4OD4A 1HCIA 2C04A 4UXNB 3PHF2 4OD5A 3ZMUB 3ABLC 4H9RC 5T1DB 4YWQA 4OIPF 1SA0E 5LBMA 4O4JE 4ULWA 3NKEA 2W4BA 4WBOA 3S29A 2K24A 4M63A 5KYYB 2CXLA 2X68A 1VRBA 3N0TA 3V5SA 4G63A 4UEMA 4ZI2C 3EH2A 5KYUB 3CVRA 2Y48B 2JPFA 4OYKA 3QUJA 4CXWA 3Q5WA 5JDGA 5DVWA 2A6HF 2YU1A 3RPUA 4GOUA 2WVQA 4EAHA 2QTVA 1KNZA 2CW0F 3HLZA 2W61A 3MXZA 1ZYRF 3LG7A 5JDNA 2D0UA 2L81A 1LS1A 2R7QA 4DVDA 2WVNA 1J8YF 2WB7A 2CE7A 3HR0A 1YW0A 4AK9A 1ZHXA 2V7MA 4BJNA 3KVBA 2Y3DA 1FEWA 3ZCJA 3N9OA 4FWVA 2J9VA 3ZC1A 3T6BA 5L3FB 1Z5ZA 4EIWA 5J2TE 4CS9C 4DOZA 4XWJA 4I1OB 2DHRA 2N2NA 3BQLA 5JVDE 2DNXA 1OKKA 4I44A 4G7ZF 4YJWA 2W00A 5KDMC 2X9HA 2EHOC 4A56A 2C03A 2EINC 3ZN1B 3E08A 4C7OB 1KU2A 2J9WA 2X0LB 2LSYA 4MBQA 5JRCB 5LHGB 3S4UA 2A68F 2D5UA 2KW3C 4AQFA 3K66A 1M2VA 1ZKEA 4CIHA 4U5HA 2A1DD 1D1AA 3IF8B 4IE4A 5M4YA 2YHSA 2IXPA 3DMDA 1PCXA 2L8KA 3RC3A 5LHHB 3AG1C 3TKLB 3ZEFB 2DI4A 1HX8A 3VAYA 3RYHE 3DZAA 1UCUA 2Q9AA 4O79A 4O8SA 2YEVA 2CXDA 3ZIBA 2FGYA 5FXVA 3R6NA 1IJ6A 1VOMA 1HFAA 2C5KT 2C5IT 2NP9A 3F2EA 2SPCA 5L2LA 1IAPA 1MNDA 2PBIA 3AG4C 5IY5C 3ZMZB 3JCUQ 5L3QA 5JDFA 5E3AA 2I59A 4PK6A 5JREA 4AE4B 2E9XC 3M65A 3EGXA 1OCCC 4CBEA 2OG2A 2JRKA 1D1BA 1HTJF 3J7Yq 2IAKA 5JRCA 2EHOD 1YKEB 4JEHB 2R7RA 2W62A 3SNHA 3UR3C 3L09A 1BR4A 4OFZA 1MIVA 4IHJE 1S7ZA 3KBUA 3P7IA 2QGSA 5LJMA 3N9MA 2E87A 3UNGC 2P9BA 4WNKA 5L3BB 4AKGA 2UXNB 4X1IE 2W0GA 1LVFA 4O4IE 2V7IA 3WG7C 4DBRA 2KZ7B 5JDMA 5LP6E 3H37A 2Z15A 4N06A 3GN5B 1U4QA 1LVKA 4WBNE 3WAJA 2Y69C 2VKOA 2IC6A 4GK0E 5J2UE 3PMRA 4UF0B 3Q6NA 3I5PA 3HI2A 4ANJA 3O1IA 4XLPF 5JDHA 1PD0A 3I0QA 2VK9A 4PNIA 2GFHA 3E70C 1IZNB 1UX4A 1ZEEA 2DLRA 1D0ZA 1MNEA 5KMGP 3N2OA 5L3GB 2XRHA 4U5DE 2LE8A 4CSAC 1W2WA 5E0OA 4P0AA 3DAGA 2QY9A 1HS7A 3LLIA 2C5JA 1HG5A 2LSKA 3LFMA 1Y64B 1ZHTA 3OWTA 3E0ZA 2NWBA 1MMDA 2LSJA 5H6RB 2WZLA 2YK0A 3UUNA 3FDQA 3UGOA 5DQWA 3FXDB 3LBXA 3QZCA 4KC9A 2KINB 3NYJA 4JJGA 3FHDA 3ABKC 1ZU5A 1PD1A 2CWYA 3AA7B 2P6VA 2Y3GA 3I5QA 1QLEC 4IWBA 4ZOLE 3AA0B 4HN9A 4ASKA 2J0XA 3ASNC 1IW7F 4HE8A 4NY3A 4F6RC 5EHHA 3QMKA 5DQTA 4MQ9F 3CQXC 4AQGA 1NZEA 2IXNA 3K1IC 3EFOA 3JC6C 4Q4ZF 3Q9DA 3K7DA 1OCOC 3OBVE 4E7ZA 2NW8A 1Z6AA 2VL8A 2HV6A 2D0TA 2WM9A 3KVAA 3GMIA 2EIJC 2W4MA 3AQBA 3DJNB 2BVLA 2E8IA 3OKQA 2MBGA 2M67A 4CQIA 2L9JA 3W8HA 5KYUA 4FI5A 1ZHYA 2PG8A 3FB2A 3F31A 2VKHA 3PUAA 5H6QB 1QZXA 1SZIA 2KNHA 2LHNA 3ETVA 5L3VA 2YINA 3OYXA 3PU3A 4EXTA 2CDQA 2O9XA 3I0OA 2A6EF 3LJBA 4IE5A 4UV9B 5C8YE 3DM9B 5KYXA 4QI2A 4FJOA 3RC8A 2J9UA 1BR1A 1SMYF 4OIRF 5LXTE 4MNDA 1RJ9A 3ZYLA 2J1DG 3SOLA 2KJGA 1RJ9B 2Q9QC 4AXPA 2Y39A 4DVYP 2W45A 2Y8DA 3ZC4A 3RFYA 3OYZA 3N2GE 2LJLA 4I50E 4NUVA 3ZYMA 4B6XA 4YJ2E 4H9OC 3FVYA 3ITFA 3ZSUA 2K48A 3FHNA 3I9WA 4L9IA 4YN0B 2DWKA 3C4XA 5GONE 4O6NA 1IJ5A 1V54C 2JQQA 2V7KA 4IE7A 4QHOA 3BQIA 4DMVA 5LJNA 3DD7A 3JSZA 5ETWA 4I3MA 3O4XE 4XTKA 2XSEA 1CUNA 1JPJA 4EBBA 2JD3A 3HTKC 4HFKB 2WAUA 3FBLA 2IW5B 2LOSA 3PU8A 2Q9BA 4ZI2D 2R7TA 3K8PC 1WR6A 5FY1A 4C91A 2R7UA 3KDSE 2KNDA 1BR0A 3UT5E 3DM5A 3O39A 2CM0A 3RYIE 4PJNA 4CS9A 3KV5A 4BAYB 2PP4A 1G8XA 3KMIA 1WRDA 3OA1A 2QA7A 2X9XA 1Z3IX 4BJMA 2CMRA 2WBLA 4EYUA 3ZMVB 2OA5A 2LEHA 2PX3A 4EZHA 5E3CA 4O2AE 3AB3B 4C3EA 1U5PA 3ZMTB 3ECSA 4OINF 1OCRC 5B1AC 3K3OA 5L3EB 4J32B 5BUOA 3UFEA 4U5FE 5FYMA 3SP1A 4ZI7E 4AQFC 4C3DA 4P0BA 4KNVA 2ZMAA 2XXAA 2GK9A 2X67A 5EK3A 2DYRC 4IE0A 4K0UA 4IJJA 3U3IA 3KL4A 4OK0A 2BZBA 1M2OA 3SYNA 4H9PC 1MMAA 2DYSC 1N1CA 2ES0A 3MJXA 2HV7A 4HGAA 4JUYA 4HFVA 1WYCA 4YHJA 2MOZA 4AKRB 2VB6A 2CLYB 2ZXWC 4HEAA 3QC9A 3ZCIA 3ZVRA 2ZM0A 1TR2A 3ZMSB 2I8BA 3LAYA 2IXMA 2NUTA 1WLXA 2NUTB 3AG2C 4BJ5C 2VASA 1IZMA 3M1CB 5HXCA 2DCFA 2XL4A 4K0DA 2WWUA 1WYBA 2MWQA 4BG0A 2G62A 3K3NA 4EZ4A 5IHYA 2R7OA 4W8KA 3X2QC 4F4BA 5FMNA 2NG1A 2HH7A 3EGXB 2WMOA 5HWYA 5DLJA 3NG1A 4E7SA 3NBXX 5HXHA 3L0IA 4I55E 2BE5F 2P7VA 3LEVA 1YD8G 3MK7C 1US7B 3I9YA 4AKIA 1LKXA 2CNWD 3EHMA 4MLKA 5F8PA 5EK2A 1MIYA 5HXRA 3LLKA 2ODUA 4O6YA 5HXSA 3AAIA 3MKDA 3AQCA 2Y3HA 2YZSA 3MZKB 2KWIB 3FXEB 2WSSV 3MACA 2N9DA 1OXZA 3B57A 1VYKA 2J45A 1KK7A 1TWAA 4JCHA 1YKHB 2X9WA 4QXCB 3NYMA 4GEHA 3HKBE 4N78D 3N2KE 3B0VC 4O4LE 3EDVA 4PW8A 4U5GA 5LNKA 3H65A 4U5EE 2NOXA 5LOVE 4UF0A 4UIGA 2X66A 3AA1B 2KQ9A 2MYSA 3RKOF 3NRHA 5LCYA 4EB6E 4TV9E 5CA0E 4J2CA 2R7VA 3JYHA 2G3VA 4NUUA 4KBLA 3BQKA 1BR2A 1NWMX 3K6BA 2IYLD 3UMKA 3A5XA 2KT9A 4LLEA 5FP3A 3RYCE 2DWGA 3EUHA 3P8CD 4O2BE 4PFOA 4RDAA 4H63H 3ZPOA 4JVSA 3W2VA 3NDBB 3GWHA 1S35A 3K1HA 3ZN0B 1QSDA 2CXFA 5EK4A 4JJFA 3I4UA 5FY0A 3HKCE 2ZLYA 2V3CC 3LK3B 4L0RA 4ZLDA 1AJ3A 4PFPA 3HL6A 4PK4A 3WI3A 2LSEA 3KV9A 3EZIA 3CZ6A 3ABMC 2C0SA 4KBMB 2XASB 4C7OA 2N1GA 2CEAA 1E1HB 4H9NC 5LA6E 2EIMC 2XAJB 3RX6A 2IOQA 3OJAA 4AX2A 3AVRA 5JDQA 3EJNA 5DQZA 4BEJA 2W63A 5LGTB 3EZHA 3JT1A 4AKLA 2KMFA 3VKHA 1FFTC 4YT8A 3AAEB 4TX5A 3VHLA 1ST6A 3JRTA 1FTSA 2H7BA 3B0UX 2NW7A 3UTKA 4Q7CA 2RP4A 3R84B 3CX8B 5BMVE 2K9AA 2MTQA 2CCQA 2Z6EA 4CZZB 2KGOA 4RBNA 3T4RA 3TD7A 2XAQB 3AVSA 3ZJ1A 2H7OA 3AA6B 3EPVA 4Q5SF 3CPZA 1S94A 3ETUA 3S27A 4IAOA 5HYAA 3C51A 4LACB 1V9DA 4KUMB 1ZU4A 4QI0A 4HFFB 1FMWA 3UUXB 4BJ6C 4YT4A 1QUUA 2HPJA 3B9QA 4DO0A 5F3JA 3GN5A 3Q7LA 3C4ZA 1VK5A 4YT2A 2Q9QA 4I4TE 3IHRA 4C90A 3N5LA 2R7SA 2Q9QB 3PUQA 2A69F 3J9X1 4G7OF 3LK2B 2NTXA 3PDYA 3PUGA 4IE6A 4MHCA 5F5HA 2PX0A 4I1MA 2B1EA 3LK42 5ADXL 4EYYR 1VYIA 2PFDA 3O6XA 2R7XA 2WVOA 2EHOB 4UV8B 5JR9C 1Z63A 5DS4A 3EHNA 3O1JA 3Q5XA 5KYWB 3U78A 4MFRA 4CS8A 4GYTA 1TWHA 4XAXB 3LS1A 3RIPA 1ZV4X 3ZLIA 2X9YA 3CQGB 4KNWA 5B3SC 2V1DB 4JLEA 3LNRA 2M4EA 5DABA 2UXXB 3HA4A 4TN7B 3DJUB 5CI8A 5HSWA 1ZHCA 3N9NA 3MA9A 4KMCA 2L9QA 4LLCA 2K5BB 4IDZA 5FY7A 3ZC0A 3NYLA 2YU2A 1O3XA 5CB4E 3FBZA 4UVCB 3ANWB 4MALA 3PURA 3RRCA 1D0XA 3IEEA 5CA1E 2Q3TA 2WL8A 4XZCA 5FXWA 2A2FX 3GANA 2BVMA 3DTOA 2LSIA 4UELA 4CXYA 4B6IA 3AAAB 3KINB 3GODA 1M57C 2VKDA 4CI2B 4P09A 4AE4A 2XAFB 2BDEA 2LT3A 5JH7E 5LGUB 2KXPB 4UVAB 4JURI 5KYYA 2ZM8A 5EGYA 2EIKC 4PJLA 3EGDB 1T98A 5KYWA 5A1LA 4H9QC 1V55C 1TWCA 2J7PA 4YT5A 3T6JA 3T8OA 2V26A 3UMHA 5LHIB 3VKGA 2IXOA 3LS0A 4OYJA 4IGUA 5E2QA 4H4KC 4CS8C 4JW1A 4UVBB 3SRZA 3C98B 5DQVA 2XQYA 3C64A 3FAJA 4ZI3C 4X0RA 3W8IA 4PJJA 3VU7H 2OCCC 3HJCA 4GK5E 5JQGE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RH3 A;  4YJW A;  3IEE A; 
#chains in the Genus database with same CATH topology
 4G7H F;  3GEE A;  3ANW A;  3HKE E;  5A69 A;  3HKD E;  2JJ9 A;  4TUY E;  1ORY A;  5HAX A;  4QDL A;  3CWZ B;  2R03 A;  4JC7 A;  4ZS2 A;  3U2M A;  3MFN A;  4P1N A;  3EQL F;  3RYL A;  3FZK B;  4DRI B;  3FZL B;  4H63 V;  3L8I A;  4MVO A;  5LGN B;  1A41 A;  2EPN A;  1X79 A;  1FNT c;  1HG2 A;  4CJO A;  3M4C A;  3KYI A;  3H3A A;  2RD9 A;  1B7T A;  5HXE A;  3RRW A;  2LOP A;  2J62 A;  2UU9 T;  2YEV C;  2G0U A;  3ZJ2 A;  3E22 E;  3B13 A;  3JC6 D;  1CGO A;  4TNV A;  2HUJ A;  1OWA A;  3IQ6 A;  4TZ4 C;  2BKP A;  3HNK A;  1FJG T;  1R4T A;  4QX7 B;  2IHR 1;  3RH3 A;  4ZZC A;  1FAP B;  2CWO A;  1UK5 A;  3C4W A;  4EUK B;  3V7O A;  2HPL A;  4LF5 T;  3O9X A;  2R7W A;  3EFO B;  3EG9 B;  2WZG A;  3KV4 A;  3EDU A;  2B0J A;  3SWH A;  4ZLC A;  4OIQ F;  1OR2 A;  4QWN B;  4TV8 E;  1ZHW A;  3PUS A;  3HKK A;  2WZI A;  2XM4 A;  3U9M A;  1I4Z A;  2XLO A;  2J8W A;  5JTG A;  1M62 A;  2LRK A;  3KKB A;  1ZHZ A;  3MX3 A;  1D1C A;  5FCL A;  4AIS A;  4AI6 A;  3ONX A;  3A11 A;  1M6T A;  4ILU A;  5AQP B;  4HEA J;  5JR9 A;  2W9Y A;  1TQG A;  1RCP A;  4ER9 A;  2A72 A;  4PK5 A;  4AL1 A;  4YFS A;  5FL0 A;  4LER A;  3CK6 A;  3RQG A;  4G2A A;  2P61 A;  4AQY T;  3SS1 A;  4FES A;  4NXM T;  4JI2 T;  3ASO C;  3Q7G A;  2CLY C;  3NWI A;  3DJB A;  4HFD A;  1HNX T;  5F5F A;  4P6I C;  3LDQ B;  3OTO T;  4ULW A;  4WBO A;  2K24 A;  5KYU B;  4JKV A;  4UEM A;  2Y48 B;  2JPF A;  2VQE T;  3QUJ A;  4CXW A;  4LMJ A;  5J0Z A;  2A6H F;  2WVQ A;  1WN0 A;  1KNZ A;  1ZYR F;  4DVD A;  1YW0 A;  1FEW A;  4BPM A;  1Z5Z A;  3BQL A;  4I44 A;  4YTM A;  1QLB A;  4GQH A;  2W00 A;  5KDM C;  4OX9 T;  2X9H A;  5A6K A;  2H89 A;  3ZN1 B;  3E08 A;  4YSX A;  3S4U A;  2D5U A;  1Q0F A;  5AQR B;  2ACZ A;  2A1D D;  3AJM A;  3UMI A;  5M4Y A;  4IE4 A;  2YHS A;  1PCX A;  2YKS A;  3Q5E A;  4IDN A;  5FL1 A;  3VAY A;  4A4A A;  5JUA A;  2LP4 A;  4XEV A;  4O79 A;  2PBE A;  2CXD A;  3IQC A;  5F28 E;  5IY5 C;  5C3J A;  3AG4 C;  3JCU Q;  5HCJ A;  1ZVZ A;  2E9X C;  3M65 A;  4JI7 T;  1J5W A;  3J7Y q;  4TWF A;  3MYI A;  1YKE B;  3P50 A;  1BR4 A;  4OFZ A;  3TLT A;  2R9R B;  2GA0 A;  3N9M A;  4AKG A;  3ZDL A;  5KXJ A;  3UQ4 A;  2W0G A;  1LVF A;  1KEY A;  2V7I A;  4DUY T;  3WG7 C;  3JAF A;  1LVK A;  4WBN E;  3WAJ A;  3RIF A;  1U89 A;  5JDH A;  4YL1 A;  2DLR A;  1MNE A;  2XRH A;  4U5D E;  2I0M A;  3DI5 A;  3S90 A;  4P0A A;  5FKY A;  1K05 A;  2C5J A;  2FJE A;  5LG3 A;  2LSJ A;  2WZL A;  1OXK A;  2XJ7 A;  5DQW A;  4KC9 A;  4WYV A;  1I94 T;  4E0I A;  1PD1 A;  4LMK A;  2P6V A;  2Y3G A;  2J0X A;  3ZSS A;  4U7Y A;  2MPK A;  4JBW F;  4MW8 A;  2IXN A;  3JC6 C;  4WGZ A;  4N4W A;  3EAM A;  2NW8 A;  3VR8 A;  2VL8 A;  2WM9 A;  2W66 A;  2X0H A;  1JMW A;  2EIJ C;  3GEI A;  2E8I A;  2MBG A;  2PNO A;  3RW0 A;  2M6B A;  1QZX A;  3PUY F;  3V5Y A;  1LI7 A;  2YIN A;  2EPL X;  3I0O A;  1YXR A;  2LK4 A;  5KYX A;  3VR9 A;  4DJ9 A;  4U2Y A;  5LXT E;  1JOG A;  4DXW A;  2Y39 A;  2QLA A;  4GKJ T;  1GQE A;  2Y8D A;  2W45 A;  3OYZ A;  3I9W A;  4HWD A;  5GON E;  3PUV F;  3JSZ A;  3BQI A;  4XTK A;  1L3P A;  4EBB A;  3HTK C;  4HFK B;  2WAU A;  3JAE A;  2IW5 B;  2R7T A;  3KDS E;  1BR0 A;  3RYI E;  4CS9 A;  3AE7 A;  2PP4 A;  1Z3I X;  4BJM A;  1EQ1 A;  2WBL A;  4YHH T;  3NMI A;  2LEH A;  4G7Z F;  4C3E A;  1U5P A;  3ZMT B;  2TMV P;  5B1A C;  2AP3 A;  2ASR A;  3UFE A;  3V5Z A;  2YVK A;  4AQF C;  3QB5 A;  2XQ8 A;  1HE9 A;  1LE2 A;  3SXM A;  3U3I A;  4NTB A;  5JLI A;  2A0U A;  3SYN A;  4H9P C;  1MMA A;  3C63 A;  3RI5 A;  1T6U A;  2OEX A;  4HEA A;  3ZCI A;  1EKY A;  3ZMS B;  4BJ5 C;  1WLX A;  3HNI A;  2WWU A;  3AGT A;  2YRF A;  2UUH A;  3ABV A;  4W8K A;  1J5E T;  2WMO A;  5DLJ A;  1CPR A;  4LF9 T;  4E7S A;  3NBX X;  3AEA A;  4I55 E;  1Y01 A;  4MVM A;  2CHO A;  1XDO A;  2IDO B;  1QPU A;  1H9G A;  5HXR A;  2ODU A;  5HXS A;  256B A;  3MZK B;  4IL4 A;  1YA7 O;  1OXZ A;  1TWA A;  5HEG A;  3NYM A;  4PW8 A;  3H65 A;  3RKO F;  2NOX A;  3AA1 B;  5CA0 E;  2R7V A;  1X9B A;  3JYH A;  2G3V A;  3C62 A;  3BQK A;  3X1D A;  3A5X A;  2XLE A;  4O2B E;  3NDB B;  4H63 H;  3W2V A;  2BKN A;  3PUW F;  2XQ5 A;  3S84 A;  3ZN0 B;  4N6C A;  1T6I A;  3I4U A;  1XNQ T;  3LK3 B;  4L0R A;  2LLY A;  1CGN A;  2LSE A;  3EZI A;  4EBJ A;  2XAS B;  2A9U A;  2N1G A;  2CEA A;  4H9N C;  2XY8 B;  1N33 T;  4AX2 A;  3RGL A;  3ZTM A;  3EZH A;  1BBH A;  4AKL A;  4AIU A;  4K0K T;  1FFT C;  1ZOY A;  4TX5 A;  1FTS A;  3NMJ A;  5ABF A;  4Q7C A;  3R7C A;  5AQO B;  2L6F A;  2IIU A;  3CX8 B;  2IM8 A;  1AVO B;  3CIR A;  4CIP A;  2PTF A;  5BQG A;  4CZZ B;  2CYD A;  1JAF A;  3AVS A;  2BG9 C;  4DV6 T;  4QI0 A;  3UUX B;  4ONS A;  3B9Q A;  4DO0 A;  5F3J A;  3FZF B;  1HY5 A;  2Q9Q A;  1ZZP A;  3N5L A;  2Q9Q B;  3J9X 1;  3LK4 2;  5ADX L;  2R7X A;  1VYI A;  3O6X A;  5TJ5 E;  2EHO B;  2BBH A;  2RSE B;  1V74 B;  2X0Y A;  5JR9 C;  3EHN A;  3Q5X A;  2HFI A;  5KYW B;  4MFR A;  3M3Z B;  1ZV4 X;  2X9Y A;  1E85 A;  3JRM O;  2UXX B;  2V6Y A;  3HA4 A;  5HSW A;  4KMC A;  2L9Q A;  3IHU A;  4LLC A;  3HNJ A;  1T8B A;  4IDZ A;  4E18 A;  2YU2 A;  4UVC B;  1E83 A;  4MAL A;  5CA1 E;  2Q3T A;  4N6H A;  3KIN B;  1M57 C;  1ORJ A;  4EKW A;  4UDV A;  2LT3 A;  1HNZ T;  4LF4 T;  2OJQ A;  5KYY A;  3DE8 A;  3P4Q A;  5A1L A;  1Q0G A;  1V55 C;  2J7P A;  1VLT A;  5E2Q A;  4JW1 A;  3SRZ A;  3RHW A;  3C98 B;  5DQV A;  2XQY A;  3C64 A;  4X0R A;  2J9B A;  4PJJ A;  3HJC A;  4COF A;  3RQE A;  2IBF A;  4ZHQ E;  4YJ3 E;  5ABG A;  2LHR A;  4EOZ B;  1FMV A;  4U5C E;  5AQT B;  3GWN A;  2DGJ A;  1A0B A;  1NG1 A;  2B76 A;  3RF1 A;  4OIO F;  3NRY A;  2NTY A;  1VCT A;  5DS5 A;  4WGY A;  4ZEY A;  1TWG A;  2XM0 A;  3N9Q A;  2R25 A;  4DVZ A;  5BR8 T;  1G73 A;  2XTL A;  2EPO A;  4ULV A;  4KP3 C;  4C7O B;  3X1O A;  3SFE A;  2D5R B;  3NKD A;  3ZYK A;  2J46 A;  1NU7 D;  3R2P A;  3DP7 A;  3VYW A;  4DR3 T;  1O87 A;  4CI1 B;  3W15 B;  3AG3 C;  3KV6 A;  2VKJ A;  3IBP A;  5AQF B;  1YZA A;  5L0I A;  3RKG A;  2XQ3 A;  2AWY A;  3VM6 A;  3LBX B;  3NVO A;  2OQM A;  4XBF B;  1VMA A;  1JNZ A;  2ZXR A;  4ISS A;  3VRA A;  4JRZ A;  2LSG A;  3N24 A;  1OXB A;  5FXZ A;  5COM A;  5KX5 E;  4GYR A;  4P9F A;  2WZF A;  1K04 A;  3HNL A;  1V4A A;  2D2S A;  5IYZ E;  4DND A;  4LFB T;  2VWA A;  4D4N A;  2Y3B A;  2E9X B;  3V5U A;  1HF8 A;  4G78 A;  4ILB A;  3LUT B;  1QKR A;  2ODV A;  4MVQ A;  1SR2 A;  4L5G A;  5L3D B;  4CS7 A;  4JZA A;  4U3C A;  2BG9 E;  1FFH A;  3DKA A;  3CQC B;  3NZQ A;  1WCR A;  3N9L A;  1D0Y A;  4MVZ A;  2ZXP A;  4JV5 T;  4QH5 A;  1O3U A;  1MIW A;  3RIU A;  4U33 A;  5E33 A;  3D0T A;  1S05 A;  2IUB A;  3WAK A;  5JR9 B;  2VQF T;  5KYN A;  4MW3 A;  2D9D A;  4DV7 T;  4V1A v;  3JAD A;  4KHZ F;  3QVY A;  1J8M F;  5TAO A;  4HKA A;  1NAF A;  3I1A A;  2PF4 E;  2R02 A;  2XS1 A;  4MVU A;  4G0H A;  2J0W A;  1B68 A;  5F5W A;  5LYJ E;  3KBT A;  5HCM A;  3AE8 A;  4IAQ A;  5D91 A;  3W2W A;  3ZG1 A;  4QXB B;  3O1H A;  3EG9 A;  3RLF F;  4OD4 A;  2C04 A;  3TJ5 A;  4UXN B;  3PHF 2;  3ZMU B;  3ABL C;  5T1D B;  2AXD S;  5LBM A;  4O4J E;  1TFO B;  1E2X A;  1HR0 T;  2CXL A;  1U0B B;  3N0T A;  4G63 A;  4F8H A;  2FJB A;  3Q5W A;  4HFI A;  5DVW A;  2QTV A;  1YLM A;  3LG7 A;  2WVN A;  2D0U A;  1J8Y F;  3U8V A;  2CE7 A;  3O55 A;  1T7S A;  2WDR A;  3T6B A;  5J2T E;  2L6G A;  2DNX A;  1Z7Q c;  4A56 A;  1IBK T;  2J9W A;  2LSY A;  3T1H T;  3UFG A;  3K66 A;  1M2V A;  3H2U A;  4U31 A;  4U5H A;  1D1A A;  3IF8 B;  3EJN A;  2IXP A;  2Q00 A;  5LHH B;  2L8K A;  3RC3 A;  3TKL B;  5AQJ B;  2MAW A;  3RYH E;  1NLX A;  4O8S A;  1WR0 A;  2YL3 A;  2FGY A;  1HFA A;  2C5K T;  4DV1 T;  2SPC A;  1KNY A;  3ZMZ B;  4U2Z A;  2KYH A;  4DRJ B;  4PK6 A;  4DR1 T;  1WWP A;  1D1B A;  4JYA T;  2IAK A;  4NQF A;  5JVE A;  1GQA A;  3U8P A;  1EI7 A;  5L4E A;  3SNH A;  3UR3 C;  3L09 A;  4IHJ E;  3P7I A;  5AQK B;  5LJM A;  2ETS A;  2UXN B;  4X1I E;  5L0D A;  2CRB A;  2BS2 A;  1NEN A;  3VRB A;  5LP6 E;  3H37 A;  3PMR A;  2VKO A;  5AQM B;  4GK0 E;  2A0B A;  2M64 A;  4XQ1 A;  3I5P A;  3RQF A;  4XLP F;  1NFN A;  4PNI A;  4U7I A;  4NTF A;  1D0Z A;  2OEV A;  4Z91 A;  5L3G B;  3M79 A;  1M7K A;  5E0O A;  3DAG A;  1OW7 A;  2QY9 A;  2BBJ A;  2LSK A;  2H88 A;  3E0Z A;  1MMD A;  3UGO A;  3FDQ A;  3UUN A;  4CJG A;  3FXD B;  2YWA A;  3QZC A;  1VLS A;  2KIN B;  1Y4C A;  2CWY A;  2ZD9 A;  4JI5 T;  4ZOL E;  4ASK A;  2LKG A;  1IW7 F;  3ZQY A;  4J7Y A;  3K7D A;  1OCO C;  3OBV E;  1XMQ T;  2D0T A;  4OD5 A;  3KVA A;  3DJN B;  1UUS A;  1XZY A;  3NKZ A;  4CQI A;  4YT0 A;  5KYU A;  1I4Y A;  1SZI A;  2KNH A;  4MTG A;  3PJA J;  2LHN A;  4JI0 T;  2HMZ A;  3O10 A;  3PU3 A;  1QQ3 A;  2CDQ A;  2BG9 A;  2O9X A;  4IE5 A;  5C8Y E;  4QI2 A;  2YLD A;  3RC8 A;  3P4S A;  4TWD A;  1NFO A;  1T01 A;  4J7T A;  2J1D G;  3SOL A;  2KJG A;  1RJ9 B;  3ZC4 A;  3RFY A;  4C3B A;  1PV3 A;  3FVY A;  3ZSU A;  4YN0 B;  2DWK A;  1H7I A;  5CFB A;  4BEM J;  5L0G A;  2WB5 A;  4DID B;  5LJN A;  2XSE A;  2L6H A;  4ZXL A;  2JD3 A;  2Q9B A;  4ZI2 D;  3K8P C;  2R7U A;  4C91 A;  1Z8U A;  2KND A;  2QRX A;  2CM0 A;  3FAP B;  4BAY B;  1G8X A;  1WRD A;  4DR2 T;  4DV3 T;  2QA7 A;  3OA1 A;  3AEB A;  5AC4 A;  3ZMV B;  1C17 M;  1A7V A;  1U6H A;  4EZH A;  4EEB A;  1OCR C;  3K3O A;  5A6J A;  5L3E B;  2YOE A;  5FYM A;  4P0B A;  4IB4 A;  2XXA A;  2X67 A;  2DYR C;  2UXD T;  4OK0 A;  1M2O A;  1N1C A;  2ES0 A;  4HWH A;  1A7D A;  4AKR B;  2ZXW C;  3ZVR A;  4CDA A;  2CLY B;  3QC9 A;  1TR2 A;  2NUT B;  1IZM A;  5HXC A;  2XL4 A;  4K0D A;  1LI5 A;  3K3N A;  5IHY A;  2VUR A;  3RIA A;  5FMN A;  2NG1 A;  3G50 A;  2QUP A;  2BE5 F;  3MK7 C;  3QMK A;  3LLK A;  4MLK A;  4O6Y A;  3AAI A;  2WWV A;  1R8I A;  3FXE B;  3SXK A;  3MAC A;  1VYK A;  1HX1 B;  1KK7 A;  1YKH B;  4GEH A;  3HKB E;  2OKU A;  4U5G A;  5LNK A;  5LOV E;  4UF0 A;  4UIG A;  2MYS A;  1QVX A;  4J2C A;  3ZT6 A;  1DU2 A;  3JZ0 A;  5CJ5 A;  4HFE A;  3K6B A;  1YQ4 A;  4I0U A;  2KT9 A;  2FAP B;  2HJ3 A;  3ZPO A;  1BZ4 A;  3K1H A;  2CXF A;  1YQ3 A;  2OJE D;  3HKC E;  3T6G B;  4ZLD A;  1ZW3 A;  3HL6 A;  4KBM B;  1KNP A;  1E1H B;  2EIM C;  1FR0 A;  2XAJ B;  3L8J A;  5JDQ A;  2W63 A;  5LGT B;  4DRH B;  3JT1 A;  1WAT A;  3B0U X;  1VTM P;  1ST6 A;  3JRT A;  3QVZ A;  2H7B A;  3R84 B;  5BMV E;  2K9A A;  4ZZB A;  4IAR A;  2CCQ A;  1Y6D A;  2XAQ B;  1G4W R;  2H7O A;  3AA6 B;  3EPV A;  3ETU A;  4IAO A;  5HYA A;  4LAC B;  4KUM B;  1ZU4 A;  2YL1 A;  3QW1 A;  1FMW A;  1WOL A;  2J4G A;  1MQV A;  3Q7L A;  5LMN T;  1VK5 A;  4YTN A;  4C90 A;  3PUQ A;  2A69 F;  2Q7R A;  3PDY A;  4CDV A;  2PX0 A;  3RIU C;  3TLV A;  1YVI A;  2XSA A;  1H9T A;  1W09 A;  2J47 A;  3QB5 K;  4KX6 A;  1Z63 A;  5DS4 A;  4ILC A;  4GYT A;  4XAX B;  3ZLI A;  2JQK A;  3CQG B;  3UU4 A;  3BEH A;  4YK5 A;  5DAB A;  2HSB A;  4NC3 A;  3LSV A;  3MA9 A;  2YN6 A;  2K5B B;  3NYL A;  3ZC0 A;  5AQH B;  1A7E A;  5CB4 E;  1E86 A;  3RRC A;  1CPQ A;  3TLS A;  1W0A A;  1RKC A;  3LNM B;  2LSI A;  1NBB A;  3SFD A;  4B6I A;  2XM2 A;  4Z90 A;  3FOP A;  2VKD A;  4B3S T;  2BDE A;  2F22 A;  5LGU B;  4JUR I;  4PJL A;  4MVS A;  3EGD B;  3OVU A;  3T6J A;  1OED B;  2QNL A;  2X0C A;  3W8I A;  3VU7 H;  2OCC C;  1M56 C;  2X51 A;  1FIO A;  5AFU L;  1EZ3 A;  2V7J A;  3LES A;  3C50 A;  4YSZ A;  1JRA A;  2VVN A;  1SHZ C;  3KFW X;  4U74 A;  4X1K E;  1MMN A;  2YKZ A;  3GA8 A;  4X1Y E;  1OR3 A;  3K33 A;  4KI0 F;  2ZPA A;  3WHN A;  4IDQ A;  3AE1 A;  3K3Q C;  3P4P A;  2XL8 A;  4QX8 B;  4U72 A;  2EIL C;  2JMH A;  1V54 C;  2A3D A;  4YL0 A;  3N2Z B;  1H7C A;  4A2N B;  4MTF A;  3PE0 A;  3PV0 F;  2L3L A;  3SEO A;  2LM9 A;  4YSY A;  5CGM A;  2HJM A;  2IML A;  3ESL A;  3F47 A;  3EHZ A;  4PJM A;  4GIW A;  1LRZ A;  2RA1 A;  3CX6 B;  1KFY A;  1XNR T;  1G5Z A;  2XUE A;  2E9X D;  2JIW A;  3PUZ F;  4PAG A;  1NU9 C;  2B0H A;  1SE7 A;  2H7V C;  4ADZ A;  1OW8 A;  4U5B E;  3E9V A;  5B1B C;  2Y6X A;  5LBQ B;  4D4X A;  2GWW A;  4IRE A;  3GEH A;  1XWJ A;  5EZY E;  2IC9 A;  4CX9 A;  3NZP A;  4IGG A;  3F57 A;  3OEO A;  4FX5 A;  4DR5 T;  3DWW A;  3F46 A;  3JYY A;  2ACX A;  4J30 B;  4DMW A;  5JP7 A;  2YDQ A;  2Q9C A;  4JEB A;  2AWC A;  3S0X A;  2XAG B;  2YLI A;  2KC3 A;  1UX5 A;  3U9J A;  4UR9 A;  4IRU A;  5KYX B;  1Z0P A;  2NUP B;  3CAX A;  4YLH A;  4KI2 A;  5L0J A;  4HWF A;  2LKH A;  1HMD A;  3BRJ A;  2XXA B;  4JEU B;  3EGD A;  3W4Y A;  4WJ0 A;  5T3T A;  3WOD F;  3N9P A;  4DBQ A;  3EH1 A;  3RVY A;  3L34 A;  3U5S A;  4I43 B;  5HV9 A;  4JEA A;  2V8S V;  3Q2M A;  5J1G A;  1Z23 A;  4GYS A;  4HE8 D;  4CI3 B;  2BC5 A;  2V5D A;  2WU5 A;  1HMO A;  3POV A;  3LJC A;  3A8Y C;  1G4U S;  3S28 A;  2WU2 A;  4AKH A;  3MBG A;  3SZR A;  4QH4 A;  2HHH T;  3RYF E;  1OW6 A;  1HCI A;  4DV4 T;  4YWQ A;  4H9R C;  1DOV A;  1YAR O;  3NKE A;  2XLH A;  5KYY B;  3S29 A;  3G06 A;  3TQO A;  2HN1 A;  4OYK A;  1UG7 A;  5JDG A;  4CS8 A;  3HLZ A;  2CW0 F;  4X65 T;  2W61 A;  3MXZ A;  2BL2 A;  5JDN A;  2R7Q A;  2XLW A;  1ZP0 A;  2WB7 A;  3HR0 A;  2OLT A;  1ZHX A;  2V7M A;  3GM3 A;  1XDP A;  3A7M A;  3KVB A;  3ZCJ A;  2Y3D A;  4NXN T;  3ZC1 A;  2J9V A;  4EIW A;  4DOZ A;  2N2N A;  2XQ6 A;  5AQN B;  4YJW A;  3ZKR A;  2LQG A;  2EHO C;  2EIN C;  1YYJ A;  2AE9 A;  5LB7 B;  4LDQ A;  1KU2 A;  4NTA A;  4MBQ A;  4A98 A;  2A68 F;  2KW3 C;  5A6A A;  1ZKE A;  4CIH A;  1YZC A;  1UGO A;  2JQH A;  3AED A;  2K3W A;  3AE9 A;  5A6B D;  4ILA A;  3ZEF B;  1XZP A;  1HX8 A;  4NIQ A;  2HS5 A;  4K1O A;  5FXV A;  1VOM A;  2I15 A;  5L2L A;  1IAP A;  1MND A;  4JI8 T;  4IDO A;  2RPA A;  5E3A A;  2I59 A;  4AE4 B;  3ONL C;  3EAB A;  1OQC A;  3EGX A;  4CBE A;  2YLG A;  5AQS B;  3KBU A;  2DL1 A;  2E87 A;  2P9B A;  4WNK A;  5L3B B;  3UNG C;  2CCY A;  5JDM A;  4N06 A;  2Y69 C;  3K1S A;  3H2V A;  4UF0 B;  3M4B A;  2Q4F A;  3HI2 A;  3TLW A;  2BKO A;  1PD0 A;  3I0Q A;  2GFH A;  1IZN B;  5AQQ B;  5KMG P;  1XZQ A;  4CSA C;  2GDC A;  1HS7 A;  4LF6 T;  1HG5 A;  3LFM A;  2MHR A;  3QW0 A;  1ZHT A;  5H6R B;  2YK0 A;  3NYJ A;  4JJG A;  3FHD A;  3ZT7 A;  5L4H A;  3I5Q A;  1QLE C;  4IWB A;  4YXD A;  3AA0 B;  4HE8 A;  3P4W A;  4F6R C;  4NY3 A;  5EHH A;  4MQ9 F;  2P0N A;  4JE9 A;  3EFO A;  4Q4Z F;  2UUC T;  5B3I A;  4E7Z A;  1Z6A A;  5AQL B;  2W4M A;  1VB5 A;  3OKQ A;  3T1Y T;  3C7J A;  5FVK A;  5JSL A;  3H3M A;  4FI5 A;  1ZHY A;  4TWH A;  1OED A;  2PG8 A;  3FB2 A;  3F31 A;  2VKH A;  3PUA A;  2EPK X;  3AE6 A;  3UU3 A;  3AXJ A;  5L3V A;  3OYX A;  4P9T A;  1T9K A;  1QSP A;  2A6E F;  3LJB A;  3DM9 B;  3AE3 A;  4HWI B;  1BR1 A;  4MTO A;  4MND A;  1RJ9 A;  4LDK A;  1XWM A;  2XQ4 A;  4I50 E;  3ITF A;  4B6X A;  4YJ2 E;  4H9O C;  2K48 A;  3FHN A;  4L9I A;  5HEO A;  3C4X A;  4O6N A;  1IJ5 A;  2NPU A;  2JQQ A;  2V7K A;  4IE7 A;  4QHO A;  5ETW A;  3O4X E;  3C8G A;  4QH1 A;  3FBL A;  3PU8 A;  5FY1 A;  3O39 A;  3DM5 A;  3AE5 A;  4Q25 A;  2X9X A;  2CMR A;  4EYU A;  3U2L A;  5E3C A;  2PX3 A;  4O2A E;  3AB3 B;  3ECS A;  4OIN F;  5C2T A;  4J32 B;  2E5V A;  5BUO A;  4U5F E;  3SP1 A;  4JIO A;  4C3D A;  4KNV A;  2GK9 A;  5EK3 A;  5JRA A;  3P4R A;  2BZB A;  2XZE A;  2DYS C;  5ABE A;  3MJX A;  4HGA A;  3L8R A;  4HFV A;  1WYC A;  4JUY A;  2I8B A;  3LAY A;  2IXM A;  3AG2 C;  2VAS A;  3M1C B;  5COG A;  2DCF A;  2MWQ A;  1N34 T;  4BG0 A;  2G62 A;  1I5N A;  4EZ4 A;  5ABF B;  2KSF A;  2YQY A;  3NG1 A;  2WQY A;  5HXH A;  2NR4 A;  2QYW A;  2P7V A;  1YD8 G;  3EHM A;  3I9Y A;  4AKI A;  1LKX A;  2CNW D;  5EK2 A;  1MIY A;  1AUE A;  2JPU A;  3JTL O;  2Y3H A;  1KNR A;  2YZS A;  2N9D A;  3B57 A;  1CGM E;  4N78 D;  1YYX A;  3N2K E;  4O4L E;  3EDV A;  3US6 A;  4U5E E;  4GKK T;  2KQ9 A;  5LCY A;  4EB6 E;  4EV6 A;  4NUU A;  1Q0K A;  4KBL A;  1NWM X;  2IYL D;  4LLE A;  5FP3 A;  3RYC E;  3EUH A;  3P8C D;  4PFO A;  4RDA A;  2XQA A;  3G4Z A;  1W0B A;  4JJF A;  2OV9 A;  3AEE A;  3ZST A;  5FY0 A;  1T6Q A;  4Z9H A;  4WAB A;  4PFP A;  4PK4 A;  1Q0M A;  3KV9 A;  3ABM C;  2C0S A;  4C7O A;  5LA6 E;  2IOQ A;  5DQZ A;  3K1I A;  3OJA A;  1T5O A;  4YY3 T;  3U3B A;  4YT8 A;  3AAE B;  3VHL A;  2I6H A;  1C03 A;  3M15 A;  2RP4 A;  4XEK A;  1XMO T;  4L6R A;  3JSE O;  2KGO A;  4RBN A;  3T4R A;  3TD7 A;  4HWC A;  3ZJ1 A;  2FJA A;  3CPZ A;  1S94 A;  4DV0 T;  3S27 A;  4HFH A;  1LS4 A;  2HPJ A;  4YT2 A;  4I4T E;  3IHR A;  2R7S A;  3PUG A;  4IE6 A;  3RF3 A;  5F5H A;  4I1M A;  2QVA A;  2B1E A;  1RKE A;  4EYY R;  2PFD A;  4UV8 B;  3AEF A;  1TWH A;  1TFK B;  2V1D B;  4JLE A;  1LM3 B;  5IUX A;  5CI8 A;  3DJU B;  5JS5 A;  1O3X A;  3FBZ A;  2XQ7 A;  3PUR A;  3IEE A;  3GAN A;  2WL8 A;  2XS8 A;  5FXW A;  2A2F X;  3AAA B;  4CI2 B;  4P09 A;  2XAF B;  5JH7 E;  4UVA B;  5EGY A;  1NSG B;  2JX0 A;  3U3F A;  1T98 A;  5LMU T;  3UMH A;  4EGW A;  5LHI B;  3VKG A;  1L0V A;  2IXO A;  3LS0 A;  4CS8 C;  4NPP A;  4UVB B;  4X62 T;  3FAJ A;  2E2A A;  1SYQ A;  2H8A A;  2NUP A;  4XPY A;  2AU5 A;  4HTE A;  3FOO A;  3BK9 A;  1TKN A;  2OU6 A;  3CQZ A;  1WGW A;  4JI6 T;  2EHO A;  2KLQ A;  4JTD B;  4X20 E;  1O5H A;  3IQ5 A;  4BJ1 A;  2V7L A;  4QXH B;  1SUM B;  5FXX A;  2WMN A;  2CBJ A;  4PR9 A;  3KH2 A;  2CPT A;  1YA9 A;  4Z8X A;  3FZH B;  4OHF A;  4A97 A;  4H9S E;  3PTR B;  3UUL A;  2VH3 A;  2HKV A;  3EI0 A;  4EWC A;  2FFH A;  5L3C B;  1WAS A;  4X5T A;  2FBW A;  3DE9 A;  4BJT A;  2PJQ A;  1JPN A;  3B0P A;  2E9X A;  3CKD A;  4WZX A;  2VCA A;  2KK1 A;  2NW9 A;  3NRX A;  2GAQ A;  2CNW A;  2KWH A;  1SF8 A;  4Z9J A;  3Q6M A;  4DV5 T;  4ZS3 A;  2LCH A;  3PJA A;  1N32 T;  4O6M A;  3RVZ A;  3ATP A;  4XLN F;  2XAH B;  2UXB T;  4BA9 A;  4EHP A;  3B5M A;  5T3W A;  5FNV E;  2KSR A;  4CN1 A;  1OKK D;  2R05 A;  3IQT A;  3RKO A;  2XHE B;  3QNU A;  3UGP A;  4O4H E;  4WW0 A;  4CXX A;  3TLU A;  4QKN A;  5CIV A;  5HWX A;  3AOU A;  4O7G A;  3FMS A;  2WDV A;  4CSA A;  3DXJ F;  1MMG A;  1ORS C;  1M2V B;  3UUM A;  4IST A;  5JDL A;  2NSF A;  1RXQ A;  3EVY A;  3T9O A;  3CX7 B;  4BJ6 A;  3L3P A;  4LFA T;  4KHP T;  1T72 A;  2LFF A;  5AGF A;  3AEC A;  5DJQ C;  2Q9Q D;  2G3K A;  1W9R A;  3MLG A;  3RQW A;  4X66 T;  4IIJ E;  2ZM2 A;  4RD9 A;  3TOM A;  3C18 A;  4TNW A;  1APC A;  2XSB A;  1RKE B;  4K7B A;  4ZI3 D;  2XL6 A;  2ZXO A;  1YJG A;  5D92 A;  4LF7 T;  2PFV A;  2W2U A;  1OCZ C;  2XM1 A;  3CML A;  1I6Z A;  2EPM X;  2DB4 A;  3CSK A;  1UUR A;  4M1P A;  3B71 A;  5ABH A;  3ZQV A;  1OED C;  3DAF A;  2J7P D;  5FVL A;  2JMK A;  4AL0 A;  3IPM O;  4IDP A;  5LG4 A;  3KPH A;  3GWL A;  5FZT A;  5DS6 A;  2YDS A;  2H3R A;  2VVS A;  3QK6 A;  2CGE A;  1E84 A;  2CA5 A;  3QOF A;  3AE2 A;  1YAU O;  4ERR A;  5CI9 A;  3L39 A;  4HFB A;  4OIP F;  4PAC A;  1SA0 E;  3VF0 A;  2W4B A;  1RMV A;  2BS4 A;  4M63 A;  2X68 A;  1VRB A;  2AVK A;  3V5S A;  4ZI2 C;  3EH2 A;  3CVR A;  3UQ7 A;  4FAP B;  3SXZ A;  5GPG B;  1BDJ B;  2NSG A;  2LM2 A;  2YU1 A;  3RPU A;  4GOU A;  2V6Y B;  4EAH A;  4U9D A;  4XWJ A;  2L81 A;  1LS1 A;  3LEO A;  5JT4 A;  3C8Z A;  5L0C A;  2LD6 A;  4AK9 A;  2QE9 A;  4BJN A;  4FWV A;  3N9O A;  4CS9 C;  5AQI B;  2CHN A;  5L3F B;  4I1O B;  2DHR A;  1OKK A;  5JVD E;  4Z9I A;  3ZWI A;  2C03 A;  2X0L B;  5JRC B;  1L7C A;  5LHG B;  4NCQ A;  1HW1 A;  4AQF A;  3DMD A;  3AG1 C;  1C02 A;  1YDI A;  3G4X A;  1WTY A;  4LDR A;  2DI4 A;  4DR7 T;  1DOW A;  3DZA A;  2UUA T;  1UCU A;  2Q9A A;  1IBL T;  2YEV A;  2LRL A;  3ZIB A;  2VC9 A;  5BQI A;  4JI1 T;  3R6N A;  1IJ6 A;  2C5I T;  4R32 A;  4BJ5 A;  3F2E A;  2NP9 A;  5DQT A;  2PBI A;  1K40 A;  3UU6 A;  2HSQ A;  4H54 A;  3GOR A;  5L3Q A;  5JDF A;  4YTP A;  5JRE A;  3NMK A;  5EK0 A;  4EBK A;  1OCC C;  2OG2 A;  2JRK A;  5L47 A;  1HTJ F;  2HZ8 A;  5JRC A;  4LML A;  1J1J A;  2EHO D;  4JEH B;  2R7R A;  2W62 A;  2LFD A;  1MIV A;  1S7Z A;  1GM5 A;  1HE1 A;  2QGS A;  2UXC T;  3TUL A;  2HMQ A;  3KYJ A;  4O4I E;  1GGQ A;  1R5I D;  4DBR A;  2KZ7 B;  2M6I A;  3WAQ A;  4HFC A;  2Z15 A;  5L0F A;  1U4Q A;  3GN5 B;  4JTC B;  3Q6N A;  5J2U E;  2IC6 A;  4LFC T;  3C8G D;  2LIG A;  5AC5 A;  5K0I A;  1KF6 A;  4ANJ A;  3O1I A;  4B3M T;  2VK9 A;  3E70 C;  2W4X A;  1UX4 A;  1ZEE A;  2HN2 A;  3N2O A;  2R6G F;  2LE8 A;  1W2W A;  3LLI A;  1Y64 B;  2YL0 A;  4DR6 T;  3OWT A;  3J06 A;  2NWB A;  1IBM T;  3LBX A;  3C8G B;  3ABK C;  2ZM6 T;  1ZU5 A;  3AA7 B;  4U9E A;  3MYF A;  4HN9 A;  3ASN C;  1N36 T;  2VCB A;  3CQX C;  4AQG A;  1NZE A;  3UU5 A;  4EED A;  3K1I C;  1CHU A;  3Q9D A;  2HV6 A;  2WS3 A;  3GMI A;  3AQB A;  2BVL A;  2M67 A;  2L9J A;  3W8H A;  3AGU A;  4DUZ T;  1F1M A;  5H6Q B;  3TOL A;  5B3S C;  2UUI A;  3AXJ B;  3ETV A;  2YL7 A;  4EXT A;  5COF A;  2VL0 A;  2WDQ A;  2WZH A;  4UV9 B;  2D4U A;  3L1M A;  4FJO A;  1HNW T;  2J9U A;  4EIY A;  1SMY F;  4OIR F;  2FUP A;  3ZYL A;  2Q9Q C;  4AXP A;  4DVY P;  3JCF A;  1HW2 A;  3N2G E;  2LJL A;  4NUV A;  3ZYM A;  5AQV B;  4A5X A;  1VCS A;  4DMV A;  3DD7 A;  4I3M A;  2DI3 A;  4E0H A;  3U0C A;  1CUN A;  1JPJ A;  3ZT5 A;  2LOS A;  3UUB A;  4IT4 A;  1WR6 A;  3PDM P;  3UT5 E;  4PJN A;  5AQU B;  3KV5 A;  3KMI A;  1NEK A;  2OA5 A;  2OOC A;  5AQG B;  4B3R T;  3S9O A;  4ZI7 E;  2E5L T;  2ZMA A;  1JR8 A;  4MVR A;  4IE0 A;  4K0U A;  4IJJ A;  3KL4 A;  4IL9 A;  2W67 A;  4CDY A;  5L0H A;  2HV7 A;  4YHJ A;  2MOZ A;  2VB6 A;  1LIH A;  2ZM0 A;  2NUT A;  5IWA T;  4XPX A;  1WYB A;  1KTM A;  4DR4 T;  3PUX F;  2R7O A;  3X2Q C;  5HEH A;  2XQ9 A;  4B3T T;  4F4B A;  2HH7 A;  3OPC A;  5HWY A;  3EGX B;  3L0I A;  1H6G A;  3LEV A;  1US7 B;  5F8P A;  4XEF A;  3TK0 A;  4JTA B;  3MKD A;  2ICW G;  3AQC A;  2UUB T;  2KWI B;  2WSS V;  4JI4 T;  2J45 A;  4JCH A;  2X9W A;  3A9C A;  2XLD A;  4QXC B;  3B0V C;  2X66 A;  2FJD A;  3Q5D A;  3PCV A;  3NRH A;  3AEG A;  4CN6 A;  4TV9 E;  2V6X A;  4YL3 A;  1BR2 A;  3UMK A;  2DWG A;  1Q0D A;  1LE4 A;  4JVS A;  3GWH A;  1E7P A;  1S35 A;  3UU8 A;  1QSD A;  5A6B A;  5EK4 A;  4X64 T;  2ZLY A;  2V3C C;  1AEP A;  1LPE A;  2V5C A;  1AJ3 A;  2CBI A;  4LF8 T;  3VRC A;  3WI3 A;  3CZ6 A;  2L7A A;  2YDR A;  2XLM A;  4JCZ A;  4E17 A;  3RX6 A;  1OED E;  3AVR A;  4MS2 A;  4BEJ A;  2KMF A;  3VKH A;  2P1A A;  2NW7 A;  3UTK A;  3IA3 A;  2MTQ A;  4W8P A;  3FXH A;  2Z6E A;  3TJ6 A;  4Q5S F;  3RQU A;  3C51 A;  1V9D A;  3GM2 A;  4HFF B;  4BJ6 C;  4YT4 A;  1QUU A;  3V5X A;  3GN5 A;  3AE4 A;  1E2A A;  3CEX A;  3C4Z A;  5HEJ A;  2WCA A;  4G7O F;  3LK2 B;  2NTX A;  2VCC A;  4MHC A;  2XLV A;  1WFD A;  2WVO A;  5BQH A;  2JQ9 A;  2BS3 A;  3O1J A;  1ZW2 A;  3U78 A;  3RIP A;  3LS1 A;  4KNW A;  3LNR A;  2M4E A;  2BG9 B;  4TN7 B;  1ZHC A;  3N9N A;  1EA8 A;  1JNR A;  3ONJ A;  5FY7 A;  3B29 A;  3ANW B;  3ZTZ A;  1UFB A;  1D0X A;  4XZC A;  2BVM A;  3DTO A;  4CXY A;  4UEL A;  2F4V T;  3GOD A;  3SXY A;  4AE4 A;  2WP9 A;  2KXP B;  2ZM8 A;  4CN4 A;  4DV2 T;  2EIK C;  2XPK A;  5KYW A;  4H9Q C;  1TWC A;  4YT5 A;  3FZM B;  3T8O A;  2V26 A;  4XPW A;  3GM1 A;  4OYJ A;  4IGU A;  4H4K C;  4JI3 T;  4ZI3 C;  3QTH A;  1GS9 A;  5HEU A;  2WY2 A;  4GK5 E;  5JQG E; 
#chains in the Genus database with same CATH homology
 4ZHQ E;  4G7H F;  1M56 C;  4YJ3 E;  2X51 A;  1FIO A;  3ANW A;  1EZ3 A;  2V7J A;  3HKE E;  5AFU L;  3C50 A;  2NUP A;  3LES A;  3HKD E;  4HTE A;  1SHZ C;  3KFW X;  4U74 A;  2JJ9 A;  3BK9 A;  2LHR A;  4TUY E;  1FMV A;  4EOZ B;  1TKN A;  5HAX A;  3CQZ A;  4QDL A;  4U5C E;  1WGW A;  2DGJ A;  3CWZ B;  4X1K E;  2EHO A;  1MMN A;  2KLQ A;  1NG1 A;  3GA8 A;  4X20 E;  1O5H A;  4BJ1 A;  4X1Y E;  2V7L A;  4QXH B;  3NRY A;  4OIO F;  4ZS2 A;  2NTY A;  3UMI A;  3K33 A;  2ZPA A;  3EQL F;  5FXX A;  2WMN A;  3RYL A;  5DS5 A;  3K3Q C;  1TWG A;  4H63 V;  4QX8 B;  4U72 A;  5LGN B;  3N9Q A;  3KH2 A;  2EIL C;  1X79 A;  1HG2 A;  4Z8X A;  2JMH A;  4DVZ A;  3H3A A;  1B7T A;  5HXE A;  2A3D A;  2LOP A;  1G73 A;  2XTL A;  4H9S E;  3PTR B;  4KP3 C;  4OHF A;  3RRW A;  3UUL A;  2VH3 A;  3N2Z B;  1H7C A;  3X1O A;  4A2N B;  4EWC A;  2FFH A;  5L3C B;  2YEV C;  2G0U A;  3ZJ2 A;  3PE0 A;  2D5R B;  3NKD A;  3E22 E;  3ZYK A;  3B13 A;  2L3L A;  2J46 A;  3JC6 D;  1NU7 D;  3DP7 A;  3SEO A;  3VYW A;  1OWA A;  2LM9 A;  1O87 A;  4CI1 B;  4BJT A;  2PJQ A;  3W15 B;  3AG3 C;  4TZ4 C;  1JPN A;  4C3B A;  3KV6 A;  3B0P A;  3ESL A;  2VKJ A;  2E9X A;  3IBP A;  3F47 A;  4PJM A;  3CKD A;  4GIW A;  2NW9 A;  1LRZ A;  2RA1 A;  3CX6 B;  3NRX A;  4QX7 B;  2CNW A;  2KWH A;  1SF8 A;  3Q6M A;  3RH3 A;  2CWO A;  3LBX B;  4ZS3 A;  4O6M A;  2XUE A;  2E9X D;  3C4W A;  4XBF B;  1VMA A;  4XLN F;  2XAH B;  4PAG A;  1NU9 C;  3V7O A;  2HPL A;  4BA9 A;  2ZXR A;  2H7V C;  5T3W A;  4ISS A;  5FNV E;  4ADZ A;  1OKK D;  3E9V A;  4U5B E;  5B1B C;  3RKO A;  2LSG A;  2XHE B;  2Y6X A;  5LBQ B;  3O9X A;  3N24 A;  2R7W A;  3UGP A;  4O4H E;  4WW0 A;  4CXX A;  3EFO B;  5FXZ A;  3EG9 B;  5KX5 E;  4GYR A;  4QKN A;  2WZG A;  2WZF A;  3KV4 A;  3EDU A;  5HWX A;  4O7G A;  2D2S A;  5IYZ E;  4DND A;  2VWA A;  5EZY E;  3SWH A;  2B0J A;  2IC9 A;  2Y3B A;  4CSA A;  3NZP A;  3DXJ F;  4ZLC A;  2E9X B;  3V5U A;  3F57 A;  3OEO A;  4OIQ F;  1HF8 A;  1ZHW A;  4QWN B;  1MMG A;  4TV8 E;  3PUS A;  4FX5 A;  1M2V B;  2ODV A;  3UUM A;  4IST A;  2ACX A;  5JDL A;  3F46 A;  4J30 B;  4L5G A;  3EVY A;  5L3D B;  4CS7 A;  4DMW A;  3CX7 B;  4JZA A;  2Q9C A;  4BJ6 A;  3S0X A;  3L3P A;  2XAG B;  1FFH A;  3CQC B;  5DJQ C;  2G3K A;  1UX5 A;  2Q9Q D;  3KKB A;  1ZHZ A;  3MLG A;  4IRU A;  1Z0P A;  3NZQ A;  3N9L A;  1D1C A;  3MX3 A;  5KYX B;  1D0Y A;  2NUP B;  4IIJ E;  2ZM2 A;  4AI6 A;  2ZXP A;  3ONX A;  4RD9 A;  5FCL A;  4YLH A;  1MIW A;  4KI2 A;  4ILU A;  5E33 A;  3D0T A;  4HEA J;  3WAK A;  5JR9 B;  4K7B A;  5KYN A;  4ZI3 D;  5JR9 A;  2W9Y A;  2ZXO A;  5D92 A;  4V1A v;  2PFV A;  1OCZ C;  2XXA B;  2A72 A;  4JEU B;  3CML A;  1J8M F;  5TAO A;  4HKA A;  4PK5 A;  3CSK A;  1NAF A;  3I1A A;  4YFS A;  3EGD A;  4M1P A;  4WJ0 A;  5T3T A;  3WOD F;  3N9P A;  4DBQ A;  2PF4 E;  3EH1 A;  4LER A;  3DAF A;  4G0H A;  2J0W A;  2J7P D;  4I43 B;  4G2A A;  3L34 A;  2JMK A;  3Q2M A;  5J1G A;  5LYJ E;  1Z23 A;  3KBT A;  4GYS A;  4HE8 D;  4BJ5 A;  5LG4 A;  3SS1 A;  4CI3 B;  4FES A;  5D91 A;  3ASO C;  3W2W A;  3POV A;  3ZG1 A;  3LJC A;  3Q7G A;  5DS6 A;  3S28 A;  2H3R A;  4QXB B;  2CLY C;  3QK6 A;  4AKH A;  2CGE A;  3SZR A;  3DJB A;  2CA5 A;  5CI9 A;  4ERR A;  3O1H A;  3RYF E;  3EG9 A;  5F5F A;  4P6I C;  4OD4 A;  1HCI A;  2C04 A;  4UXN B;  3PHF 2;  4OD5 A;  3ZMU B;  3ABL C;  4H9R C;  5T1D B;  4YWQ A;  4OIP F;  1SA0 E;  5LBM A;  4O4J E;  4ULW A;  3NKE A;  2W4B A;  4WBO A;  3S29 A;  2K24 A;  4M63 A;  5KYY B;  2CXL A;  2X68 A;  1VRB A;  3N0T A;  3V5S A;  4G63 A;  4UEM A;  4ZI2 C;  3EH2 A;  5KYU B;  3CVR A;  2Y48 B;  2JPF A;  4OYK A;  3QUJ A;  4CXW A;  3Q5W A;  5JDG A;  5DVW A;  2A6H F;  2YU1 A;  3RPU A;  4GOU A;  2WVQ A;  4EAH A;  2QTV A;  1KNZ A;  2CW0 F;  3HLZ A;  2W61 A;  3MXZ A;  1ZYR F;  3LG7 A;  5JDN A;  2D0U A;  2L81 A;  1LS1 A;  2R7Q A;  4DVD A;  2WVN A;  1J8Y F;  2WB7 A;  2CE7 A;  3HR0 A;  1YW0 A;  4AK9 A;  1ZHX A;  2V7M A;  4BJN A;  3KVB A;  2Y3D A;  1FEW A;  3ZCJ A;  3N9O A;  4FWV A;  2J9V A;  3ZC1 A;  3T6B A;  5L3F B;  1Z5Z A;  4EIW A;  5J2T E;  4CS9 C;  4DOZ A;  4XWJ A;  4I1O B;  2DHR A;  2N2N A;  3BQL A;  5JVD E;  2DNX A;  1OKK A;  4I44 A;  4G7Z F;  4YJW A;  2W00 A;  5KDM C;  2X9H A;  2EHO C;  4A56 A;  2C03 A;  2EIN C;  3ZN1 B;  3E08 A;  4C7O B;  1KU2 A;  2J9W A;  2X0L B;  2LSY A;  4MBQ A;  5JRC B;  5LHG B;  3S4U A;  2A68 F;  2D5U A;  2KW3 C;  4AQF A;  3K66 A;  1M2V A;  1ZKE A;  4CIH A;  4U5H A;  2A1D D;  1D1A A;  3IF8 B;  4IE4 A;  5M4Y A;  2YHS A;  2IXP A;  3DMD A;  1PCX A;  2L8K A;  3RC3 A;  5LHH B;  3AG1 C;  3TKL B;  3ZEF B;  2DI4 A;  1HX8 A;  3VAY A;  3RYH E;  3DZA A;  1UCU A;  2Q9A A;  4O79 A;  4O8S A;  2YEV A;  2CXD A;  3ZIB A;  2FGY A;  5FXV A;  3R6N A;  1IJ6 A;  1VOM A;  1HFA A;  2C5K T;  2C5I T;  2NP9 A;  3F2E A;  2SPC A;  5L2L A;  1IAP A;  1MND A;  2PBI A;  3AG4 C;  5IY5 C;  3ZMZ B;  3JCU Q;  5L3Q A;  5JDF A;  5E3A A;  2I59 A;  4PK6 A;  5JRE A;  4AE4 B;  2E9X C;  3M65 A;  3EGX A;  1OCC C;  4CBE A;  2OG2 A;  2JRK A;  1D1B A;  1HTJ F;  3J7Y q;  2IAK A;  5JRC A;  2EHO D;  1YKE B;  4JEH B;  2R7R A;  2W62 A;  3SNH A;  3UR3 C;  3L09 A;  1BR4 A;  4OFZ A;  1MIV A;  4IHJ E;  1S7Z A;  3KBU A;  3P7I A;  2QGS A;  5LJM A;  3N9M A;  2E87 A;  3UNG C;  2P9B A;  4WNK A;  5L3B B;  4AKG A;  2UXN B;  4X1I E;  2W0G A;  1LVF A;  4O4I E;  2V7I A;  3WG7 C;  4DBR A;  2KZ7 B;  5JDM A;  5LP6 E;  3H37 A;  2Z15 A;  4N06 A;  3GN5 B;  1U4Q A;  1LVK A;  4WBN E;  3WAJ A;  2Y69 C;  2VKO A;  2IC6 A;  4GK0 E;  5J2U E;  3PMR A;  4UF0 B;  3Q6N A;  3I5P A;  3HI2 A;  4ANJ A;  3O1I A;  4XLP F;  5JDH A;  1PD0 A;  3I0Q A;  2VK9 A;  4PNI A;  2GFH A;  3E70 C;  1IZN B;  1UX4 A;  1ZEE A;  2DLR A;  1D0Z A;  1MNE A;  5KMG P;  3N2O A;  5L3G B;  2XRH A;  4U5D E;  2LE8 A;  4CSA C;  1W2W A;  5E0O A;  4P0A A;  3DAG A;  2QY9 A;  1HS7 A;  3LLI A;  2C5J A;  1HG5 A;  2LSK A;  3LFM A;  1Y64 B;  1ZHT A;  3OWT A;  3E0Z A;  2NWB A;  1MMD A;  2LSJ A;  5H6R B;  2WZL A;  2YK0 A;  3UUN A;  3FDQ A;  3UGO A;  5DQW A;  3FXD B;  3LBX A;  3QZC A;  4KC9 A;  2KIN B;  3NYJ A;  4JJG A;  3FHD A;  3ABK C;  1ZU5 A;  1PD1 A;  2CWY A;  3AA7 B;  2P6V A;  2Y3G A;  3I5Q A;  1QLE C;  4IWB A;  4ZOL E;  3AA0 B;  4HN9 A;  4ASK A;  2J0X A;  3ASN C;  1IW7 F;  4HE8 A;  4NY3 A;  4F6R C;  5EHH A;  3QMK A;  5DQT A;  4MQ9 F;  3CQX C;  4AQG A;  1NZE A;  2IXN A;  3K1I C;  3EFO A;  3JC6 C;  4Q4Z F;  3Q9D A;  3K7D A;  1OCO C;  3OBV E;  4E7Z A;  2NW8 A;  1Z6A A;  2VL8 A;  2HV6 A;  2D0T A;  2WM9 A;  3KVA A;  3GMI A;  2EIJ C;  2W4M A;  3AQB A;  3DJN B;  2BVL A;  2E8I A;  3OKQ A;  2MBG A;  2M67 A;  4CQI A;  2L9J A;  3W8H A;  5KYU A;  4FI5 A;  1ZHY A;  2PG8 A;  3FB2 A;  3F31 A;  2VKH A;  3PUA A;  5H6Q B;  1QZX A;  1SZI A;  2KNH A;  2LHN A;  3ETV A;  5L3V A;  2YIN A;  3OYX A;  3PU3 A;  4EXT A;  2CDQ A;  2O9X A;  3I0O A;  2A6E F;  3LJB A;  4IE5 A;  4UV9 B;  5C8Y E;  3DM9 B;  5KYX A;  4QI2 A;  4FJO A;  3RC8 A;  2J9U A;  1BR1 A;  1SMY F;  4OIR F;  5LXT E;  4MND A;  1RJ9 A;  3ZYL A;  2J1D G;  3SOL A;  2KJG A;  1RJ9 B;  2Q9Q C;  4AXP A;  2Y39 A;  4DVY P;  2W45 A;  2Y8D A;  3ZC4 A;  3RFY A;  3OYZ A;  3N2G E;  2LJL A;  4I50 E;  4NUV A;  3ZYM A;  4B6X A;  4YJ2 E;  4H9O C;  3FVY A;  3ITF A;  3ZSU A;  2K48 A;  3FHN A;  3I9W A;  4L9I A;  4YN0 B;  2DWK A;  3C4X A;  5GON E;  4O6N A;  1IJ5 A;  1V54 C;  2JQQ A;  2V7K A;  4IE7 A;  4QHO A;  3BQI A;  4DMV A;  5LJN A;  3DD7 A;  3JSZ A;  5ETW A;  4I3M A;  3O4X E;  4XTK A;  2XSE A;  1CUN A;  1JPJ A;  4EBB A;  2JD3 A;  3HTK C;  4HFK B;  2WAU A;  3FBL A;  2IW5 B;  2LOS A;  3PU8 A;  2Q9B A;  4ZI2 D;  2R7T A;  3K8P C;  1WR6 A;  5FY1 A;  4C91 A;  2R7U A;  3KDS E;  2KND A;  1BR0 A;  3UT5 E;  3DM5 A;  3O39 A;  2CM0 A;  3RYI E;  4PJN A;  4CS9 A;  3KV5 A;  4BAY B;  2PP4 A;  1G8X A;  3KMI A;  1WRD A;  3OA1 A;  2QA7 A;  2X9X A;  1Z3I X;  4BJM A;  2CMR A;  2WBL A;  4EYU A;  3ZMV B;  2OA5 A;  2LEH A;  2PX3 A;  4EZH A;  5E3C A;  4O2A E;  3AB3 B;  4C3E A;  1U5P A;  3ZMT B;  3ECS A;  4OIN F;  1OCR C;  5B1A C;  3K3O A;  5L3E B;  4J32 B;  5BUO A;  3UFE A;  4U5F E;  5FYM A;  3SP1 A;  4ZI7 E;  4AQF C;  4C3D A;  4P0B A;  4KNV A;  2ZMA A;  2XXA A;  2GK9 A;  2X67 A;  5EK3 A;  2DYR C;  4IE0 A;  4K0U A;  4IJJ A;  3U3I A;  3KL4 A;  4OK0 A;  2BZB A;  1M2O A;  3SYN A;  4H9P C;  1MMA A;  2DYS C;  1N1C A;  2ES0 A;  3MJX A;  2HV7 A;  4HGA A;  4JUY A;  4HFV A;  1WYC A;  4YHJ A;  2MOZ A;  4AKR B;  2VB6 A;  2CLY B;  2ZXW C;  4HEA A;  3QC9 A;  3ZCI A;  3ZVR A;  2ZM0 A;  1TR2 A;  3ZMS B;  2I8B A;  3LAY A;  2IXM A;  2NUT A;  1WLX A;  2NUT B;  3AG2 C;  4BJ5 C;  2VAS A;  1IZM A;  3M1C B;  5HXC A;  2DCF A;  2XL4 A;  4K0D A;  2WWU A;  1WYB A;  2MWQ A;  4BG0 A;  2G62 A;  3K3N A;  4EZ4 A;  5IHY A;  2R7O A;  4W8K A;  3X2Q C;  4F4B A;  5FMN A;  2NG1 A;  2HH7 A;  3EGX B;  2WMO A;  5HWY A;  5DLJ A;  3NG1 A;  4E7S A;  3NBX X;  5HXH A;  3L0I A;  4I55 E;  2BE5 F;  2P7V A;  3LEV A;  1YD8 G;  3MK7 C;  1US7 B;  3I9Y A;  4AKI A;  1LKX A;  2CNW D;  3EHM A;  4MLK A;  5F8P A;  5EK2 A;  1MIY A;  5HXR A;  3LLK A;  2ODU A;  4O6Y A;  5HXS A;  3AAI A;  3MKD A;  3AQC A;  2Y3H A;  2YZS A;  3MZK B;  2KWI B;  3FXE B;  2WSS V;  3MAC A;  2N9D A;  1OXZ A;  3B57 A;  1VYK A;  2J45 A;  1KK7 A;  1TWA A;  4JCH A;  1YKH B;  2X9W A;  4QXC B;  3NYM A;  4GEH A;  3HKB E;  4N78 D;  3N2K E;  3B0V C;  4O4L E;  3EDV A;  4PW8 A;  4U5G A;  5LNK A;  3H65 A;  4U5E E;  2NOX A;  5LOV E;  4UF0 A;  4UIG A;  2X66 A;  3AA1 B;  2KQ9 A;  2MYS A;  3RKO F;  3NRH A;  5LCY A;  4EB6 E;  4TV9 E;  5CA0 E;  4J2C A;  2R7V A;  3JYH A;  2G3V A;  4NUU A;  4KBL A;  3BQK A;  1BR2 A;  1NWM X;  3K6B A;  2IYL D;  3UMK A;  3A5X A;  2KT9 A;  4LLE A;  5FP3 A;  3RYC E;  2DWG A;  3EUH A;  3P8C D;  4O2B E;  4PFO A;  4RDA A;  4H63 H;  3ZPO A;  4JVS A;  3W2V A;  3NDB B;  3GWH A;  1S35 A;  3K1H A;  3ZN0 B;  1QSD A;  2CXF A;  5EK4 A;  4JJF A;  3I4U A;  5FY0 A;  3HKC E;  2ZLY A;  2V3C C;  3LK3 B;  4L0R A;  4ZLD A;  1AJ3 A;  4PFP A;  3HL6 A;  4PK4 A;  3WI3 A;  2LSE A;  3KV9 A;  3EZI A;  3CZ6 A;  3ABM C;  2C0S A;  4KBM B;  2XAS B;  4C7O A;  2N1G A;  2CEA A;  1E1H B;  4H9N C;  5LA6 E;  2EIM C;  2XAJ B;  3RX6 A;  2IOQ A;  3OJA A;  4AX2 A;  3AVR A;  5JDQ A;  3EJN A;  5DQZ A;  4BEJ A;  2W63 A;  5LGT B;  3EZH A;  3JT1 A;  4AKL A;  2KMF A;  3VKH A;  1FFT C;  4YT8 A;  3AAE B;  4TX5 A;  3VHL A;  1ST6 A;  3JRT A;  1FTS A;  2H7B A;  3B0U X;  2NW7 A;  3UTK A;  4Q7C A;  2RP4 A;  3R84 B;  3CX8 B;  5BMV E;  2K9A A;  2MTQ A;  2CCQ A;  2Z6E A;  4CZZ B;  2KGO A;  4RBN A;  3T4R A;  3TD7 A;  2XAQ B;  3AVS A;  3ZJ1 A;  2H7O A;  3AA6 B;  3EPV A;  4Q5S F;  3CPZ A;  1S94 A;  3ETU A;  3S27 A;  4IAO A;  5HYA A;  3C51 A;  4LAC B;  1V9D A;  4KUM B;  1ZU4 A;  4QI0 A;  4HFF B;  1FMW A;  3UUX B;  4BJ6 C;  4YT4 A;  1QUU A;  2HPJ A;  3B9Q A;  4DO0 A;  5F3J A;  3GN5 A;  3Q7L A;  3C4Z A;  1VK5 A;  4YT2 A;  2Q9Q A;  4I4T E;  3IHR A;  4C90 A;  3N5L A;  2R7S A;  2Q9Q B;  3PUQ A;  2A69 F;  3J9X 1;  4G7O F;  3LK2 B;  2NTX A;  3PDY A;  3PUG A;  4IE6 A;  4MHC A;  5F5H A;  2PX0 A;  4I1M A;  2B1E A;  3LK4 2;  5ADX L;  4EYY R;  1VYI A;  2PFD A;  3O6X A;  2R7X A;  2WVO A;  2EHO B;  4UV8 B;  5JR9 C;  1Z63 A;  5DS4 A;  3EHN A;  3O1J A;  3Q5X A;  5KYW B;  3U78 A;  4MFR A;  4CS8 A;  4GYT A;  1TWH A;  4XAX B;  3LS1 A;  3RIP A;  1ZV4 X;  3ZLI A;  2X9Y A;  3CQG B;  4KNW A;  5B3S C;  2V1D B;  4JLE A;  3LNR A;  2M4E A;  5DAB A;  2UXX B;  3HA4 A;  4TN7 B;  3DJU B;  5CI8 A;  5HSW A;  1ZHC A;  3N9N A;  3MA9 A;  4KMC A;  2L9Q A;  4LLC A;  2K5B B;  4IDZ A;  5FY7 A;  3ZC0 A;  3NYL A;  2YU2 A;  1O3X A;  5CB4 E;  3FBZ A;  4UVC B;  3ANW B;  4MAL A;  3PUR A;  3RRC A;  1D0X A;  3IEE A;  5CA1 E;  2Q3T A;  2WL8 A;  4XZC A;  5FXW A;  2A2F X;  3GAN A;  2BVM A;  3DTO A;  2LSI A;  4UEL A;  4CXY A;  4B6I A;  3AAA B;  3KIN B;  3GOD A;  1M57 C;  2VKD A;  4CI2 B;  4P09 A;  4AE4 A;  2XAF B;  2BDE A;  2LT3 A;  5JH7 E;  5LGU B;  2KXP B;  4UVA B;  4JUR I;  5KYY A;  2ZM8 A;  5EGY A;  2EIK C;  4PJL A;  3EGD B;  1T98 A;  5KYW A;  5A1L A;  4H9Q C;  1V55 C;  1TWC A;  2J7P A;  4YT5 A;  3T6J A;  3T8O A;  2V26 A;  3UMH A;  5LHI B;  3VKG A;  2IXO A;  3LS0 A;  4OYJ A;  4IGU A;  5E2Q A;  4H4K C;  4CS8 C;  4JW1 A;  4UVB B;  3SRZ A;  3C98 B;  5DQV A;  2XQY A;  3C64 A;  3FAJ A;  4ZI3 C;  4X0R A;  3W8I A;  4PJJ A;  3VU7 H;  2OCC C;  3HJC A;  4GK5 E;  5JQG E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...