3RH3A

Crystal structure of an uncharacterized duf3829-like protein (bt_1908) from bacteroides thetaiotaomicron vpi-5482 at 2.10 a resolution
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
256
structure length
239
Chain Sequence
b'TEELDDASKVINYYHMSLAVLRHVANAKDINAVLGYMEQTGTAELLDPGDYFNPEVRQNLKQNYAGLFNVRTQFYDNFNKFLAYKKSKDTAKTAQLLDENYKLSVELSEYKQVIFDILSPLTEQAESELLADEPLKDQIMAMRKMSGTVQSIMNLYSRKHAMDGVRIDLKMAELEKELKAAEKIPAVTGYDEELKNFQSFLSTVKSFMNDMQKARSKGAYSDKEYQAMSEAYEYGLSVI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized DUF3829-like protein
molecule tags Structural genomics, unknown function
source organism Bacteroides thetaiotaomicron
publication title Crystal structure of an Uncharacterized DUF3829-like protein (BT_1908) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution
rcsb
total genus 89
structure length 239
sequence length 256
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-04-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.820 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3rh3A02
1.20.120.930 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3rh3A01
3IEEA 3RH3A 4YJWA
chains in the Genus database with same CATH superfamily
4COFA 4AKHA 1XNRT 4L9IA 2WCAA 4EZ4A 1CHUA 5JDQA 3FHDA 3O55A 2WL8A 2XQ9A 4JV5T 5CI9A 2DB4A 5AQMB 3HKEE 5E0OA 4DXWA 2CBIA 3ZJ1A 4PJMA 2V7JA 2PTFA 1L7CA 1A7EA 2MYSA 3P4RA 2GDCA 2LT3A 4CS9A 2KJGA 3VYWA 5LCYA 4G7OF 4CXWA 5KYXB 3RKGA 4LLCA 3DM9B 3DJNB 1TFOB 5AQKB 4HFKB 5L0CA 2V8SV 3MFNA 1QSPA 3ZVRA 3AEEA 5BUOA 4I1OB 3I1AA 4YJ2E 3ZWIA 1YQ4A 3NWIA 4JW1A 3S9OA 5GPGB 1Q0KA 2AE9A 5E3AA 4U31A 2B0JA 3K3NA 2BDEA 3PJAJ 3RRWA 2NPUA 2C04A 2EILC 3FZLB 1S7ZA 1D1AA 2PF4E 4DNDA 4DJ9A 3EABA 4IE0A 2FBWA 2OU6A 2DHRA 2PX0A 2IXMA 3S28A 3SNHA 4C3DA 4KP3C 4O7GA 1HFAA 2ODVA 1ZV4X 2DYRC 1OXBA 2YK0A 3WI3A 3BQKA 5BR8T 1HX8A 4I4TE 4ERRA 3S4UA 2YVKA 3EGDA 5EK3A 3OA1A 5DQVA 4B3TT 5GONE 2XLOA 4X0RA 3JCUQ 3KV4A 3O39A 4IE7A 1ZYRF 4E18A 4EHPA 3KINB 3KVBA 5L0JA 3T6GB 2V6XA 2CNWA 3FZMB 3AOUA 3MYIA 3M1CB 2J4GA 3RQGA 4JC7A 2CPTA 1R8IA 4V1Av 3D0TA 5AQOB 1G4WR 5TJ5E 4IAOA 1CGNA 2DGJA 4AKLA 1YKHB 2G3KA 4KHPT 1JR8A 3ZYKA 1WCRA 4BJ5A 4YL3A 3P4SA 3SFEA 1W09A 3N9OA 5D91A 4ZXLA 4IGUA 1BR0A 2YL0A 2YKZA 1Y64B 2CW0F 1LKXA 2NTYA 4KI0F 2VVNA 2NW7A 3PCVA 1SA0E 3DE8A 4EEDA 3L0IA 4UELA 3P4QA 4UR9A 3UMHA 1OCRC 4E7SA 2L3LA 2IM8A 4XWJA 2R7SA 2C0SA 3KVAA 1UURA 3E70C 2B1EA 4CN1A 3KKBA 1WATA 4JE9A 3QTHA 3NBXX 3AQCA 2YU1A 3M65A 2DI4A 3VU7H 2W4MA 4GIWA 3UT5E 5JR9B 2OJED 4U9DA 2VCCA 2ZXRA 3PHF2 1OXKA 2UU9T 3DJUB 4OIOF 2J7PA 3F47A 3CK6A 5LOVE 2UUAT 2VC9A 3OYXA 2BG9A 3A11A 2D5UA 3RYHE 2WMNA 3EZHA 3ZLIA 1E2AA 4WGYA 2PJQA 2LKGA 3ZPOA 2K48A 3GEHA 2NUTA 2KYHA 4CIHA 5K0IA 2XQYA 4WABA 4K0DA 4AL1A 3Q5WA 1M2VA 1ZVZA 3K3OA 4EZHA 1UG7A 1Q0GA 5LHGB 4NTFA 3EGDB 2QNLA 4K0UA 4X64T 1QVXA 1ZP0A 1YDIA 3BRJA 4U5HA 2VKJA 5IWAT 3CKDA 4B3ST 3IPMO 3UMIA 3GN5B 4UVCB 5L3BB 1FEWA 3CX7B 1LI5A 4H54A 4DVZA 4Q4ZF 1U0BB 1Y4CA 4OIQF 4CIPA 2MPKA 4UF0B 3T6BA 4CS7A 3C4WA 3PJAA 3QB5A 2ZPAA 1Z6AA 3ZSUA 3QVZA 3I0OA 3PUYF 4QX8B 4IWBA 3ZYLA 3AE6A 4UVBB 3MLGA 2CEAA 2K24A 4KC9A 4YTNA 1FAPB 4PJLA 2YWAA 4E17A 3AE9A 4YL1A 3KH2A 3LBXA 4MVOA 4LMJA 3EHNA 3T9OA 5DLJA 5B3SC 2A68F 1UFBA 3J7Yq 1XDOA 3AA7B 2W2UA 1YZAA 5A6BD 5B1BC 2J46A 3QW0A 5D92A 4WBNE 2ZM2A 3ZT6A 3CQGB 4J7TA 1YA9A 2IYLD 4YLHA 2N2NA 2ZM6T 1I4ZA 5KYUA 4HE8D 3N2ZB 4HWIB 2V7KA 3AG3C 5FMNA 5AFUL 2JPUA 4Z9HA 2HV7A 3MZKB 4HGAA 1JAFA 2J1DG 4JYAT 3JYHA 3UMKA 3K1SA 3HNLA 4JKVA 3SP1A 1HG2A 5LG3A 2A2FX 1H9TA 2IW5B 3V5SA 2H89A 1XMQT 1V4AA 2R7RA 4HN9A 4ISTA 1HMOA 1W0BA 1O3UA 2BS3A 4IDZA 1B7TA 1OWAA 2F22A 2R25A 2HV6A 3OKQA 3JT1A 2V7MA 2J7PD 3N0TA 2A0BA 2EHOC 2BL2A 1ZOYA 4YHJA 4AISA 3RHWA 3AQBA 4BJ1A 1M2OA 2AP3A 1O87A 4EKWA 2V7LA 3P8CD 3IHUA 2W67A 4YFSA 3ZMSB 4CXYA 3LK3B 4L6RA 2Z6EA 2XAJB 1HMDA 4X66T 5BMVE 1Y01A 3CEXA 2CHNA 3RIUA 4HFDA 4MNDA 3C7JA 4H9OC 4X1KE 5AC5A 4BJTA 2R7OA 3GEEA 3HR0A 3NZPA 3EPVA 1ZHCA 1S94A 2BKOA 4I1MA 3UUBA 3RPUA 2NW9A 3GM3A 3Q5DA 1T5OA 2K3WA 2HFIA 2XZEA 3IQCA 1ORJA 2J47A 4DMWA 3UFEA 4JCHA 4M63A 2VL0A 3NRYA 5AQHB 4YK5A 1YZCA 4MTGA 5C8YE 4AQGA 2CDQA 5AGFA 2HN1A 3PU8A 2P9BA 4HWHA 1JOGA 4HFVA 3RFYA 3QUJA 5J2TE 2WDRA 4A97A 4F8HA 1ZHWA 1FR0A 2WVQA 3C8GD 1XZPA 2CM0A 4TWFA 5DS4A 2ZM0A 5LG4A 2CWYA 1HTJF 1HE9A 1NU7D 3ASNC 2Y39A 1H7IA 5AQQB 4H63H 3FDQA 4ILCA 2WBLA 1QZXA 4A98A 2ES0A 4GQHA 3JCFA 3PUZF 1IJ6A 2IAKA 2R7QA 2FJBA 4PJNA 5J2UE 2HMZA 3BK9A 4NXMT 1ZW3A 5E3CA 5TAOA 3T6JA 3C18A 1E83A 3SXYA 1OEDB 4LDKA 4OK0A 2XM1A 3CVRA 2X51A 4I50E 3IQ5A 3HL6A 3Q2MA 3DTOA 4J7YA 4QH1A 2BVLA 1E1HB 4EBBA 5HSWA 2W61A 4IE6A 4JTDB 4OIPF 2Q9QA 1HS7A 4ONSA 5LP6E 3H2UA 4IE5A 3CAXA 2I6HA 5KYUB 2AU5A 3FHNA 2Y3HA 4YT5A 5IYZE 2G62A 3LLKA 2XASB 4CZZB 2WWUA 3UR3C 4U33A 4TV8E 1W9RA 4CS8C 4EV6A 1BR1A 1WGWA 2CE7A 4IHJE 1LM3B 3PTRB 2RA1A 3NKZA 5AQLB 3LG7A 2MTQA 4ZS2A 4BEJA 3N2GE 2K9AA 1CPRA 3K3QC 4C7OA 5HXCA 2XY8B 4B3MT 3IA3A 2H8AA 3FZHB 1HW2A 1NAFA 4JEHB 4YT8A 4U5BE 4TUYE 2XM4A 2ZM8A 1EQ1A 2A69F 5EK0A 3CQZA 2A1DD 3RQFA 3ZC4A 3L8RA 1OW7A 2YLGA 3B29A 4P6IC 3ITFA 5LMNT 4NC3A 3CX6B 5JH7E 5L3DB 3LAYA 4G7HF 1WYBA 4H9SE 2OJQA 5HEUA 3UULA 3UGPA 3AECA 3GA8A 4ULVA 1WOLA 1WR0A 4MW3A 3NG1A 2OV9A 3FBZA 3N2OA 1IZMA 4BPMA 5A6AA 3RIFA 1OEDE 3LNRA 4X5TA 3PDYA 3T1YT 1XWMA 3NYJA 2V5CA 3AVRA 2LRLA 4DR2T 3N2KE 4WYVA 4NIQA 3UQ4A 1RKEA 2LD6A 1VOMA 3LFMA 4JEUB 3G4XA 3NMJA 4QWNB 5HAXA 3SOLA 3ATPA 1VB5A 4IAQA 1U4QA 1I6ZA 4HEAA 2WWVA 5L2LA 3MK7C 4DV1T 3SEOA 4NCQA 4DMVA 5JDGA 2X9YA 3POVA 1B68A 5H6RB 4DV0T 4GKKT 4TV9E 2VQET 3IQTA 3JRTA 3AGTA 4ANJA 1HNXT 2I15A 2W4BA 2CNWD 4AQYT 1WLXA 1F1MA 2YN6A 2VASA 4DV2T 3AG4C 3NKDA 3L1MA 4ULWA 4AKIA 3U3IA 1NENA 3UUNA 3L8IA 1NG1A 3DI5A 4DOZA 1IZNB 1OXZA 3TOMA 1MNDA 1G73A 5FYMA 2YDQA 4JI4T 2NSFA 2L6HA 1X9BA 4XPXA 4LDQA 2R7VA 2HSQA 2LFDA 2KWHA 4PW8A 4RD9A 5JT4A 3HNKA 4KBLA 2QY9A 3MACA 1OW6A 5LHIB 1T72A 2BS2A 3HKDE 5JP7A 2FJAA 4U5GA 5KYWB 4EGWA 2PG8A 1IJ5A 3ECSA 3ZMTB 2XAGB 3N9LA 2WVOA 2KSFA 4XLPF 3QNUA 3O1JA 1UX4A 4UIGA 4Z8XA 4C91A 2NSGA 3VM6A 3UU4A 4CI1B 3AEGA 2W0GA 3TLWA 3JSZA 4K1OA 4I3MA 1AJ3A 2A9UA 3X1DA 3SWHA 4LERA 2W45A 3RF3A 4H9NC 2LM9A 1N33T 3GEIA 1SE7A 2VL8A 4QKNA 4KNVA 4WW0A 3AEBA 1LVKA 3TD7A 4OFZA 4LMLA 2HH7A 3CMLA 5L3VA 4MVMA 3F31A 3SFDA 1NFNA 4JEBA 2LFFA 3FMSA 4YY3T 2OQMA 2XQ6A 5L4EA 3OVUA 2L81A 3ETVA 4CI3B 4D4XA 1Z63A 2BC5A 2XSBA 4ILUA 3NRHA 4D4NA 2WVNA 1FMWA 3PE0A 2WU5A 3O6XA 4G7ZF 2JQQA 2Y6XA 1FMVA 3OJAA 2H88A 2ZXOA 3KL4A 4Q25A 4FESA 4A56A 1YJGA 3AE8A 4JI3T 3RIAA 1VCTA 3N9QA 2GA0A 3C8GB 3ZKRA 2QGSA 1T98A 2NTXA 1LS4A 2WB7A 3HKCE 2JQKA 3OBVE 1ZHXA 3PURA 2I59A 1APCA 1YVIA 3AA0B 3C62A 1D0XA 4LF8T 3NVOA 4JI5T 3C8ZA 4HFIA 4NXNT 4ZI2C 1E2XA 5JREA 2BBHA 3W2WA 4BAYB 4IARA 2R6GF 4HWDA 2WM9A 3ABLC 2BE5F 4YTMA 3AA6B 3GANA 4TWHA 3RC3A 3SZRA 3DMDA 4DBRA 2WZHA 1FTSA 3PUWF 3NYLA 4IB4A 4EAHA 2R7UA 3US6A 3MBGA 1Q0MA 3T1HT 4MVUA 5L0IA 3HKBE 2YEVA 2WZGA 2Y48B 4HKAA 4PFOA 3M4BA 1ZHYA 2KMFA 2JJ9A 5DQZA 1M62A 4O79A 3RQEA 2XQ7A 5AQUB 2YL3A 1NZEA 3B9QA 2HN2A 2CLYB 3KBUA 2P6VA 5COFA 3JZ0A 3LEOA 3Q7GA 4I44A 4G78A 1ZEEA 1YARO 3NZQA 2Q3TA 3SXKA 2V7IA 3OWTA 2XSAA 1TFKB 2QRXA 1MIYA 3AAEB 4ILBA 3K66A 5HXHA 2CYDA 3ZG1A 4XLNF 1PD0A 4B6XA 2AVKA 1KEYA 2E9XD 2NR4A 2XAFB 3V5ZA 2XLVA 2YL1A 4AL0A 1A41A 4FJOA 2MWQA 1MNEA 3AXJB 3U2MA 3B71A 4IT4A 2BG9C 2UUIA 2I0MA 1JNZA 3WODF 2OKUA 1JNRA 2LSKA 5F28E 2JPFA 3HTKC 3K8PC 3L3PA 4A5XA 3U3FA 3WAKA 3SXMA 5AQVB 3U8PA 2XSEA 4LF5T 4JBWF 1HR0T 1WYCA 3KMIA 4O4HE 1XWJA 2IXPA 4FWVA 1VCSA 2DI3A 256BA 4CJGA 4ADZA 1T6QA 4DV6T 3TKLB 1C03A 2EIKC 2XJ7A 4JURI 2HHHT 3ZYMA 2KW3C 4U5DE 3ZMUB 4YTPA 3KBTA 3ZJ2A 1V54C 3RH3A 1QKRA 5JUAA 2GWWA 1D1BA 1D1CA 1AEPA 1LS1A 4JTCB 2LSGA 3IF8B 4FI5A 1GQAA 1TWAA 2HS5A 3P4WA 2Q9QB 5KMGP 1WTYA 4YWQA 4KUMB 2HPLA 4P09A 1TR2A 3CZ6A 1US7B 3HNJA 5COMA 2D5RB 4IJJA 4PK4A 3ZC0A 1QUUA 5F5FA 2YHSA 3G50A 1VK5A 5FZTA 3GWNA 1D0ZA 4BJ6A 1LI7A 4U5FE 3E08A 1Q0FA 4JRZA 3UUMA 3U9MA 4LDRA 4B3RT 2E9XB 4TNVA 1KNYA 1XNQT 2BVMA 1M2VB 1ORSC 2YL7A 4U74A 1M57C 4LLEA 3N5LA 2LE8A 2W63A 2BBJA 3O1IA 3JYYA 4U72A 1VLTA 5FXWA 1C17M 3AE3A 2XLHA 4CJOA 1WRDA 4XEKA 4ZZCA 1K05A 4XZCA 3G4ZA 3AB3B 3C50A 1V9DA 4ILAA 3QW1A 2ZD9A 2R03A 3ZDLA 4DRHB 1UGOA 3AA1B 4DUZT 4H9RC 4IDPA 2KZ7B 2ZMAA 3L8JA 2EPOA 4X1YE 2ACZA 1MIWA 3QOFA 1HNWT 2MBGA 2YU2A 4AXPA 4JJGA 5L4HA 2LHRA 2HJMA 3RKOA 1VYKA 2XLEA 2E9XA 2DL1A 2P61A 2CCYA 3TJ5A 4YT2A 3RYLA 1WWPA 2JD3A 5JDLA 1HX1B 1GS9A 1M7KA 5EK4A 3FOOA 1SYQA 1J5WA 1YA7O 5L3EB 2PFDA 2IIUA 5HEHA 1OW8A 3R84B 2Q4FA 2E8IA 1SR2A 2XQ3A 5JR9A 5LBMA 2A6HF 4LMKA 2IXOA 2Q7RA 2K5BB 3R6NA 2PX3A 5JTGA 3HJCA 4PNIA 4XBFB 4DVDA 5JSLA 1NU9C 5LGTB 4LFBT 2M64A 2CXDA 2NUPB 3EFOA 1T01A 3EVYA 2WAUA 5JLIA 3AE7A 4O4IE 4JTAB 1IBMT 3DJBA 3CIRA 3T4RA 2EIJC 4JJFA 4OYKA 4TNWA 2WDVA 5HEGA 4HFBA 4K0KT 1XDPA 3B0PA 2XHEB 1EA8A 5L0DA 1NBBA 1NSGB 2OCCC 4XAXB 4LF7T 2FJDA 3GMIA 5FNVE 3RRCA 4HFCA 4HEAJ 2SPCA 1Y6DA 2Q00A 1SHZC 2XS1A 3H3MA 1TQGA 3CQXC 4HFFB 5KYXA 4LFAT 4DRJB 2PFVA 4TN7B 2L6FA 4PK5A 1UX5A 2YKSA 4YSZA 4OINF 5AC4A 3WAJA 2JMKA 3WAQA 3QB5K 2OA5A 3EAMA 4EYUA 4MW8A 3PV0F 1MIVA 3VAYA 5E2QA 4JUYA 1GQEA 2KXPB 3JC6D 2HUJA 3O4XE 1G8XA 4YT0A 1WASA 4LF6T 4Z91A 4MTFA 3ANWA 3CWZB 3GM2A 3ZQYA 4KI2A 1XZYA 3DE9A 4P9FA 1V55C 3L34A 2V26A 1EZ3A 4JI2T 2WU2A 5B1AC 3SRZA 1XMOT 3W8HA 4ZLCA 2VKDA 4AI6A 2OEXA 2P7VA 5BQGA 1IBKT 3DZAA 3RKOF 4JI6T 4NQFA 3M4CA 1Q0DA 1M6TA 2R7WA 4QXCB 3VKGA 4HFEA 3AE4A 5J1GA 2CHOA 3ONJA 4XPWA 4DR6T 5F3JA 2R02A 4PACA 2LP4A 3A5XA 1OKKA 1HY5A 4AKRB 2UXBT 5L0GA 3SS1A 2LLYA 4GYSA 4XEVA 3EZIA 4MS2A 3S84A 2B76A 3MKDA 1NEKA 4WGZA 2Q9AA 3W2VA 4BJ6C 4CBEA 1QLEC 5HCMA 5JR9C 2E87A 3AE1A 1NFOA 2M6BA 5AQTB 2QUPA 5FXXA 1HF8A 2PBEA 5DS6A 2IXNA 1PCXA 4PJJA 3FOPA 3PUXF 3S27A 5CFBA 5EZYE 3ASOC 3P7IA 3F2EA 3EDVA 1BR2A 4QXHB 1L3PA 1N34T 1QPUA 5L3FB 4YJWA 4BEMJ 2EPNA 4JI0T 4CI2B 1HW1A 1OEDC 3N24A 2XS8A 4KBMB 3MXZA 2D9DA 4DV7T 2LHNA 2P0NA 1CGOA 2X0HA 4XPYA 1D0YA 2YOEA 2EPLX 1XZQA 5CGMA 3F46A 3B13A 5EHHA 3FAJA 1A7DA 2EPMX 2L6GA 1E7PA 3ZN1B 4H4KC 4JZAA 5KX5E 2UXXB 3NRXA 1LIHA 2J9WA 3U8VA 3ABVA 2BG9E 3MX3A 4MLKA 2RPAA 4CN4A 3DD7A 1U89A 4N78D 2J9BA 2MAWA 4JI1T 4HWCA 3C8GA 5T3WA 3IEEA 4IGGA 2JRKA 1FIOA 4KMCA 3RQUA 3JRMO 3K7DA 4QHOA 4BJNA 3Q7LA 4DV3T 4G0HA 3W15B 1S35A 5T1DB 2Y3GA 3JADA 2V6YA 4BA9A 5L0HA 2Z15A 3EGXA 2E9XC 2EIMC 1YYXA 2A72A 3U78A 3LDQB 1A0BA 1QSDA 3VRAA 2C5KT 4E7ZA 2X9XA 5LGUB 1JPJA 4N4WA 3J06A 3EH2A 2CA5A 3RLFF 5LYJE 4QH5A 1MQVA 3ZIBA 1HE1A 3Q9DA 4IDOA 3S0XA 4PR9A 4FAPB 4J30B 4BJ5C 4AQFA 4AIUA 3TULA 1LRZA 1TWGA 1CGME 4AE4B 3U3BA 2J45A 3RF1A 2MOZA 3LLIA 2D4UA 1TWHA 1YXRA 4IDNA 1YW0A 2BG9B 2C5JA 3OYZA 2J9VA 4ZS3A 4P1NA 3KYJA 2A0UA 3AJMA 3LK2B 4LFCT 4YSXA 5ABEA 1U6HA 3GN5A 3LUTB 3KV9A 1YD8G 2OOCA 2YLDA 1J5ET 4MQ9F 3VF0A 1CUNA 4QI0A 3I0QA 2W4XA 3E0ZA 1KNZA 3C4XA 3QK6A 3C51A 1T9KA 2KQ9A 3LNMB 1CPQA 3ZMVB 3GODA 2H7VC 1E84A 2XXAA 4I0UA 2UUCT 4W8PA 1LPEA 2NG1A 4E0IA 2ACXA 1VMAA 1YQ3A 2VWAA 4IIJE 2XL6A 3TLVA 2I8BA 3T8OA 2HZ8A 2PP4A 4IREA 4CS8A 1GM5A 1Z3IX 3HLZA 1WN0A 3I5PA 1A7VA 4EBKA 1OCOC 5F5WA 1K04A 1T6UA 2VH3A 3UU5A 5HXEA 3WHNA 4ZI3D 1YAUO 5HWYA 5FY7A 1HCIA 4DUYT 4X1IE 3K6BA 3Q6NA 2B0HA 2C03A 3QMKA 4LF4T 1FFHA 2F4VT 3E22E 4KHZF 3C64A 1OKKD 1ZHTA 4Z90A 4WJ0A 1SZIA 2LOPA 1KNRA 2IC6A 2W9YA 1R5ID 3SXZA 4EBJA 1DU2A 2W62A 3WG7C 5JDNA 4GK5E 5LJMA 1DOVA 4I43B 4LACB 3ZEFB 1ZZPA 4NTAA 2WP9A 1LE2A 5JQGE 5F5HA 3LJCA 4WBOA 1T8BA 5LBQB 1KF6A 3UU3A 2X9HA 3RIPA 4OD5A 3S90A 1V74B 5T3TA 1NWMX 5JDMA 2V5DA 1HG5A 1I94T 4XQ1A 5JVDE 2VURA 3BEHA 2EHOA 3PUGA 4U7IA 4QX7B 4AKGA 4GOUA 4UV8B 5L3CB 4U9EA 2V1DB 3A7MA 2IMLA 2FGYA 2LK4A 2X0CA 3FBLA 5FL0A 3P50A 1MMGA 2WB5A 1J8MF 2M6IA 4YSYA 5IY5C 2DCFA 1PV3A 4Q5SF 3R2PA 2UXDT 3EUHA 2FJEA 5AQJB 2CBJA 4H9QC 2YEVC 3NMIA 4GYTA 2CMRA 2NWBA 4IL9A 2E5LT 3GWHA 4X20E 4OHFA 1RJ9B 5DS5A 2JQ9A 1BBHA 4CXXA 2V6YB 4EYYR 5LMUT 2R9RB 2X66A 4L0RA 4O6YA 3DXJF 2WQYA 2C5IT 2ETSA 5AQFB 3AG2C 4DR7T 2KLQA 3TLTA 2XQ4A 2QA7A 5C2TA 2VCAA 5E33A 2IOQA 4KNWA 3AGUA 3ESLA 4IRUA 2HKVA 2UXNB 2LRKA 3ZTZA 1FJGT 3RC8A 3ZT7A 5A6BA 2VCBA 4ASKA 3QC9A 2LSYA 3N9PA 4J2CA 2DWGA 1KU2A 4ZHQE 2RP4A 5CIVA 4CQIA 4ZEYA 4BG0A 3B5MA 2X0YA 4O4JE 4OIRF 2XRHA 2Y8DA 4DVYP 4MBQA 3ZQVA 5FCLA 1SF8A 2HPJA 1YLMA 3AE2A 3M3ZB 2P1AA 5DQTA 2N9DA 4UXNB 1ZKEA 1H7CA 1BZ4A 5KDMC 3M15A 3TOLA 2OLTA 2LSEA 2DLRA 3N9MA 3M79A 5LGNB 2YZSA 2YRFA 1OEDA 3I5QA 4DO0A 1J1JA 5L0FA 3KV6A 4TWDA 4LF9T 2CXLA 4QDLA 1PD1A 1KFYA 4GKJT 2BKPA 4MALA 1SUMB 5AQNB 4BJMA 5FXVA 3NMKA 3LEVA 4EIYA 2FUPA 3ZN0B 3LBXB 1OQCA 3X2QC 3KDSE 3ONLC 2VQFT 4P9TA 5JS5A 3A9CA 3K33A 3CX8B 4PAGA 4OD4A 4X65T 5KYNA 2JIWA 4W8KA 3S29A 5IUXA 2HSBA 3I9WA 1IBLT 2QLAA 2XLDA 4UF0A 4MVZA 3UQ7A 3VRCA 1K40A 4G2AA 3RVYA 4CS9C 1X79A 5ABFB 3AEAA 1N32T 5A6KA 3DWWA 3TQOA 1RMVA 2BZBA 2Q9BA 4OYJA 3UNGC 2J0WA 2PBIA 3U5SA 1VYIA 1N36T 2WZFA 3LK42 1Z5ZA 2EPKX 1ZW2A 3L39A 2D2SA 4ZOLE 5EGYA 3AXJA 1VRBA 2AWCA 2R7TA 3X1OA 4DRIB 3HA4A 2RD9A 2JX0A 3V5XA 3EH1A 2Y3DA 2H3RA 3AEDA 3RGLA 1ST6A 1OCCC 1EI7A 2KNHA 2NW8A 2WDQA 2W00A 4AQFC 2EINC 1LE4A 4R32A 4O8SA 3R7CA 1W2WA 2LIGA 3B0UX 2AXDS 2UUBT 4EIWA 2KT9A 3BQLA 2XUEA 2ZXPA 5A69A 4ZI2D 5LXTE 4N06A 2Q9QC 4UDVA 3EHZA 3ETUA 3RYCE 4AX2A 2JQHA 3PMRA 5A1LA 1UCUA 3H3AA 5CA0E 3ZTMA 2OG2A 3H2VA 3I9YA 2Y3BA 3NYMA 3LS1A 1I5NA 1U5PA 3ZMZB 2DWKA 3DAGA 3GM1A 1L0VA 1FFTC 4MVSA 2WSSV 2XPKA 1VLSA 2A3DA 2YDRA 2EHOB 3O1HA 3GORA 5LHHB 1NLXA 2HJ3A 4C3BA 1RJ9A 2AWYA 3UGOA 3JAEA 3AG1C 3FXHA 4UVAB 1QQ3A 3RQWA 4MVQA 1R4TA 2XLMA 3C4ZA 2ICWG 5CJ5A 2X68A 1TKNA 2N1GA 2XQ8A 2HMQA 3FVYA 3IHRA 5FVKA 1ZU4A 4PK6A 3B0VC 1DOWA 2JMHA 3NKEA 2O9XA 3AAAB 4EB6E 1W0AA 3PDMP 4DR4T 2UXCT 2TMVP 3AVSA 5ETWA 4E0HA 3KYIA 3KPHA 2J0XA 3OTOT 3ZCJA 5JVEA 3H37A 4MVRA 3JSEO 1MMDA 3KV5A 1C02A 2V3CC 2LM2A 3UTKA 2YDSA 1YYJA 2KC3A 3DM5A 1AUEA 3RYIE 3V5YA 4NUVA 2J8WA 2KWIB 3FZKB 3OEOA 2QYWA 3CQCB 5HYAA 1YKEB 3ABMC 3RYFE 1Z0PA 4ER9A 5AQPB 1IAPA 3UFGA 4DV4T 4Q7CA 3V7OA 2FAPB 1J8YF 3J9X1 4QXBB 3RIUC 2GFHA 2WY2A 3C63A 4Z9JA 1Z7Qc 1WR6A 2IBFA 2M4EA 5EK2A 4YT4A 1OR2A 2CGEA 1Z23A 5JRAA 4I55E 4HFHA 3MJXA 3HKKA 4WNKA 3K1IA 5KYWA 1HNZT 5JRCA 5KXJA 5HV9A 3ZSTA 4O6NA 3C98B 3FAPB 2VKOA 1KTMA 4JCZA 4B6IA 5DABA 1S05A 4DR5T 5LA6E 2LSJA 4A4AA 2KINB 4H63V 4F4BA 4CSAA 3QZCA 3U9JA 3CSKA 4OX9T 3K1HA 1JPNA 3P4PA 4CDYA 4P0BA 2CRBA 4U2ZA 2D0UA 2GAQA 2KSRA 4EOZB 5KYYA 1O5HA 1BR4A 1OCZC 2PNOA 4NY3A 4IL4A 1G5ZA 1AVOB 5HEOA 2XAQB 4JI8T 1UUSA 2KGOA 4UV9B 3AEFA 3LESA 5CB4E 2D0TA 3LJBA 4DIDB 3JTLO 3MYFA 5BQHA 3DP7A 1BDJB 2UUHA 5HXSA 2NUPA 3ZCIA 1RKCA 3EFOB 3Q5EA 4N6HA 1MMAA 1TWCA 3TLUA 1ZU5A 2RSEB 2H7BA 3EG9B 3PUAA 1I4YA 2L9JA 3F57A 5CA1E 3PUSA 2DYSC 3TK0A 2X0LB 3VHLA 4ZLDA 4EXTA 4A2NB 4IDQA 4ZZBA 5HWXA 2IC9A 2IDOB 3AE5A 2R7XA 3JC6C 4NPPA 4GEHA 3O10A 4EEBA 4JVSA 4YHHT 2IUBA 3ANWB 5AQGB 4MHCA 2KK1A 1T7SA 4YN0B 2CXFA 5L3GB 3W4YA 3W8IA 1KK7A 5DVWA 4QH4A 4CSAC 3RVZA 5HXRA 4EWCA 3Q6MA 1MMNA 3A8YC 1JRAA 5H6QB 1ZHZA 3N9NA 4G63A 4FX5A 2CCQA 4CX9A 1E86A 4C7OB 4RDAA 3I4UA 3EJNA 3MA9A 4YL0A 5DJQC 5IHYA 2IHR1 2XQ5A 4U3CA 4MTOA 2XL8A 3SYNA 4U5CE 2CWOA 2J62A 3PUQA 3Q5XA 1N1CA 3IQ6A 2X67A 4TX5A 3K1IC 5J0ZA 5ABGA 3QVYA 5FP3A 4K7BA 2XAHB 2XQAA 3ZC1A 4CDAA 3ZT5A 2NUTB 4PFPA 3U2LA 3RX6A 4KX6A 4TZ4C 3H65A 1UK5A 2VB6A 4NTBA 3TJ6A 3ONXA 2E5VA 3PU3A 2LEHA 2NP9A 2ZLYA 2M67A 3BQIA 2LOSA 3O9XA 1WFDA 3PUVF 5ABHA 2EHOD 2QTVA 2DNXA 1QLBA 2X9WA 5JDHA 4HTEA 1ORYA 4UEMA 2VKHA 1FNTc 4ZI3C 5HEJA 2Q9CA 4C3EA 3DAFA 2A6EF 4HE8A 5AQSB 2YLIA 2ASRA 2E2AA 2CLYC 1JMWA 3E9VA 1RXQA 3EGXB 1H6GA 2KNDA 1IW7F 5A6JA 2BKNA 5LB7B 3NDBB 4C90A 4GK0E 2Y69C 4MFRA 1E85A 2FFHA 3U0CA 5ADXL 3JAFA 4H9PC 2XTLA 4QI2A 5HCJA 4DV5T 4DBQA 3L09A 3UUXB 4X62T 2ZXWC 1RKEB 2YQYA 2W66A 2MHRA 3LSVA 2QE9A 2H7OA 1OR3A 2XM2A 3B57A 3RI5A 3HNIA 4AE4A 5AQIB 5KYYB 5JRCB 5M4YA 4JI7T 3KFWX 3VRBA 2L9QA 1O3XA 2XLWA 4NUUA 3VR9A 3VKHA 2WMOA 2L7AA 2WZLA 5CI8A 4O4LE 5L47A 1LVFA 3HI2A 2LKHA 2WS3A 5JDFA 2LCHA 5AQRB 4EUKB 4HWFA 2VK9A 2ODUA 4L5GA 2WZIA 4O2BE 4DR1T 4P0AA 2G0UA 3AAIA 1SMYF 1G4US 4CN6A 4XTKA 3EHMA 4GYRA 4IE4A 5FXZA 1KNPA 4Z9IA 3ABKC 1EKYA 1RCPA 4AK9A 2GK9A 2QVAA 4U7YA 3EDUA 4XEFA 4RBNA 2J9UA 5FKYA 3EI0A 5LNKA 3LS0A 3GWLA 5ABFA 3EG9A 4JIOA 2YINA 5FY1A 2VVSA 2XL4A 4JLEA 4M1PA 2XXAB 3FB2A 2LSIA 1GGQA 5FY0A 2XM0A 5FL1A 4O6MA 3DKAA 4YXDA 2R05A 2Q9QD 2LJLA 1H9GA 2G3VA 5FVLA 5B3IA 4O2AE 3IBPA 3TLSA 5DQWA 3ZSSA 2OEVA 5BQIA 5L3QA 3OPCA 4YJ3E 4CDVA 1T6IA 3VR8A 5COGA 3FXDB 4ISSA 2LQGA 1Z8UA 4JEAA 3UU8A 3RW0A 3UU6A 3FXEB 1M56C 2NOXA 5F8PA 3FZFB 3G06A 3CPZA 4U5EE 4U2YA 4WZXA 4ZI7E 4F6RC 4N6CA 5LJNA 4J32B 2BS4A 3EQLF 4DR3T 1VTMP 3V5UA 2L8KA 5C3JA
chains in the Genus database with same CATH topology
3GMIA 2ZM8A 3RRCA 2BZBA 4AKHA 2A69F 4OYJA 2Q9BA 4L9IA 3CQZA 2A1DD 3ZC4A 4EZ4A 3UNGC 2J0WA 5JDQA 2PBIA 2SPCA 3FHDA 4HEAJ 4P6IC 1SHZC 1VYIA 2WZFA 3ITFA 2WL8A 3CX6B 3LK42 5JH7E 5L3DB 3CQXC 1Z5ZA 1WYBA 3LAYA 4H9SE 5CI9A 4HFFB 5KYXA 3HKEE 3UULA 3UGPA 5E0OA 2D2SA 2PFVA 3GA8A 4ZOLE 4PJMA 2V7JA 3ZJ1A 5EGYA 4TN7B 1VRBA 4PK5A 3NG1A 1UX5A 2MYSA 3X1OA 2R7TA 3FBZA 3HA4A 3N2OA 1IZMA 2LT3A 4CS9A 4OINF 2KJGA 3EH1A 2Y3DA 2H3RA 3LNRA 3WAJA 2JMKA 3VYWA 1ST6A 2OA5A 5LCYA 3PDYA 1OCCC 4EYUA 2KNHA 4CXWA 5KYXB 4G7OF 1MIVA 4LLCA 3VAYA 2NW8A 3DM9B 4JUYA 2W00A 4AQFC 2EINC 3NYJA 3DJNB 5E2QA 2KXPB 3JC6D 3AVRA 4O8SA 3O4XE 4HFKB 1W2WA 1G8XA 3N2KE 3B0UX 3ZVRA 5BUOA 1VOMA 3ANWA 3CWZB 3LFMA 4JEUB 4I1OB 4EIWA 2KT9A 3BQLA 2XUEA 2ZXPA 4QWNB 3I1AA 5HAXA 3SOLA 4YJ2E 4ZI2D 5LXTE 4N06A 1U4QA 2Q9QC 4HEAA 4KI2A 4JW1A 5L2LA 3MK7C 3ETUA 1V55C 3L34A 2V26A 3RYCE 4AX2A 3SEOA 5E3AA 2B0JA 1EZ3A 4DMVA 3K3NA 5A1LA 1UCUA 5JDGA 3H3AA 5CA0E 2BDEA 3PMRA 2X9YA 3RRWA 3SRZA 2OG2A 3I9YA 2VKDA 5B1AC 3W8HA 4ZLCA 2Y3BA 3POVA 4AI6A 2C04A 2EILC 2P7VA 5H6RB 1S7ZA 2PF4E 1D1AA 3DZAA 4DNDA 3LS1A 1U5PA 3NYMA 4JVSA 3ZMZB 2DWKA 4TV9E 3DAGA 4IE0A 3RKOF 1FFTC 2DHRA 2PX0A 3JRTA 2WSSV 2IXMA 4ANJA 3S28A 2A3DA 3SNHA 4C3DA 2EHOB 4KP3C 3O1HA 1HFAA 2W4BA 2ODVA 1ZV4X 4QXCB 2CNWD 4O7GA 5LHHB 2R7WA 2DYRC 2YK0A 3WI3A 3VKGA 1WLXA 3BQKA 1RJ9A 2VASA 1HX8A 5J1GA 3AG4C 4I4TE 3NKDA 4ULWA 4ERRA 3S4UA 3U3IA 4AKIA 5EK3A 3UUNA 3EGDA 5DQVA 1NG1A 3OA1A 3UGOA 4DOZA 1IZNB 1OXZA 5F3JA 3AG1C 5GONE 3A5XA 1MNDA 4UVAB 1G73A 5FYMA 1OKKA 4X0RA 3JCUQ 3C4ZA 3KV4A 4AKRB 2X68A 3O39A 4IE7A 1ZYRF 1TKNA 3SS1A 4GYSA 2N1GA 2R7VA 3EZIA 3FVYA 3KINB 3KVBA 2KWHA 3IHRA 4PW8A 4RD9A 3MKDA 3W2VA 4KBLA 2CNWA 2Q9AA 4BJ6C 2QY9A 4CBEA 1ZU4A 4PK6A 1QLEC 3MACA 3B0VC 2JMHA 5JR9C 2E87A 5LHIB 3M1CB 3NKEA 2O9XA 3HKDE 5FXXA 3AAAB 1HF8A 4EB6E 5DS6A 2IXNA 4U5GA 1PCXA 5KYWB 4V1Av 3D0TA 3AVSA 4PJJA 5ETWA 2PG8A 2J0XA 3S27A 3ZCJA 1IJ5A 4IAOA 3ABLC 3H37A 3ZMTB 3ECSA 5EZYE 3ASOC 2XAGB 1MMDA 3N9LA 2WVOA 2DGJA 3KV5A 3P7IA 2V3CC 4AKLA 1YKHB 2G3KA 4XLPF 3F2EA 3UTKA 3O1JA 1UX4A 3EDVA 4UIGA 4Z8XA 4C91A 1BR2A 4YWQA 4QXHB 3DM5A 3ZYKA 5L3FB 4YJWA 3RYIE 4BJ5A 4CI1B 3CZ6A 4NUVA 2W0GA 4CI2B 2KWIB 3OEOA 3N24A 3JSZA 4KBMB 4I3MA 3MXZA 3CQCB 5HYAA 1YKEB 3ABMC 3N9OA 2LHNA 3RYFE 5D91A 1Z0PA 4IGUA 1AJ3A 1BR0A 3SWHA 1IAPA 1Y64B 2CW0F 1LKXA 2NTYA 4LERA 4Q7CA 2W45A 3V7OA 2NW7A 1D0YA 4H9NC 1SA0E 2LM9A 4QXBB 3J9X1 1J8YF 3L0IA 3F46A 3B13A 2VL8A 4QKNA 4UELA 2GFHA 3FAJA 4WW0A 4KNVA 1LVKA 3UMHA 5EHHA 3ZN1B 1OCRC 4H4KC 4OFZA 4E7SA 2L3LA 5KX5E 2UXXB 3NRXA 2J9WA 1WR6A 4JZAA 4XWJA 2HH7A 3CMLA 2C0SA 5EK2A 2M4EA 4YT4A 5L3VA 2R7SA 3KVAA 3E70C 3KKBA 2B1EA 2CGEA 1Z23A 4I55E 3MX3A 3F31A 3MJXA 4MLKA 4FESA 4WNKA 5KYWA 5JRCA 3DD7A 4O6NA 3NBXX 3AQCA 2YU1A 3C98B 3M65A 2DI4A 4N78D 3VU7H 2W4MA 4GIWA 3UT5E 2VKOA 2L81A 3ETVA 4CI3B 5T3WA 3IEEA 5JR9B 1Z63A 4ILUA 2ZXRA 3NRHA 3PHF2 4B6IA 2WVNA 2JRKA 1FIOA 1FMWA 3PE0A 4KMCA 3O6XA 3DJUB 4G7ZF 2J7PA 4OIOF 5DABA 2JQQA 2Y6XA 1FMVA 3F47A 3OJAA 2ZXOA 3KL4A 5LOVE 3K7DA 4QHOA 3OYXA 5LA6E 2LSJA 4BJNA 2D5UA 2KINB 2WMNA 4H63V 3RYHE 3W15B 4A56A 3EZHA 3Q7LA 3QZCA 4G0HA 3CSKA 4G7HF 3K1HA 1JPNA 1S35A 3ZLIA 5T1DB 3N9QA 2PJQA 2Y3GA 2QGSA 4P0BA 3ZPOA 1T98A 4BA9A 2D0UA 2NTXA 2K48A 2WB7A 2Z15A 2NUTA 4CIHA 4EOZB 5KYYA 3EGXA 2E9XC 3HKCE 1O5HA 3OBVE 1ZHXA 2EIMC 2A72A 2XQYA 3PURA 3U78A 2I59A 4K0DA 1BR4A 3Q5WA 1QSDA 4E7ZA 2C5KT 3K3OA 2X9XA 5LGUB 1JPJA 1M2VA 1OCZC 4NY3A 4EZHA 3EH2A 5LHGB 2CA5A 2XAQB 3EGDB 3AA0B 4K0UA 5LYJE 2KGOA 4UV9B 3LESA 5CB4E 3ZIBA 2D0TA 3LJBA 4U5HA 2VKJA 3Q9DA 1D0XA 3DP7A 3S0XA 4J30B 5HXSA 3CKDA 3ZCIA 4ZI2C 2NUPA 3EFOB 4BJ5C 4AQFA 1MMAA 5JREA 1TWCA 1ZU5A 2H7BA 3UMIA 3W2WA 4BAYB 1LRZA 3EG9B 3PUAA 1TWGA 2L9JA 2WM9A 3F57A 3GN5B 5CA1E 4UVCB 5L3BB 3PUSA 1FEWA 3CX7B 2BE5F 4AE4B 2DYSC 2J45A 2X0LB 4DVZA 3AA6B 2MOZA 4Q4ZF 3VHLA 3GANA 3RC3A 3LLIA 3SZRA 4OIQF 4ZLDA 3DMDA 1TWHA 4UF0B 4DBRA 4EXTA 3C4WA 3T6BA 4A2NB 2ZPAA 4CS7A 1FTSA 5HWXA 1YW0A 1Z6AA 3NYLA 2IC9A 3ZSUA 2C5JA 3OYZA 3I0OA 4ZS3A 4EAHA 2J9VA 3JC6C 4QX8B 2R7XA 4GEHA 2R7UA 3LK2B 4IWBA 3ZYLA 3GN5A 4UVBB 3MLGA 3KV9A 3HKBE 1YD8G 2CEAA 2K24A 1WGWA 2WZGA 2YEVA 3ANWB 4PJLA 4KC9A 4MHCA 2Y48B 4HKAA 1CUNA 4PFOA 4MQ9F 4QI0A 1ZHYA 4YN0B 2CXFA 2KMFA 5L3GB 3LBXA 3KH2A 3I0QA 3E0ZA 1KK7A 3C4XA 1KNZA 3QK6A 3EHNA 2JJ9A 5DVWA 3W8IA 3C51A 5DLJA 5DQZA 4CSAC 5B3SC 2KQ9A 4O79A 2A68F 5HXRA 3J7Yq 4EWCA 4OIPF 3ZMVB 3Q6MA 3GODA 1MMNA 3AA7B 5H6QB 1NZEA 2H7VC 3B9QA 2XXAA 1ZHZA 3N9NA 4G63A 4FX5A 2CLYB 3KBUA 5B1BC 2CCQA 2J46A 2P6VA 4C7OB 4RDAA 3I4UA 3EJNA 3MA9A 5D92A 4WBNE 2NG1A 3Q7GA 2ZM2A 5DJQC 4I44A 2ACXA 3CQGB 5IHYA 1VMAA 1ZEEA 2VWAA 4IIJE 3NZQA 4YLHA 2IYLD 2I8BA 3SYNA 2Q3TA 2N2NA 2V7IA 4U5CE 3T8OA 2PP4A 3OWTA 2CWOA 3PUQA 3Q5XA 1N1CA 3AAEB 1MIYA 2X67A 4TX5A 3K1IC 4HE8D 1Z3IX 3K66A 5FP3A 3HLZA 3N2ZB 4CS8A 4K7BA 2XAHB 2V7KA 3ZC1A 5HXHA 3AG3C 3I5PA 3ZG1A 1OCOC 5FMNA 4XLNF 1PD0A 4B6XA 5AFUL 2NUTB 4PFPA 3RX6A 2E9XD 2HV7A 3MZKB 2VH3A 2XAFB 4HGAA 5HXEA 2J1DG 4TZ4C 4ZI3D 4FJOA 2VB6A 3H65A 3JYHA 3ONXA 5HWYA 5FY7A 2MWQA 1MNEA 1HCIA 3TD7A 3PU3A 3UMKA 4X1IE 3K6BA 3Q6NA 3SP1A 1HG2A 2LEHA 2NP9A 2A2FX 2C03A 2ZLYA 2M67A 3BQIA 3QMKA 2IW5B 3V5SA 2LOSA 3O9XA 3E22E 1FFHA 3C64A 2R7RA 3WODF 4HN9A 2EHOD 4ISTA 2LSKA 2QTVA 2DNXA 2JPFA 1OKKD 1ZHTA 3K8PC 2X9WA 5JDHA 3L3PA 4IDZA 3HTKC 4WJ0A 4HTEA 4CSAA 1SZIA 3WAKA 4F4BA 2LOPA 4UEMA 1B7TA 2IC6A 2VKHA 1OWAA 2W9YA 2XSEA 1WYCA 3JT1A 2HV6A 3OKQA 4ZI3C 3KMIA 2Q9CA 2V7MA 4O4HE 2J7PD 2W62A 4C3EA 3N0TA 2EHOC 4YHJA 3WG7C 2IXPA 3AQBA 5JDNA 4FWVA 3DAFA 4GK5E 4BJ1A 5LJMA 1M2OA 2A6EF 4HE8A 1O87A 4I43B 4ADZA 2V7LA 2CLYC 3P8CD 4LACB 4YFSA 3E9VA 3TKLB 3ZMSB 3LK3B 3ZEFB 4CXYA 2EIKC 3EGXB 2Z6EA 4JURI 2XAJB 2KNDA 3ZYMA 1IW7F 2KW3C 5BMVE 3ZMUB 5JQGE 4U5DE 3NDBB 5F5HA 3LJCA 3KBTA 4C90A 4WBOA 3ZJ2A 3RH3A 1V54C 4GK0E 5LBQB 2Y69C 4MNDA 4MFRA 1D1BA 1D1CA 4H9OC 2X9HA 4X1KE 1LS1A 2FFHA 2LSGA 3IF8B 4FI5A 5ADXL 2R7OA 1TWAA 4OD5A 4H9PC 4BJTA 2XTLA 4QI2A 5T3TA 1NWMX 2Q9QB 3HR0A 5KMGP 5JDMA 3NZPA 2HPLA 4KUMB 1HG5A 4P09A 3L09A 4DBQA 1US7B 1TR2A 3UUXB 5JVDE 1ZHCA 2D5RB 3EPVA 4IJJA 2EHOA 1S94A 3PUGA 4PK4A 1QUUA 3ZC0A 2ZXWC 5F5FA 4I1MA 2YHSA 4QX7B 4C3BA 3RPUA 2NW9A 2H7OA 1VK5A 3B57A 4BJ6A 1D0ZA 4AKGA 4GOUA 4UV8B 5L3CB 4U5FE 4AE4A 5KYYB 2V1DB 3E08A 4DMWA 3UFEA 2FGYA 4JCHA 3FBLA 5JRCB 4M63A 5M4YA 3UUMA 3KFWX 1MMGA 2L9QA 1O3XA 3NRYA 1J8MF 2E9XB 4NUUA 5IY5C 2BVMA 1M2VB 3VKHA 2DCFA 4U74A 4Q5SF 1M57C 2WMOA 4LLEA 3EUHA 3N5LA 5C8YE 4AQGA 2LE8A 2CDQA 2WZLA 2W63A 3O1IA 5CI8A 4U72A 3PU8A 2P9BA 4H9QC 4O4LE 5FXWA 1LVFA 3HI2A 2YEVC 4HFVA 3RFYA 5JDFA 3QUJA 5J2TE 4GYTA 2CMRA 1WRDA 2NWBA 1ZHWA 2VK9A 3GWHA 2ODUA 4L5GA 4X20E 4OHFA 4XZCA 1RJ9B 2WVQA 5DS5A 4O2BE 4CXXA 4EYYR 2CM0A 4P0AA 2X66A 4L0RA 3AB3B 3C50A 4O6YA 2G0UA 1V9DA 3AAIA 1SMYF 3DXJF 2ZM0A 5DS4A 2C5IT 3AG2C 2KLQA 4XTKA 5LG4A 2CWYA 1HTJF 3EHMA 1NU7D 4GYRA 3ASNC 2QA7A 3AA1B 4IE4A 5FXZA 5E33A 2IOQA 4KNWA 3ESLA 4H9RC 2Y39A 4IRUA 2KZ7B 2UXNB 2ZMAA 3ABKC 4H63H 3RC8A 4X1YE 3FDQA 4AK9A 2WBLA 1QZXA 1MIWA 4ASKA 2ES0A 2GK9A 3QC9A 1IJ6A 2YU2A 2MBGA 2LSYA 3EDUA 3N9PA 2DWGA 4J2CA 1KU2A 4RBNA 4ZHQE 2IAKA 4AXPA 2J9UA 2R7QA 2RP4A 4PJNA 5J2UE 5LNKA 4JJGA 3BK9A 3LS0A 5E3CA 4CQIA 2LHRA 3EG9A 2YINA 4BG0A 5FY1A 4O4JE 5TAOA 3T6JA 3RKOA 1VYKA 2XL4A 4OK0A 2XRHA 2E9XA 4OIRF 3CVRA 2X51A 4I50E 4JLEA 4M1PA 2Y8DA 2XXAB 3FB2A 4DVYP 3HL6A 3Q2MA 3DTOA 4MBQA 5FCLA 4YT2A 2LSIA 1SF8A 3RYLA 2BVLA 5FY0A 2HPJA 1E1HB 2JD3A 4O6MA 2W61A 4IE6A 5EK4A 5JDLA 5KYUA 5DQTA 2N9DA 4EBBA 5HSWA 2Q9QA 4UXNB 1HS7A 2Q9QD 5L3EB 1ZKEA 2LJLA 1H7CA 5LP6E 2G3VA 2PFDA 5KDMC 4IE5A 3R84B 4O2AE 2LSEA 2DLRA 3IBPA 3N9MA 5KYUB 5LGNB 2E8IA 2YZSA 3I5QA 2A6HF 3FHNA 5JR9A 5LBMA 4DO0A 2Y3HA 4YT5A 5IYZE 2G62A 3KV6A 3LLKA 2IXOA 2XASB 5DQWA 2K5BB 2CXLA 3R6NA 4CZZB 1PD1A 2PX3A 4QDLA 5L3QA 2WWUA 4YJ3E 3HJCA 4PNIA 3UR3C 4DVDA 4XBFB 4MALA 4TV8E 4BJMA 5FXVA 4CS8C 3LEVA 1BR1A 3ZN0B 3FXDB 4ISSA 2CE7A 4IHJE 3LBXB 5LGTB 1NU9C 2CXDA 3X2QC 3PTRB 2RA1A 2NUPB 3EFOA 3KDSE 3EVYA 2WAUA 3K33A 4O4IE 3CX8B 3DJBA 3FXEB 3LG7A 2NOXA 4PAGA 1M56C 4OD4A 2MTQA 5F8PA 4ZS2A 3T4RA 2EIJC 3N2GE 4JJFA 2K9AA 4OYKA 4BEJA 5KYNA 3CPZA 4W8KA 4U5EE 3K3QC 3S29A 4C7OA 4ZI7E 5HXCA 4F6RC 3I9WA 3B0PA 2XHEB 5LJNA 4UF0A 4J32B 1NAFA 4G2AA 4JEHB 2OCCC 3EQLF 4CS9C 4YT8A 4U5BE 4TUYE 1X79A 4XAXB 3V5UA 3RIPA 2L8KA 5FNVE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IEE A;  3RH3 A;  4YJW A; 
#chains in the Genus database with same CATH topology
 4COF A;  4AKH A;  1XNR T;  4L9I A;  2WCA A;  4EZ4 A;  1CHU A;  5JDQ A;  3FHD A;  3O55 A;  2WL8 A;  2XQ9 A;  4JV5 T;  5CI9 A;  2DB4 A;  5AQM B;  3HKE E;  5E0O A;  4DXW A;  2CBI A;  3ZJ1 A;  4PJM A;  2V7J A;  2PTF A;  1L7C A;  1A7E A;  2MYS A;  3P4R A;  2GDC A;  2LT3 A;  4CS9 A;  2KJG A;  3VYW A;  5LCY A;  4G7O F;  4CXW A;  5KYX B;  3RKG A;  4LLC A;  3DM9 B;  3DJN B;  1TFO B;  5AQK B;  4HFK B;  5L0C A;  2V8S V;  3MFN A;  1QSP A;  3ZVR A;  3AEE A;  5BUO A;  4I1O B;  3I1A A;  4YJ2 E;  3ZWI A;  1YQ4 A;  3NWI A;  4JW1 A;  3S9O A;  5GPG B;  1Q0K A;  2AE9 A;  5E3A A;  4U31 A;  2B0J A;  3K3N A;  2BDE A;  3PJA J;  3RRW A;  2NPU A;  2C04 A;  2EIL C;  3FZL B;  1S7Z A;  1D1A A;  2PF4 E;  4DND A;  4DJ9 A;  3EAB A;  4IE0 A;  2FBW A;  2OU6 A;  2DHR A;  2PX0 A;  2IXM A;  3S28 A;  3SNH A;  4C3D A;  4KP3 C;  4O7G A;  1HFA A;  2ODV A;  1ZV4 X;  2DYR C;  1OXB A;  2YK0 A;  3WI3 A;  3BQK A;  5BR8 T;  1HX8 A;  4I4T E;  4ERR A;  3S4U A;  2YVK A;  3EGD A;  5EK3 A;  3OA1 A;  5DQV A;  4B3T T;  5GON E;  2XLO A;  4X0R A;  3JCU Q;  3KV4 A;  3O39 A;  4IE7 A;  1ZYR F;  4E18 A;  4EHP A;  3KIN B;  3KVB A;  5L0J A;  3T6G B;  2V6X A;  2CNW A;  3FZM B;  3AOU A;  3MYI A;  3M1C B;  2J4G A;  3RQG A;  4JC7 A;  2CPT A;  1R8I A;  4V1A v;  3D0T A;  5AQO B;  1G4W R;  5TJ5 E;  4IAO A;  1CGN A;  2DGJ A;  4AKL A;  1YKH B;  2G3K A;  4KHP T;  1JR8 A;  3ZYK A;  1WCR A;  4BJ5 A;  4YL3 A;  3P4S A;  3SFE A;  1W09 A;  3N9O A;  5D91 A;  4ZXL A;  4IGU A;  1BR0 A;  2YL0 A;  2YKZ A;  1Y64 B;  2CW0 F;  1LKX A;  2NTY A;  4KI0 F;  2VVN A;  2NW7 A;  3PCV A;  1SA0 E;  3DE8 A;  4EED A;  3L0I A;  4UEL A;  3P4Q A;  4UR9 A;  3UMH A;  1OCR C;  4E7S A;  2L3L A;  2IM8 A;  4XWJ A;  2R7S A;  2C0S A;  3KVA A;  1UUR A;  3E70 C;  2B1E A;  4CN1 A;  3KKB A;  1WAT A;  4JE9 A;  3QTH A;  3NBX X;  3AQC A;  2YU1 A;  3M65 A;  2DI4 A;  3VU7 H;  2W4M A;  4GIW A;  3UT5 E;  5JR9 B;  2OJE D;  4U9D A;  2VCC A;  2ZXR A;  3PHF 2;  1OXK A;  2UU9 T;  3DJU B;  4OIO F;  2J7P A;  3F47 A;  3CK6 A;  5LOV E;  2UUA T;  2VC9 A;  3OYX A;  2BG9 A;  3A11 A;  2D5U A;  3RYH E;  2WMN A;  3EZH A;  3ZLI A;  1E2A A;  4WGY A;  2PJQ A;  2LKG A;  3ZPO A;  2K48 A;  3GEH A;  2NUT A;  2KYH A;  4CIH A;  5K0I A;  2XQY A;  4WAB A;  4K0D A;  4AL1 A;  3Q5W A;  1M2V A;  1ZVZ A;  3K3O A;  4EZH A;  1UG7 A;  1Q0G A;  5LHG B;  4NTF A;  3EGD B;  2QNL A;  4K0U A;  4X64 T;  1QVX A;  1ZP0 A;  1YDI A;  3BRJ A;  4U5H A;  2VKJ A;  5IWA T;  3CKD A;  4B3S T;  3IPM O;  3UMI A;  3GN5 B;  4UVC B;  5L3B B;  1FEW A;  3CX7 B;  1LI5 A;  4H54 A;  4DVZ A;  4Q4Z F;  1U0B B;  1Y4C A;  4OIQ F;  4CIP A;  2MPK A;  4UF0 B;  3T6B A;  4CS7 A;  3C4W A;  3PJA A;  3QB5 A;  2ZPA A;  1Z6A A;  3ZSU A;  3QVZ A;  3I0O A;  3PUY F;  4QX8 B;  4IWB A;  3ZYL A;  3AE6 A;  4UVB B;  3MLG A;  2CEA A;  2K24 A;  4KC9 A;  4YTN A;  1FAP B;  4PJL A;  2YWA A;  4E17 A;  3AE9 A;  4YL1 A;  3KH2 A;  3LBX A;  4MVO A;  4LMJ A;  3EHN A;  3T9O A;  5DLJ A;  5B3S C;  2A68 F;  1UFB A;  3J7Y q;  1XDO A;  3AA7 B;  2W2U A;  1YZA A;  5A6B D;  5B1B C;  2J46 A;  3QW0 A;  5D92 A;  4WBN E;  2ZM2 A;  3ZT6 A;  3CQG B;  4J7T A;  1YA9 A;  2IYL D;  4YLH A;  2N2N A;  2ZM6 T;  1I4Z A;  5KYU A;  4HE8 D;  3N2Z B;  4HWI B;  2V7K A;  3AG3 C;  5FMN A;  5AFU L;  2JPU A;  4Z9H A;  2HV7 A;  3MZK B;  4HGA A;  1JAF A;  2J1D G;  4JYA T;  3JYH A;  3UMK A;  3K1S A;  3HNL A;  4JKV A;  3SP1 A;  1HG2 A;  5LG3 A;  2A2F X;  1H9T A;  2IW5 B;  3V5S A;  2H89 A;  1XMQ T;  1V4A A;  2R7R A;  4HN9 A;  4IST A;  1HMO A;  1W0B A;  1O3U A;  2BS3 A;  4IDZ A;  1B7T A;  1OWA A;  2F22 A;  2R25 A;  2HV6 A;  3OKQ A;  3JT1 A;  2V7M A;  2J7P D;  3N0T A;  2A0B A;  2EHO C;  2BL2 A;  1ZOY A;  4YHJ A;  4AIS A;  3RHW A;  3AQB A;  4BJ1 A;  1M2O A;  2AP3 A;  1O87 A;  4EKW A;  2V7L A;  3P8C D;  3IHU A;  2W67 A;  4YFS A;  3ZMS B;  4CXY A;  3LK3 B;  4L6R A;  2Z6E A;  2XAJ B;  1HMD A;  4X66 T;  5BMV E;  1Y01 A;  3CEX A;  2CHN A;  3RIU A;  4HFD A;  4MND A;  3C7J A;  4H9O C;  4X1K E;  5AC5 A;  4BJT A;  2R7O A;  3GEE A;  3HR0 A;  3NZP A;  3EPV A;  1ZHC A;  1S94 A;  2BKO A;  4I1M A;  3UUB A;  3RPU A;  2NW9 A;  3GM3 A;  3Q5D A;  1T5O A;  2K3W A;  2HFI A;  2XZE A;  3IQC A;  1ORJ A;  2J47 A;  4DMW A;  3UFE A;  4JCH A;  4M63 A;  2VL0 A;  3NRY A;  5AQH B;  4YK5 A;  1YZC A;  4MTG A;  5C8Y E;  4AQG A;  2CDQ A;  5AGF A;  2HN1 A;  3PU8 A;  2P9B A;  4HWH A;  1JOG A;  4HFV A;  3RFY A;  3QUJ A;  5J2T E;  2WDR A;  4A97 A;  4F8H A;  1ZHW A;  1FR0 A;  2WVQ A;  3C8G D;  1XZP A;  2CM0 A;  4TWF A;  5DS4 A;  2ZM0 A;  5LG4 A;  2CWY A;  1HTJ F;  1HE9 A;  1NU7 D;  3ASN C;  2Y39 A;  1H7I A;  5AQQ B;  4H63 H;  3FDQ A;  4ILC A;  2WBL A;  1QZX A;  4A98 A;  2ES0 A;  4GQH A;  3JCF A;  3PUZ F;  1IJ6 A;  2IAK A;  2R7Q A;  2FJB A;  4PJN A;  5J2U E;  2HMZ A;  3BK9 A;  4NXM T;  1ZW3 A;  5E3C A;  5TAO A;  3T6J A;  3C18 A;  1E83 A;  3SXY A;  1OED B;  4LDK A;  4OK0 A;  2XM1 A;  3CVR A;  2X51 A;  4I50 E;  3IQ5 A;  3HL6 A;  3Q2M A;  3DTO A;  4J7Y A;  4QH1 A;  2BVL A;  1E1H B;  4EBB A;  5HSW A;  2W61 A;  4IE6 A;  4JTD B;  4OIP F;  2Q9Q A;  1HS7 A;  4ONS A;  5LP6 E;  3H2U A;  4IE5 A;  3CAX A;  2I6H A;  5KYU B;  2AU5 A;  3FHN A;  2Y3H A;  4YT5 A;  5IYZ E;  2G62 A;  3LLK A;  2XAS B;  4CZZ B;  2WWU A;  3UR3 C;  4U33 A;  4TV8 E;  1W9R A;  4CS8 C;  4EV6 A;  1BR1 A;  1WGW A;  2CE7 A;  4IHJ E;  1LM3 B;  3PTR B;  2RA1 A;  3NKZ A;  5AQL B;  3LG7 A;  2MTQ A;  4ZS2 A;  4BEJ A;  3N2G E;  2K9A A;  1CPR A;  3K3Q C;  4C7O A;  5HXC A;  2XY8 B;  4B3M T;  3IA3 A;  2H8A A;  3FZH B;  1HW2 A;  1NAF A;  4JEH B;  4YT8 A;  4U5B E;  4TUY E;  2XM4 A;  2ZM8 A;  1EQ1 A;  2A69 F;  5EK0 A;  3CQZ A;  2A1D D;  3RQF A;  3ZC4 A;  3L8R A;  1OW7 A;  2YLG A;  3B29 A;  4P6I C;  3ITF A;  5LMN T;  4NC3 A;  3CX6 B;  5JH7 E;  5L3D B;  3LAY A;  4G7H F;  1WYB A;  4H9S E;  2OJQ A;  5HEU A;  3UUL A;  3UGP A;  3AEC A;  3GA8 A;  4ULV A;  1WOL A;  1WR0 A;  4MW3 A;  3NG1 A;  2OV9 A;  3FBZ A;  3N2O A;  1IZM A;  4BPM A;  5A6A A;  3RIF A;  1OED E;  3LNR A;  4X5T A;  3PDY A;  3T1Y T;  1XWM A;  3NYJ A;  2V5C A;  3AVR A;  2LRL A;  4DR2 T;  3N2K E;  4WYV A;  4NIQ A;  3UQ4 A;  1RKE A;  2LD6 A;  1VOM A;  3LFM A;  4JEU B;  3G4X A;  3NMJ A;  4QWN B;  5HAX A;  3SOL A;  3ATP A;  1VB5 A;  4IAQ A;  1U4Q A;  1I6Z A;  4HEA A;  2WWV A;  5L2L A;  3MK7 C;  4DV1 T;  3SEO A;  4NCQ A;  4DMV A;  5JDG A;  2X9Y A;  3POV A;  1B68 A;  5H6R B;  4DV0 T;  4GKK T;  4TV9 E;  2VQE T;  3IQT A;  3JRT A;  3AGT A;  4ANJ A;  1HNX T;  2I15 A;  2W4B A;  2CNW D;  4AQY T;  1WLX A;  1F1M A;  2YN6 A;  2VAS A;  4DV2 T;  3AG4 C;  3NKD A;  3L1M A;  4ULW A;  4AKI A;  3U3I A;  1NEN A;  3UUN A;  3L8I A;  1NG1 A;  3DI5 A;  4DOZ A;  1IZN B;  1OXZ A;  3TOM A;  1MND A;  1G73 A;  5FYM A;  2YDQ A;  4JI4 T;  2NSF A;  2L6H A;  1X9B A;  4XPX A;  4LDQ A;  2R7V A;  2HSQ A;  2LFD A;  2KWH A;  4PW8 A;  4RD9 A;  5JT4 A;  3HNK A;  4KBL A;  2QY9 A;  3MAC A;  1OW6 A;  5LHI B;  1T72 A;  2BS2 A;  3HKD E;  5JP7 A;  2FJA A;  4U5G A;  5KYW B;  4EGW A;  2PG8 A;  1IJ5 A;  3ECS A;  3ZMT B;  2XAG B;  3N9L A;  2WVO A;  2KSF A;  4XLP F;  3QNU A;  3O1J A;  1UX4 A;  4UIG A;  4Z8X A;  4C91 A;  2NSG A;  3VM6 A;  3UU4 A;  4CI1 B;  3AEG A;  2W0G A;  3TLW A;  3JSZ A;  4K1O A;  4I3M A;  1AJ3 A;  2A9U A;  3X1D A;  3SWH A;  4LER A;  2W45 A;  3RF3 A;  4H9N C;  2LM9 A;  1N33 T;  3GEI A;  1SE7 A;  2VL8 A;  4QKN A;  4KNV A;  4WW0 A;  3AEB A;  1LVK A;  3TD7 A;  4OFZ A;  4LML A;  2HH7 A;  3CML A;  5L3V A;  4MVM A;  3F31 A;  3SFD A;  1NFN A;  4JEB A;  2LFF A;  3FMS A;  4YY3 T;  2OQM A;  2XQ6 A;  5L4E A;  3OVU A;  2L81 A;  3ETV A;  4CI3 B;  4D4X A;  1Z63 A;  2BC5 A;  2XSB A;  4ILU A;  3NRH A;  4D4N A;  2WVN A;  1FMW A;  3PE0 A;  2WU5 A;  3O6X A;  4G7Z F;  2JQQ A;  2Y6X A;  1FMV A;  3OJA A;  2H88 A;  2ZXO A;  3KL4 A;  4Q25 A;  4FES A;  4A56 A;  1YJG A;  3AE8 A;  4JI3 T;  3RIA A;  1VCT A;  3N9Q A;  2GA0 A;  3C8G B;  3ZKR A;  2QGS A;  1T98 A;  2NTX A;  1LS4 A;  2WB7 A;  3HKC E;  2JQK A;  3OBV E;  1ZHX A;  3PUR A;  2I59 A;  1APC A;  1YVI A;  3AA0 B;  3C62 A;  1D0X A;  4LF8 T;  3NVO A;  4JI5 T;  3C8Z A;  4HFI A;  4NXN T;  4ZI2 C;  1E2X A;  5JRE A;  2BBH A;  3W2W A;  4BAY B;  4IAR A;  2R6G F;  4HWD A;  2WM9 A;  3ABL C;  2BE5 F;  4YTM A;  3AA6 B;  3GAN A;  4TWH A;  3RC3 A;  3SZR A;  3DMD A;  4DBR A;  2WZH A;  1FTS A;  3PUW F;  3NYL A;  4IB4 A;  4EAH A;  2R7U A;  3US6 A;  3MBG A;  1Q0M A;  3T1H T;  4MVU A;  5L0I A;  3HKB E;  2YEV A;  2WZG A;  2Y48 B;  4HKA A;  4PFO A;  3M4B A;  1ZHY A;  2KMF A;  2JJ9 A;  5DQZ A;  1M62 A;  4O79 A;  3RQE A;  2XQ7 A;  5AQU B;  2YL3 A;  1NZE A;  3B9Q A;  2HN2 A;  2CLY B;  3KBU A;  2P6V A;  5COF A;  3JZ0 A;  3LEO A;  3Q7G A;  4I44 A;  4G78 A;  1ZEE A;  1YAR O;  3NZQ A;  2Q3T A;  3SXK A;  2V7I A;  3OWT A;  2XSA A;  1TFK B;  2QRX A;  1MIY A;  3AAE B;  4ILB A;  3K66 A;  5HXH A;  2CYD A;  3ZG1 A;  4XLN F;  1PD0 A;  4B6X A;  2AVK A;  1KEY A;  2E9X D;  2NR4 A;  2XAF B;  3V5Z A;  2XLV A;  2YL1 A;  4AL0 A;  1A41 A;  4FJO A;  2MWQ A;  1MNE A;  3AXJ B;  3U2M A;  3B71 A;  4IT4 A;  2BG9 C;  2UUI A;  2I0M A;  1JNZ A;  3WOD F;  2OKU A;  1JNR A;  2LSK A;  5F28 E;  2JPF A;  3HTK C;  3K8P C;  3L3P A;  4A5X A;  3U3F A;  3WAK A;  3SXM A;  5AQV B;  3U8P A;  2XSE A;  4LF5 T;  4JBW F;  1HR0 T;  1WYC A;  3KMI A;  4O4H E;  1XWJ A;  2IXP A;  4FWV A;  1VCS A;  2DI3 A;  256B A;  4CJG A;  4ADZ A;  1T6Q A;  4DV6 T;  3TKL B;  1C03 A;  2EIK C;  2XJ7 A;  4JUR I;  2HHH T;  3ZYM A;  2KW3 C;  4U5D E;  3ZMU B;  4YTP A;  3KBT A;  3ZJ2 A;  1V54 C;  3RH3 A;  1QKR A;  5JUA A;  2GWW A;  1D1B A;  1D1C A;  1AEP A;  1LS1 A;  4JTC B;  2LSG A;  3IF8 B;  4FI5 A;  1GQA A;  1TWA A;  2HS5 A;  3P4W A;  2Q9Q B;  5KMG P;  1WTY A;  4YWQ A;  4KUM B;  2HPL A;  4P09 A;  1TR2 A;  3CZ6 A;  1US7 B;  3HNJ A;  5COM A;  2D5R B;  4IJJ A;  4PK4 A;  3ZC0 A;  1QUU A;  5F5F A;  2YHS A;  3G50 A;  1VK5 A;  5FZT A;  3GWN A;  1D0Z A;  4BJ6 A;  1LI7 A;  4U5F E;  3E08 A;  1Q0F A;  4JRZ A;  3UUM A;  3U9M A;  4LDR A;  4B3R T;  2E9X B;  4TNV A;  1KNY A;  1XNQ T;  2BVM A;  1M2V B;  1ORS C;  2YL7 A;  4U74 A;  1M57 C;  4LLE A;  3N5L A;  2LE8 A;  2W63 A;  2BBJ A;  3O1I A;  3JYY A;  4U72 A;  1VLT A;  5FXW A;  1C17 M;  3AE3 A;  2XLH A;  4CJO A;  1WRD A;  4XEK A;  4ZZC A;  1K05 A;  4XZC A;  3G4Z A;  3AB3 B;  3C50 A;  1V9D A;  4ILA A;  3QW1 A;  2ZD9 A;  2R03 A;  3ZDL A;  4DRH B;  1UGO A;  3AA1 B;  4DUZ T;  4H9R C;  4IDP A;  2KZ7 B;  2ZMA A;  3L8J A;  2EPO A;  4X1Y E;  2ACZ A;  1MIW A;  3QOF A;  1HNW T;  2MBG A;  2YU2 A;  4AXP A;  4JJG A;  5L4H A;  2LHR A;  2HJM A;  3RKO A;  1VYK A;  2XLE A;  2E9X A;  2DL1 A;  2P61 A;  2CCY A;  3TJ5 A;  4YT2 A;  3RYL A;  1WWP A;  2JD3 A;  5JDL A;  1HX1 B;  1GS9 A;  1M7K A;  5EK4 A;  3FOO A;  1SYQ A;  1J5W A;  1YA7 O;  5L3E B;  2PFD A;  2IIU A;  5HEH A;  1OW8 A;  3R84 B;  2Q4F A;  2E8I A;  1SR2 A;  2XQ3 A;  5JR9 A;  5LBM A;  2A6H F;  4LMK A;  2IXO A;  2Q7R A;  2K5B B;  3R6N A;  2PX3 A;  5JTG A;  3HJC A;  4PNI A;  4XBF B;  4DVD A;  5JSL A;  1NU9 C;  5LGT B;  4LFB T;  2M64 A;  2CXD A;  2NUP B;  3EFO A;  1T01 A;  3EVY A;  2WAU A;  5JLI A;  3AE7 A;  4O4I E;  4JTA B;  1IBM T;  3DJB A;  3CIR A;  3T4R A;  2EIJ C;  4JJF A;  4OYK A;  4TNW A;  2WDV A;  5HEG A;  4HFB A;  4K0K T;  1XDP A;  3B0P A;  2XHE B;  1EA8 A;  5L0D A;  1NBB A;  1NSG B;  2OCC C;  4XAX B;  4LF7 T;  2FJD A;  3GMI A;  5FNV E;  3RRC A;  4HFC A;  4HEA J;  2SPC A;  1Y6D A;  2Q00 A;  1SHZ C;  2XS1 A;  3H3M A;  1TQG A;  3CQX C;  4HFF B;  5KYX A;  4LFA T;  4DRJ B;  2PFV A;  4TN7 B;  2L6F A;  4PK5 A;  1UX5 A;  2YKS A;  4YSZ A;  4OIN F;  5AC4 A;  3WAJ A;  2JMK A;  3WAQ A;  3QB5 K;  2OA5 A;  3EAM A;  4EYU A;  4MW8 A;  3PV0 F;  1MIV A;  3VAY A;  5E2Q A;  4JUY A;  1GQE A;  2KXP B;  3JC6 D;  2HUJ A;  3O4X E;  1G8X A;  4YT0 A;  1WAS A;  4LF6 T;  4Z91 A;  4MTF A;  3ANW A;  3CWZ B;  3GM2 A;  3ZQY A;  4KI2 A;  1XZY A;  3DE9 A;  4P9F A;  1V55 C;  3L34 A;  2V26 A;  1EZ3 A;  4JI2 T;  2WU2 A;  5B1A C;  3SRZ A;  1XMO T;  3W8H A;  4ZLC A;  2VKD A;  4AI6 A;  2OEX A;  2P7V A;  5BQG A;  1IBK T;  3DZA A;  3RKO F;  4JI6 T;  4NQF A;  3M4C A;  1Q0D A;  1M6T A;  2R7W A;  4QXC B;  3VKG A;  4HFE A;  3AE4 A;  5J1G A;  2CHO A;  3ONJ A;  4XPW A;  4DR6 T;  5F3J A;  2R02 A;  4PAC A;  2LP4 A;  3A5X A;  1OKK A;  1HY5 A;  4AKR B;  2UXB T;  5L0G A;  3SS1 A;  2LLY A;  4GYS A;  4XEV A;  3EZI A;  4MS2 A;  3S84 A;  2B76 A;  3MKD A;  1NEK A;  4WGZ A;  2Q9A A;  3W2V A;  4BJ6 C;  4CBE A;  1QLE C;  5HCM A;  5JR9 C;  2E87 A;  3AE1 A;  1NFO A;  2M6B A;  5AQT B;  2QUP A;  5FXX A;  1HF8 A;  2PBE A;  5DS6 A;  2IXN A;  1PCX A;  4PJJ A;  3FOP A;  3PUX F;  3S27 A;  5CFB A;  5EZY E;  3ASO C;  3P7I A;  3F2E A;  3EDV A;  1BR2 A;  4QXH B;  1L3P A;  1N34 T;  1QPU A;  5L3F B;  4YJW A;  4BEM J;  2EPN A;  4JI0 T;  4CI2 B;  1HW1 A;  1OED C;  3N24 A;  2XS8 A;  4KBM B;  3MXZ A;  2D9D A;  4DV7 T;  2LHN A;  2P0N A;  1CGO A;  2X0H A;  4XPY A;  1D0Y A;  2YOE A;  2EPL X;  1XZQ A;  5CGM A;  3F46 A;  3B13 A;  5EHH A;  3FAJ A;  1A7D A;  2EPM X;  2L6G A;  1E7P A;  3ZN1 B;  4H4K C;  4JZA A;  5KX5 E;  2UXX B;  3NRX A;  1LIH A;  2J9W A;  3U8V A;  3ABV A;  2BG9 E;  3MX3 A;  4MLK A;  2RPA A;  4CN4 A;  3DD7 A;  1U89 A;  4N78 D;  2J9B A;  2MAW A;  4JI1 T;  4HWC A;  3C8G A;  5T3W A;  3IEE A;  4IGG A;  2JRK A;  1FIO A;  4KMC A;  3RQU A;  3JRM O;  3K7D A;  4QHO A;  4BJN A;  3Q7L A;  4DV3 T;  4G0H A;  3W15 B;  1S35 A;  5T1D B;  2Y3G A;  3JAD A;  2V6Y A;  4BA9 A;  5L0H A;  2Z15 A;  3EGX A;  2E9X C;  2EIM C;  1YYX A;  2A72 A;  3U78 A;  3LDQ B;  1A0B A;  1QSD A;  3VRA A;  2C5K T;  4E7Z A;  2X9X A;  5LGU B;  1JPJ A;  4N4W A;  3J06 A;  3EH2 A;  2CA5 A;  3RLF F;  5LYJ E;  4QH5 A;  1MQV A;  3ZIB A;  1HE1 A;  3Q9D A;  4IDO A;  3S0X A;  4PR9 A;  4FAP B;  4J30 B;  4BJ5 C;  4AQF A;  4AIU A;  3TUL A;  1LRZ A;  1TWG A;  1CGM E;  4AE4 B;  3U3B A;  2J45 A;  3RF1 A;  2MOZ A;  3LLI A;  2D4U A;  1TWH A;  1YXR A;  4IDN A;  1YW0 A;  2BG9 B;  2C5J A;  3OYZ A;  2J9V A;  4ZS3 A;  4P1N A;  3KYJ A;  2A0U A;  3AJM A;  3LK2 B;  4LFC T;  4YSX A;  5ABE A;  1U6H A;  3GN5 A;  3LUT B;  3KV9 A;  1YD8 G;  2OOC A;  2YLD A;  1J5E T;  4MQ9 F;  3VF0 A;  1CUN A;  4QI0 A;  3I0Q A;  2W4X A;  3E0Z A;  1KNZ A;  3C4X A;  3QK6 A;  3C51 A;  1T9K A;  2KQ9 A;  3LNM B;  1CPQ A;  3ZMV B;  3GOD A;  2H7V C;  1E84 A;  2XXA A;  4I0U A;  2UUC T;  4W8P A;  1LPE A;  2NG1 A;  4E0I A;  2ACX A;  1VMA A;  1YQ3 A;  2VWA A;  4IIJ E;  2XL6 A;  3TLV A;  2I8B A;  3T8O A;  2HZ8 A;  2PP4 A;  4IRE A;  4CS8 A;  1GM5 A;  1Z3I X;  3HLZ A;  1WN0 A;  3I5P A;  1A7V A;  4EBK A;  1OCO C;  5F5W A;  1K04 A;  1T6U A;  2VH3 A;  3UU5 A;  5HXE A;  3WHN A;  4ZI3 D;  1YAU O;  5HWY A;  5FY7 A;  1HCI A;  4DUY T;  4X1I E;  3K6B A;  3Q6N A;  2B0H A;  2C03 A;  3QMK A;  4LF4 T;  1FFH A;  2F4V T;  3E22 E;  4KHZ F;  3C64 A;  1OKK D;  1ZHT A;  4Z90 A;  4WJ0 A;  1SZI A;  2LOP A;  1KNR A;  2IC6 A;  2W9Y A;  1R5I D;  3SXZ A;  4EBJ A;  1DU2 A;  2W62 A;  3WG7 C;  5JDN A;  4GK5 E;  5LJM A;  1DOV A;  4I43 B;  4LAC B;  3ZEF B;  1ZZP A;  4NTA A;  2WP9 A;  1LE2 A;  5JQG E;  5F5H A;  3LJC A;  4WBO A;  1T8B A;  5LBQ B;  1KF6 A;  3UU3 A;  2X9H A;  3RIP A;  4OD5 A;  3S90 A;  1V74 B;  5T3T A;  1NWM X;  5JDM A;  2V5D A;  1HG5 A;  1I94 T;  4XQ1 A;  5JVD E;  2VUR A;  3BEH A;  2EHO A;  3PUG A;  4U7I A;  4QX7 B;  4AKG A;  4GOU A;  4UV8 B;  5L3C B;  4U9E A;  2V1D B;  3A7M A;  2IML A;  2FGY A;  2LK4 A;  2X0C A;  3FBL A;  5FL0 A;  3P50 A;  1MMG A;  2WB5 A;  1J8M F;  2M6I A;  4YSY A;  5IY5 C;  2DCF A;  1PV3 A;  4Q5S F;  3R2P A;  2UXD T;  3EUH A;  2FJE A;  5AQJ B;  2CBJ A;  4H9Q C;  2YEV C;  3NMI A;  4GYT A;  2CMR A;  2NWB A;  4IL9 A;  2E5L T;  3GWH A;  4X20 E;  4OHF A;  1RJ9 B;  5DS5 A;  2JQ9 A;  1BBH A;  4CXX A;  2V6Y B;  4EYY R;  5LMU T;  2R9R B;  2X66 A;  4L0R A;  4O6Y A;  3DXJ F;  2WQY A;  2C5I T;  2ETS A;  5AQF B;  3AG2 C;  4DR7 T;  2KLQ A;  3TLT A;  2XQ4 A;  2QA7 A;  5C2T A;  2VCA A;  5E33 A;  2IOQ A;  4KNW A;  3AGU A;  3ESL A;  4IRU A;  2HKV A;  2UXN B;  2LRK A;  3ZTZ A;  1FJG T;  3RC8 A;  3ZT7 A;  5A6B A;  2VCB A;  4ASK A;  3QC9 A;  2LSY A;  3N9P A;  4J2C A;  2DWG A;  1KU2 A;  4ZHQ E;  2RP4 A;  5CIV A;  4CQI A;  4ZEY A;  4BG0 A;  3B5M A;  2X0Y A;  4O4J E;  4OIR F;  2XRH A;  2Y8D A;  4DVY P;  4MBQ A;  3ZQV A;  5FCL A;  1SF8 A;  2HPJ A;  1YLM A;  3AE2 A;  3M3Z B;  2P1A A;  5DQT A;  2N9D A;  4UXN B;  1ZKE A;  1H7C A;  1BZ4 A;  5KDM C;  3M15 A;  3TOL A;  2OLT A;  2LSE A;  2DLR A;  3N9M A;  3M79 A;  5LGN B;  2YZS A;  2YRF A;  1OED A;  3I5Q A;  4DO0 A;  1J1J A;  5L0F A;  3KV6 A;  4TWD A;  4LF9 T;  2CXL A;  4QDL A;  1PD1 A;  1KFY A;  4GKJ T;  2BKP A;  4MAL A;  1SUM B;  5AQN B;  4BJM A;  5FXV A;  3NMK A;  3LEV A;  4EIY A;  2FUP A;  3ZN0 B;  3LBX B;  1OQC A;  3X2Q C;  3KDS E;  3ONL C;  2VQF T;  4P9T A;  5JS5 A;  3A9C A;  3K33 A;  3CX8 B;  4PAG A;  4OD4 A;  4X65 T;  5KYN A;  2JIW A;  4W8K A;  3S29 A;  5IUX A;  2HSB A;  3I9W A;  1IBL T;  2QLA A;  2XLD A;  4UF0 A;  4MVZ A;  3UQ7 A;  3VRC A;  1K40 A;  4G2A A;  3RVY A;  4CS9 C;  1X79 A;  5ABF B;  3AEA A;  1N32 T;  5A6K A;  3DWW A;  3TQO A;  1RMV A;  2BZB A;  2Q9B A;  4OYJ A;  3UNG C;  2J0W A;  2PBI A;  3U5S A;  1VYI A;  1N36 T;  2WZF A;  3LK4 2;  1Z5Z A;  2EPK X;  1ZW2 A;  3L39 A;  2D2S A;  4ZOL E;  5EGY A;  3AXJ A;  1VRB A;  2AWC A;  2R7T A;  3X1O A;  4DRI B;  3HA4 A;  2RD9 A;  2JX0 A;  3V5X A;  3EH1 A;  2Y3D A;  2H3R A;  3AED A;  3RGL A;  1ST6 A;  1OCC C;  1EI7 A;  2KNH A;  2NW8 A;  2WDQ A;  2W00 A;  4AQF C;  2EIN C;  1LE4 A;  4R32 A;  4O8S A;  3R7C A;  1W2W A;  2LIG A;  3B0U X;  2AXD S;  2UUB T;  4EIW A;  2KT9 A;  3BQL A;  2XUE A;  2ZXP A;  5A69 A;  4ZI2 D;  5LXT E;  4N06 A;  2Q9Q C;  4UDV A;  3EHZ A;  3ETU A;  3RYC E;  4AX2 A;  2JQH A;  3PMR A;  5A1L A;  1UCU A;  3H3A A;  5CA0 E;  3ZTM A;  2OG2 A;  3H2V A;  3I9Y A;  2Y3B A;  3NYM A;  3LS1 A;  1I5N A;  1U5P A;  3ZMZ B;  2DWK A;  3DAG A;  3GM1 A;  1L0V A;  1FFT C;  4MVS A;  2WSS V;  2XPK A;  1VLS A;  2A3D A;  2YDR A;  2EHO B;  3O1H A;  3GOR A;  5LHH B;  1NLX A;  2HJ3 A;  4C3B A;  1RJ9 A;  2AWY A;  3UGO A;  3JAE A;  3AG1 C;  3FXH A;  4UVA B;  1QQ3 A;  3RQW A;  4MVQ A;  1R4T A;  2XLM A;  3C4Z A;  2ICW G;  5CJ5 A;  2X68 A;  1TKN A;  2N1G A;  2XQ8 A;  2HMQ A;  3FVY A;  3IHR A;  5FVK A;  1ZU4 A;  4PK6 A;  3B0V C;  1DOW A;  2JMH A;  3NKE A;  2O9X A;  3AAA B;  4EB6 E;  1W0A A;  3PDM P;  4DR4 T;  2UXC T;  2TMV P;  3AVS A;  5ETW A;  4E0H A;  3KYI A;  3KPH A;  2J0X A;  3OTO T;  3ZCJ A;  5JVE A;  3H37 A;  4MVR A;  3JSE O;  1MMD A;  3KV5 A;  1C02 A;  2V3C C;  2LM2 A;  3UTK A;  2YDS A;  1YYJ A;  2KC3 A;  3DM5 A;  1AUE A;  3RYI E;  3V5Y A;  4NUV A;  2J8W A;  2KWI B;  3FZK B;  3OEO A;  2QYW A;  3CQC B;  5HYA A;  1YKE B;  3ABM C;  3RYF E;  1Z0P A;  4ER9 A;  5AQP B;  1IAP A;  3UFG A;  4DV4 T;  4Q7C A;  3V7O A;  2FAP B;  1J8Y F;  3J9X 1;  4QXB B;  3RIU C;  2GFH A;  2WY2 A;  3C63 A;  4Z9J A;  1Z7Q c;  1WR6 A;  2IBF A;  2M4E A;  5EK2 A;  4YT4 A;  1OR2 A;  2CGE A;  1Z23 A;  5JRA A;  4I55 E;  4HFH A;  3MJX A;  3HKK A;  4WNK A;  3K1I A;  5KYW A;  1HNZ T;  5JRC A;  5KXJ A;  5HV9 A;  3ZST A;  4O6N A;  3C98 B;  3FAP B;  2VKO A;  1KTM A;  4JCZ A;  4B6I A;  5DAB A;  1S05 A;  4DR5 T;  5LA6 E;  2LSJ A;  4A4A A;  2KIN B;  4H63 V;  4F4B A;  4CSA A;  3QZC A;  3U9J A;  3CSK A;  4OX9 T;  3K1H A;  1JPN A;  3P4P A;  4CDY A;  4P0B A;  2CRB A;  4U2Z A;  2D0U A;  2GAQ A;  2KSR A;  4EOZ B;  5KYY A;  1O5H A;  1BR4 A;  1OCZ C;  2PNO A;  4NY3 A;  4IL4 A;  1G5Z A;  1AVO B;  5HEO A;  2XAQ B;  4JI8 T;  1UUS A;  2KGO A;  4UV9 B;  3AEF A;  3LES A;  5CB4 E;  2D0T A;  3LJB A;  4DID B;  3JTL O;  3MYF A;  5BQH A;  3DP7 A;  1BDJ B;  2UUH A;  5HXS A;  2NUP A;  3ZCI A;  1RKC A;  3EFO B;  3Q5E A;  4N6H A;  1MMA A;  1TWC A;  3TLU A;  1ZU5 A;  2RSE B;  2H7B A;  3EG9 B;  3PUA A;  1I4Y A;  2L9J A;  3F57 A;  5CA1 E;  3PUS A;  2DYS C;  3TK0 A;  2X0L B;  3VHL A;  4ZLD A;  4EXT A;  4A2N B;  4IDQ A;  4ZZB A;  5HWX A;  2IC9 A;  2IDO B;  3AE5 A;  2R7X A;  3JC6 C;  4NPP A;  4GEH A;  3O10 A;  4EEB A;  4JVS A;  4YHH T;  2IUB A;  3ANW B;  5AQG B;  4MHC A;  2KK1 A;  1T7S A;  4YN0 B;  2CXF A;  5L3G B;  3W4Y A;  3W8I A;  1KK7 A;  5DVW A;  4QH4 A;  4CSA C;  3RVZ A;  5HXR A;  4EWC A;  3Q6M A;  1MMN A;  3A8Y C;  1JRA A;  5H6Q B;  1ZHZ A;  3N9N A;  4G63 A;  4FX5 A;  2CCQ A;  4CX9 A;  1E86 A;  4C7O B;  4RDA A;  3I4U A;  3EJN A;  3MA9 A;  4YL0 A;  5DJQ C;  5IHY A;  2IHR 1;  2XQ5 A;  4U3C A;  4MTO A;  2XL8 A;  3SYN A;  4U5C E;  2CWO A;  2J62 A;  3PUQ A;  3Q5X A;  1N1C A;  3IQ6 A;  2X67 A;  4TX5 A;  3K1I C;  5J0Z A;  5ABG A;  3QVY A;  5FP3 A;  4K7B A;  2XAH B;  2XQA A;  3ZC1 A;  4CDA A;  3ZT5 A;  2NUT B;  4PFP A;  3U2L A;  3RX6 A;  4KX6 A;  4TZ4 C;  3H65 A;  1UK5 A;  2VB6 A;  4NTB A;  3TJ6 A;  3ONX A;  2E5V A;  3PU3 A;  2LEH A;  2NP9 A;  2ZLY A;  2M67 A;  3BQI A;  2LOS A;  3O9X A;  1WFD A;  3PUV F;  5ABH A;  2EHO D;  2QTV A;  2DNX A;  1QLB A;  2X9W A;  5JDH A;  4HTE A;  1ORY A;  4UEM A;  2VKH A;  1FNT c;  4ZI3 C;  5HEJ A;  2Q9C A;  4C3E A;  3DAF A;  2A6E F;  4HE8 A;  5AQS B;  2YLI A;  2ASR A;  2E2A A;  2CLY C;  1JMW A;  3E9V A;  1RXQ A;  3EGX B;  1H6G A;  2KND A;  1IW7 F;  5A6J A;  2BKN A;  5LB7 B;  3NDB B;  4C90 A;  4GK0 E;  2Y69 C;  4MFR A;  1E85 A;  2FFH A;  3U0C A;  5ADX L;  3JAF A;  4H9P C;  2XTL A;  4QI2 A;  5HCJ A;  4DV5 T;  4DBQ A;  3L09 A;  3UUX B;  4X62 T;  2ZXW C;  1RKE B;  2YQY A;  2W66 A;  2MHR A;  3LSV A;  2QE9 A;  2H7O A;  1OR3 A;  2XM2 A;  3B57 A;  3RI5 A;  3HNI A;  4AE4 A;  5AQI B;  5KYY B;  5JRC B;  5M4Y A;  4JI7 T;  3KFW X;  3VRB A;  2L9Q A;  1O3X A;  2XLW A;  4NUU A;  3VR9 A;  3VKH A;  2WMO A;  2L7A A;  2WZL A;  5CI8 A;  4O4L E;  5L47 A;  1LVF A;  3HI2 A;  2LKH A;  2WS3 A;  5JDF A;  2LCH A;  5AQR B;  4EUK B;  4HWF A;  2VK9 A;  2ODU A;  4L5G A;  2WZI A;  4O2B E;  4DR1 T;  4P0A A;  2G0U A;  3AAI A;  1SMY F;  1G4U S;  4CN6 A;  4XTK A;  3EHM A;  4GYR A;  4IE4 A;  5FXZ A;  1KNP A;  4Z9I A;  3ABK C;  1EKY A;  1RCP A;  4AK9 A;  2GK9 A;  2QVA A;  4U7Y A;  3EDU A;  4XEF A;  4RBN A;  2J9U A;  5FKY A;  3EI0 A;  5LNK A;  3LS0 A;  3GWL A;  5ABF A;  3EG9 A;  4JIO A;  2YIN A;  5FY1 A;  2VVS A;  2XL4 A;  4JLE A;  4M1P A;  2XXA B;  3FB2 A;  2LSI A;  1GGQ A;  5FY0 A;  2XM0 A;  5FL1 A;  4O6M A;  3DKA A;  4YXD A;  2R05 A;  2Q9Q D;  2LJL A;  1H9G A;  2G3V A;  5FVL A;  5B3I A;  4O2A E;  3IBP A;  3TLS A;  5DQW A;  3ZSS A;  2OEV A;  5BQI A;  5L3Q A;  3OPC A;  4YJ3 E;  4CDV A;  1T6I A;  3VR8 A;  5COG A;  3FXD B;  4ISS A;  2LQG A;  1Z8U A;  4JEA A;  3UU8 A;  3RW0 A;  3UU6 A;  3FXE B;  1M56 C;  2NOX A;  5F8P A;  3FZF B;  3G06 A;  3CPZ A;  4U5E E;  4U2Y A;  4WZX A;  4ZI7 E;  4F6R C;  4N6C A;  5LJN A;  4J32 B;  2BS4 A;  3EQL F;  4DR3 T;  1VTM P;  3V5U A;  2L8K A;  5C3J A; 
#chains in the Genus database with same CATH homology
 3GMI A;  2ZM8 A;  3RRC A;  2BZB A;  4AKH A;  2A69 F;  4OYJ A;  2Q9B A;  4L9I A;  3CQZ A;  2A1D D;  3ZC4 A;  4EZ4 A;  3UNG C;  2J0W A;  5JDQ A;  2PBI A;  2SPC A;  3FHD A;  4HEA J;  4P6I C;  1SHZ C;  1VYI A;  2WZF A;  3ITF A;  2WL8 A;  3CX6 B;  3LK4 2;  5JH7 E;  5L3D B;  3CQX C;  1Z5Z A;  1WYB A;  3LAY A;  4H9S E;  5CI9 A;  4HFF B;  5KYX A;  3HKE E;  3UUL A;  3UGP A;  5E0O A;  2D2S A;  2PFV A;  3GA8 A;  4ZOL E;  4PJM A;  2V7J A;  3ZJ1 A;  5EGY A;  4TN7 B;  1VRB A;  4PK5 A;  3NG1 A;  1UX5 A;  2MYS A;  3X1O A;  2R7T A;  3FBZ A;  3HA4 A;  3N2O A;  1IZM A;  2LT3 A;  4CS9 A;  4OIN F;  2KJG A;  3EH1 A;  2Y3D A;  2H3R A;  3LNR A;  3WAJ A;  2JMK A;  3VYW A;  1ST6 A;  2OA5 A;  5LCY A;  3PDY A;  1OCC C;  4EYU A;  2KNH A;  4CXW A;  5KYX B;  4G7O F;  1MIV A;  4LLC A;  3VAY A;  2NW8 A;  3DM9 B;  4JUY A;  2W00 A;  4AQF C;  2EIN C;  3NYJ A;  3DJN B;  5E2Q A;  2KXP B;  3JC6 D;  3AVR A;  4O8S A;  3O4X E;  4HFK B;  1W2W A;  1G8X A;  3N2K E;  3B0U X;  3ZVR A;  5BUO A;  1VOM A;  3ANW A;  3CWZ B;  3LFM A;  4JEU B;  4I1O B;  4EIW A;  2KT9 A;  3BQL A;  2XUE A;  2ZXP A;  4QWN B;  3I1A A;  5HAX A;  3SOL A;  4YJ2 E;  4ZI2 D;  5LXT E;  4N06 A;  1U4Q A;  2Q9Q C;  4HEA A;  4KI2 A;  4JW1 A;  5L2L A;  3MK7 C;  3ETU A;  1V55 C;  3L34 A;  2V26 A;  3RYC E;  4AX2 A;  3SEO A;  5E3A A;  2B0J A;  1EZ3 A;  4DMV A;  3K3N A;  5A1L A;  1UCU A;  5JDG A;  3H3A A;  5CA0 E;  2BDE A;  3PMR A;  2X9Y A;  3RRW A;  3SRZ A;  2OG2 A;  3I9Y A;  2VKD A;  5B1A C;  3W8H A;  4ZLC A;  2Y3B A;  3POV A;  4AI6 A;  2C04 A;  2EIL C;  2P7V A;  5H6R B;  1S7Z A;  2PF4 E;  1D1A A;  3DZA A;  4DND A;  3LS1 A;  1U5P A;  3NYM A;  4JVS A;  3ZMZ B;  2DWK A;  4TV9 E;  3DAG A;  4IE0 A;  3RKO F;  1FFT C;  2DHR A;  2PX0 A;  3JRT A;  2WSS V;  2IXM A;  4ANJ A;  3S28 A;  2A3D A;  3SNH A;  4C3D A;  2EHO B;  4KP3 C;  3O1H A;  1HFA A;  2W4B A;  2ODV A;  1ZV4 X;  4QXC B;  2CNW D;  4O7G A;  5LHH B;  2R7W A;  2DYR C;  2YK0 A;  3WI3 A;  3VKG A;  1WLX A;  3BQK A;  1RJ9 A;  2VAS A;  1HX8 A;  5J1G A;  3AG4 C;  4I4T E;  3NKD A;  4ULW A;  4ERR A;  3S4U A;  3U3I A;  4AKI A;  5EK3 A;  3UUN A;  3EGD A;  5DQV A;  1NG1 A;  3OA1 A;  3UGO A;  4DOZ A;  1IZN B;  1OXZ A;  5F3J A;  3AG1 C;  5GON E;  3A5X A;  1MND A;  4UVA B;  1G73 A;  5FYM A;  1OKK A;  4X0R A;  3JCU Q;  3C4Z A;  3KV4 A;  4AKR B;  2X68 A;  3O39 A;  4IE7 A;  1ZYR F;  1TKN A;  3SS1 A;  4GYS A;  2N1G A;  2R7V A;  3EZI A;  3FVY A;  3KIN B;  3KVB A;  2KWH A;  3IHR A;  4PW8 A;  4RD9 A;  3MKD A;  3W2V A;  4KBL A;  2CNW A;  2Q9A A;  4BJ6 C;  2QY9 A;  4CBE A;  1ZU4 A;  4PK6 A;  1QLE C;  3MAC A;  3B0V C;  2JMH A;  5JR9 C;  2E87 A;  5LHI B;  3M1C B;  3NKE A;  2O9X A;  3HKD E;  5FXX A;  3AAA B;  1HF8 A;  4EB6 E;  5DS6 A;  2IXN A;  4U5G A;  1PCX A;  5KYW B;  4V1A v;  3D0T A;  3AVS A;  4PJJ A;  5ETW A;  2PG8 A;  2J0X A;  3S27 A;  3ZCJ A;  1IJ5 A;  4IAO A;  3ABL C;  3H37 A;  3ZMT B;  3ECS A;  5EZY E;  3ASO C;  2XAG B;  1MMD A;  3N9L A;  2WVO A;  2DGJ A;  3KV5 A;  3P7I A;  2V3C C;  4AKL A;  1YKH B;  2G3K A;  4XLP F;  3F2E A;  3UTK A;  3O1J A;  1UX4 A;  3EDV A;  4UIG A;  4Z8X A;  4C91 A;  1BR2 A;  4YWQ A;  4QXH B;  3DM5 A;  3ZYK A;  5L3F B;  4YJW A;  3RYI E;  4BJ5 A;  4CI1 B;  3CZ6 A;  4NUV A;  2W0G A;  4CI2 B;  2KWI B;  3OEO A;  3N24 A;  3JSZ A;  4KBM B;  4I3M A;  3MXZ A;  3CQC B;  5HYA A;  1YKE B;  3ABM C;  3N9O A;  2LHN A;  3RYF E;  5D91 A;  1Z0P A;  4IGU A;  1AJ3 A;  1BR0 A;  3SWH A;  1IAP A;  1Y64 B;  2CW0 F;  1LKX A;  2NTY A;  4LER A;  4Q7C A;  2W45 A;  3V7O A;  2NW7 A;  1D0Y A;  4H9N C;  1SA0 E;  2LM9 A;  4QXB B;  3J9X 1;  1J8Y F;  3L0I A;  3F46 A;  3B13 A;  2VL8 A;  4QKN A;  4UEL A;  2GFH A;  3FAJ A;  4WW0 A;  4KNV A;  1LVK A;  3UMH A;  5EHH A;  3ZN1 B;  1OCR C;  4H4K C;  4OFZ A;  4E7S A;  2L3L A;  5KX5 E;  2UXX B;  3NRX A;  2J9W A;  1WR6 A;  4JZA A;  4XWJ A;  2HH7 A;  3CML A;  2C0S A;  5EK2 A;  2M4E A;  4YT4 A;  5L3V A;  2R7S A;  3KVA A;  3E70 C;  3KKB A;  2B1E A;  2CGE A;  1Z23 A;  4I55 E;  3MX3 A;  3F31 A;  3MJX A;  4MLK A;  4FES A;  4WNK A;  5KYW A;  5JRC A;  3DD7 A;  4O6N A;  3NBX X;  3AQC A;  2YU1 A;  3C98 B;  3M65 A;  2DI4 A;  4N78 D;  3VU7 H;  2W4M A;  4GIW A;  3UT5 E;  2VKO A;  2L81 A;  3ETV A;  4CI3 B;  5T3W A;  3IEE A;  5JR9 B;  1Z63 A;  4ILU A;  2ZXR A;  3NRH A;  3PHF 2;  4B6I A;  2WVN A;  2JRK A;  1FIO A;  1FMW A;  3PE0 A;  4KMC A;  3O6X A;  3DJU B;  4G7Z F;  2J7P A;  4OIO F;  5DAB A;  2JQQ A;  2Y6X A;  1FMV A;  3F47 A;  3OJA A;  2ZXO A;  3KL4 A;  5LOV E;  3K7D A;  4QHO A;  3OYX A;  5LA6 E;  2LSJ A;  4BJN A;  2D5U A;  2KIN B;  2WMN A;  4H63 V;  3RYH E;  3W15 B;  4A56 A;  3EZH A;  3Q7L A;  3QZC A;  4G0H A;  3CSK A;  4G7H F;  3K1H A;  1JPN A;  1S35 A;  3ZLI A;  5T1D B;  3N9Q A;  2PJQ A;  2Y3G A;  2QGS A;  4P0B A;  3ZPO A;  1T98 A;  4BA9 A;  2D0U A;  2NTX A;  2K48 A;  2WB7 A;  2Z15 A;  2NUT A;  4CIH A;  4EOZ B;  5KYY A;  3EGX A;  2E9X C;  3HKC E;  1O5H A;  3OBV E;  1ZHX A;  2EIM C;  2A72 A;  2XQY A;  3PUR A;  3U78 A;  2I59 A;  4K0D A;  1BR4 A;  3Q5W A;  1QSD A;  4E7Z A;  2C5K T;  3K3O A;  2X9X A;  5LGU B;  1JPJ A;  1M2V A;  1OCZ C;  4NY3 A;  4EZH A;  3EH2 A;  5LHG B;  2CA5 A;  2XAQ B;  3EGD B;  3AA0 B;  4K0U A;  5LYJ E;  2KGO A;  4UV9 B;  3LES A;  5CB4 E;  3ZIB A;  2D0T A;  3LJB A;  4U5H A;  2VKJ A;  3Q9D A;  1D0X A;  3DP7 A;  3S0X A;  4J30 B;  5HXS A;  3CKD A;  3ZCI A;  4ZI2 C;  2NUP A;  3EFO B;  4BJ5 C;  4AQF A;  1MMA A;  5JRE A;  1TWC A;  1ZU5 A;  2H7B A;  3UMI A;  3W2W A;  4BAY B;  1LRZ A;  3EG9 B;  3PUA A;  1TWG A;  2L9J A;  2WM9 A;  3F57 A;  3GN5 B;  5CA1 E;  4UVC B;  5L3B B;  3PUS A;  1FEW A;  3CX7 B;  2BE5 F;  4AE4 B;  2DYS C;  2J45 A;  2X0L B;  4DVZ A;  3AA6 B;  2MOZ A;  4Q4Z F;  3VHL A;  3GAN A;  3RC3 A;  3LLI A;  3SZR A;  4OIQ F;  4ZLD A;  3DMD A;  1TWH A;  4UF0 B;  4DBR A;  4EXT A;  3C4W A;  3T6B A;  4A2N B;  2ZPA A;  4CS7 A;  1FTS A;  5HWX A;  1YW0 A;  1Z6A A;  3NYL A;  2IC9 A;  3ZSU A;  2C5J A;  3OYZ A;  3I0O A;  4ZS3 A;  4EAH A;  2J9V A;  3JC6 C;  4QX8 B;  2R7X A;  4GEH A;  2R7U A;  3LK2 B;  4IWB A;  3ZYL A;  3GN5 A;  4UVB B;  3MLG A;  3KV9 A;  3HKB E;  1YD8 G;  2CEA A;  2K24 A;  1WGW A;  2WZG A;  2YEV A;  3ANW B;  4PJL A;  4KC9 A;  4MHC A;  2Y48 B;  4HKA A;  1CUN A;  4PFO A;  4MQ9 F;  4QI0 A;  1ZHY A;  4YN0 B;  2CXF A;  2KMF A;  5L3G B;  3LBX A;  3KH2 A;  3I0Q A;  3E0Z A;  1KK7 A;  3C4X A;  1KNZ A;  3QK6 A;  3EHN A;  2JJ9 A;  5DVW A;  3W8I A;  3C51 A;  5DLJ A;  5DQZ A;  4CSA C;  5B3S C;  2KQ9 A;  4O79 A;  2A68 F;  5HXR A;  3J7Y q;  4EWC A;  4OIP F;  3ZMV B;  3Q6M A;  3GOD A;  1MMN A;  3AA7 B;  5H6Q B;  1NZE A;  2H7V C;  3B9Q A;  2XXA A;  1ZHZ A;  3N9N A;  4G63 A;  4FX5 A;  2CLY B;  3KBU A;  5B1B C;  2CCQ A;  2J46 A;  2P6V A;  4C7O B;  4RDA A;  3I4U A;  3EJN A;  3MA9 A;  5D92 A;  4WBN E;  2NG1 A;  3Q7G A;  2ZM2 A;  5DJQ C;  4I44 A;  2ACX A;  3CQG B;  5IHY A;  1VMA A;  1ZEE A;  2VWA A;  4IIJ E;  3NZQ A;  4YLH A;  2IYL D;  2I8B A;  3SYN A;  2Q3T A;  2N2N A;  2V7I A;  4U5C E;  3T8O A;  2PP4 A;  3OWT A;  2CWO A;  3PUQ A;  3Q5X A;  1N1C A;  3AAE B;  1MIY A;  2X67 A;  4TX5 A;  3K1I C;  4HE8 D;  1Z3I X;  3K66 A;  5FP3 A;  3HLZ A;  3N2Z B;  4CS8 A;  4K7B A;  2XAH B;  2V7K A;  3ZC1 A;  5HXH A;  3AG3 C;  3I5P A;  3ZG1 A;  1OCO C;  5FMN A;  4XLN F;  1PD0 A;  4B6X A;  5AFU L;  2NUT B;  4PFP A;  3RX6 A;  2E9X D;  2HV7 A;  3MZK B;  2VH3 A;  2XAF B;  4HGA A;  5HXE A;  2J1D G;  4TZ4 C;  4ZI3 D;  4FJO A;  2VB6 A;  3H65 A;  3JYH A;  3ONX A;  5HWY A;  5FY7 A;  2MWQ A;  1MNE A;  1HCI A;  3TD7 A;  3PU3 A;  3UMK A;  4X1I E;  3K6B A;  3Q6N A;  3SP1 A;  1HG2 A;  2LEH A;  2NP9 A;  2A2F X;  2C03 A;  2ZLY A;  2M67 A;  3BQI A;  3QMK A;  2IW5 B;  3V5S A;  2LOS A;  3O9X A;  3E22 E;  1FFH A;  3C64 A;  2R7R A;  3WOD F;  4HN9 A;  2EHO D;  4IST A;  2LSK A;  2QTV A;  2DNX A;  2JPF A;  1OKK D;  1ZHT A;  3K8P C;  2X9W A;  5JDH A;  3L3P A;  4IDZ A;  3HTK C;  4WJ0 A;  4HTE A;  4CSA A;  1SZI A;  3WAK A;  4F4B A;  2LOP A;  4UEM A;  1B7T A;  2IC6 A;  2VKH A;  1OWA A;  2W9Y A;  2XSE A;  1WYC A;  3JT1 A;  2HV6 A;  3OKQ A;  4ZI3 C;  3KMI A;  2Q9C A;  2V7M A;  4O4H E;  2J7P D;  2W62 A;  4C3E A;  3N0T A;  2EHO C;  4YHJ A;  3WG7 C;  2IXP A;  3AQB A;  5JDN A;  4FWV A;  3DAF A;  4GK5 E;  4BJ1 A;  5LJM A;  1M2O A;  2A6E F;  4HE8 A;  1O87 A;  4I43 B;  4ADZ A;  2V7L A;  2CLY C;  3P8C D;  4LAC B;  4YFS A;  3E9V A;  3TKL B;  3ZMS B;  3LK3 B;  3ZEF B;  4CXY A;  2EIK C;  3EGX B;  2Z6E A;  4JUR I;  2XAJ B;  2KND A;  3ZYM A;  1IW7 F;  2KW3 C;  5BMV E;  3ZMU B;  5JQG E;  4U5D E;  3NDB B;  5F5H A;  3LJC A;  3KBT A;  4C90 A;  4WBO A;  3ZJ2 A;  3RH3 A;  1V54 C;  4GK0 E;  5LBQ B;  2Y69 C;  4MND A;  4MFR A;  1D1B A;  1D1C A;  4H9O C;  2X9H A;  4X1K E;  1LS1 A;  2FFH A;  2LSG A;  3IF8 B;  4FI5 A;  5ADX L;  2R7O A;  1TWA A;  4OD5 A;  4H9P C;  4BJT A;  2XTL A;  4QI2 A;  5T3T A;  1NWM X;  2Q9Q B;  3HR0 A;  5KMG P;  5JDM A;  3NZP A;  2HPL A;  4KUM B;  1HG5 A;  4P09 A;  3L09 A;  4DBQ A;  1US7 B;  1TR2 A;  3UUX B;  5JVD E;  1ZHC A;  2D5R B;  3EPV A;  4IJJ A;  2EHO A;  1S94 A;  3PUG A;  4PK4 A;  1QUU A;  3ZC0 A;  2ZXW C;  5F5F A;  4I1M A;  2YHS A;  4QX7 B;  4C3B A;  3RPU A;  2NW9 A;  2H7O A;  1VK5 A;  3B57 A;  4BJ6 A;  1D0Z A;  4AKG A;  4GOU A;  4UV8 B;  5L3C B;  4U5F E;  4AE4 A;  5KYY B;  2V1D B;  3E08 A;  4DMW A;  3UFE A;  2FGY A;  4JCH A;  3FBL A;  5JRC B;  4M63 A;  5M4Y A;  3UUM A;  3KFW X;  1MMG A;  2L9Q A;  1O3X A;  3NRY A;  1J8M F;  2E9X B;  4NUU A;  5IY5 C;  2BVM A;  1M2V B;  3VKH A;  2DCF A;  4U74 A;  4Q5S F;  1M57 C;  2WMO A;  4LLE A;  3EUH A;  3N5L A;  5C8Y E;  4AQG A;  2LE8 A;  2CDQ A;  2WZL A;  2W63 A;  3O1I A;  5CI8 A;  4U72 A;  3PU8 A;  2P9B A;  4H9Q C;  4O4L E;  5FXW A;  1LVF A;  3HI2 A;  2YEV C;  4HFV A;  3RFY A;  5JDF A;  3QUJ A;  5J2T E;  4GYT A;  2CMR A;  1WRD A;  2NWB A;  1ZHW A;  2VK9 A;  3GWH A;  2ODU A;  4L5G A;  4X20 E;  4OHF A;  4XZC A;  1RJ9 B;  2WVQ A;  5DS5 A;  4O2B E;  4CXX A;  4EYY R;  2CM0 A;  4P0A A;  2X66 A;  4L0R A;  3AB3 B;  3C50 A;  4O6Y A;  2G0U A;  1V9D A;  3AAI A;  1SMY F;  3DXJ F;  2ZM0 A;  5DS4 A;  2C5I T;  3AG2 C;  2KLQ A;  4XTK A;  5LG4 A;  2CWY A;  1HTJ F;  3EHM A;  1NU7 D;  4GYR A;  3ASN C;  2QA7 A;  3AA1 B;  4IE4 A;  5FXZ A;  5E33 A;  2IOQ A;  4KNW A;  3ESL A;  4H9R C;  2Y39 A;  4IRU A;  2KZ7 B;  2UXN B;  2ZMA A;  3ABK C;  4H63 H;  3RC8 A;  4X1Y E;  3FDQ A;  4AK9 A;  2WBL A;  1QZX A;  1MIW A;  4ASK A;  2ES0 A;  2GK9 A;  3QC9 A;  1IJ6 A;  2YU2 A;  2MBG A;  2LSY A;  3EDU A;  3N9P A;  2DWG A;  4J2C A;  1KU2 A;  4RBN A;  4ZHQ E;  2IAK A;  4AXP A;  2J9U A;  2R7Q A;  2RP4 A;  4PJN A;  5J2U E;  5LNK A;  4JJG A;  3BK9 A;  3LS0 A;  5E3C A;  4CQI A;  2LHR A;  3EG9 A;  2YIN A;  4BG0 A;  5FY1 A;  4O4J E;  5TAO A;  3T6J A;  3RKO A;  1VYK A;  2XL4 A;  4OK0 A;  2XRH A;  2E9X A;  4OIR F;  3CVR A;  2X51 A;  4I50 E;  4JLE A;  4M1P A;  2Y8D A;  2XXA B;  3FB2 A;  4DVY P;  3HL6 A;  3Q2M A;  3DTO A;  4MBQ A;  5FCL A;  4YT2 A;  2LSI A;  1SF8 A;  3RYL A;  2BVL A;  5FY0 A;  2HPJ A;  1E1H B;  2JD3 A;  4O6M A;  2W61 A;  4IE6 A;  5EK4 A;  5JDL A;  5KYU A;  5DQT A;  2N9D A;  4EBB A;  5HSW A;  2Q9Q A;  4UXN B;  1HS7 A;  2Q9Q D;  5L3E B;  1ZKE A;  2LJL A;  1H7C A;  5LP6 E;  2G3V A;  2PFD A;  5KDM C;  4IE5 A;  3R84 B;  4O2A E;  2LSE A;  2DLR A;  3IBP A;  3N9M A;  5KYU B;  5LGN B;  2E8I A;  2YZS A;  3I5Q A;  2A6H F;  3FHN A;  5JR9 A;  5LBM A;  4DO0 A;  2Y3H A;  4YT5 A;  5IYZ E;  2G62 A;  3KV6 A;  3LLK A;  2IXO A;  2XAS B;  5DQW A;  2K5B B;  2CXL A;  3R6N A;  4CZZ B;  1PD1 A;  2PX3 A;  4QDL A;  5L3Q A;  2WWU A;  4YJ3 E;  3HJC A;  4PNI A;  3UR3 C;  4DVD A;  4XBF B;  4MAL A;  4TV8 E;  4BJM A;  5FXV A;  4CS8 C;  3LEV A;  1BR1 A;  3ZN0 B;  3FXD B;  4ISS A;  2CE7 A;  4IHJ E;  3LBX B;  5LGT B;  1NU9 C;  2CXD A;  3X2Q C;  3PTR B;  2RA1 A;  2NUP B;  3EFO A;  3KDS E;  3EVY A;  2WAU A;  3K33 A;  4O4I E;  3CX8 B;  3DJB A;  3FXE B;  3LG7 A;  2NOX A;  4PAG A;  1M56 C;  4OD4 A;  2MTQ A;  5F8P A;  4ZS2 A;  3T4R A;  2EIJ C;  3N2G E;  4JJF A;  2K9A A;  4OYK A;  4BEJ A;  5KYN A;  3CPZ A;  4W8K A;  4U5E E;  3K3Q C;  3S29 A;  4C7O A;  4ZI7 E;  5HXC A;  4F6R C;  3I9W A;  3B0P A;  2XHE B;  5LJN A;  4UF0 A;  4J32 B;  1NAF A;  4G2A A;  4JEH B;  2OCC C;  3EQL F;  4CS9 C;  4YT8 A;  4U5B E;  4TUY E;  1X79 A;  4XAX B;  3V5U A;  3RIP A;  2L8K A;  5FNV E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...