3RH3A

Crystal structure of an uncharacterized duf3829-like protein (bt_1908) from bacteroides thetaiotaomicron vpi-5482 at 2.10 a resolution
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
256
structure length
239
Chain Sequence
TEELDDASKVINYYHMSLAVLRHVANAKDINAVLGYMEQTGTAELLDPGDYFNPEVRQNLKQNYAGLFNVRTQFYDNFNKFLAYKKSKDTAKTAQLLDENYKLSVELSEYKQVIFDILSPLTEQAESELLADEPLKDQIMAMRKMSGTVQSIMNLYSRKHAMDGVRIDLKMAELEKELKAAEKIPAVTGYDEELKNFQSFLSTVKSFMNDMQKARSKGAYSDKEYQAMSEAYEYGLSVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of an Uncharacterized DUF3829-like protein (BT_1908) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution
rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized DUF3829-like protein
total genus 89
structure length 239
sequence length 256
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-04-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.820 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3rh3A02
1.20.120.930 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3rh3A01
3IEEA 3RH3A 4YJWA
chains in the Genus database with same CATH superfamily
3QZCA 2FJDA 2NUTA 3RVYA 5JRAA 3TLVA 3J7Yq 2CDQA 5IHYA 2NUPB 1OEDA 3K7DA 4JI5T 2W2UA 1KNZA 3I4UA 2E9XD 2JPFA 4DR2T 1Q0KA 4MVQA 3MBGA 4CS9A 3EFOB 4TV8E 3LEVA 2XM2A 2PX0A 2BBJA 3OBVE 4JEHB 1QUUA 1A7VA 2VKDA 2KINB 1YKHB 4ZI3D 5L2LA 3RF3A 3O10A 2NUTB 4QH1A 4PACA 4UF0B 3HA4A 3N9MA 2K9AA 4ZZBA 3HKDE 2Q9QC 2P0NA 2DHRA 4YHHT 3EH1A 3NRYA 1MIYA 1WASA 4YT8A 4FAPB 5LCYA 4HFKB 3UQ7A 1V54C 3RRWA 4OIOF 4PK4A 1HY5A 3NKZA 2VURA 4CJGA 2HUJA 3V5SA 3OTOT 3F2EA 3S27A 3ONLC 2VVNA 1BR4A 2XY8B 3FHDA 3DTOA 5LMUT 3M65A 2X0YA 3JCUQ 4JC7A 2E87A 2V7JA 4MVRA 3PJAJ 4P0BA 2DWGA 2WWVA 5JUAA 2HMQA 4DVYP 5B3SC 5L0IA 2QYWA 3AXJB 1B68A 3MX3A 2BKNA 4UV9B 2X51A 5KYUA 2VQET 1H9GA 3Q2MA 4XLPF 2LM9A 2JMHA 1Z8UA 3LSVA 3LLKA 1W0AA 2IIUA 4NPPA 3ZYLA 5BQIA 2B76A 4MVZA 4U5BE 2LFFA 3AE6A 4ZLDA 3LNRA 4HE8A 3TLTA 2WB7A 2Y3DA 3OWTA 4UDVA 1Q0MA 3JTLO 3BQKA 3AG4C 3RIFA 3FDQA 5EK2A 3Q5XA 4N06A 3B0VC 2CLYC 2HV6A 2LP4A 3PMRA 4YT2A 2DYRC 2DCFA 1N36T 3AAIA 5IWAT 5LMNT 1HCIA 3KINB 2DI3A 3U5SA 1ZHZA 2PFDA 1VRBA 2XSEA 4OHFA 3N9LA 4XLNF 4BJ1A 4AQGA 4KNVA 2X68A 1YD8G 4N78D 4GK0E 1BR0A 4EIYA 4JBWF 3QNUA 4AQFA 2IUBA 2BG9A 5L0FA 1K40A 2XSAA 3FZHB 1YYXA 2YL3A 3S90A 1TKNA 1ZU4A 3LK2B 1TWGA 2XM0A 4WABA 1KK7A 3OKQA 5AQUB 4XQ1A 4G2AA 5KMGP 4K0DA 3PHF2 5FNVE 1A7DA 1TWAA 2G62A 2X66A 1D1CA 1EZ3A 2L3LA 5HXCA 4MFRA 4CJOA 2D0TA 3EQLF 4I0UA 4QKNA 5JSLA 4UEMA 4H54A 3GM3A 3FXEB 3C8GD 1IAPA 3NVOA 3ZYKA 1U0BB 3LEOA 4XZCA 1DU2A 2Q9QD 4HGAA 4L5GA 3CSKA 2WL8A 2EPKX 2J9WA 3LDQB 4MLKA 2J1DG 2CA5A 4HEAA 4G78A 3P7IA 4KX6A 2EIKC 5CFBA 4CDAA 4A98A 4TN7B 5L3VA 3JADA 3VM6A 1SR2A 3AB3B 5FVLA 4EIWA 4YJ3E 1YW0A 4X62T 4BA9A 3OVUA 2JQKA 4QXHB 4C7OB 5HEGA 3N2KE 4LF4T 3RIUC 1E86A 4DR6T 3ONXA 5DVWA 2CM0A 1RJ9A 1M62A 4ZOLE 3JC6C 2LHRA 3FAJA 4P0AA 3KH2A 2D0UA 3VYWA 3GANA 2LD6A 4PK5A 1OKKA 4YSYA 5FXXA 3PUQA 2UUCT 1Q0FA 3B0PA 4OD5A 5DS4A 5JH7E 3ONJA 4J30B 4IJJA 2A6HF 4U5FE 3TLSA 2IMLA 4X65T 2GAQA 4LMKA 5LB7B 3RLFF 3JRMO 4YLHA 1MQVA 1AUEA 1RJ9B 3SXKA 2YDSA 2ICWG 3ZMUB 4U31A 3UGPA 2DL1A 3DJUB 5HCJA 2XQ5A 2HHHT 1E1HB 4YL0A 4EV6A 3ZPOA 3PUZF 4YT5A 3QB5A 1Z5ZA 3WAKA 3G50A 2XQ6A 5EK4A 3EZIA 3KVAA 1HG5A 3MJXA 3BEHA 4H9NC 1HNZT 2CPTA 3M3ZB 4Z9IA 2HZ8A 2QY9A 3S0XA 2NTYA 4HWFA 4AQFC 3CQZA 3AEGA 3FOPA 1NU7D 5CI9A 3U9JA 3NKEA 2Q7RA 4MALA 3ZVRA 4IAOA 4ZI2C 2GFHA 5DQZA 2PF4E 5AQFB 5H6RB 5ABFB 1MNEA 3W2VA 5BUOA 4HN9A 3H65A 1KNPA 2MTQA 5HXRA 3EGDB 4PFOA 2D4UA 2PNOA 1LE2A 2Q9QB 3RQGA 5KYNA 3NDBB 1PCXA 2L7AA 3FB2A 4IDNA 4CI1B 3K3NA 3QW1A 2LRLA 4GYRA 4NTBA 4CQIA 3T9OA 1WYBA 3VHLA 2QTVA 5E2QA 4X66T 2ZXRA 2JMKA 5F5HA 2WDRA 4JE9A 2EIJC 1H7CA 3IQTA 1C02A 1IJ5A 5HCMA 1AEPA 3IEEA 3DE8A 3K1IC 4ZZCA 2A1DD 2UUIA 2QE9A 4E0HA 3N5LA 3M79A 4HWIB 3ZT6A 2OEVA 3N9OA 2R7WA 2P1AA 2L81A 5J0ZA 4DV5T 2A68F 1OCRC 2BDEA 3MLGA 1IBMT 4UXNB 3DM5A 3C8GB 4LF5T 3PU3A 1JMWA 2EPOA 2FFHA 1G4WR 2FJAA 2JIWA 1XZYA 4DMVA 3AGTA 2HPLA 2W4MA 4PK6A 3RYHE 3HI2A 1VLTA 4JW1A 1QLBA 2BVLA 3JYHA 4ILAA 3I0QA 2CBJA 3NYMA 1XZPA 2HV7A 2B0JA 4ZEYA 2IHR1 2LSIA 2WWUA 3DJNB 3SXMA 2UXCT 3RF1A 4YL1A 2MBGA 4ISSA 4G7OF 1ZHYA 4KBLA 1Z0PA 4IWBA 4KUMB 2JQQA 4OFZA 3ZSUA 2JPUA 3GODA 2VASA 3CQCB 1G73A 2WQYA 1LM3B 1UG7A 4DV1T 4I1MA 1G8XA 4HFHA 2CXDA 1QQ3A 1RXQA 4AKLA 2WY2A 5H6QB 4FWVA 2DLRA 3EJNA 1ZOYA 3ANWB 3NBXX 2W62A 1VCTA 4AL1A 2C5JA 2A9UA 4BJ5A 3SRZA 3L34A 4DVZA 5EGYA 4U2YA 3Q9DA 4U7YA 2BKPA 1OCCC 3RYLA 5KXJA 1C17M 2V5CA 3FBLA 2NR4A 4HFDA 3CWZB 1US7B 4AIUA 3RRCA 4X64T 3A7MA 4W8PA 5BMVE 2K3WA 4ERRA 3ECSA 1YZAA 3MYFA 3S84A 1CPQA 4DIDB 4JTAB 3ZC4A 4G63A 4B3RT 4ER9A 2ZD9A 1H7IA 4ZLCA 3RIAA 2ZM2A 1FNTc 4P9FA 2J0WA 3IQ5A 3FZKB 3TLWA 5F5WA 3ZYMA 1X79A 1KU2A 4LFAT 2KXPB 2R02A 4H9QC 2JRKA 1VMAA 2W66A 3O55A 1FAPB 1V9DA 2BG9B 1H6GA 5FXWA 4YHJA 1G4US 1ST6A 4DVDA 4IE4A 1NG1A 2VCCA 3FMSA 3C4XA 4JI0T 3AG3C 5A1LA 3EGDA 4E7SA 3T1HT 3E9VA 4H63V 4XPWA 3F47A 4A56A 4DV2T 4CS8A 3MKDA 5JTGA 1CGME 2WAUA 3AAEB 2CHNA 5JP7A 3UUXB 3EG9B 4C3BA 3H2UA 2CYDA 5M4YA 2AU5A 2LKGA 5LNKA 4ZI7E 4U5DE 1LE4A 2J7PA 2XUEA 4BJNA 4IE5A 1T01A 3KKBA 3NG1A 5DQWA 2VL8A 3D0TA 4Z9JA 5L47A 2KT9A 5L0CA 5JVEA 1OWAA 4N6HA 3L8RA 4AI6A 5DQVA 3NRHA 5IUXA 1QLEC 4I1OB 4JTDB 2BKOA 2WDQA 4MHCA 2FAPB 1HTJF 2ZMAA 2BS4A 1RCPA 4GQHA 3DI5A 2YINA 2V6YB 2PJQA 1R5ID 4BEMJ 2XAQB 1J8YF 2BC5A 4A97A 5IYZE 2XLOA 4EUKB 3U3IA 1HNWT 2LIGA 2KMFA 2B1EA 1NENA 2BVMA 3ASNC 3CAXA 2R9RB 2M4EA 5AQKB 4EYYR 3TQOA 2W45A 1OXBA 3I5PA 4QHOA 1BBHA 3RKGA 3NMKA 3VR8A 1NEKA 2E9XB 3ZDLA 3AA7B 4PAGA 4QDLA 1WWPA 3HNKA 4NCQA 3OPCA 2X0LB 2RP4A 2D5RB 2MAWA 1L0VA 3U8VA 4BEJA 4XWJA 2WVNA 4UR9A 5AFUL 4WJ0A 3RW0A 2J7PD 4TWFA 5LGNB 1JR8A 4TZ4C 1M2OA 4DV0T 2VQFT 2XQYA 3K1SA 3DAFA 2UUBT 4NXNT 3U0CA 3L8JA 1OXKA 2V5DA 2A69F 5JR9B 1XWMA 3N24A 4E0IA 4IDPA 2H8AA 1CGNA 2AVKA 4DUYT 2K48A 2UUHA 2YK0A 4DBRA 4HFFB 1U5PA 3ZMSB 2NSFA 3V5YA 1D1AA 3DXJF 2DYSC 5FY1A 1LS4A 4JLEA 2Q9CA 2FJBA 4IE0A 3S28A 1FFHA 4UELA 1XNQT 2ZXOA 2XLMA 3X1DA 2H88A 2WS3A 3ZJ1A 1XZQA 4LF7T 2WZHA 2R7XA 2ASRA 1K05A 1CUNA 2OQMA 2Y3GA 5HEJA 4EB6E 5C2TA 3VRAA 5DLJA 4GYSA 5D91A 4OIRF 2G3KA 1RKEB 3UQ4A 2E2AA 3LG7A 1KNYA 3KFWX 5EZYE 1ZV4X 3A11A 4KP3C 3AE7A 3U8PA 3AAAB 5CIVA 2DB4A 5LHGB 3TLUA 1TFKB 4I43B 2ZXWC 3PUVF 4IE6A 4PJJA 1ZHXA 1EKYA 3AXJA 1UGOA 4IHJE 3RFYA 2YWAA 4LFBT 2J47A 1H9TA 3C50A 3J06A 2NW7A 4MS2A 4P6IC 3AQCA 3LLIA 4HFEA 3U2MA 5JDFA 1W09A 3UMHA 5FXVA 5JR9A 4OD4A 3KL4A 2VCAA 2BS2A 4N6CA 4JV5T 4LDRA 2IDOB 4HTEA 3K33A 4IIJE 2KW3C 3MFNA 4CSAA 5HWYA 4G0HA 5CGMA 3TKLB 4AE4A 3RKOA 2P7VA 3ZKRA 4JI6T 2NPUA 3U3FA 3O1IA 2C5IT 4X5TA 3P4SA 2KYHA 3CX6B 4U5HA 4IARA 5FYMA 1TQGA 2SPCA 3EUHA 5HYAA 3M4BA 1SA0E 4MW3A 5JREA 4V1Av 4JKVA 4CDVA 2MWQA 3UU6A 4EWCA 1S94A 3GORA 2LM2A 1T6UA 4NUVA 4AK9A 2VCBA 4UVBB 1J8MF 5AC4A 3LK42 1YDIA 2I8BA 4K7BA 5HSWA 2XTLA 3L39A 2LSJA 2OJED 2KC3A 3UUBA 3QK6A 2WM9A 1UURA 1SF8A 4JTCB 4M1PA 256BA 4JCHA 1WRDA 1OW6A 4OINF 4CI3B 3LBXA 5E3CA 1W0BA 2J9BA 4DV7T 2IYLD 1L3PA 3AE3A 2YEVA 2ZLYA 2J8WA 2Q3TA 3IQCA 5L0DA 1SUMB 3QB5K 3TOMA 2LE8A 4DV6T 4JZAA 4JI4T 2LRKA 3HNIA 3AEBA 5C8YE 2HH7A 3N2ZB 2XQ3A 4CIPA 3R6NA 1JAFA 1Q0DA 4AISA 1ZHTA 1LS1A 2H7OA 2NOXA 3DP7A 1ZYRF 2D9DA 3H3AA 2R7TA 2D5UA 5LBMA 2XRHA 4YJWA 3PV0F 3BQLA 5LA6E 2PTFA 4B3TT 3ZEFB 3SEOA 4RBNA 1I4YA 4GIWA 3C62A 3ZC0A 3W4YA 1OEDC 5JDNA 2KZ7B 5FL0A 2I59A 4QH5A 4ZI3C 2V3CC 4OYJA 3HNJA 4LDKA 3AEDA 3AVSA 4JI8T 3MA9A 2R6GF 3TD7A 4M63A 2LK4A 3IHRA 4IAQA 3T8OA 4UIGA 4IL4A 2YL1A 4BJTA 4DR4T 1IW7F 2OCCC 2Q9AA 2R03A 4MVUA 1ZW2A 2LSYA 5KYUB 4KC9A 4QXBB 5LP6E 3ZTMA 2OOCA 3ZN1B 3UU8A 3KVBA 1LI7A 3EHMA 1OR3A 5T3WA 2VWAA 4HFCA 5L3GB 2HSBA 3O1HA 4IDZA 5ABGA 3SFEA 2L9JA 2R7RA 3C7JA 4YT0A 2V7KA 3U78A 2Y8DA 2WU2A 3C98B 1NAFA 3NWIA 5B3IA 5L3CB 2CNWA 5KYYA 4YTNA 2N2NA 4F6RC 4CZZB 4CS7A 1OKKD 4Q25A 1ZW3A 3T4RA 3ABMC 3H3MA 3EZHA 1Z6AA 3RIPA 3AE1A 4BG0A 2CCYA 3AEFA 4LLCA 2XJ7A 3ZG1A 1HS7A 2ODUA 2X9WA 2JQHA 4IDOA 4LF6T 4WBNE 2WVQA 3P4RA 4J7YA 3UT5E 4U5GA 2XLVA 2XM1A 3UU3A 2W9YA 4YTMA 1DOWA 1I5NA 2AWYA 5DJQC 2R25A 5L3FB 3E22E 5A69A 2PBEA 4Z9HA 4ZI2D 1FTSA 1JOGA 4EZ4A 1V4AA 1R8IA 4Z8XA 5J2TE 1SMYF 3FXHA 5KX5E 3LS0A 1JPJA 4YXDA 3ATPA 2E5VA 3MK7C 3J9X1 1MMDA 3ZCJA 3W8IA 2V26A 4ISTA 4ZS3A 4JI2T 5LJNA 1YKEB 5JDHA 2EPLX 5LG4A 4NXMT 4XAXB 4ULVA 3P50A 4CI2B 1ORSC 4I4TE 5CA1E 1TR2A 3KPHA 3DZAA 3CQXC 4U5EE 4J2CA 4MBQA 5FY0A 3ASOC 4GOUA 5CB4E 1JRAA 4COFA 3G06A 3UUNA 3VRBA 4L6RA 2YDQA 3HJCA 1OW7A 2QVAA 3MXZA 2QLAA 2WZGA 5FKYA 4CS9C 1MMAA 4X1YE 5EK0A 1O3XA 3AE8A 1V74B 4PR9A 2LSKA 3Q7GA 1WR0A 1HFAA 2NWBA 1N34T 4JRZA 3PURA 2UXDT 2Q9BA 3IF8B 2A0BA 3AOUA 4IB4A 3T1YT 2HMZA 1X9BA 5AQIB 5AQJB 1VYIA 4Q5SF 5KYWB 2GK9A 3DMDA 1PD1A 4YFSA 5LGTB 2X9YA 4EBJA 2UU9T 4GEHA 2YLGA 3OA1A 4UF0A 2IOQA 3GN5A 2H89A 3GMIA 4OIPF 3QVYA 2YN6A 4HFVA 5L3QA 4CN6A 3K66A 4YWQA 2XAJB 4JCZA 1E7PA 5HWXA 1I94T 5K0IA 4JI7T 3EGXA 2YLDA 4QX7B 3TK0A 3IPMO 5AQRB 5AQOB 3JCFA 1E2AA 2J4GA 4MVOA 3QVZA 2XZEA 4EEDA 4Q4ZF 2R7UA 3AA0B 3O9XA 2F22A 5AQQB 4BJ6A 2BG9E 2ZM0A 3KBUA 2B0HA 2Q4FA 2EILC 5B1AC 3WHNA 5FZTA 5F3JA 1LI5A 2UXNB 3Q7LA 1D1BA 1NFOA 1WR6A 5A6KA 4UVAB 5A6AA 3NYLA 2KLQA 3LJCA 1KNRA 2CRBA 5ABFA 3RGLA 4LFCT 2Y3HA 3US6A 4EAHA 4WYVA 2V7MA 4LF8T 5AQTB 1LVFA 4L0RA 1M2VA 3W15B 3C51A 2NW9A 2IM8A 3GEIA 3CEXA 4PFPA 3HNLA 1GS9A 2XLHA 3RH3A 1NSGB 2CWOA 1QVXA 3JRTA 3KYIA 3ZTZA 2CBIA 4TNVA 3ZJ2A 4C3DA 2CW0F 5AQGB 4DR3T 3LFMA 4BJ6C 5LGUB 4AKRB 4MVMA 1APCA 3Q6NA 1TWHA 4NTAA 4KNWA 5D92A 1E85A 3EPVA 2CMRA 5L3BB 4I55E 1A7EA 3JSEO 4MTOA 3C8ZA 2N9DA 1UX4A 2PP4A 3PUAA 4O4JE 4X1KE 2QA7A 2OJQA 2MHRA 2VK9A 3TJ6A 2L6GA 2RSEB 4U72A 5AQHB 3MYIA 2CGEA 2JJ9A 2Z15A 1I6ZA 3RYIE 2IC6A 4LMJA 2CLYB 1E2XA 3UMKA 1T7SA 1D0XA 5ETWA 3ZSTA 4PNIA 3A8YC 3E08A 2W4BA 4DV3T 3FVYA 4NC3A 1N1CA 3CMLA 1O3UA 2VKHA 3CX8B 4MNDA 4O6NA 4LERA 1FMWA 4ILUA 4DNDA 4EYUA 3KYJA 1HX8A 2M67A 4O6YA 2LKHA 2CNWD 2LCHA 4CS8C 4ADZA 5DABA 2WP9A 3GA8A 1O87A 4FESA 4KI2A 3VKHA 4CXXA 2J45A 5AQMB 5COFA 2E5LT 4Z90A 5J2UE 4ZXLA 1BZ4A 2EHOA 4YJ2E 2Y6XA 4K1OA 3FZLB 4U7IA 4A5XA 2XHEB 3DAGA 2ZXPA 1A41A 2H3RA 3N2OA 3P4PA 2YVKA 2VKJA 2A2FX 3DD7A 1IZNB 2V1DB 2CCQA 3FZMB 4JURI 1VB5A 3JC6D 5LHHB 1C03A 3H2VA 4CIHA 4F4BA 2KSRA 1I4ZA 2LSEA 3L1MA 1OR2A 4FJOA 1T9KA 2M64A 4XPYA 1NLXA 2CWYA 5L4EA 4O6MA 4UVCB 3A5XA 4JVSA 1QSDA 2X0CA 3DM9B 3RQWA 1WFDA 2HJ3A 2Y39A 3OYXA 2M6BA 4U9EA 2YDRA 4YSXA 4TNWA 4PJMA 3M4CA 1XMOT 3ZQYA 2K5BB 5FMNA 3VAYA 3NKDA 3RQFA 2BS3A 4P09A 1HE9A 5ABHA 1M7KA 2EHOC 1ZHWA 3BRJA 2OKUA 3O1JA 2VKOA 1ZZPA 2V6XA 4DR5T 1NWMX 4EOZB 3VF0A 5TAOA 3QW0A 3ZT5A 3MACA 4LMLA 2EINC 1Z7Qc 4CN4A 1UK5A 1U6HA 4EXTA 3DKAA 2Q00A 4CBEA 4NTFA 3T6BA 1WGWA 4NUUA 4JJFA 2BE5F 3OJAA 3PCVA 3C64A 4PJNA 5F5FA 4H9OC 3B9QA 1NU9C 3ZSSA 3SP1A 2OA5A 4JYAT 1G5ZA 2HPJA 1VK5A 3WAJA 2C04A 3AQBA 1MIVA 1EA8A 4D4XA 4J7TA 2HN1A 2OLTA 4K0KT 4DMWA 2LFDA 4QH4A 3HLZA 4HKAA 3LK3B 4H9PC 4R32A 4H63H 2MPKA 4KI0F 1CHUA 2G0UA 3WI3A 3ZMZB 3N0TA 4O4LE 3LAYA 4RD9A 1M57C 2L6FA 3ZC1A 3KMIA 1EI7A 2HKVA 5BQHA 1KEYA 2DNXA 3FHNA 1HG2A 5ADXL 3CVRA 2XAHB 1JPNA 3IHUA 5FP3A 2BL2A 1LKXA 3VU7H 3ABKC 1WATA 2XM4A 2YL0A 4WZXA 4KHPT 2VC9A 2CXFA 3E0ZA 4DR7T 3FOOA 1K04A 4TV9E 4JI3T 4PJLA 1Z63A 1ORJA 4GK5E 4N4WA 1MMGA 1VYKA 1D0YA 2A3DA 4CDYA 3EAMA 5FCLA 4YY3T 2XL4A 4AE4B 3M1CB 1XDPA 5E3AA 2J46A 3LJBA 1BDJB 4U2ZA 3UR3C 1FJGT 5DS5A 3C8GA 4I3MA 2OU6A 1LPEA 3PU8A 2PFVA 3RHWA 3EDVA 1NFNA 1KTMA 2R05A 4WBOA 4JEBA 3DJBA 2KWIB 1N32T 2HSQA 4LACB 3GM2A 2KJGA 5AC5A 2V7IA 3JZ0A 2KNHA 1JNZA 4O2BE 3S4UA 4BJ5C 3KV9A 2V8SV 4XEKA 5KYYB 1F1MA 5AQPB 3MZKB 3S29A 4HFIA 4E17A 2XQ4A 1XDOA 3AJMA 3SXZA 3HL6A 2IW5B 1T72A 3C4ZA 3ETVA 4DJ9A 3CK6A 4ZHQE 2YKSA 5L0GA 5CJ5A 4YTPA 3L0IA 5A6JA 4CSAC 1YJGA 1YYJA 2ACZA 3FXDB 2YHSA 3LBXB 4HEAJ 1XWJA 3H37A 1ZU5A 1WLXA 2O9XA 3Q6MA 4QI2A 5JDLA 3W2WA 1Y4CA 2Y48B 1NZEA 2XQ9A 4C91A 3T6GB 4EBBA 1W2WA 3F31A 2TMVP 5KDMC 2RPAA 2NP9A 5KYXA 2HS5A 1ORYA 4YT4A 4IE7A 2KGOA 3GN5B 1V55C 2WU5A 3ZMTB 2P61A 3X2QC 4WNKA 4O4HE 5L3DB 4F8HA 3EGXB 2HFIA 3SNHA 5L0JA 3O4XE 1HW2A 1FFTC 3SXYA 2W00A 3SYNA 1GM5A 3AE9A 3RC3A 2ACXA 2BZBA 4P9TA 4B6IA 4BAYB 3CKDA 2MOZA 3ZCIA 2J62A 1ZP0A 3JSZA 1SYQA 5L0HA 4RDAA 4IREA 2X67A 3VR9A 3EABA 2A6EF 2GA0A 2H7BA 3U2LA 2WZLA 1YAUO 2VL0A 3AE4A 4DOZA 4O4IE 3R7CA 2WB5A 3HKKA 4ILCA 3JYYA 5COGA 3X1OA 1OXZA 1J5WA 3NMJA 3KDSE 4NIQA 4OIQF 3NMIA 3Q5EA 4JEUB 4O8SA 2EHOD 2Z6EA 1ZKEA 2AXDS 3PUGA 1R4TA 2YU2A 3HKCE 2LSGA 2W61A 2WZIA 5JDMA 5A6BA 3AG1C 4JJGA 1TFOB 3KV6A 5LYJE 1AVOB 2YEVC 1QZXA 3O6XA 2C0SA 1HW1A 1ZEEA 4XPXA 1RMVA 1UCUA 3DE9A 4YN0B 2ES0A 5HAXA 2WVOA 3I0OA 3L09A 2XSBA 4KBMB 2ODVA 3B29A 2LQGA 4LDQA 3B5MA 3ZLIA 5JS5A 3ANWA 4CN1A 4Q7CA 3ZQVA 2UXXB 4KHZF 3PUXF 2OG2A 3QMKA 5LOVE 3IBPA 1SZIA 5JT4A 2LEHA 1U89A 4WGZA 2XQ8A 4IGUA 2IXMA 1N33T 1YVIA 5IY5C 5F28E 4J32B 3GEEA 4XEFA 3EDUA 4ILBA 1XNRT 5E33A 2EIMC 2E9XA 3QUJA 5J1GA 5T3TA 3AA1B 5AQLB 3KV5A 4GYTA 5HEHA 2V6YA 4TWDA 1FMVA 1QPUA 1UFBA 3AVRA 3SZRA 2N1GA 3PUWF 3TOLA 2XLDA 5HEUA 3UMIA 3I1AA 3RKOF 4OK0A 3PJAA 3AE5A 2X0HA 1Y01A 2J9VA 3CIRA 3ITFA 5HEOA 4MTFA 4B3ST 1Z23A 4U3CA 1LIHA 3RC8A 4EBKA 3K3OA 3A9CA 5COMA 1YQ3A 2XAGB 4GKJT 5AGFA 3KV4A 4DV4T 3RYCE 5HXSA 5AQNB 2UXBT 2RA1A 4CXYA 3RIUA 1TWCA 4AKGA 1FIOA 1WN0A 3JAFA 4D4NA 3JAEA 3G4XA 5AQVB 1L7CA 3JT1A 3I5QA 3LS1A 2XXAA 3AECA 3HKEE 2YKZA 3NRXA 5FL1A 1O5HA 4ASKA 2HJMA 1T5OA 3ZT7A 5B1BC 1WTYA 3K1HA 3C63A 2M6IA 4H4KC 2ETSA 3G4ZA 2X9XA 1M56C 1NBBA 1OCOC 1VOMA 2UUAT 4IGGA 1YLMA 4U74A 5ABEA 3SFDA 3EHZA 3UTKA 4U9DA 2E9XC 3UGOA 2XL8A 2LLYA 2KWHA 3ZMVB 2PBIA 2F4VT 1A0BA 1S35A 2H7VC 4EEBA 4DO0A 3RPUA 3TJ5A 3OYZA 4B3MT 1YA9A 4C90A 5DS6A 2PX3A 4JI1T 2YLIA 5EHHA 1BR1A 5GPGB 3WODF 5F8PA 5LHIB 4MW8A 2CHOA 4H9SE 5L3EB 3NYJA 2NUPA 3IA3A 3SWHA 5HXEA 3T6JA 3QC9A 3L8IA 2IXPA 3V5UA 1HE1A 2JD3A 3UFEA 4U5CE 1OEDE 1HNXT 1MNDA 5CI8A 2YL7A 2D2SA 3EI0A 3EVYA 4IDQA 4U33A 5TJ5E 4I50E 3B0UX 3LUTB 2WDVA 4LF9T 3I9WA 3K3QC 2A72A 3HKBE 2AWCA 2KNDA 2FGYA 3WG7C 4XBFB 2OEXA 3W8HA 5AQSB 4IRUA 2PG8A 1ZVZA 2OV9A 1RKEA 5JQGE 3ABLC 3N2GE 2NG1A 3ZN0B 3SS1A 1IJ6A 2XLWA 4YL3A 4HWDA 5C3JA 3K6BA 4HFBA 1EQ1A 2K24A 2IBFA 2G3VA 1WOLA 1W9RA 2FUPA 3AEAA 4ZS2A 5L4HA 4JIOA 4Z91A 3OEOA 4P1NA 5A6BD 1T8BA 2DGJA 1OEDB 4MVSA 1SE7A 3C4WA 1VCSA 3LESA 5LXTE 1IBKT 5FXZA 3RI5A 1QSPA 2BG9C 2I15A 4O79A 2L6HA 2Y3BA 4H9RC 2EPMX 3M15A 1CGOA 1HR0T 1OCZC 3K8PC 2A0UA 1YARO 1WYCA 2LT3A 3FAPB 4O2AE 4EZHA 2J9UA 2XPKA 2P9BA 2QNLA 3I9YA 3DWWA 2IXNA 4XTKA 2LOSA 4TX5A 1HMDA 5FVKA 3UU4A 2CE7A 2XQAA 5LBQB 2WMNA 5DQTA 1IZMA 3Q5WA 2QUPA 3WAQA 4YK5A 4X20E 1DOVA 2J0XA 3ABVA 4QI0A 1XMQT 3PE0A 4QX8B 4PW8A 1E83A 3IQ6A 1FEWA 5BR8T 1T6QA 5T1DB 5JR9C 4G7HF 4C7OA 5JRCA 3PUYF 4UV8B 4CX9A 1M2VB 3AA6B 3GWLA 2KSFA 3F46A 3RVZA 4AXPA 1AJ3A 3U3BA 4IL9A 1D0ZA 4L9IA 2WZFA 4FX5A 3K1IA 3L3PA 3AG2C 3UULA 2GDCA 5HXHA 4C3EA 4EHPA 3UNGC 3EG9A 2HN2A 2W67A 1FR0A 4LLEA 1ZHCA 2QRXA 2Y69C 4NY3A 4DBQA 3CX7B 1OW8A 2FBWA 4DRJB 4E7ZA 4ANJA 3LNMB 5FY7A 4MQ9F 3GEHA 4HWHA 3P4QA 3S9OA 2YQYA 2WSSV 2VB6A 3R84B 1B7TA 2V7LA 1T98A 1YA7O 3PDYA 3BK9A 2P6VA 3AE2A 2ZPAA 2R7VA 3V5ZA 3SOLA 2IC9A 2JX0A 4B6XA 1J5ET 4QWNB 2XAFB 3GWHA 3PTRB 3UFGA 2WBLA 3E70C 4ONSA 2CXLA 3F57A 3NZPA 4K0UA 5HV9A 2L8KA 2XQ7A 2I0MA 1GGQA 5GONE 1LRZA 1Y64B 4X0RA 1UUSA 3O39A 1CPRA 1T6IA 3TULA 4X1IE 3HR0A 1KF6A 3CQGB 2XS8A 2KK1A 3ESLA 2NW8A 4AQYT 3ZWIA 4AX2A 4A4AA 2R7SA 2AP3A 5JRCB 4O7GA 5JDGA 2Q9QA 3GWNA 1HMOA 2YU1A 2EHOB 3UUMA 3CZ6A 3FZFB 4WW0A 1HF8A 4DUZT 2QGSA 3UU5A 3PUSA 3ETUA 1MIWA 1S7ZA 3EHNA 1YXRA 2EPNA 4KMCA 2IAKA 2X9HA 4DR1T 2ZM8A 2BBHA 1JNRA 2FJEA 4TUYE 1E84A 1YQ4A 3B13A 4ULWA 1PD0A 2XS1A 2NTXA 4JUYA 4AKHA 2R7OA 2GWWA 2KQ9A 5LG3A 3V7OA 2LOPA 4DXWA 2AE9A 3EH2A 3RX6A 2ZM6T 4FI5A 1YZCA 3N9QA 2R7QA 3C18A 4BPMA 1J1JA 2DWKA 2NSGA 5KYXB 4GKKT 2E8IA 3B57A 3RYFE 3RQEA 5KYWA 2MYSA 3FBZA 3QTHA 4MTGA 4NQFA 2L9QA 4TWHA 2W4XA 2WMOA 2XXAB 3NZQA 4AKIA 4HWCA 2C03A 5JVDE 1SHZC 1KFYA 4OX9T 3GM1A 3U9MA 3N9NA 3HTKC 2I6HA 4JEAA 4DRIB 5LJMA 1LVKA 1WCRA 3ZIBA 3POVA 4G7ZF 4OYKA 1M6TA 2W0GA 4HE8D 3N9PA 3PDMP 4EKWA 1U4QA 4E18A 3Q5DA 1VLSA 1S05A 1Q0GA 2RD9A 1GQAA 3VRCA 1UX5A 1PV3A 2XLEA 4WGYA 2C5KT 3P8CD 4AL0A 4CXWA 2XL6A 4YSZA 3P4WA 1HX1B 2CEAA 4IT4A 1BR2A 3CPZA 4EGWA 3EFOA 2LHNA 1VTMP 3B71A 2W63A 2YOEA 4DRHB 2VVSA 5BQGA 3R2PA 4W8KA 3KBTA 1Z3IX 3V5XA 3RQUA 3AGUA 2YRFA 3BQIA 2DI4A 2XASB 5EK3A 1OQCA 4I44A 1MMNA 2IXOA 4QXCB 1QKRA 2VH3A 5JLIA 1GQEA 2YZSA 2WCAA 2LJLA 4XEVA 4BJMA 5JDQA 3QOFA 1IBLT 1RKCA 1Y6DA 3AEEA 4A2NB 5E0OA 2JQ9A 5CA0E 3VKGA
chains in the Genus database with same CATH topology
3AG3C 3QMKA 3QZCA 2R7TA 5DQZA 2NUTA 5A1LA 5LOVE 3IBPA 4UF0A 1SZIA 3EGDA 3OA1A 4E7SA 2LEHA 2IOQA 3GN5A 3GMIA 3E9VA 4OIPF 3J7Yq 4H63V 5IHYA 2CDQA 2NUPB 3F47A 4HFVA 4A56A 4IGUA 2IXMA 3K7DA 4CS8A 5L3QA 3MKDA 3K66A 5IY5C 4YWQA 2WAUA 3AAEB 1KNZA 3I4UA 4J32B 2E9XD 2JPFA 2XAJB 3UUXB 3EG9B 3S28A 3EDUA 4C3BA 3EFOB 4CS9A 4TV8E 5HWXA 3LEVA 5M4YA 2PX0A 3EGXA 3OBVE 5LNKA 4JEHB 5E33A 2EIMC 4QX7B 1QUUA 4ZI7E 2E9XA 2J7PA 3QUJA 5J1GA 4U5DE 2XUEA 3AA1B 2VKDA 2KINB 4IE5A 4BJNA 3KV5A 4GYTA 3KKBA 3NG1A 5DQWA 1YKHB 1FMVA 2VL8A 4ZI3D 5L2LA 3D0TA 4I44A 2NUTB 2KT9A 3AVRA 3SZRA 4UF0B 3HA4A 2N1GA 3N9MA 4Q4ZF 2K9AA 1OWAA 3HKDE 3UMIA 3I1AA 3RKOF 2Q9QC 2R7UA 4AI6A 2DHRA 5DQVA 3AA0B 4OK0A 3O9XA 3EH1A 3NRYA 4BJ6A 1MIYA 3NRHA 4I1OB 1QLEC 2W4BA 4MHCA 2ZM0A 2J9VA 3ZVRA 3KBUA 4YT8A 5LCYA 4HFKB 1HTJF 3ITFA 1V54C 3RRWA 1Z23A 2ZMAA 3RC8A 2EILC 3K3OA 4OIOF 4PK4A 5B1AC 2XAGB 2YINA 2PJQA 3KV4A 2XAQB 3RYCE 3V5SA 5F3JA 5HXSA 1J8YF 3F2EA 3S27A 2RA1A 4CXYA 5IYZE 1TWCA 2UXNB 1BR4A 3U3IA 1D1BA 1FIOA 3DTOA 2KMFA 4AKGA 3FHDA 3Q7LA 1WR6A 2B1EA 3JT1A 2BVMA 3M65A 4UVAB 3ASNC 3I5QA 3JCUQ 3LS1A 3HKEE 2XXAA 3NYLA 2KLQA 2E87A 2M4EA 3LJCA 2V7JA 3NRXA 1O5HA 2Y3HA 4ASKA 4EYYR 4EAHA 5B1BC 3K1HA 2V7MA 4H4KC 4P0BA 2W45A 2DWGA 3I5PA 1LVFA 2X9XA 4L0RA 1M56C 1M2VA 1OCOC 1VOMA 3W15B 4DVYP 5B3SC 3C51A 4U74A 3MX3A 2NW9A 4UV9B 4QHOA 2X51A 3UTKA 2E9XC 2E9XB 5KYUA 3AA7B 3UGOA 4PAGA 4QDLA 2KWHA 4PFPA 3Q2MA 3ZMVB 3RH3A 4XLPF 2PBIA 2ZXPA 2CWOA 2LM9A 3JRTA 2X0LB 1S35A 2H7VC 2RP4A 2JMHA 4DO0A 2D5RB 3RPUA 3ZJ2A 4C3DA 3OYZA 4YT4A 2CW0F 4C90A 3LLKA 4BEJA 4XWJA 5DS6A 3LFMA 2WVNA 3ZYLA 4BJ6C 5LGUB 4AKRB 2PX3A 5AFUL 4WJ0A 4U5BE 5EHHA 1BR1A 2J7PD 4IAOA 3Q6NA 4ZLDA 3LNRA 5LGNB 4HE8A 1TWHA 5F8PA 5LHIB 2WB7A 3WODF 4H9SE 5L3EB 4KNWA 3NYJA 2NUPA 5D92A 4TZ4C 1M2OA 2Y3DA 3OWTA 3SWHA 3EPVA 5HXEA 2CMRA 2XQYA 3DAFA 3T6JA 5L3BB 4I55E 3QC9A 3BQKA 3V5UA 2IXPA 3AG4C 2A69F 2JD3A 5JR9B 3UFEA 2N9DA 1UX4A 4U5CE 3FDQA 5EK2A 3N24A 1MNDA 5CI8A 2PP4A 3PUAA 3Q5XA 4O4JE 4X1KE 2QA7A 4N06A 3B0VC 2D2SA 3EVYA 2CLYC 2HV6A 2VK9A 4I50E 4U72A 3B0UX 2K48A 3PMRA 4YJWA 4YT2A 2CGEA 2JJ9A 2Z15A 2YK0A 3I9WA 2DCFA 2A72A 3AAIA 2IC6A 3K3QC 3RYIE 4DBRA 2CLYB 1HCIA 3HKBE 3UMKA 4HFFB 3KINB 1U5PA 3ZMSB 2KNDA 2FGYA 1D0XA 4XBFB 3WG7C 1D1AA 5ETWA 4PNIA 3E08A 1ZHZA 2DYSC 1VRBA 2PFDA 4OHFA 2PG8A 3N9LA 5FY1A 1N1CA 4AQGA 2XSEA 4IRUA 4XLNF 4BJ1A 3CMLA 4KNVA 5JQGE 4JLEA 2X68A 4IE0A 1YD8G 2VKHA 3CX8B 1FFHA 3N2GE 4QWNB 2NG1A 2Q9CA 4N78D 3ABLC 4GK0E 3ZN0B 3SS1A 1IJ6A 1FMWA 4UELA 1BR0A 4ILUA 4LERA 4AQFA 2ZXOA 4DNDA 4EYUA 3ZJ1A 1HX8A 3K6BA 2K24A 2M67A 5T3TA 2G3VA 2R7XA 4O6YA 1CUNA 2CNWD 2Y3GA 4CS8C 4ZS2A 4ADZA 5DABA 1TKNA 4EB6E 1ZU4A 5DLJA 3GA8A 3OEOA 1O87A 4GYSA 4FESA 5D91A 3VKHA 4KI2A 3LK2B 4CXXA 2G3KA 2J45A 4OIRF 2DGJA 1TWGA 5J2UE 1KK7A 3OKQA 3C4WA 3LESA 3LG7A 4G2AA 2EHOA 5KMGP 3KFWX 5EZYE 1ZV4X 4YJ2E 5LXTE 4K0DA 5FXZA 4KP3C 3PHF2 5FNVE 3AAAB 2Y6XA 5LHGB 1TWAA 4I43B 2ZXWC 4O79A 2G62A 2X66A 1D1CA 1EZ3A 2L3LA 2XHEB 4H9RC 4IE6A 4PJJA 4MFRA 5HXCA 2D0TA 4IHJE 2H3RA 1ZHXA 3RFYA 3N2OA 2PF4E 1OCZC 3EQLF 4QKNA 2VKJA 3K8PC 4UEMA 2A2FX 3DD7A 1IZNB 3FXEB 2CCQA 2V1DB 4JURI 1WYCA 3C50A 1IAPA 3JC6D 3ZYKA 5LHHB 2NW7A 4XZCA 2LT3A 2Q9QD 4O2AE 4EZHA 2J9UA 4P6IC 4F4BA 2LSEA 4HGAA 4L5GA 3AQCA 2P9BA 3LLIA 3CSKA 2WL8A 5JDFA 4FJOA 2J9WA 3I9YA 4XTKA 2IXNA 3UMHA 4MLKA 2CWYA 2LOSA 2J1DG 2CA5A 4TX5A 5FXVA 5JR9A 3KL4A 2CE7A 4OD4A 4O6MA 4UVCB 4HEAA 3A5XA 4JVSA 1QSDA 5LBQB 2WMNA 3P7IA 3DM9B 1IZMA 5DQTA 2Y39A 3OYXA 3Q5WA 2EIKC 4HTEA 4X20E 4IIJE 4TN7B 2KW3C 3K33A 5HWYA 5L3VA 2J0XA 4CSAA 4PJMA 4G0HA 3AB3B 4EIWA 3TKLB 4YJ3E 4AE4A 3RKOA 2P7VA 1YW0A 4QI0A 4BA9A 2K5BB 5FMNA 3VAYA 3PE0A 4QXHB 4QX8B 4C7OB 3O1IA 2C5IT 4PW8A 3N2KE 3NKDA 3CX6B 1FEWA 4P09A 3ONXA 4U5HA 5FYMA 5DVWA 2EHOC 2SPCA 2CM0A 5T1DB 3EUHA 5JR9C 5HYAA 1ZHWA 3O1JA 1SA0E 1RJ9A 2VKOA 4G7HF 4ZOLE 4C7OA 5JRCA 3JC6C 1NWMX 4UV8B 2LHRA 4V1Av 5TAOA 4EOZB 5JREA 1M2VB 3AA6B 2MWQA 3FAJA 4P0AA 3F46A 3MACA 4AXPA 1AJ3A 4EWCA 3KH2A 2D0UA 1D0ZA 1S94A 4L9IA 2EINC 2WZFA 3GANA 4FX5A 3VYWA 4PK5A 1OKKA 5FXXA 4EXTA 4NUVA 3L3PA 3AG2C 3PUQA 3UULA 3B0PA 5HXHA 4AK9A 4C3EA 4OD5A 3UNGC 3EG9A 4UVBB 4CBEA 5DS4A 4LLEA 1ZHCA 1J8MF 2Y69C 5JH7E 3T6BA 1WGWA 4NUUA 4J30B 4IJJA 4DBQA 4NY3A 3LK42 4JJFA 3CX7B 2A6HF 2BE5F 2I8BA 4K7BA 4U5FE 5HSWA 2XTLA 3OJAA 2LSJA 3C64A 4PJNA 3QK6A 4E7ZA 2WM9A 4YLHA 4ANJA 1SF8A 1RJ9B 5F5FA 4H9OC 3ZMUB 3B9QA 4M1PA 1NU9C 4JCHA 3SP1A 3UGPA 2OA5A 3DJUB 1E1HB 2HPJA 1WRDA 3WAJA 1VK5A 2C04A 3AQBA 5FY7A 4OINF 1MIVA 3LBXA 4CI3B 4MQ9F 5E3CA 3ZPOA 2IYLD 4YT5A 1Z5ZA 2YEVA 2ZLYA 3WAKA 2WSSV 2Q3TA 2VB6A 4DMWA 3R84B 1B7TA 5EK4A 2V7LA 3EZIA 1T98A 4HKAA 3KVAA 1HG5A 3LK3B 2LE8A 3MJXA 4H9PC 4H9NC 4H63H 4JZAA 3PDYA 3BK9A 2P6VA 5C8YE 2HH7A 2QY9A 3S0XA 2G0UA 2NTYA 3WI3A 4AQFC 3ZMZB 2ZPAA 3HLZA 3N0TA 3N2ZB 4O4LE 3R6NA 3CQZA 2R7VA 3LAYA 1NU7D 3SOLA 2IC9A 1LS1A 1M57C 2H7OA 1ZHTA 4RD9A 5CI9A 2NOXA 3DP7A 3ZC1A 3NKEA 1ZYRF 3KMIA 4B6XA 2DNXA 3H3AA 4MALA 2XAFB 3FHNA 1HG2A 3GWHA 2D5UA 3PTRB 3CVRA 5LBMA 2XAHB 5ADXL 4ZI2C 1JPNA 2WBLA 5FP3A 2XRHA 2GFHA 3E70C 3BQLA 2CXLA 3F57A 3NZPA 1LKXA 4K0UA 5H6RB 5LA6E 3VU7H 2L8KA 3ZEFB 3ABKC 3SEOA 4RBNA 1MNEA 3W2VA 4GIWA 5BUOA 5GONE 3ZC0A 1LRZA 4HN9A 1Y64B 2CXFA 3E0ZA 3H65A 4X0RA 3O39A 5JDNA 2MTQA 2KZ7B 5HXRA 4PFOA 3EGDB 4TV9E 2I59A 4ZI3C 2V3CC 4PJLA 2Q9QB 4X1IE 4OYJA 3HR0A 3CQGB 3W8HA 1PCXA 4GK5E 5KYNA 1Z63A 3ESLA 3NDBB 1MMGA 3AVSA 1VYKA 1D0YA 3FB2A 2NW8A 4AX2A 2R7SA 2A3DA 3MA9A 4CI1B 5FCLA 5JRCB 2XL4A 4O7GA 3K3NA 4M63A 3M1CB 3TD7A 4AE4B 5JDGA 2J46A 5E3AA 4GYRA 2Q9QA 3IHRA 3LJBA 3T8OA 4UIGA 4CQIA 3UR3C 5DS5A 1WYBA 3VHLA 2QTVA 5E2QA 4BJTA 2ZXRA 1IW7F 4I3MA 2YU1A 2EHOB 3UUMA 3CZ6A 2JMKA 3PU8A 2OCCC 2Q9AA 5F5HA 2EIJC 1H7CA 4WW0A 1HF8A 2LSYA 3EDVA 1IJ5A 2PFVA 4KC9A 5KYUB 3IEEA 3K1IC 4QXBB 2A1DD 4WBOA 5LP6E 3DJBA 2QGSA 1S7ZA 3PUSA 3ETUA 1MIWA 3ZN1B 2KWIB 3KVBA 3N5LA 3EHNA 4KMCA 2IAKA 2X9HA 4LACB 4O6NA 2ZM8A 2KJGA 3N9OA 3EHMA 2R7WA 2V7IA 5T3WA 4CIHA 2VWAA 2KNHA 4O2BE 2L81A 3S4UA 4BJ5C 3KV9A 2Y3BA 5L3GB 2A68F 3O1HA 5KYYB 3MZKB 4IDZA 2L9JA 4TUYE 1OCRC 3S29A 2BDEA 2R7RA 3B13A 2V7KA 3MLGA 4ULWA 1PD0A 3U78A 2Y8DA 3HL6A 4UXNB 2NTXA 2IW5B 3DM5A 3C98B 3C4ZA 4JUYA 1NAFA 3ETVA 4AKHA 3PU3A 5L3CB 2CNWA 2R7OA 2KQ9A 3FVYA 3V7OA 2FFHA 2LOPA 5KYYA 4ZHQE 2N2NA 4F6RC 4CZZB 3EH2A 3RX6A 3L0IA 4CS7A 4FI5A 4CSAC 1OKKD 4DMVA 2HPLA 3T4RA 2W4MA 3ABMC 4PK6A 3RYHE 3FXDB 3N9QA 3HI2A 1Z6AA 2YHSA 3LBXB 3EZHA 3RIPA 2R7QA 4JW1A 4HEAJ 4BG0A 3H37A 2BVLA 2DWKA 3JYHA 3I0QA 1ZU5A 5KYXB 4LLCA 1WLXA 2O9XA 3Q6MA 3NYMA 4QI2A 3ZG1A 1HS7A 2ODUA 5JDLA 2E8IA 2X9WA 3W2WA 2Y48B 3B57A 1NZEA 4C91A 3RYFE 4EBBA 1W2WA 3F31A 2HV7A 5KDMC 2B0JA 2NP9A 5KYWA 5KYXA 2MYSA 3FBZA 2LSIA 2WWUA 4IE7A 4WBNE 2KGOA 3GN5B 2L9QA 1V55C 2WVQA 3DJNB 2WMOA 2XXAB 3NZQA 3UT5E 2MBGA 4U5GA 4ISSA 4AKIA 3DAGA 3ZMTB 1ZHYA 4G7OF 2C03A 5JVDE 4KBLA 2W9YA 1SHZC 1Z0PA 3X2QC 4IWBA 4KUMB 2JQQA 4WNKA 5DJQC 5L3FB 3E22E 4O4HE 4OFZA 5L3DB 3ZSUA 3N9NA 3HTKC 3EGXB 3SNHA 3O4XE 1FFTC 3SYNA 2W00A 4ZI2D 1FTSA 3GODA 3RC3A 2VASA 3CQCB 4EZ4A 1G73A 1LVKA 2ACXA 2BZBA 5LJMA 4BAYB 1G8XA 4I1MA 2CXDA 3ZIBA 4B6IA 3CKDA 2MOZA 3ZCIA 4G7ZF 4Z8XA 5J2TE 3POVA 4AKLA 1SMYF 4OYKA 2W0GA 5H6QB 4FWVA 2DLRA 3JSZA 3N9PA 4HE8D 3EJNA 5KX5E 3LS0A 3ANWB 4RDAA 3NBXX 1U4QA 2X67A 1JPJA 2W62A 2A6EF 2H7BA 2C5JA 3MK7C 3J9X1 1MMDA 3ZCJA 2WZLA 3SRZA 3L34A 3W8IA 4BJ5A 4DVZA 3Q9DA 5EGYA 2V26A 4ISTA 4ZS3A 5LJNA 1YKEB 1OCCC 3RYLA 1UX5A 4DOZA 5JDHA 4O4IE 3FBLA 2C5KT 3P8CD 3CWZB 4CXWA 3X1OA 1OXZA 1US7B 5LG4A 4XAXB 3RRCA 2CEAA 4CI2B 1BR2A 3KDSE 4OIQF 4I4TE 4JEUB 5CA1E 3CPZA 1TR2A 3EFOA 2LHNA 4O8SA 2EHOD 2Z6EA 2W63A 3CQXC 3DZAA 1ZKEA 4U5EE 4J2CA 4ERRA 3PUGA 4MBQA 5FY0A 5BMVE 3ASOC 3ECSA 4GOUA 5CB4E 2YU2A 3HKCE 2LSGA 2W61A 3UUNA 5JDMA 3KBTA 1Z3IX 4W8KA 3AG1C 4JJGA 3ZC4A 4G63A 3HJCA 3MXZA 3BQIA 2DI4A 2XASB 5EK3A 2WZGA 4CS9C 4ZLCA 2ZM2A 1MMAA 3KV6A 4X1YE 1O3XA 2YEVC 1MMNA 5LYJE 1QZXA 4QXCB 2IXOA 2J0WA 3O6XA 2LSKA 4MNDA 2VH3A 2C0SA 2NWBA 1HFAA 3Q7GA 1ZEEA 3ZYMA 2YZSA 3PURA 1X79A 2Q9BA 3IF8B 1KU2A 1UCUA 4YN0B 2ES0A 2KXPB 4H9QC 2JRKA 2LJLA 5HAXA 1VMAA 2WVOA 3I0OA 3DXJF 3L09A 4KBMB 4BJMA 5JDQA 4Q5SF 1VYIA 5KYWB 2ODVA 2GK9A 3ZLIA 1V9DA 5FXWA 3DMDA 1PD1A 4A2NB 4YHJA 5E0OA 3ANWA 4YFSA 1ST6A 4DVDA 2X9YA 5CA0E 5LGTB 2DYRC 4Q7CA 4IE4A 2UXXB 3VKGA 1NG1A 4GEHA 2OG2A 3C4XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IEE A;  3RH3 A;  4YJW A; 
#chains in the Genus database with same CATH topology
 3QZC A;  2FJD A;  2NUT A;  3RVY A;  5JRA A;  3TLV A;  3J7Y q;  2CDQ A;  5IHY A;  2NUP B;  1OED A;  3K7D A;  4JI5 T;  2W2U A;  1KNZ A;  3I4U A;  2E9X D;  2JPF A;  4DR2 T;  1Q0K A;  4MVQ A;  3MBG A;  4CS9 A;  3EFO B;  4TV8 E;  3LEV A;  2XM2 A;  2PX0 A;  2BBJ A;  3OBV E;  4JEH B;  1QUU A;  1A7V A;  2VKD A;  2KIN B;  1YKH B;  4ZI3 D;  5L2L A;  3RF3 A;  3O10 A;  2NUT B;  4QH1 A;  4PAC A;  4UF0 B;  3HA4 A;  3N9M A;  2K9A A;  4ZZB A;  3HKD E;  2Q9Q C;  2P0N A;  2DHR A;  4YHH T;  3EH1 A;  3NRY A;  1MIY A;  1WAS A;  4YT8 A;  4FAP B;  5LCY A;  4HFK B;  3UQ7 A;  1V54 C;  3RRW A;  4OIO F;  4PK4 A;  1HY5 A;  3NKZ A;  2VUR A;  4CJG A;  2HUJ A;  3V5S A;  3OTO T;  3F2E A;  3S27 A;  3ONL C;  2VVN A;  1BR4 A;  2XY8 B;  3FHD A;  3DTO A;  5LMU T;  3M65 A;  2X0Y A;  3JCU Q;  4JC7 A;  2E87 A;  2V7J A;  4MVR A;  3PJA J;  4P0B A;  2DWG A;  2WWV A;  5JUA A;  2HMQ A;  4DVY P;  5B3S C;  5L0I A;  2QYW A;  3AXJ B;  1B68 A;  3MX3 A;  2BKN A;  4UV9 B;  2X51 A;  5KYU A;  2VQE T;  1H9G A;  3Q2M A;  4XLP F;  2LM9 A;  2JMH A;  1Z8U A;  3LSV A;  3LLK A;  1W0A A;  2IIU A;  4NPP A;  3ZYL A;  5BQI A;  2B76 A;  4MVZ A;  4U5B E;  2LFF A;  3AE6 A;  4ZLD A;  3LNR A;  4HE8 A;  3TLT A;  2WB7 A;  2Y3D A;  3OWT A;  4UDV A;  1Q0M A;  3JTL O;  3BQK A;  3AG4 C;  3RIF A;  3FDQ A;  5EK2 A;  3Q5X A;  4N06 A;  3B0V C;  2CLY C;  2HV6 A;  2LP4 A;  3PMR A;  4YT2 A;  2DYR C;  2DCF A;  1N36 T;  3AAI A;  5IWA T;  5LMN T;  1HCI A;  3KIN B;  2DI3 A;  3U5S A;  1ZHZ A;  2PFD A;  1VRB A;  2XSE A;  4OHF A;  3N9L A;  4XLN F;  4BJ1 A;  4AQG A;  4KNV A;  2X68 A;  1YD8 G;  4N78 D;  4GK0 E;  1BR0 A;  4EIY A;  4JBW F;  3QNU A;  4AQF A;  2IUB A;  2BG9 A;  5L0F A;  1K40 A;  2XSA A;  3FZH B;  1YYX A;  2YL3 A;  3S90 A;  1TKN A;  1ZU4 A;  3LK2 B;  1TWG A;  2XM0 A;  4WAB A;  1KK7 A;  3OKQ A;  5AQU B;  4XQ1 A;  4G2A A;  5KMG P;  4K0D A;  3PHF 2;  5FNV E;  1A7D A;  1TWA A;  2G62 A;  2X66 A;  1D1C A;  1EZ3 A;  2L3L A;  5HXC A;  4MFR A;  4CJO A;  2D0T A;  3EQL F;  4I0U A;  4QKN A;  5JSL A;  4UEM A;  4H54 A;  3GM3 A;  3FXE B;  3C8G D;  1IAP A;  3NVO A;  3ZYK A;  1U0B B;  3LEO A;  4XZC A;  1DU2 A;  2Q9Q D;  4HGA A;  4L5G A;  3CSK A;  2WL8 A;  2EPK X;  2J9W A;  3LDQ B;  4MLK A;  2J1D G;  2CA5 A;  4HEA A;  4G78 A;  3P7I A;  4KX6 A;  2EIK C;  5CFB A;  4CDA A;  4A98 A;  4TN7 B;  5L3V A;  3JAD A;  3VM6 A;  1SR2 A;  3AB3 B;  5FVL A;  4EIW A;  4YJ3 E;  1YW0 A;  4X62 T;  4BA9 A;  3OVU A;  2JQK A;  4QXH B;  4C7O B;  5HEG A;  3N2K E;  4LF4 T;  3RIU C;  1E86 A;  4DR6 T;  3ONX A;  5DVW A;  2CM0 A;  1RJ9 A;  1M62 A;  4ZOL E;  3JC6 C;  2LHR A;  3FAJ A;  4P0A A;  3KH2 A;  2D0U A;  3VYW A;  3GAN A;  2LD6 A;  4PK5 A;  1OKK A;  4YSY A;  5FXX A;  3PUQ A;  2UUC T;  1Q0F A;  3B0P A;  4OD5 A;  5DS4 A;  5JH7 E;  3ONJ A;  4J30 B;  4IJJ A;  2A6H F;  4U5F E;  3TLS A;  2IML A;  4X65 T;  2GAQ A;  4LMK A;  5LB7 B;  3RLF F;  3JRM O;  4YLH A;  1MQV A;  1AUE A;  1RJ9 B;  3SXK A;  2YDS A;  2ICW G;  3ZMU B;  4U31 A;  3UGP A;  2DL1 A;  3DJU B;  5HCJ A;  2XQ5 A;  2HHH T;  1E1H B;  4YL0 A;  4EV6 A;  3ZPO A;  3PUZ F;  4YT5 A;  3QB5 A;  1Z5Z A;  3WAK A;  3G50 A;  2XQ6 A;  5EK4 A;  3EZI A;  3KVA A;  1HG5 A;  3MJX A;  3BEH A;  4H9N C;  1HNZ T;  2CPT A;  3M3Z B;  4Z9I A;  2HZ8 A;  2QY9 A;  3S0X A;  2NTY A;  4HWF A;  4AQF C;  3CQZ A;  3AEG A;  3FOP A;  1NU7 D;  5CI9 A;  3U9J A;  3NKE A;  2Q7R A;  4MAL A;  3ZVR A;  4IAO A;  4ZI2 C;  2GFH A;  5DQZ A;  2PF4 E;  5AQF B;  5H6R B;  5ABF B;  1MNE A;  3W2V A;  5BUO A;  4HN9 A;  3H65 A;  1KNP A;  2MTQ A;  5HXR A;  3EGD B;  4PFO A;  2D4U A;  2PNO A;  1LE2 A;  2Q9Q B;  3RQG A;  5KYN A;  3NDB B;  1PCX A;  2L7A A;  3FB2 A;  4IDN A;  4CI1 B;  3K3N A;  3QW1 A;  2LRL A;  4GYR A;  4NTB A;  4CQI A;  3T9O A;  1WYB A;  3VHL A;  2QTV A;  5E2Q A;  4X66 T;  2ZXR A;  2JMK A;  5F5H A;  2WDR A;  4JE9 A;  2EIJ C;  1H7C A;  3IQT A;  1C02 A;  1IJ5 A;  5HCM A;  1AEP A;  3IEE A;  3DE8 A;  3K1I C;  4ZZC A;  2A1D D;  2UUI A;  2QE9 A;  4E0H A;  3N5L A;  3M79 A;  4HWI B;  3ZT6 A;  2OEV A;  3N9O A;  2R7W A;  2P1A A;  2L81 A;  5J0Z A;  4DV5 T;  2A68 F;  1OCR C;  2BDE A;  3MLG A;  1IBM T;  4UXN B;  3DM5 A;  3C8G B;  4LF5 T;  3PU3 A;  1JMW A;  2EPO A;  2FFH A;  1G4W R;  2FJA A;  2JIW A;  1XZY A;  4DMV A;  3AGT A;  2HPL A;  2W4M A;  4PK6 A;  3RYH E;  3HI2 A;  1VLT A;  4JW1 A;  1QLB A;  2BVL A;  3JYH A;  4ILA A;  3I0Q A;  2CBJ A;  3NYM A;  1XZP A;  2HV7 A;  2B0J A;  4ZEY A;  2IHR 1;  2LSI A;  2WWU A;  3DJN B;  3SXM A;  2UXC T;  3RF1 A;  4YL1 A;  2MBG A;  4ISS A;  4G7O F;  1ZHY A;  4KBL A;  1Z0P A;  4IWB A;  4KUM B;  2JQQ A;  4OFZ A;  3ZSU A;  2JPU A;  3GOD A;  2VAS A;  3CQC B;  1G73 A;  2WQY A;  1LM3 B;  1UG7 A;  4DV1 T;  4I1M A;  1G8X A;  4HFH A;  2CXD A;  1QQ3 A;  1RXQ A;  4AKL A;  2WY2 A;  5H6Q B;  4FWV A;  2DLR A;  3EJN A;  1ZOY A;  3ANW B;  3NBX X;  2W62 A;  1VCT A;  4AL1 A;  2C5J A;  2A9U A;  4BJ5 A;  3SRZ A;  3L34 A;  4DVZ A;  5EGY A;  4U2Y A;  3Q9D A;  4U7Y A;  2BKP A;  1OCC C;  3RYL A;  5KXJ A;  1C17 M;  2V5C A;  3FBL A;  2NR4 A;  4HFD A;  3CWZ B;  1US7 B;  4AIU A;  3RRC A;  4X64 T;  3A7M A;  4W8P A;  5BMV E;  2K3W A;  4ERR A;  3ECS A;  1YZA A;  3MYF A;  3S84 A;  1CPQ A;  4DID B;  4JTA B;  3ZC4 A;  4G63 A;  4B3R T;  4ER9 A;  2ZD9 A;  1H7I A;  4ZLC A;  3RIA A;  2ZM2 A;  1FNT c;  4P9F A;  2J0W A;  3IQ5 A;  3FZK B;  3TLW A;  5F5W A;  3ZYM A;  1X79 A;  1KU2 A;  4LFA T;  2KXP B;  2R02 A;  4H9Q C;  2JRK A;  1VMA A;  2W66 A;  3O55 A;  1FAP B;  1V9D A;  2BG9 B;  1H6G A;  5FXW A;  4YHJ A;  1G4U S;  1ST6 A;  4DVD A;  4IE4 A;  1NG1 A;  2VCC A;  3FMS A;  3C4X A;  4JI0 T;  3AG3 C;  5A1L A;  3EGD A;  4E7S A;  3T1H T;  3E9V A;  4H63 V;  4XPW A;  3F47 A;  4A56 A;  4DV2 T;  4CS8 A;  3MKD A;  5JTG A;  1CGM E;  2WAU A;  3AAE B;  2CHN A;  5JP7 A;  3UUX B;  3EG9 B;  4C3B A;  3H2U A;  2CYD A;  5M4Y A;  2AU5 A;  2LKG A;  5LNK A;  4ZI7 E;  4U5D E;  1LE4 A;  2J7P A;  2XUE A;  4BJN A;  4IE5 A;  1T01 A;  3KKB A;  3NG1 A;  5DQW A;  2VL8 A;  3D0T A;  4Z9J A;  5L47 A;  2KT9 A;  5L0C A;  5JVE A;  1OWA A;  4N6H A;  3L8R A;  4AI6 A;  5DQV A;  3NRH A;  5IUX A;  1QLE C;  4I1O B;  4JTD B;  2BKO A;  2WDQ A;  4MHC A;  2FAP B;  1HTJ F;  2ZMA A;  2BS4 A;  1RCP A;  4GQH A;  3DI5 A;  2YIN A;  2V6Y B;  2PJQ A;  1R5I D;  4BEM J;  2XAQ B;  1J8Y F;  2BC5 A;  4A97 A;  5IYZ E;  2XLO A;  4EUK B;  3U3I A;  1HNW T;  2LIG A;  2KMF A;  2B1E A;  1NEN A;  2BVM A;  3ASN C;  3CAX A;  2R9R B;  2M4E A;  5AQK B;  4EYY R;  3TQO A;  2W45 A;  1OXB A;  3I5P A;  4QHO A;  1BBH A;  3RKG A;  3NMK A;  3VR8 A;  1NEK A;  2E9X B;  3ZDL A;  3AA7 B;  4PAG A;  4QDL A;  1WWP A;  3HNK A;  4NCQ A;  3OPC A;  2X0L B;  2RP4 A;  2D5R B;  2MAW A;  1L0V A;  3U8V A;  4BEJ A;  4XWJ A;  2WVN A;  4UR9 A;  5AFU L;  4WJ0 A;  3RW0 A;  2J7P D;  4TWF A;  5LGN B;  1JR8 A;  4TZ4 C;  1M2O A;  4DV0 T;  2VQF T;  2XQY A;  3K1S A;  3DAF A;  2UUB T;  4NXN T;  3U0C A;  3L8J A;  1OXK A;  2V5D A;  2A69 F;  5JR9 B;  1XWM A;  3N24 A;  4E0I A;  4IDP A;  2H8A A;  1CGN A;  2AVK A;  4DUY T;  2K48 A;  2UUH A;  2YK0 A;  4DBR A;  4HFF B;  1U5P A;  3ZMS B;  2NSF A;  3V5Y A;  1D1A A;  3DXJ F;  2DYS C;  5FY1 A;  1LS4 A;  4JLE A;  2Q9C A;  2FJB A;  4IE0 A;  3S28 A;  1FFH A;  4UEL A;  1XNQ T;  2ZXO A;  2XLM A;  3X1D A;  2H88 A;  2WS3 A;  3ZJ1 A;  1XZQ A;  4LF7 T;  2WZH A;  2R7X A;  2ASR A;  1K05 A;  1CUN A;  2OQM A;  2Y3G A;  5HEJ A;  4EB6 E;  5C2T A;  3VRA A;  5DLJ A;  4GYS A;  5D91 A;  4OIR F;  2G3K A;  1RKE B;  3UQ4 A;  2E2A A;  3LG7 A;  1KNY A;  3KFW X;  5EZY E;  1ZV4 X;  3A11 A;  4KP3 C;  3AE7 A;  3U8P A;  3AAA B;  5CIV A;  2DB4 A;  5LHG B;  3TLU A;  1TFK B;  4I43 B;  2ZXW C;  3PUV F;  4IE6 A;  4PJJ A;  1ZHX A;  1EKY A;  3AXJ A;  1UGO A;  4IHJ E;  3RFY A;  2YWA A;  4LFB T;  2J47 A;  1H9T A;  3C50 A;  3J06 A;  2NW7 A;  4MS2 A;  4P6I C;  3AQC A;  3LLI A;  4HFE A;  3U2M A;  5JDF A;  1W09 A;  3UMH A;  5FXV A;  5JR9 A;  4OD4 A;  3KL4 A;  2VCA A;  2BS2 A;  4N6C A;  4JV5 T;  4LDR A;  2IDO B;  4HTE A;  3K33 A;  4IIJ E;  2KW3 C;  3MFN A;  4CSA A;  5HWY A;  4G0H A;  5CGM A;  3TKL B;  4AE4 A;  3RKO A;  2P7V A;  3ZKR A;  4JI6 T;  2NPU A;  3U3F A;  3O1I A;  2C5I T;  4X5T A;  3P4S A;  2KYH A;  3CX6 B;  4U5H A;  4IAR A;  5FYM A;  1TQG A;  2SPC A;  3EUH A;  5HYA A;  3M4B A;  1SA0 E;  4MW3 A;  5JRE A;  4V1A v;  4JKV A;  4CDV A;  2MWQ A;  3UU6 A;  4EWC A;  1S94 A;  3GOR A;  2LM2 A;  1T6U A;  4NUV A;  4AK9 A;  2VCB A;  4UVB B;  1J8M F;  5AC4 A;  3LK4 2;  1YDI A;  2I8B A;  4K7B A;  5HSW A;  2XTL A;  3L39 A;  2LSJ A;  2OJE D;  2KC3 A;  3UUB A;  3QK6 A;  2WM9 A;  1UUR A;  1SF8 A;  4JTC B;  4M1P A;  256B A;  4JCH A;  1WRD A;  1OW6 A;  4OIN F;  4CI3 B;  3LBX A;  5E3C A;  1W0B A;  2J9B A;  4DV7 T;  2IYL D;  1L3P A;  3AE3 A;  2YEV A;  2ZLY A;  2J8W A;  2Q3T A;  3IQC A;  5L0D A;  1SUM B;  3QB5 K;  3TOM A;  2LE8 A;  4DV6 T;  4JZA A;  4JI4 T;  2LRK A;  3HNI A;  3AEB A;  5C8Y E;  2HH7 A;  3N2Z B;  2XQ3 A;  4CIP A;  3R6N A;  1JAF A;  1Q0D A;  4AIS A;  1ZHT A;  1LS1 A;  2H7O A;  2NOX A;  3DP7 A;  1ZYR F;  2D9D A;  3H3A A;  2R7T A;  2D5U A;  5LBM A;  2XRH A;  4YJW A;  3PV0 F;  3BQL A;  5LA6 E;  2PTF A;  4B3T T;  3ZEF B;  3SEO A;  4RBN A;  1I4Y A;  4GIW A;  3C62 A;  3ZC0 A;  3W4Y A;  1OED C;  5JDN A;  2KZ7 B;  5FL0 A;  2I59 A;  4QH5 A;  4ZI3 C;  2V3C C;  4OYJ A;  3HNJ A;  4LDK A;  3AED A;  3AVS A;  4JI8 T;  3MA9 A;  2R6G F;  3TD7 A;  4M63 A;  2LK4 A;  3IHR A;  4IAQ A;  3T8O A;  4UIG A;  4IL4 A;  2YL1 A;  4BJT A;  4DR4 T;  1IW7 F;  2OCC C;  2Q9A A;  2R03 A;  4MVU A;  1ZW2 A;  2LSY A;  5KYU B;  4KC9 A;  4QXB B;  5LP6 E;  3ZTM A;  2OOC A;  3ZN1 B;  3UU8 A;  3KVB A;  1LI7 A;  3EHM A;  1OR3 A;  5T3W A;  2VWA A;  4HFC A;  5L3G B;  2HSB A;  3O1H A;  4IDZ A;  5ABG A;  3SFE A;  2L9J A;  2R7R A;  3C7J A;  4YT0 A;  2V7K A;  3U78 A;  2Y8D A;  2WU2 A;  3C98 B;  1NAF A;  3NWI A;  5B3I A;  5L3C B;  2CNW A;  5KYY A;  4YTN A;  2N2N A;  4F6R C;  4CZZ B;  4CS7 A;  1OKK D;  4Q25 A;  1ZW3 A;  3T4R A;  3ABM C;  3H3M A;  3EZH A;  1Z6A A;  3RIP A;  3AE1 A;  4BG0 A;  2CCY A;  3AEF A;  4LLC A;  2XJ7 A;  3ZG1 A;  1HS7 A;  2ODU A;  2X9W A;  2JQH A;  4IDO A;  4LF6 T;  4WBN E;  2WVQ A;  3P4R A;  4J7Y A;  3UT5 E;  4U5G A;  2XLV A;  2XM1 A;  3UU3 A;  2W9Y A;  4YTM A;  1DOW A;  1I5N A;  2AWY A;  5DJQ C;  2R25 A;  5L3F B;  3E22 E;  5A69 A;  2PBE A;  4Z9H A;  4ZI2 D;  1FTS A;  1JOG A;  4EZ4 A;  1V4A A;  1R8I A;  4Z8X A;  5J2T E;  1SMY F;  3FXH A;  5KX5 E;  3LS0 A;  1JPJ A;  4YXD A;  3ATP A;  2E5V A;  3MK7 C;  3J9X 1;  1MMD A;  3ZCJ A;  3W8I A;  2V26 A;  4IST A;  4ZS3 A;  4JI2 T;  5LJN A;  1YKE B;  5JDH A;  2EPL X;  5LG4 A;  4NXM T;  4XAX B;  4ULV A;  3P50 A;  4CI2 B;  1ORS C;  4I4T E;  5CA1 E;  1TR2 A;  3KPH A;  3DZA A;  3CQX C;  4U5E E;  4J2C A;  4MBQ A;  5FY0 A;  3ASO C;  4GOU A;  5CB4 E;  1JRA A;  4COF A;  3G06 A;  3UUN A;  3VRB A;  4L6R A;  2YDQ A;  3HJC A;  1OW7 A;  2QVA A;  3MXZ A;  2QLA A;  2WZG A;  5FKY A;  4CS9 C;  1MMA A;  4X1Y E;  5EK0 A;  1O3X A;  3AE8 A;  1V74 B;  4PR9 A;  2LSK A;  3Q7G A;  1WR0 A;  1HFA A;  2NWB A;  1N34 T;  4JRZ A;  3PUR A;  2UXD T;  2Q9B A;  3IF8 B;  2A0B A;  3AOU A;  4IB4 A;  3T1Y T;  2HMZ A;  1X9B A;  5AQI B;  5AQJ B;  1VYI A;  4Q5S F;  5KYW B;  2GK9 A;  3DMD A;  1PD1 A;  4YFS A;  5LGT B;  2X9Y A;  4EBJ A;  2UU9 T;  4GEH A;  2YLG A;  3OA1 A;  4UF0 A;  2IOQ A;  3GN5 A;  2H89 A;  3GMI A;  4OIP F;  3QVY A;  2YN6 A;  4HFV A;  5L3Q A;  4CN6 A;  3K66 A;  4YWQ A;  2XAJ B;  4JCZ A;  1E7P A;  5HWX A;  1I94 T;  5K0I A;  4JI7 T;  3EGX A;  2YLD A;  4QX7 B;  3TK0 A;  3IPM O;  5AQR B;  5AQO B;  3JCF A;  1E2A A;  2J4G A;  4MVO A;  3QVZ A;  2XZE A;  4EED A;  4Q4Z F;  2R7U A;  3AA0 B;  3O9X A;  2F22 A;  5AQQ B;  4BJ6 A;  2BG9 E;  2ZM0 A;  3KBU A;  2B0H A;  2Q4F A;  2EIL C;  5B1A C;  3WHN A;  5FZT A;  5F3J A;  1LI5 A;  2UXN B;  3Q7L A;  1D1B A;  1NFO A;  1WR6 A;  5A6K A;  4UVA B;  5A6A A;  3NYL A;  2KLQ A;  3LJC A;  1KNR A;  2CRB A;  5ABF A;  3RGL A;  4LFC T;  2Y3H A;  3US6 A;  4EAH A;  4WYV A;  2V7M A;  4LF8 T;  5AQT B;  1LVF A;  4L0R A;  1M2V A;  3W15 B;  3C51 A;  2NW9 A;  2IM8 A;  3GEI A;  3CEX A;  4PFP A;  3HNL A;  1GS9 A;  2XLH A;  3RH3 A;  1NSG B;  2CWO A;  1QVX A;  3JRT A;  3KYI A;  3ZTZ A;  2CBI A;  4TNV A;  3ZJ2 A;  4C3D A;  2CW0 F;  5AQG B;  4DR3 T;  3LFM A;  4BJ6 C;  5LGU B;  4AKR B;  4MVM A;  1APC A;  3Q6N A;  1TWH A;  4NTA A;  4KNW A;  5D92 A;  1E85 A;  3EPV A;  2CMR A;  5L3B B;  4I55 E;  1A7E A;  3JSE O;  4MTO A;  3C8Z A;  2N9D A;  1UX4 A;  2PP4 A;  3PUA A;  4O4J E;  4X1K E;  2QA7 A;  2OJQ A;  2MHR A;  2VK9 A;  3TJ6 A;  2L6G A;  2RSE B;  4U72 A;  5AQH B;  3MYI A;  2CGE A;  2JJ9 A;  2Z15 A;  1I6Z A;  3RYI E;  2IC6 A;  4LMJ A;  2CLY B;  1E2X A;  3UMK A;  1T7S A;  1D0X A;  5ETW A;  3ZST A;  4PNI A;  3A8Y C;  3E08 A;  2W4B A;  4DV3 T;  3FVY A;  4NC3 A;  1N1C A;  3CML A;  1O3U A;  2VKH A;  3CX8 B;  4MND A;  4O6N A;  4LER A;  1FMW A;  4ILU A;  4DND A;  4EYU A;  3KYJ A;  1HX8 A;  2M67 A;  4O6Y A;  2LKH A;  2CNW D;  2LCH A;  4CS8 C;  4ADZ A;  5DAB A;  2WP9 A;  3GA8 A;  1O87 A;  4FES A;  4KI2 A;  3VKH A;  4CXX A;  2J45 A;  5AQM B;  5COF A;  2E5L T;  4Z90 A;  5J2U E;  4ZXL A;  1BZ4 A;  2EHO A;  4YJ2 E;  2Y6X A;  4K1O A;  3FZL B;  4U7I A;  4A5X A;  2XHE B;  3DAG A;  2ZXP A;  1A41 A;  2H3R A;  3N2O A;  3P4P A;  2YVK A;  2VKJ A;  2A2F X;  3DD7 A;  1IZN B;  2V1D B;  2CCQ A;  3FZM B;  4JUR I;  1VB5 A;  3JC6 D;  5LHH B;  1C03 A;  3H2V A;  4CIH A;  4F4B A;  2KSR A;  1I4Z A;  2LSE A;  3L1M A;  1OR2 A;  4FJO A;  1T9K A;  2M64 A;  4XPY A;  1NLX A;  2CWY A;  5L4E A;  4O6M A;  4UVC B;  3A5X A;  4JVS A;  1QSD A;  2X0C A;  3DM9 B;  3RQW A;  1WFD A;  2HJ3 A;  2Y39 A;  3OYX A;  2M6B A;  4U9E A;  2YDR A;  4YSX A;  4TNW A;  4PJM A;  3M4C A;  1XMO T;  3ZQY A;  2K5B B;  5FMN A;  3VAY A;  3NKD A;  3RQF A;  2BS3 A;  4P09 A;  1HE9 A;  5ABH A;  1M7K A;  2EHO C;  1ZHW A;  3BRJ A;  2OKU A;  3O1J A;  2VKO A;  1ZZP A;  2V6X A;  4DR5 T;  1NWM X;  4EOZ B;  3VF0 A;  5TAO A;  3QW0 A;  3ZT5 A;  3MAC A;  4LML A;  2EIN C;  1Z7Q c;  4CN4 A;  1UK5 A;  1U6H A;  4EXT A;  3DKA A;  2Q00 A;  4CBE A;  4NTF A;  3T6B A;  1WGW A;  4NUU A;  4JJF A;  2BE5 F;  3OJA A;  3PCV A;  3C64 A;  4PJN A;  5F5F A;  4H9O C;  3B9Q A;  1NU9 C;  3ZSS A;  3SP1 A;  2OA5 A;  4JYA T;  1G5Z A;  2HPJ A;  1VK5 A;  3WAJ A;  2C04 A;  3AQB A;  1MIV A;  1EA8 A;  4D4X A;  4J7T A;  2HN1 A;  2OLT A;  4K0K T;  4DMW A;  2LFD A;  4QH4 A;  3HLZ A;  4HKA A;  3LK3 B;  4H9P C;  4R32 A;  4H63 H;  2MPK A;  4KI0 F;  1CHU A;  2G0U A;  3WI3 A;  3ZMZ B;  3N0T A;  4O4L E;  3LAY A;  4RD9 A;  1M57 C;  2L6F A;  3ZC1 A;  3KMI A;  1EI7 A;  2HKV A;  5BQH A;  1KEY A;  2DNX A;  3FHN A;  1HG2 A;  5ADX L;  3CVR A;  2XAH B;  1JPN A;  3IHU A;  5FP3 A;  2BL2 A;  1LKX A;  3VU7 H;  3ABK C;  1WAT A;  2XM4 A;  2YL0 A;  4WZX A;  4KHP T;  2VC9 A;  2CXF A;  3E0Z A;  4DR7 T;  3FOO A;  1K04 A;  4TV9 E;  4JI3 T;  4PJL A;  1Z63 A;  1ORJ A;  4GK5 E;  4N4W A;  1MMG A;  1VYK A;  1D0Y A;  2A3D A;  4CDY A;  3EAM A;  5FCL A;  4YY3 T;  2XL4 A;  4AE4 B;  3M1C B;  1XDP A;  5E3A A;  2J46 A;  3LJB A;  1BDJ B;  4U2Z A;  3UR3 C;  1FJG T;  5DS5 A;  3C8G A;  4I3M A;  2OU6 A;  1LPE A;  3PU8 A;  2PFV A;  3RHW A;  3EDV A;  1NFN A;  1KTM A;  2R05 A;  4WBO A;  4JEB A;  3DJB A;  2KWI B;  1N32 T;  2HSQ A;  4LAC B;  3GM2 A;  2KJG A;  5AC5 A;  2V7I A;  3JZ0 A;  2KNH A;  1JNZ A;  4O2B E;  3S4U A;  4BJ5 C;  3KV9 A;  2V8S V;  4XEK A;  5KYY B;  1F1M A;  5AQP B;  3MZK B;  3S29 A;  4HFI A;  4E17 A;  2XQ4 A;  1XDO A;  3AJM A;  3SXZ A;  3HL6 A;  2IW5 B;  1T72 A;  3C4Z A;  3ETV A;  4DJ9 A;  3CK6 A;  4ZHQ E;  2YKS A;  5L0G A;  5CJ5 A;  4YTP A;  3L0I A;  5A6J A;  4CSA C;  1YJG A;  1YYJ A;  2ACZ A;  3FXD B;  2YHS A;  3LBX B;  4HEA J;  1XWJ A;  3H37 A;  1ZU5 A;  1WLX A;  2O9X A;  3Q6M A;  4QI2 A;  5JDL A;  3W2W A;  1Y4C A;  2Y48 B;  1NZE A;  2XQ9 A;  4C91 A;  3T6G B;  4EBB A;  1W2W A;  3F31 A;  2TMV P;  5KDM C;  2RPA A;  2NP9 A;  5KYX A;  2HS5 A;  1ORY A;  4YT4 A;  4IE7 A;  2KGO A;  3GN5 B;  1V55 C;  2WU5 A;  3ZMT B;  2P61 A;  3X2Q C;  4WNK A;  4O4H E;  5L3D B;  4F8H A;  3EGX B;  2HFI A;  3SNH A;  5L0J A;  3O4X E;  1HW2 A;  1FFT C;  3SXY A;  2W00 A;  3SYN A;  1GM5 A;  3AE9 A;  3RC3 A;  2ACX A;  2BZB A;  4P9T A;  4B6I A;  4BAY B;  3CKD A;  2MOZ A;  3ZCI A;  2J62 A;  1ZP0 A;  3JSZ A;  1SYQ A;  5L0H A;  4RDA A;  4IRE A;  2X67 A;  3VR9 A;  3EAB A;  2A6E F;  2GA0 A;  2H7B A;  3U2L A;  2WZL A;  1YAU O;  2VL0 A;  3AE4 A;  4DOZ A;  4O4I E;  3R7C A;  2WB5 A;  3HKK A;  4ILC A;  3JYY A;  5COG A;  3X1O A;  1OXZ A;  1J5W A;  3NMJ A;  3KDS E;  4NIQ A;  4OIQ F;  3NMI A;  3Q5E A;  4JEU B;  4O8S A;  2EHO D;  2Z6E A;  1ZKE A;  2AXD S;  3PUG A;  1R4T A;  2YU2 A;  3HKC E;  2LSG A;  2W61 A;  2WZI A;  5JDM A;  5A6B A;  3AG1 C;  4JJG A;  1TFO B;  3KV6 A;  5LYJ E;  1AVO B;  2YEV C;  1QZX A;  3O6X A;  2C0S A;  1HW1 A;  1ZEE A;  4XPX A;  1RMV A;  1UCU A;  3DE9 A;  4YN0 B;  2ES0 A;  5HAX A;  2WVO A;  3I0O A;  3L09 A;  2XSB A;  4KBM B;  2ODV A;  3B29 A;  2LQG A;  4LDQ A;  3B5M A;  3ZLI A;  5JS5 A;  3ANW A;  4CN1 A;  4Q7C A;  3ZQV A;  2UXX B;  4KHZ F;  3PUX F;  2OG2 A;  3QMK A;  5LOV E;  3IBP A;  1SZI A;  5JT4 A;  2LEH A;  1U89 A;  4WGZ A;  2XQ8 A;  4IGU A;  2IXM A;  1N33 T;  1YVI A;  5IY5 C;  5F28 E;  4J32 B;  3GEE A;  4XEF A;  3EDU A;  4ILB A;  1XNR T;  5E33 A;  2EIM C;  2E9X A;  3QUJ A;  5J1G A;  5T3T A;  3AA1 B;  5AQL B;  3KV5 A;  4GYT A;  5HEH A;  2V6Y A;  4TWD A;  1FMV A;  1QPU A;  1UFB A;  3AVR A;  3SZR A;  2N1G A;  3PUW F;  3TOL A;  2XLD A;  5HEU A;  3UMI A;  3I1A A;  3RKO F;  4OK0 A;  3PJA A;  3AE5 A;  2X0H A;  1Y01 A;  2J9V A;  3CIR A;  3ITF A;  5HEO A;  4MTF A;  4B3S T;  1Z23 A;  4U3C A;  1LIH A;  3RC8 A;  4EBK A;  3K3O A;  3A9C A;  5COM A;  1YQ3 A;  2XAG B;  4GKJ T;  5AGF A;  3KV4 A;  4DV4 T;  3RYC E;  5HXS A;  5AQN B;  2UXB T;  2RA1 A;  4CXY A;  3RIU A;  1TWC A;  4AKG A;  1FIO A;  1WN0 A;  3JAF A;  4D4N A;  3JAE A;  3G4X A;  5AQV B;  1L7C A;  3JT1 A;  3I5Q A;  3LS1 A;  2XXA A;  3AEC A;  3HKE E;  2YKZ A;  3NRX A;  5FL1 A;  1O5H A;  4ASK A;  2HJM A;  1T5O A;  3ZT7 A;  5B1B C;  1WTY A;  3K1H A;  3C63 A;  2M6I A;  4H4K C;  2ETS A;  3G4Z A;  2X9X A;  1M56 C;  1NBB A;  1OCO C;  1VOM A;  2UUA T;  4IGG A;  1YLM A;  4U74 A;  5ABE A;  3SFD A;  3EHZ A;  3UTK A;  4U9D A;  2E9X C;  3UGO A;  2XL8 A;  2LLY A;  2KWH A;  3ZMV B;  2PBI A;  2F4V T;  1A0B A;  1S35 A;  2H7V C;  4EEB A;  4DO0 A;  3RPU A;  3TJ5 A;  3OYZ A;  4B3M T;  1YA9 A;  4C90 A;  5DS6 A;  2PX3 A;  4JI1 T;  2YLI A;  5EHH A;  1BR1 A;  5GPG B;  3WOD F;  5F8P A;  5LHI B;  4MW8 A;  2CHO A;  4H9S E;  5L3E B;  3NYJ A;  2NUP A;  3IA3 A;  3SWH A;  5HXE A;  3T6J A;  3QC9 A;  3L8I A;  2IXP A;  3V5U A;  1HE1 A;  2JD3 A;  3UFE A;  4U5C E;  1OED E;  1HNX T;  1MND A;  5CI8 A;  2YL7 A;  2D2S A;  3EI0 A;  3EVY A;  4IDQ A;  4U33 A;  5TJ5 E;  4I50 E;  3B0U X;  3LUT B;  2WDV A;  4LF9 T;  3I9W A;  3K3Q C;  2A72 A;  3HKB E;  2AWC A;  2KND A;  2FGY A;  3WG7 C;  4XBF B;  2OEX A;  3W8H A;  5AQS B;  4IRU A;  2PG8 A;  1ZVZ A;  2OV9 A;  1RKE A;  5JQG E;  3ABL C;  3N2G E;  2NG1 A;  3ZN0 B;  3SS1 A;  1IJ6 A;  2XLW A;  4YL3 A;  4HWD A;  5C3J A;  3K6B A;  4HFB A;  1EQ1 A;  2K24 A;  2IBF A;  2G3V A;  1WOL A;  1W9R A;  2FUP A;  3AEA A;  4ZS2 A;  5L4H A;  4JIO A;  4Z91 A;  3OEO A;  4P1N A;  5A6B D;  1T8B A;  2DGJ A;  1OED B;  4MVS A;  1SE7 A;  3C4W A;  1VCS A;  3LES A;  5LXT E;  1IBK T;  5FXZ A;  3RI5 A;  1QSP A;  2BG9 C;  2I15 A;  4O79 A;  2L6H A;  2Y3B A;  4H9R C;  2EPM X;  3M15 A;  1CGO A;  1HR0 T;  1OCZ C;  3K8P C;  2A0U A;  1YAR O;  1WYC A;  2LT3 A;  3FAP B;  4O2A E;  4EZH A;  2J9U A;  2XPK A;  2P9B A;  2QNL A;  3I9Y A;  3DWW A;  2IXN A;  4XTK A;  2LOS A;  4TX5 A;  1HMD A;  5FVK A;  3UU4 A;  2CE7 A;  2XQA A;  5LBQ B;  2WMN A;  5DQT A;  1IZM A;  3Q5W A;  2QUP A;  3WAQ A;  4YK5 A;  4X20 E;  1DOV A;  2J0X A;  3ABV A;  4QI0 A;  1XMQ T;  3PE0 A;  4QX8 B;  4PW8 A;  1E83 A;  3IQ6 A;  1FEW A;  5BR8 T;  1T6Q A;  5T1D B;  5JR9 C;  4G7H F;  4C7O A;  5JRC A;  3PUY F;  4UV8 B;  4CX9 A;  1M2V B;  3AA6 B;  3GWL A;  2KSF A;  3F46 A;  3RVZ A;  4AXP A;  1AJ3 A;  3U3B A;  4IL9 A;  1D0Z A;  4L9I A;  2WZF A;  4FX5 A;  3K1I A;  3L3P A;  3AG2 C;  3UUL A;  2GDC A;  5HXH A;  4C3E A;  4EHP A;  3UNG C;  3EG9 A;  2HN2 A;  2W67 A;  1FR0 A;  4LLE A;  1ZHC A;  2QRX A;  2Y69 C;  4NY3 A;  4DBQ A;  3CX7 B;  1OW8 A;  2FBW A;  4DRJ B;  4E7Z A;  4ANJ A;  3LNM B;  5FY7 A;  4MQ9 F;  3GEH A;  4HWH A;  3P4Q A;  3S9O A;  2YQY A;  2WSS V;  2VB6 A;  3R84 B;  1B7T A;  2V7L A;  1T98 A;  1YA7 O;  3PDY A;  3BK9 A;  2P6V A;  3AE2 A;  2ZPA A;  2R7V A;  3V5Z A;  3SOL A;  2IC9 A;  2JX0 A;  4B6X A;  1J5E T;  4QWN B;  2XAF B;  3GWH A;  3PTR B;  3UFG A;  2WBL A;  3E70 C;  4ONS A;  2CXL A;  3F57 A;  3NZP A;  4K0U A;  5HV9 A;  2L8K A;  2XQ7 A;  2I0M A;  1GGQ A;  5GON E;  1LRZ A;  1Y64 B;  4X0R A;  1UUS A;  3O39 A;  1CPR A;  1T6I A;  3TUL A;  4X1I E;  3HR0 A;  1KF6 A;  3CQG B;  2XS8 A;  2KK1 A;  3ESL A;  2NW8 A;  4AQY T;  3ZWI A;  4AX2 A;  4A4A A;  2R7S A;  2AP3 A;  5JRC B;  4O7G A;  5JDG A;  2Q9Q A;  3GWN A;  1HMO A;  2YU1 A;  2EHO B;  3UUM A;  3CZ6 A;  3FZF B;  4WW0 A;  1HF8 A;  4DUZ T;  2QGS A;  3UU5 A;  3PUS A;  3ETU A;  1MIW A;  1S7Z A;  3EHN A;  1YXR A;  2EPN A;  4KMC A;  2IAK A;  2X9H A;  4DR1 T;  2ZM8 A;  2BBH A;  1JNR A;  2FJE A;  4TUY E;  1E84 A;  1YQ4 A;  3B13 A;  4ULW A;  1PD0 A;  2XS1 A;  2NTX A;  4JUY A;  4AKH A;  2R7O A;  2GWW A;  2KQ9 A;  5LG3 A;  3V7O A;  2LOP A;  4DXW A;  2AE9 A;  3EH2 A;  3RX6 A;  2ZM6 T;  4FI5 A;  1YZC A;  3N9Q A;  2R7Q A;  3C18 A;  4BPM A;  1J1J A;  2DWK A;  2NSG A;  5KYX B;  4GKK T;  2E8I A;  3B57 A;  3RYF E;  3RQE A;  5KYW A;  2MYS A;  3FBZ A;  3QTH A;  4MTG A;  4NQF A;  2L9Q A;  4TWH A;  2W4X A;  2WMO A;  2XXA B;  3NZQ A;  4AKI A;  4HWC A;  2C03 A;  5JVD E;  1SHZ C;  1KFY A;  4OX9 T;  3GM1 A;  3U9M A;  3N9N A;  3HTK C;  2I6H A;  4JEA A;  4DRI B;  5LJM A;  1LVK A;  1WCR A;  3ZIB A;  3POV A;  4G7Z F;  4OYK A;  1M6T A;  2W0G A;  4HE8 D;  3N9P A;  3PDM P;  4EKW A;  1U4Q A;  4E18 A;  3Q5D A;  1VLS A;  1S05 A;  1Q0G A;  2RD9 A;  1GQA A;  3VRC A;  1UX5 A;  1PV3 A;  2XLE A;  4WGY A;  2C5K T;  3P8C D;  4AL0 A;  4CXW A;  2XL6 A;  4YSZ A;  3P4W A;  1HX1 B;  2CEA A;  4IT4 A;  1BR2 A;  3CPZ A;  4EGW A;  3EFO A;  2LHN A;  1VTM P;  3B71 A;  2W63 A;  2YOE A;  4DRH B;  2VVS A;  5BQG A;  3R2P A;  4W8K A;  3KBT A;  1Z3I X;  3V5X A;  3RQU A;  3AGU A;  2YRF A;  3BQI A;  2DI4 A;  2XAS B;  5EK3 A;  1OQC A;  4I44 A;  1MMN A;  2IXO A;  4QXC B;  1QKR A;  2VH3 A;  5JLI A;  1GQE A;  2YZS A;  2WCA A;  2LJL A;  4XEV A;  4BJM A;  5JDQ A;  3QOF A;  1IBL T;  1RKC A;  1Y6D A;  3AEE A;  4A2N B;  5E0O A;  2JQ9 A;  5CA0 E;  3VKG A; 
#chains in the Genus database with same CATH homology
 3AG3 C;  3QMK A;  3QZC A;  2R7T A;  5DQZ A;  2NUT A;  5A1L A;  5LOV E;  3IBP A;  4UF0 A;  1SZI A;  3EGD A;  3OA1 A;  4E7S A;  2LEH A;  2IOQ A;  3GN5 A;  3GMI A;  3E9V A;  4OIP F;  3J7Y q;  4H63 V;  5IHY A;  2CDQ A;  2NUP B;  3F47 A;  4HFV A;  4A56 A;  4IGU A;  2IXM A;  3K7D A;  4CS8 A;  5L3Q A;  3MKD A;  3K66 A;  5IY5 C;  4YWQ A;  2WAU A;  3AAE B;  1KNZ A;  3I4U A;  4J32 B;  2E9X D;  2JPF A;  2XAJ B;  3UUX B;  3EG9 B;  3S28 A;  3EDU A;  4C3B A;  3EFO B;  4CS9 A;  4TV8 E;  5HWX A;  3LEV A;  5M4Y A;  2PX0 A;  3EGX A;  3OBV E;  5LNK A;  4JEH B;  5E33 A;  2EIM C;  4QX7 B;  1QUU A;  4ZI7 E;  2E9X A;  2J7P A;  3QUJ A;  5J1G A;  4U5D E;  2XUE A;  3AA1 B;  2VKD A;  2KIN B;  4IE5 A;  4BJN A;  3KV5 A;  4GYT A;  3KKB A;  3NG1 A;  5DQW A;  1YKH B;  1FMV A;  2VL8 A;  4ZI3 D;  5L2L A;  3D0T A;  4I44 A;  2NUT B;  2KT9 A;  3AVR A;  3SZR A;  4UF0 B;  3HA4 A;  2N1G A;  3N9M A;  4Q4Z F;  2K9A A;  1OWA A;  3HKD E;  3UMI A;  3I1A A;  3RKO F;  2Q9Q C;  2R7U A;  4AI6 A;  2DHR A;  5DQV A;  3AA0 B;  4OK0 A;  3O9X A;  3EH1 A;  3NRY A;  4BJ6 A;  1MIY A;  3NRH A;  4I1O B;  1QLE C;  2W4B A;  4MHC A;  2ZM0 A;  2J9V A;  3ZVR A;  3KBU A;  4YT8 A;  5LCY A;  4HFK B;  1HTJ F;  3ITF A;  1V54 C;  3RRW A;  1Z23 A;  2ZMA A;  3RC8 A;  2EIL C;  3K3O A;  4OIO F;  4PK4 A;  5B1A C;  2XAG B;  2YIN A;  2PJQ A;  3KV4 A;  2XAQ B;  3RYC E;  3V5S A;  5F3J A;  5HXS A;  1J8Y F;  3F2E A;  3S27 A;  2RA1 A;  4CXY A;  5IYZ E;  1TWC A;  2UXN B;  1BR4 A;  3U3I A;  1D1B A;  1FIO A;  3DTO A;  2KMF A;  4AKG A;  3FHD A;  3Q7L A;  1WR6 A;  2B1E A;  3JT1 A;  2BVM A;  3M65 A;  4UVA B;  3ASN C;  3I5Q A;  3JCU Q;  3LS1 A;  3HKE E;  2XXA A;  3NYL A;  2KLQ A;  2E87 A;  2M4E A;  3LJC A;  2V7J A;  3NRX A;  1O5H A;  2Y3H A;  4ASK A;  4EYY R;  4EAH A;  5B1B C;  3K1H A;  2V7M A;  4H4K C;  4P0B A;  2W45 A;  2DWG A;  3I5P A;  1LVF A;  2X9X A;  4L0R A;  1M56 C;  1M2V A;  1OCO C;  1VOM A;  3W15 B;  4DVY P;  5B3S C;  3C51 A;  4U74 A;  3MX3 A;  2NW9 A;  4UV9 B;  4QHO A;  2X51 A;  3UTK A;  2E9X C;  2E9X B;  5KYU A;  3AA7 B;  3UGO A;  4PAG A;  4QDL A;  2KWH A;  4PFP A;  3Q2M A;  3ZMV B;  3RH3 A;  4XLP F;  2PBI A;  2ZXP A;  2CWO A;  2LM9 A;  3JRT A;  2X0L B;  1S35 A;  2H7V C;  2RP4 A;  2JMH A;  4DO0 A;  2D5R B;  3RPU A;  3ZJ2 A;  4C3D A;  3OYZ A;  4YT4 A;  2CW0 F;  4C90 A;  3LLK A;  4BEJ A;  4XWJ A;  5DS6 A;  3LFM A;  2WVN A;  3ZYL A;  4BJ6 C;  5LGU B;  4AKR B;  2PX3 A;  5AFU L;  4WJ0 A;  4U5B E;  5EHH A;  1BR1 A;  2J7P D;  4IAO A;  3Q6N A;  4ZLD A;  3LNR A;  5LGN B;  4HE8 A;  1TWH A;  5F8P A;  5LHI B;  2WB7 A;  3WOD F;  4H9S E;  5L3E B;  4KNW A;  3NYJ A;  2NUP A;  5D92 A;  4TZ4 C;  1M2O A;  2Y3D A;  3OWT A;  3SWH A;  3EPV A;  5HXE A;  2CMR A;  2XQY A;  3DAF A;  3T6J A;  5L3B B;  4I55 E;  3QC9 A;  3BQK A;  3V5U A;  2IXP A;  3AG4 C;  2A69 F;  2JD3 A;  5JR9 B;  3UFE A;  2N9D A;  1UX4 A;  4U5C E;  3FDQ A;  5EK2 A;  3N24 A;  1MND A;  5CI8 A;  2PP4 A;  3PUA A;  3Q5X A;  4O4J E;  4X1K E;  2QA7 A;  4N06 A;  3B0V C;  2D2S A;  3EVY A;  2CLY C;  2HV6 A;  2VK9 A;  4I50 E;  4U72 A;  3B0U X;  2K48 A;  3PMR A;  4YJW A;  4YT2 A;  2CGE A;  2JJ9 A;  2Z15 A;  2YK0 A;  3I9W A;  2DCF A;  2A72 A;  3AAI A;  2IC6 A;  3K3Q C;  3RYI E;  4DBR A;  2CLY B;  1HCI A;  3HKB E;  3UMK A;  4HFF B;  3KIN B;  1U5P A;  3ZMS B;  2KND A;  2FGY A;  1D0X A;  4XBF B;  3WG7 C;  1D1A A;  5ETW A;  4PNI A;  3E08 A;  1ZHZ A;  2DYS C;  1VRB A;  2PFD A;  4OHF A;  2PG8 A;  3N9L A;  5FY1 A;  1N1C A;  4AQG A;  2XSE A;  4IRU A;  4XLN F;  4BJ1 A;  3CML A;  4KNV A;  5JQG E;  4JLE A;  2X68 A;  4IE0 A;  1YD8 G;  2VKH A;  3CX8 B;  1FFH A;  3N2G E;  4QWN B;  2NG1 A;  2Q9C A;  4N78 D;  3ABL C;  4GK0 E;  3ZN0 B;  3SS1 A;  1IJ6 A;  1FMW A;  4UEL A;  1BR0 A;  4ILU A;  4LER A;  4AQF A;  2ZXO A;  4DND A;  4EYU A;  3ZJ1 A;  1HX8 A;  3K6B A;  2K24 A;  2M67 A;  5T3T A;  2G3V A;  2R7X A;  4O6Y A;  1CUN A;  2CNW D;  2Y3G A;  4CS8 C;  4ZS2 A;  4ADZ A;  5DAB A;  1TKN A;  4EB6 E;  1ZU4 A;  5DLJ A;  3GA8 A;  3OEO A;  1O87 A;  4GYS A;  4FES A;  5D91 A;  3VKH A;  4KI2 A;  3LK2 B;  4CXX A;  2G3K A;  2J45 A;  4OIR F;  2DGJ A;  1TWG A;  5J2U E;  1KK7 A;  3OKQ A;  3C4W A;  3LES A;  3LG7 A;  4G2A A;  2EHO A;  5KMG P;  3KFW X;  5EZY E;  1ZV4 X;  4YJ2 E;  5LXT E;  4K0D A;  5FXZ A;  4KP3 C;  3PHF 2;  5FNV E;  3AAA B;  2Y6X A;  5LHG B;  1TWA A;  4I43 B;  2ZXW C;  4O79 A;  2G62 A;  2X66 A;  1D1C A;  1EZ3 A;  2L3L A;  2XHE B;  4H9R C;  4IE6 A;  4PJJ A;  4MFR A;  5HXC A;  2D0T A;  4IHJ E;  2H3R A;  1ZHX A;  3RFY A;  3N2O A;  2PF4 E;  1OCZ C;  3EQL F;  4QKN A;  2VKJ A;  3K8P C;  4UEM A;  2A2F X;  3DD7 A;  1IZN B;  3FXE B;  2CCQ A;  2V1D B;  4JUR I;  1WYC A;  3C50 A;  1IAP A;  3JC6 D;  3ZYK A;  5LHH B;  2NW7 A;  4XZC A;  2LT3 A;  2Q9Q D;  4O2A E;  4EZH A;  2J9U A;  4P6I C;  4F4B A;  2LSE A;  4HGA A;  4L5G A;  3AQC A;  2P9B A;  3LLI A;  3CSK A;  2WL8 A;  5JDF A;  4FJO A;  2J9W A;  3I9Y A;  4XTK A;  2IXN A;  3UMH A;  4MLK A;  2CWY A;  2LOS A;  2J1D G;  2CA5 A;  4TX5 A;  5FXV A;  5JR9 A;  3KL4 A;  2CE7 A;  4OD4 A;  4O6M A;  4UVC B;  4HEA A;  3A5X A;  4JVS A;  1QSD A;  5LBQ B;  2WMN A;  3P7I A;  3DM9 B;  1IZM A;  5DQT A;  2Y39 A;  3OYX A;  3Q5W A;  2EIK C;  4HTE A;  4X20 E;  4IIJ E;  4TN7 B;  2KW3 C;  3K33 A;  5HWY A;  5L3V A;  2J0X A;  4CSA A;  4PJM A;  4G0H A;  3AB3 B;  4EIW A;  3TKL B;  4YJ3 E;  4AE4 A;  3RKO A;  2P7V A;  1YW0 A;  4QI0 A;  4BA9 A;  2K5B B;  5FMN A;  3VAY A;  3PE0 A;  4QXH B;  4QX8 B;  4C7O B;  3O1I A;  2C5I T;  4PW8 A;  3N2K E;  3NKD A;  3CX6 B;  1FEW A;  4P09 A;  3ONX A;  4U5H A;  5FYM A;  5DVW A;  2EHO C;  2SPC A;  2CM0 A;  5T1D B;  3EUH A;  5JR9 C;  5HYA A;  1ZHW A;  3O1J A;  1SA0 E;  1RJ9 A;  2VKO A;  4G7H F;  4ZOL E;  4C7O A;  5JRC A;  3JC6 C;  1NWM X;  4UV8 B;  2LHR A;  4V1A v;  5TAO A;  4EOZ B;  5JRE A;  1M2V B;  3AA6 B;  2MWQ A;  3FAJ A;  4P0A A;  3F46 A;  3MAC A;  4AXP A;  1AJ3 A;  4EWC A;  3KH2 A;  2D0U A;  1D0Z A;  1S94 A;  4L9I A;  2EIN C;  2WZF A;  3GAN A;  4FX5 A;  3VYW A;  4PK5 A;  1OKK A;  5FXX A;  4EXT A;  4NUV A;  3L3P A;  3AG2 C;  3PUQ A;  3UUL A;  3B0P A;  5HXH A;  4AK9 A;  4C3E A;  4OD5 A;  3UNG C;  3EG9 A;  4UVB B;  4CBE A;  5DS4 A;  4LLE A;  1ZHC A;  1J8M F;  2Y69 C;  5JH7 E;  3T6B A;  1WGW A;  4NUU A;  4J30 B;  4IJJ A;  4DBQ A;  4NY3 A;  3LK4 2;  4JJF A;  3CX7 B;  2A6H F;  2BE5 F;  2I8B A;  4K7B A;  4U5F E;  5HSW A;  2XTL A;  3OJA A;  2LSJ A;  3C64 A;  4PJN A;  3QK6 A;  4E7Z A;  2WM9 A;  4YLH A;  4ANJ A;  1SF8 A;  1RJ9 B;  5F5F A;  4H9O C;  3ZMU B;  3B9Q A;  4M1P A;  1NU9 C;  4JCH A;  3SP1 A;  3UGP A;  2OA5 A;  3DJU B;  1E1H B;  2HPJ A;  1WRD A;  3WAJ A;  1VK5 A;  2C04 A;  3AQB A;  5FY7 A;  4OIN F;  1MIV A;  3LBX A;  4CI3 B;  4MQ9 F;  5E3C A;  3ZPO A;  2IYL D;  4YT5 A;  1Z5Z A;  2YEV A;  2ZLY A;  3WAK A;  2WSS V;  2Q3T A;  2VB6 A;  4DMW A;  3R84 B;  1B7T A;  5EK4 A;  2V7L A;  3EZI A;  1T98 A;  4HKA A;  3KVA A;  1HG5 A;  3LK3 B;  2LE8 A;  3MJX A;  4H9P C;  4H9N C;  4H63 H;  4JZA A;  3PDY A;  3BK9 A;  2P6V A;  5C8Y E;  2HH7 A;  2QY9 A;  3S0X A;  2G0U A;  2NTY A;  3WI3 A;  4AQF C;  3ZMZ B;  2ZPA A;  3HLZ A;  3N0T A;  3N2Z B;  4O4L E;  3R6N A;  3CQZ A;  2R7V A;  3LAY A;  1NU7 D;  3SOL A;  2IC9 A;  1LS1 A;  1M57 C;  2H7O A;  1ZHT A;  4RD9 A;  5CI9 A;  2NOX A;  3DP7 A;  3ZC1 A;  3NKE A;  1ZYR F;  3KMI A;  4B6X A;  2DNX A;  3H3A A;  4MAL A;  2XAF B;  3FHN A;  1HG2 A;  3GWH A;  2D5U A;  3PTR B;  3CVR A;  5LBM A;  2XAH B;  5ADX L;  4ZI2 C;  1JPN A;  2WBL A;  5FP3 A;  2XRH A;  2GFH A;  3E70 C;  3BQL A;  2CXL A;  3F57 A;  3NZP A;  1LKX A;  4K0U A;  5H6R B;  5LA6 E;  3VU7 H;  2L8K A;  3ZEF B;  3ABK C;  3SEO A;  4RBN A;  1MNE A;  3W2V A;  4GIW A;  5BUO A;  5GON E;  3ZC0 A;  1LRZ A;  4HN9 A;  1Y64 B;  2CXF A;  3E0Z A;  3H65 A;  4X0R A;  3O39 A;  5JDN A;  2MTQ A;  2KZ7 B;  5HXR A;  4PFO A;  3EGD B;  4TV9 E;  2I59 A;  4ZI3 C;  2V3C C;  4PJL A;  2Q9Q B;  4X1I E;  4OYJ A;  3HR0 A;  3CQG B;  3W8H A;  1PCX A;  4GK5 E;  5KYN A;  1Z63 A;  3ESL A;  3NDB B;  1MMG A;  3AVS A;  1VYK A;  1D0Y A;  3FB2 A;  2NW8 A;  4AX2 A;  2R7S A;  2A3D A;  3MA9 A;  4CI1 B;  5FCL A;  5JRC B;  2XL4 A;  4O7G A;  3K3N A;  4M63 A;  3M1C B;  3TD7 A;  4AE4 B;  5JDG A;  2J46 A;  5E3A A;  4GYR A;  2Q9Q A;  3IHR A;  3LJB A;  3T8O A;  4UIG A;  4CQI A;  3UR3 C;  5DS5 A;  1WYB A;  3VHL A;  2QTV A;  5E2Q A;  4BJT A;  2ZXR A;  1IW7 F;  4I3M A;  2YU1 A;  2EHO B;  3UUM A;  3CZ6 A;  2JMK A;  3PU8 A;  2OCC C;  2Q9A A;  5F5H A;  2EIJ C;  1H7C A;  4WW0 A;  1HF8 A;  2LSY A;  3EDV A;  1IJ5 A;  2PFV A;  4KC9 A;  5KYU B;  3IEE A;  3K1I C;  4QXB B;  2A1D D;  4WBO A;  5LP6 E;  3DJB A;  2QGS A;  1S7Z A;  3PUS A;  3ETU A;  1MIW A;  3ZN1 B;  2KWI B;  3KVB A;  3N5L A;  3EHN A;  4KMC A;  2IAK A;  2X9H A;  4LAC B;  4O6N A;  2ZM8 A;  2KJG A;  3N9O A;  3EHM A;  2R7W A;  2V7I A;  5T3W A;  4CIH A;  2VWA A;  2KNH A;  4O2B E;  2L81 A;  3S4U A;  4BJ5 C;  3KV9 A;  2Y3B A;  5L3G B;  2A68 F;  3O1H A;  5KYY B;  3MZK B;  4IDZ A;  2L9J A;  4TUY E;  1OCR C;  3S29 A;  2BDE A;  2R7R A;  3B13 A;  2V7K A;  3MLG A;  4ULW A;  1PD0 A;  3U78 A;  2Y8D A;  3HL6 A;  4UXN B;  2NTX A;  2IW5 B;  3DM5 A;  3C98 B;  3C4Z A;  4JUY A;  1NAF A;  3ETV A;  4AKH A;  3PU3 A;  5L3C B;  2CNW A;  2R7O A;  2KQ9 A;  3FVY A;  3V7O A;  2FFH A;  2LOP A;  5KYY A;  4ZHQ E;  2N2N A;  4F6R C;  4CZZ B;  3EH2 A;  3RX6 A;  3L0I A;  4CS7 A;  4FI5 A;  4CSA C;  1OKK D;  4DMV A;  2HPL A;  3T4R A;  2W4M A;  3ABM C;  4PK6 A;  3RYH E;  3FXD B;  3N9Q A;  3HI2 A;  1Z6A A;  2YHS A;  3LBX B;  3EZH A;  3RIP A;  2R7Q A;  4JW1 A;  4HEA J;  4BG0 A;  3H37 A;  2BVL A;  2DWK A;  3JYH A;  3I0Q A;  1ZU5 A;  5KYX B;  4LLC A;  1WLX A;  2O9X A;  3Q6M A;  3NYM A;  4QI2 A;  3ZG1 A;  1HS7 A;  2ODU A;  5JDL A;  2E8I A;  2X9W A;  3W2W A;  2Y48 B;  3B57 A;  1NZE A;  4C91 A;  3RYF E;  4EBB A;  1W2W A;  3F31 A;  2HV7 A;  5KDM C;  2B0J A;  2NP9 A;  5KYW A;  5KYX A;  2MYS A;  3FBZ A;  2LSI A;  2WWU A;  4IE7 A;  4WBN E;  2KGO A;  3GN5 B;  2L9Q A;  1V55 C;  2WVQ A;  3DJN B;  2WMO A;  2XXA B;  3NZQ A;  3UT5 E;  2MBG A;  4U5G A;  4ISS A;  4AKI A;  3DAG A;  3ZMT B;  1ZHY A;  4G7O F;  2C03 A;  5JVD E;  4KBL A;  2W9Y A;  1SHZ C;  1Z0P A;  3X2Q C;  4IWB A;  4KUM B;  2JQQ A;  4WNK A;  5DJQ C;  5L3F B;  3E22 E;  4O4H E;  4OFZ A;  5L3D B;  3ZSU A;  3N9N A;  3HTK C;  3EGX B;  3SNH A;  3O4X E;  1FFT C;  3SYN A;  2W00 A;  4ZI2 D;  1FTS A;  3GOD A;  3RC3 A;  2VAS A;  3CQC B;  4EZ4 A;  1G73 A;  1LVK A;  2ACX A;  2BZB A;  5LJM A;  4BAY B;  1G8X A;  4I1M A;  2CXD A;  3ZIB A;  4B6I A;  3CKD A;  2MOZ A;  3ZCI A;  4G7Z F;  4Z8X A;  5J2T E;  3POV A;  4AKL A;  1SMY F;  4OYK A;  2W0G A;  5H6Q B;  4FWV A;  2DLR A;  3JSZ A;  3N9P A;  4HE8 D;  3EJN A;  5KX5 E;  3LS0 A;  3ANW B;  4RDA A;  3NBX X;  1U4Q A;  2X67 A;  1JPJ A;  2W62 A;  2A6E F;  2H7B A;  2C5J A;  3MK7 C;  3J9X 1;  1MMD A;  3ZCJ A;  2WZL A;  3SRZ A;  3L34 A;  3W8I A;  4BJ5 A;  4DVZ A;  3Q9D A;  5EGY A;  2V26 A;  4IST A;  4ZS3 A;  5LJN A;  1YKE B;  1OCC C;  3RYL A;  1UX5 A;  4DOZ A;  5JDH A;  4O4I E;  3FBL A;  2C5K T;  3P8C D;  3CWZ B;  4CXW A;  3X1O A;  1OXZ A;  1US7 B;  5LG4 A;  4XAX B;  3RRC A;  2CEA A;  4CI2 B;  1BR2 A;  3KDS E;  4OIQ F;  4I4T E;  4JEU B;  5CA1 E;  3CPZ A;  1TR2 A;  3EFO A;  2LHN A;  4O8S A;  2EHO D;  2Z6E A;  2W63 A;  3CQX C;  3DZA A;  1ZKE A;  4U5E E;  4J2C A;  4ERR A;  3PUG A;  4MBQ A;  5FY0 A;  5BMV E;  3ASO C;  3ECS A;  4GOU A;  5CB4 E;  2YU2 A;  3HKC E;  2LSG A;  2W61 A;  3UUN A;  5JDM A;  3KBT A;  1Z3I X;  4W8K A;  3AG1 C;  4JJG A;  3ZC4 A;  4G63 A;  3HJC A;  3MXZ A;  3BQI A;  2DI4 A;  2XAS B;  5EK3 A;  2WZG A;  4CS9 C;  4ZLC A;  2ZM2 A;  1MMA A;  3KV6 A;  4X1Y E;  1O3X A;  2YEV C;  1MMN A;  5LYJ E;  1QZX A;  4QXC B;  2IXO A;  2J0W A;  3O6X A;  2LSK A;  4MND A;  2VH3 A;  2C0S A;  2NWB A;  1HFA A;  3Q7G A;  1ZEE A;  3ZYM A;  2YZS A;  3PUR A;  1X79 A;  2Q9B A;  3IF8 B;  1KU2 A;  1UCU A;  4YN0 B;  2ES0 A;  2KXP B;  4H9Q C;  2JRK A;  2LJL A;  5HAX A;  1VMA A;  2WVO A;  3I0O A;  3DXJ F;  3L09 A;  4KBM B;  4BJM A;  5JDQ A;  4Q5S F;  1VYI A;  5KYW B;  2ODV A;  2GK9 A;  3ZLI A;  1V9D A;  5FXW A;  3DMD A;  1PD1 A;  4A2N B;  4YHJ A;  5E0O A;  3ANW A;  4YFS A;  1ST6 A;  4DVD A;  2X9Y A;  5CA0 E;  5LGT B;  2DYR C;  4Q7C A;  4IE4 A;  2UXX B;  3VKG A;  1NG1 A;  4GEH A;  2OG2 A;  3C4X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...