3RH3A

Crystal structure of an uncharacterized duf3829-like protein (bt_1908) from bacteroides thetaiotaomicron vpi-5482 at 2.10 a resolution
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
256
structure length
239
Chain Sequence
TEELDDASKVINYYHMSLAVLRHVANAKDINAVLGYMEQTGTAELLDPGDYFNPEVRQNLKQNYAGLFNVRTQFYDNFNKFLAYKKSKDTAKTAQLLDENYKLSVELSEYKQVIFDILSPLTEQAESELLADEPLKDQIMAMRKMSGTVQSIMNLYSRKHAMDGVRIDLKMAELEKELKAAEKIPAVTGYDEELKNFQSFLSTVKSFMNDMQKARSKGAYSDKEYQAMSEAYEYGLSVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized DUF3829-like protein
publication title Crystal structure of an Uncharacterized DUF3829-like protein (BT_1908) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution
rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Structural genomics, unknown function
total genus 89
structure length 239
sequence length 256
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-04-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.820 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3rh3A02
1.20.120.930 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3rh3A01
3RH3A 3IEEA 4YJWA
chains in the Genus database with same CATH superfamily
4Z8XA 3U5SA 2MHRA 1A7DA 3ZMTB 3POVA 2CCYA 3QZCA 3TLUA 1OXKA 5KDMC 2CHOA 2EHOD 4HGAA 2CXFA 1TWGA 1PD0A 5COFA 3NMJA 4JVSA 3CX8B 2H88A 5KX5E 1Y4CA 4FESA 2XAHB 4EBKA 1KNRA 4RD9A 2K5BB 2J62A 3W8IA 2IYLD 3CSKA 4U5GA 5AFUL 3BRJA 3PHF2 4A2NB 4X1KE 2WDRA 2J9WA 3HKEE 1FFTC 3JC6C 1ORSC 2GWWA 3P8CD 2RA1A 2QE9A 2BG9B 4AQGA 1T6IA 2DGJA 3MKDA 4HWCA 1FNTc 2CPTA 3MA9A 2CM0A 2SPCA 5D92A 2BZBA 2DHRA 3RIPA 4LMLA 1WRDA 1D0XA 2OOCA 5JVEA 3WHNA 5DLJA 1LVFA 4GKKT 2Y3DA 2R7OA 3EHNA 3V5ZA 4YSXA 4KC9A 3T6JA 3UUBA 2CXDA 1T9KA 1YQ4A 4AKIA 2XASB 2LRLA 2HMZA 2KMFA 4ISSA 1VRBA 2YOEA 1L0VA 1YVIA 4R32A 4MVRA 4QX8B 4ZXLA 4DV4T 1LI5A 1NWMX 3QB5K 4UF0B 3NMKA 2OCCC 3KV5A 5KMGP 3QVYA 4JTAB 3C7JA 4OYKA 1OEDE 2VKOA 1C02A 4IT4A 4OYJA 4A56A 1ORYA 4LDQA 5L0HA 1EA8A 4Q5SF 2LM9A 3TD7A 2R7XA 2CBJA 2UU9T 2BS4A 3HKBE 4ZLDA 4IDNA 2OV9A 4JEUB 3H37A 3B5MA 2VCAA 2R7QA 4IWBA 2Q3TA 2CE7A 2XM0A 5HCJA 3B57A 3ZQYA 2X9HA 1A0BA 3ZEFB 2L9QA 4JE9A 3K1IA 4X1IE 4O4LE 2IDOB 4E7ZA 4EGWA 2KINB 2WVOA 1O3UA 2A2FX 3KINB 2WU2A 3UU3A 3RYHE 4YL3A 2DYSC 2HPLA 1Z5ZA 4DXWA 5LP6E 1WASA 2Y3GA 2FJDA 2E5LT 4CN6A 3RYLA 4HFDA 4GEHA 2NR4A 3ETUA 5HEJA 3V7OA 2V7KA 2VKDA 1XWJA 1OXBA 2BBHA 2YHSA 3GM2A 4IL9A 2XLWA 4ZI7E 3K66A 2KK1A 5FL0A 3TK0A 3U3BA 5CIVA 2D5UA 4HEAA 1GGQA 3W2WA 4NY3A 4WGZA 1JPJA 2OEXA 3UGOA 4MVQA 5JR9A 4ULWA 4QHOA 2XQ5A 3K3QC 5HEUA 2V7LA 4BAYB 2YWAA 1ZV4X 1VCSA 2ASRA 2CDQA 5L3DB 2KNDA 1V9DA 2BKOA 2WM9A 3CX6B 1FR0A 1YKEB 3ZMZB 5ABFB 4IDPA 3J06A 4WZXA 4ER9A 4XEKA 2EIMC 4H9SE 3ANWB 3O10A 3L09A 3L8JA 1VCTA 2PF4E 3V5UA 3PJAJ 3V5SA 4UIGA 1HX1B 1NLXA 5JDMA 5BR8T 2UXCT 1HY5A 5DQVA 3ESLA 3LEOA 2BDEA 2E2AA 1VTMP 4A97A 3CZ6A 1JNRA 1CUNA 3NBXX 5LB7B 1V54C 1WTYA 3I5QA 1HNZT 2ZPAA 2D2SA 4N6HA 2CCQA 2QVAA 3TOLA 4YL1A 2IC9A 2Y48B 1LE4A 1NAFA 2Q4FA 5LBMA 2UXNB 3M65A 3CQZA 2BS2A 4U7YA 3ETVA 4IDZA 4QKNA 1SMYF 2CNWD 1IJ6A 3EG9B 1DOVA 2Q9QB 1MIVA 5KYUA 4ZLCA 3RHWA 3S84A 3T4RA 2W0GA 1I4ZA 5L0CA 2XAJB 3RVYA 2R02A 3UU4A 4X1YE 1HMDA 4AL0A 3P50A 4LERA 3O39A 3GM1A 2V8SV 1RJ9B 2IW5B 3JRTA 3G4XA 4IAQA 4H63V 3RF3A 2VC9A 3PMRA 2H7VC 3RLFF 2NW9A 5J1GA 3OEOA 3PUXF 1E84A 3LDQB 1T72A 2UXBT 2L8KA 2NTXA 3B0PA 3O55A 3RPUA 3KBUA 3AAEB 4JLEA 4CN4A 1IW7F 2P0NA 2XSBA 3DZAA 4JI3T 2EIKC 1ZVZA 5L3BB 2BL2A 2WP9A 2WZHA 5HYAA 2WZGA 5E3AA 4ADZA 3AA7B 2H3RA 5IY5C 2HH7A 4HWIB 2W66A 2ZXWC 3SFDA 5KYUB 5M4YA 4AK9A 2L7AA 4ERRA 2YLDA 2W4XA 3ZC1A 1Z6AA 1BBHA 1OW6A 3FXDB 3GEHA 3X2QC 5TAOA 5IYZE 3FMSA 2QUPA 5AQVB 2R9RB 2XQ6A 4I50E 4K7BA 4GIWA 3RIFA 4H9OC 4KBMB 3GM3A 2CWOA 3ZCIA 1LKXA 4KBLA 2XS8A 2J9VA 4EWCA 2OJQA 3FHNA 1VMAA 4ZZCA 2W00A 4TX5A 3H65A 5ADXL 5LGNB 4DVZA 2X9WA 5LGTB 3KYIA 3M4CA 1U5PA 5AQKB 4JJFA 4BJ5C 4BJ6C 3UFEA 5EK4A 3SEOA 4JEBA 3H2UA 3K33A 5JDHA 3PUWF 3OJAA 4BJNA 2Y3BA 2AE9A 2IM8A 5FXZA 4CJGA 1CHUA 3L3PA 3EZHA 4PK6A 3RQFA 4DR7T 4JEHB 3IF8B 2V7JA 5F8PA 3QVZA 3AECA 4JI1T 3R84B 3HKDE 3GWNA 4HFIA 2WWVA 3JADA 4X66T 3AJMA 5JRCA 2VCBA 3N9PA 3PUZF 4U5HA 3RQWA 1OW7A 3AE1A 4KHZF 2W63A 2D5RB 3K8PC 3AQCA 5DVWA 3U0CA 2A68F 4WBOA 3OTOT 1SHZC 2ACXA 2EPKX 3ZYLA 2OQMA 3NYLA 1MMAA 3KKBA 5A6JA 1D1CA 3W15B 4PJLA 4NXMT 4ISTA 5JREA 2PX0A 3SXZA 5LG4A 5L3VA 2EHOA 5JDNA 2BKPA 4AL1A 3ABVA 4PJMA 2XRHA 2LSKA 3Q5XA 1LI7A 2G0UA 1IZMA 3G4ZA 1NG1A 2JPUA 4EEBA 2XL4A 3QK6A 3SXKA 1JOGA 1TKNA 3DAFA 3UMIA 1OCOC 1WFDA 2L3LA 3AE4A 4ASKA 3C8GD 2FJAA 3SZRA 4DMWA 4COFA 1JAFA 5AC5A 2VQET 4CJOA 5KYXB 4JI2T 3O4XE 2BG9C 3NKDA 3S28A 2QTVA 5AQGB 5FVLA 3W8HA 4JI7T 4HWHA 2Q9QD 3M79A 4E0IA 4KHPT 4UV8B 5L0JA 3GN5A 3P4WA 3GORA 2NWBA 3AQBA 3M15A 2WMNA 2OJED 5FXXA 2XXAB 2NPUA 2EHOB 3O6XA 2JQQA 2PBEA 3HKKA 2VKHA 4IE5A 1HS7A 3KPHA 1IZNB 5JDGA 3V5XA 3TOMA 1E86A 2VL0A 5LGUB 4H63H 3HNKA 4EIYA 5JDLA 3AA1B 1I5NA 3AG2C 1E85A 4C90A 2ACZA 3VRAA 4YJ2E 2YVKA 2IUBA 1YW0A 3FOOA 1CGME 3TLVA 1HNXT 2ZXOA 1KFYA 1XMQT 2M4EA 4J30B 4NIQA 4QWNB 1WGWA 4PW8A 4DOZA 5JP7A 3FAPB 3HTKC 3S9OA 5FXWA 256BA 2A1DD 4O2BE 3RI5A 4IAOA 4A5XA 1D1BA 5AQTB 4DJ9A 3MACA 2UUAT 2YEVC 4JI6T 2VK9A 2QGSA 4LLCA 2DI4A 5DJQC 1V4AA 4JI5T 2GDCA 2DWGA 3GANA 1KU2A 4OIRF 3DAGA 1NENA 3T9OA 3AG3C 1TWCA 4YWQA 4AKRB 3CPZA 1HG2A 5EK2A 2A69F 5HAXA 2I0MA 1QSDA 3ABKC 3B13A 1QZXA 1EI7A 3TJ6A 4IARA 3DXJF 1Z8UA 4QX7B 2JIWA 2XL8A 4IRUA 4BJ5A 2I6HA 2XQ8A 4BJ6A 1J5ET 4MVZA 4C3EA 2YU2A 4JTDB 2WDVA 4DV6T 4J7TA 4OIOF 4JI0T 2CA5A 1YAUO 1YA7O 4UVBB 5F5FA 3AEFA 5A6AA 2YDRA 1FFHA 2E8IA 4D4XA 1YARO 3L0IA 3RC8A 2Q9CA 1Q0KA 2ZM6T 2LK4A 4UEMA 4CI1B 4LF5T 4GYTA 3EDVA 1QSPA 3VAYA 2KWIB 2XL6A 1SUMB 4CS7A 2B0JA 2RP4A 1Z23A 4AE4A 2B76A 3IA3A 1CGOA 3KMIA 5AQFB 3AEAA 2YINA 1OR3A 5LNKA 2NW7A 1OXZA 3CKDA 3Q7LA 3RQEA 5ETWA 3ZKRA 1T01A 2W4MA 1A7EA 1Z63A 4TN7B 4YLHA 3ZC4A 2CNWA 4UELA 4AX2A 3UTKA 4H9NC 4DV2T 2JX0A 1LS4A 5F3JA 2X9YA 2Q9QC 2KNHA 4DV5T 5E2QA 5K0IA 1YQ3A 2QLAA 4Z9IA 1EKYA 4F4BA 3OBVE 1MIYA 3LNRA 5FY0A 3N24A 2J7PA 5FL1A 3JT1A 3ZVRA 3WI3A 2V26A 4YY3T 3ITFA 4KNWA 4X64T 4HEAJ 1AUEA 3FHDA 1UUSA 2H7OA 4IREA 5FMNA 1M2VB 1E2XA 3P4QA 4FJOA 1TFKB 2YZSA 2ICWG 4CZZB 4P0AA 3NYMA 5JUAA 3FOPA 3UGPA 4FX5A 2Y3HA 1O87A 3TJ5A 3US6A 5E0OA 2BKNA 3W2VA 3AE3A 2W45A 3ZWIA 3R7CA 2R7WA 2WL8A 2XUEA 4PK5A 2CWYA 3AE8A 3PU3A 1KNYA 2OLTA 4WGYA 2D9DA 2PBIA 3MYIA 4PFOA 3LS1A 3DE9A 1FMVA 3QW0A 2OA5A 2R7RA 3V5YA 3Q6NA 2I59A 1A7VA 4EZHA 5LHHB 2MOZA 3MFNA 1U0BB 4UF0A 3HJCA 3E70C 3SOLA 3K1SA 3FBLA 4MBQA 3IQTA 2XQAA 1S7ZA 2FJBA 4CIHA 1EZ3A 2CMRA 3LUTB 1HTJF 2V5CA 3MXZA 4C3DA 1KK7A 1K04A 2O9XA 4FI5A 2Y39A 5ABHA 1T8BA 3EDUA 3VHLA 3L1MA 3MLGA 3FZHB 3HR0A 4C7OB 2X68A 4WNKA 1WLXA 3SXYA 1T6QA 2XS1A 4IB4A 4HFKB 1QPUA 3AEDA 4XQ1A 2LKHA 2FFHA 2YEVA 3FXEB 2R7SA 3LLIA 3IHUA 1OCZC 3AXJB 1XNQT 1NSGB 2X0YA 1OKKD 5A69A 4P0BA 4EYYR 4DUZT 4U2YA 1U89A 2F22A 2WU5A 2NP9A 4CN1A 2VQFT 2HHHT 2GK9A 5H6RB 4B3TT 3JYHA 4EHPA 2J1DG 4I0UA 3MX3A 4MVMA 3NDBB 1YLMA 3EVYA 4HFVA 2ZM2A 2D0UA 1R8IA 3S4UA 1SA0E 2MYSA 5IUXA 4XPYA 4DR5T 1M7KA 2CRBA 3E9VA 1J1JA 1MNDA 1M57C 5ABFA 1AVOB 2K9AA 1JR8A 4AKLA 1YJGA 3SRZA 3TULA 2NOXA 1XZQA 3F2EA 5LHIB 4G0HA 3ANWA 2C5JA 4X20E 3ABLC 3TLSA 3P4RA 4H9PC 1V74B 4OIQF 3P4SA 3SWHA 3JRMO 3DJUB 2P9BA 2Y6XA 4O8SA 2A9UA 3N2KE 3EABA 4U5DE 2XZEA 1ZHYA 4OIPF 4LFCT 2WZIA 3RKGA 5C8YE 3DJNB 3WG7C 3C8GA 3OYXA 4DUYT 1WYBA 1E7PA 2Z15A 2XHEB 4MTOA 1HW2A 1GQEA 1C03A 4JTCB 1D1AA 2X0CA 3UNGC 2R03A 3AVRA 2W4BA 4EXTA 2XM4A 3EG9A 4DR2T 2Q9QA 3LS0A 4YK5A 4DBRA 1U4QA 4G2AA 2KT9A 4B3RT 5CGMA 2XLHA 3UU6A 2YRFA 2MWQA 2AWCA 2X0HA 5CJ5A 4O4IE 3FAJA 4M63A 4DV7T 4QXBB 4EAHA 4PJJA 3RYIE 2EHOC 4X65T 5JSLA 3T6GB 2A0UA 2XLVA 3A11A 1CPQA 2LIGA 5KYYB 5LA6E 2VB6A 4I55E 4IDOA 5L3CB 2OG2A 1RJ9A 2P1AA 1EQ1A 2XLOA 4OD5A 3UFGA 3ZN1B 1G8XA 2LSYA 4YHHT 4OHFA 1E83A 3C8GB 2E87A 1H9GA 3RGLA 5LBQB 2QY9A 3AGUA 1YZAA 3SNHA 1YZCA 4L9IA 3DJBA 3RYFE 5LMUT 2LFFA 4OK0A 2VVNA 4DO0A 2G3VA 3RIUA 2LSIA 4KX6A 2B0HA 5LG3A 1B7TA 2V5DA 1UURA 4JJGA 5CI8A 3ZMUB 2HN1A 1R4TA 2KSFA 3BEHA 4AI6A 4K1OA 3C4ZA 2JPFA 1W0BA 1UX4A 4L5GA 2DYRC 2YL3A 2ZMAA 1IBLT 3NYJA 1RKCA 2LM2A 1GM5A 2XQ3A 1ZZPA 2V7MA 4LDRA 2V3CC 1ZHXA 3AAIA 3C50A 3PCVA 3PV0F 2W9YA 3G06A 3PUAA 4EZ4A 2BBJA 2WY2A 4W8KA 3U9JA 2XAFB 4UVCB 3QUJA 3AEEA 1N33T 4CIPA 1FMWA 1S35A 5LXTE 3CAXA 3HA4A 4TUYE 2CEAA 2J9BA 4HFBA 4EIWA 4YFSA 1LM3B 2UUCT 1NU7D 2OU6A 5KXJA 5H6QB 1WR0A 3EGXB 2N9DA 1N36T 3SP1A 3Q7GA 1D0ZA 1ZW2A 3VM6A 4JURI 5IWAT 3K1HA 4XBFB 2IBFA 1BDJB 4DMVA 2XY8B 2ZXRA 3FZLB 4JC7A 5BMVE 3EH1A 1HE9A 1FJGT 1LE2A 4AIUA 2EIJC 2M67A 2C04A 5B1AC 4QXHB 5J2UE 3DI5A 3RKOA 4TNWA 3JZ0A 4ONSA 1XDOA 1BR0A 1ZYRF 1OQCA 3A7MA 4BJTA 4CI3B 1WATA 4O6NA 4MW3A 3F31A 3RQUA 3W4YA 1OCCC 3RRWA 1I6ZA 1M62A 5AQLB 4JKVA 3ZT6A 1I94T 4IE7A 1APCA 1T5OA 5CFBA 1KTMA 4QDLA 2LD6A 3NRHA 4MVOA 4E17A 2X51A 4I4TE 1FTSA 1ORJA 3GODA 3KH2A 4NQFA 4K0DA 3UUMA 1LVKA 4BG0A 4Q4ZF 4D4NA 5HXRA 4HE8A 3I9WA 3KV9A 2CHNA 1UG7A 2IIUA 4LFBT 1OEDA 3N2ZB 2P7VA 4CXXA 2QA7A 1JRAA 2NSFA 3C8ZA 1YYJA 3HNJA 5KYXA 4P9TA 3CQGB 1W09A 3UT5E 4IGUA 2XM2A 4G7HF 1IJ5A 2XSAA 4HKAA 3PDMP 1DU2A 2LP4A 4LF9T 2BG9E 2H7BA 3S90A 3CX7B 4YJWA 3OPCA 5HXSA 2YKZA 3G50A 4XPWA 4G78A 2MAWA 3LSVA 2IC6A 1WCRA 4L6RA 2W61A 3HLZA 3U2LA 2XXAA 1US7B 4U72A 4O6YA 3EPVA 3ZCJA 3K7DA 3EFOB 2GA0A 2HN2A 4U5EE 4AQYT 3AVSA 1KF6A 4O4HE 3EHMA 5JLIA 2X67A 4YT5A 4K0UA 1OEDB 2HS5A 3N9OA 5L3FB 5T1DB 3M3ZB 2HSBA 3F57A 3ZT7A 2R25A 3U8PA 4YSYA 1Y6DA 3Q9DA 3B0UX 3CQXC 4MS2A 1ZEEA 3ZN0B 3ZTZA 4J2CA 2J9UA 4CI2B 3NKEA 3TLTA 2CBIA 4CSAA 2NSGA 4IJJA 1WOLA 3J7Yq 1A41A 5AQSB 5L4EA 4J32B 3R2PA 1OKKA 1O5HA 2YL1A 4XTKA 5HXHA 3M1CB 4MTGA 4TWFA 3EGDB 1MMDA 4EBJA 5ABGA 1D0YA 1H7IA 2KJGA 2YDQA 4BPMA 3KVAA 3QOFA 4XAXB 4N6CA 3DE8A 4Z9JA 2W2UA 4YT0A 3NZQA 1LRZA 2EPOA 2YLGA 1SZIA 2KC3A 4H54A 3K3OA 4XPXA 1IBMT 2Z6EA 3I4UA 3MYFA 3N0TA 2BC5A 4KI0F 3O9XA 3KDSE 4NXNT 2XLMA 1LS1A 1WYCA 2IXPA 5E33A 3VR8A 3RH3A 4MALA 3VF0A 3C4WA 1VK5A 1SE7A 5L4HA 4EUKB 3ZC0A 3PUGA 2NUPA 1W9RA 4QH5A 1ZP0A 4NPPA 2P6VA 2YLIA 5FYMA 2NUTA 2LJLA 3S0XA 1JNZA 2ZXPA 2D4UA 2YQYA 3AE2A 2C03A 3RFYA 4F8HA 2WSSV 1YD8G 3E08A 2YL0A 4GK5E 4U5BE 1OWAA 3ZYMA 4KMCA 3B0VC 5J0ZA 2A6EF 3L34A 2C5KT 4GK0E 2YL7A 1K40A 2L6GA 3PE0A 3Q5WA 4MFRA 3OVUA 3NG1A 4HWDA 3FVYA 4MW8A 4LACB 2K3WA 3H3MA 2R05A 2F4VT 4CS9C 4X5TA 3C51A 2EPNA 4NC3A 1FEWA 3LK3B 4XZCA 3F47A 1RXQA 3OWTA 1ZKEA 4P6IC 2NUPB 2NUTB 2C0SA 3PU8A 3I5PA 2MTQA 2HZ8A 3O1IA 4NCQA 4CDVA 5AQQB 2WBLA 3DD7A 3AB3B 2ES0A 1QVXA 2XQ7A 4CXYA 3GA8A 5FCLA 2RD9A 3VKHA 1M2VA 4Q7CA 2LHNA 3EUHA 1NEKA 1HG5A 1VLSA 2YN6A 4O4JE 4I1MA 4NUVA 2XTLA 1HNWT 2JMKA 4AISA 2J46A 3KFWX 4W8PA 4YTMA 3ZPOA 2VL8A 3DWWA 3ECSA 3ZT5A 2XLEA 4GYRA 4NTFA 3S27A 3LG7A 1RKEB 3RW0A 4U9EA 4BEJA 2E9XB 3GWHA 3EH2A 4CDAA 5JDFA 4AKHA 3LEVA 4EYUA 3E22E 4MVUA 3AE6A 3I1AA 3R6NA 1GQAA 1NZEA 5B3SC 5GPGB 5AQHB 2UUBT 5HCMA 3RC3A 3FDQA 3IPMO 2WB7A 3GEIA 4O6MA 2HUJA 4ZI3D 2DLRA 4ILAA 2I15A 3EHZA 1T6UA 3QMKA 4LMKA 5F28E 2AXDS 1E2AA 2FUPA 2WDQA 1SF8A 2WMOA 5B3IA 2OEVA 3AAAB 4NTAA 3K6BA 4DVYP 5L0FA 5BQGA 4HFHA 4HN9A 4C7OA 2HJMA 4IHJE 2R7UA 2EPMX 1H7CA 4TV9E 1ZHCA 3UUNA 4UVAB 3MJXA 5AQOB 4N4WA 1YKHB 1PCXA 2WVNA 4N06A 1NBBA 1YA9A 3AXJA 3RIUC 1Q0FA 3C63A 5FY1A 4ILBA 3SYNA 1UGOA 2ZLYA 1QLEC 4V1Av 5DS5A 4AKGA 2V1DB 3ZDLA 4JV5T 3IQCA 3U78A 1IBKT 4MVSA 1KNPA 4TZ4C 3UMHA 5AC4A 5F5HA 3UR3C 1UFBA 2WB5A 4H9RC 2DNXA 4U5CE 1VYIA 2CW0F 1RMVA 4TWHA 1Q0MA 2AU5A 5DABA 4C3BA 5JTGA 4U9DA 2YK0A 2LOPA 4A98A 4XEVA 2IXNA 3IQ5A 3S29A 2K24A 4BA9A 4BJMA 1H9TA 4BEMJ 4QH1A 5HWYA 1GS9A 2PP4A 5E3CA 2YDSA 3JTLO 4RBNA 3O1HA 1ZHWA 5HEOA 2R7TA 2X9XA 4WYVA 2BVMA 1G4WR 1LPEA 1M2OA 4I3MA 5DS6A 5BQHA 2WAUA 2AVKA 4M1PA 3PUVF 2LEHA 3FZKB 1M6TA 1UCUA 3NVOA 5KYWA 3AG4C 2UXXB 3CWZB 1HE1A 3KV6A 3KL4A 3ZSUA 2TMVP 1N1CA 5BUOA 5CA0E 3JAFA 5HWXA 4PAGA 2ZM8A 3ONXA 2MPKA 3KYJA 2G62A 5TJ5E 3UU5A 3QNUA 3DMDA 3QTHA 1Y01A 3MK7C 2RSEB 2LSJA 5DS4A 4KNVA 5AQUB 2GAQA 2LKGA 2W62A 1BR2A 1YYXA 5FKYA 4CS9A 5IHYA 3ONLC 3A9CA 2JRKA 1J8YF 2XPKA 2L81A 3B71A 2CXLA 1PV3A 3L39A 4ANJA 5L47A 4JRZA 4PK4A 4DR3T 4WJ0A 4FAPB 1I4YA 3UMKA 5CB4E 3EZIA 1MQVA 1BR4A 3I0OA 2PTFA 5KYWB 2FJEA 2X66A 2H8AA 5EZYE 5CA1E 2XQ4A 2VASA 1HFAA 5KYYA 2YU1A 1HCIA 3IEEA 3UQ4A 3BK9A 2WVQA 2QNLA 3N9MA 5A6BD 2KSRA 1SR2A 1W0AA 3GWLA 4IE0A 4ZI3C 4ULVA 2PX3A 1MNEA 2FBWA 4ZHQE 1W2WA 2E9XD 1OEDC 2DWKA 2FGYA 4JYAT 3IBPA 2JQHA 4RDAA 5LMNT 4MHCA 3OA1A 4EB6E 1HR0T 4H4KC 3LESA 4TV8E 2LLYA 4B3MT 4LF8T 4U33A 4ILCA 1ZHZA 1WR6A 3QW1A 1IAPA 2BS3A 1Y64B 4UV9B 4JI8T 2Y8DA 2ODVA 4KI2A 3VYWA 4ZS3A 1VB5A 3I0QA 3ZJ1A 2J8WA 5AGFA 4OINF 4HFEA 3PTRB 3KV4A 2J47A 4DVDA 2KQ9A 3WODF 3P4PA 3AOUA 4Z91A 2QYWA 1BZ4A 3ONJA 1S05A 4O79A 2PFVA 4ZI2D 3PUYF 1LIHA 5L3EB 5LHGB 2IHR1 5L3GB 5CI9A 3FBZA 3ZMVB 3N5LA 4DNDA 4Q25A 5AQIB 4GKJT 2KW3C 3LJBA 3LBXA 2HMQA 1TWHA 2CLYB 5AQPB 2EPLX 5FVKA 2I8BA 4CBEA 4H9QC 2MBGA 2QRXA 2V6XA 4DRJB 3AE5A 5T3WA 3ZQVA 1AJ3A 2UUIA 5JH7E 5JR9B 3RKOF 4YN0B 2E5VA 3H2VA 3EGXA 2NW8A 2PFDA 4CSAC 4G63A 1VYKA 2KYHA 4CS8C 3RQGA 4TWDA 1S94A 3U8VA 5JT4A 1N34T 5FZTA 1ZHTA 4YJ3E 2M6BA 4C91A 3EJNA 5A6KA 3AGTA 3LK42 4YSZA 2DCFA 1R5ID 3FXHA 4JEAA 2A72A 2GFHA 3D0TA 2L6HA 1VLTA 5BQIA 4YXDA 5HV9A 2PJQA 1TQGA 3IHRA 5GONE 4X62T 4PR9A 4CXWA 1PD1A 2DB4A 3H3AA 4YTNA 3F46A 3Q5DA 3LBXB 1OW8A 2J7PD 3CK6A 3EAMA 2XJ7A 3OYZA 2V6YA 3HI2A 4EOZB 4LLEA 2H89A 5EHHA 3JYYA 1CPRA 1QLBA 4E7SA 3JAEA 1ST6A 1J5WA 1B68A 3BQIA 5ABEA 2EILC 2NG1A 1XDPA 3QB5A 3PUQA 4U5FE 1Q0DA 3P7IA 1HX8A 3WAKA 1ZU4A 3ZTMA 1OR2A 3J9X1 2BVLA 5HSWA 3NZPA 3AG1C 4WBNE 5C3JA 5COGA 2XQYA 1M56C 4DBQA 4UXNB 4N78D 4DV1T 2LFDA 3RIAA 4OFZA 4JW1A 4L0RA 4XWJA 1E1HB 3AEGA 4G7ZF 4DV3T 4EKWA 2W67A 1YXRA 2IAKA 2IXMA 2RPAA 4DV0T 2HSQA 5EGYA 4DRHB 4XLPF 1C17M 4B6XA 2L9JA 2IMLA 5FY7A 2V6YB 1X9BA 3HNIA 4FWVA 2LHRA 2CYDA 4HFFB 4UDVA 2XAQB 4LF7T 4IDQA 5EK0A 5J2TE 2ETSA 2E9XC 2C5IT 2BE5F 4P9FA 3ZLIA 1Z7Qc 1QKRA 3B9QA 3LFMA 4IE6A 3RX6A 2XAGB 2WCAA 2EINC 4NTBA 4GOUA 3X1OA 3EFOA 1TFOB 3AA0B 1CGNA 3ZJ2A 2Q00A 2G3KA 2D0TA 3VRCA 3K3NA 4LMJA 3LAYA 3ZSSA 4YTPA 4B3ST 2PG8A 4U74A 2AWYA 2KWHA 1HW1A 5T3TA 3HKCE 4P09A 2N2NA 5F5WA 2LSGA 1L3PA 3PJAA 1QQ3A 2VURA 4JCZA 3CEXA 3JCFA 4EBBA 4DRIB 1KEYA 1XWMA 3CVRA 4ZI2C 1HF8A 2LQGA 4XEFA 5LJMA 2UXDT 1QUUA 2VVSA 1FAPB 1V55C 2A3DA 1XNRT 2FAPB 4ILUA 1L7CA 2Q7RA 1NU9C 4NUUA 4QI0A 1ZW3A 1TWAA 3PURA 5LJNA 4I44A 4MTFA 5FXVA 3AE7A 1UX5A 4E0HA 4JIOA 2JQ9A 3UU8A 3N2OA 2R7VA 3N9QA 2IOQA 2KGOA 4PACA 5HXCA 4LDKA 4IGGA 3EGDA 3T1HT 4QXCB 5JRAA 5FP3A 4BJ1A 3MBGA 4J7YA 2B1EA 3NRXA 3GMIA 2XLDA 4CX9A 4DR4T 4PJNA 2XSEA 1K05A 1F1MA 3DM5A 2DI3A 4Z9HA 4JUYA 2HV6A 2OKUA 2KZ7B 3DTOA 4U3CA 2J4GA 2WQYA 3JSZA 5COMA 1MIWA 3A5XA 5DQWA 4IIJE 3PUSA 4IL4A 3T6BA 3B29A 4X0RA 2J0WA 3QC9A 3RRCA 2ZM0A 5D91A 1Q0GA 5C2TA 1JPNA 4O7GA 3GEEA 4CS8A 4OX9T 1NFNA 5JRCB 3U2MA 1T98A 1MMGA 1HMOA 2IXOA 3NRYA 4F6RC 1KNZA 3C62A 2P61A 3L8RA 2XQ9A 4GQHA 4IE4A 4WABA 4DR6T 4JCHA 4UR9A 3JSEO 3U9MA 4AQFC 3FZMB 4HWFA 2N1GA 1G73A 1O3XA 5JQGE 2CGEA 2LE8A 3LLKA 4ZEYA 2UUHA 5AQRB 1SYQA 4PNIA 1G4US 4DIDB 4YT2A 3ABMC 4ZS2A 3L8IA 3ZYKA 4LF4T 4QH4A 4WW0A 3ATPA 2LSEA 1BR1A 3LK2B 1J8MF 3HL6A 5L2LA 3OKQA 3C98B 3O1JA 1XZPA 5B1BC 4YT4A 4KP3C 4LFAT 3SXMA 2WWUA 3LNMB 2XM1A 1G5ZA 4I43B 3FZFB 5L0DA 2ODUA 3E0ZA 3VRBA 3JCUQ 4YT8A 2WZLA 4MQ9F 1NFOA 3KVBA 3ZG1A 2VCCA 3AEBA 2ZD9A 3C18A 2AP3A 5AQNB 4ZOLE 3TLWA 2HKVA 4YHJA 5KYNA 3RF1A 4JZAA 4CQIA 4U2ZA 3HNLA 3N2GE 3U3IA 1H6GA 3GN5B 4AXPA 5DQZA 2WZFA 3Q6MA 3DM9B 2X0LB 3JC6D 4OD4A 5HEGA 3BQKA 1DOWA 5A6BA 3Q5EA 3UQ7A 2Q9AA 2J0XA 2NTYA 4HTEA 1RKEA 3TKLB 2LT3A 3DP7A 2E9XA 1ZOYA 4O2AE 2JD3A 3FB2A 1N32T 1VOMA 4JBWF 5HEHA 4U7IA 2VH3A 5A1LA 2PNOA 2K48A 3LJCA 2KLQA 2YKSA 3SS1A 3ZSTA 3VU7H 1Z3IX 1U6HA 3SFEA 3T1YT 3UUXB 2HPJA 3NWIA 3ZIBA 4E18A 4U31A 1MMNA 4CDYA 4B6IA 3NMIA 3C64A 3K1IC 3KBTA 4KUMB 2HJ3A 3MZKB 5L0GA 3WAJA 4EV6A 2DL1A 5L3QA 3VKGA 5DQTA 2LRKA 1YDIA 3EQLF 3AE9A 2VKJA 2HV7A 4G7OF 2A6HF 2LCHA 2A0BA 2JMHA 2V7IA 2M64A 2L6FA 1ZU5A 3X1DA 3NKZA 4I1OB 5JDQA 2Y69C 4K0KT 5JVDE 2LOSA 2CLYC 1X79A 3RVZA 1RCPA 4ZZBA 3I9YA 4DR1T 3N9LA 5LYJE 4A4AA 1XZYA 1JMWA 3U3FA 3RYCE 1OCRC 4GYSA 5JR9C 5EK3A 3UULA 4HFCA 3A8YC 2R6GF 3VR9A 4MNDA 3ASNC 4XLNF 1Z0PA 4PFPA 2J45A 3IQ6A 1WN0A 4EEDA 3CQCB 2VWAA 3ZMSB 4MLKA 1TR2A 1FIOA 3C4XA 5L0IA 3WAQA 4HE8D 1AEPA 2WS3A 4P1NA 3N9NA 4TNVA 2KXPB 5AQJB 3Q2MA 3TQOA 3CMLA 5JS5A 3PDYA 3BQLA 4Z90A 2BG9A 3AA6B 2M6IA 1T7SA 5LCYA 3ASOC 2JJ9A 3EI0A 3DKAA 2JQKA 5HXEA 3M4BA 4JI4T 5AQMB 4AE4B 3CIRA 4LF6T 1WWPA 2HFIA 4YL0A 1UK5A 4QI2A 4AQFA 5FNVE 1XMOT 2Q9BA 5LOVE 3T8OA
chains in the Genus database with same CATH topology
4Z8XA 3ZMTB 3POVA 3QZCA 5KDMC 2EHOD 4HGAA 1TWGA 2CXFA 1PD0A 4JVSA 3CX8B 5KX5E 4FESA 2XAHB 4RD9A 2K5BB 3W8IA 2IYLD 3CSKA 4U5GA 5AFUL 3PHF2 4A2NB 4X1KE 2J9WA 3HKEE 1FFTC 3JC6C 3P8CD 2RA1A 4AQGA 2DGJA 3MKDA 3MA9A 2CM0A 2SPCA 5D92A 2BZBA 2DHRA 3RIPA 1WRDA 1D0XA 5DLJA 1LVFA 2Y3DA 2R7OA 3EHNA 4KC9A 3T6JA 2CXDA 4AKIA 2XASB 2KMFA 4ISSA 1VRBA 4QX8B 1NWMX 4UF0B 2OCCC 3KV5A 5KMGP 4OYKA 2VKOA 4OYJA 4A56A 4Q5SF 2LM9A 3TD7A 2R7XA 3HKBE 4ZLDA 2R7QA 4JEUB 3H37A 4IWBA 2Q3TA 2CE7A 3B57A 2X9HA 3ZEFB 2L9QA 4X1IE 4O4LE 4E7ZA 2KINB 2WVOA 2A2FX 3KINB 3RYHE 2DYSC 2HPLA 1Z5ZA 5LP6E 2Y3GA 3RYLA 4GEHA 3ETUA 3V7OA 2V7KA 2VKDA 2YHSA 4ZI7E 3K66A 2D5UA 4HEAA 3W2WA 4NY3A 1JPJA 3UGOA 5JR9A 4ULWA 4QHOA 3K3QC 4BAYB 2V7LA 1ZV4X 2CDQA 5L3DB 2KNDA 1V9DA 2WM9A 3CX6B 1YKEB 3ZMZB 2EIMC 4H9SE 3ANWB 3L09A 2PF4E 3V5UA 3V5SA 4UIGA 5JDMA 5DQVA 3ESLA 2BDEA 3CZ6A 1CUNA 3NBXX 3I5QA 1V54C 2ZPAA 2D2SA 2CCQA 2IC9A 2Y48B 1NAFA 5LBMA 2UXNB 3M65A 3CQZA 3ETVA 4IDZA 4QKNA 1SMYF 2CNWD 1IJ6A 3EG9B 2Q9QB 1MIVA 5KYUA 4ZLCA 3T4RA 2W0GA 2XAJB 4X1YE 4LERA 3O39A 1RJ9B 2IW5B 3JRTA 4H63V 3PMRA 2H7VC 2NW9A 5J1GA 3OEOA 2L8KA 2NTXA 3B0PA 3RPUA 3KBUA 3AAEB 4JLEA 1IW7F 3DZAA 2EIKC 5L3BB 5HYAA 2WZGA 5E3AA 4ADZA 3AA7B 2H3RA 5IY5C 2HH7A 2ZXWC 5KYUB 5M4YA 4AK9A 4ERRA 3ZC1A 1Z6AA 3FXDB 3X2QC 5TAOA 5IYZE 4I50E 4K7BA 4GIWA 4H9OC 4KBMB 2CWOA 3ZCIA 1LKXA 4KBLA 2J9VA 4EWCA 3FHNA 1VMAA 2W00A 4TX5A 3H65A 5ADXL 5LGNB 4DVZA 2X9WA 5LGTB 1U5PA 4JJFA 4BJ5C 4BJ6C 3UFEA 5EK4A 3SEOA 3K33A 5JDHA 2Y3BA 3OJAA 4BJNA 5FXZA 3L3PA 3EZHA 4PK6A 4JEHB 3IF8B 2V7JA 5F8PA 3R84B 3HKDE 5JRCA 3N9PA 4U5HA 2W63A 2D5RB 3K8PC 3AQCA 5DVWA 2A68F 4WBOA 1SHZC 2ACXA 3ZYLA 3NYLA 1MMAA 3KKBA 1D1CA 3W15B 4PJLA 4ISTA 5JREA 2PX0A 5L3VA 5LG4A 2EHOA 5JDNA 4PJMA 2XRHA 2LSKA 3Q5XA 2G0UA 1IZMA 1NG1A 2XL4A 3QK6A 1TKNA 3DAFA 3UMIA 1OCOC 2L3LA 4ASKA 3SZRA 4DMWA 5KYXB 3O4XE 3NKDA 3S28A 2QTVA 3W8HA 2Q9QD 4UV8B 3GN5A 2NWBA 3AQBA 2WMNA 5FXXA 2XXAB 2EHOB 3O6XA 2JQQA 2VKHA 4IE5A 1HS7A 1IZNB 5JDGA 5LGUB 4H63H 5JDLA 3AA1B 3AG2C 4C90A 4YJ2E 1YW0A 2ZXOA 2M4EA 4J30B 4QWNB 1WGWA 4PW8A 4DOZA 3HTKC 5FXWA 2A1DD 4O2BE 4IAOA 1D1BA 3MACA 2YEVC 2VK9A 2QGSA 4LLCA 2DI4A 5DJQC 2DWGA 3GANA 1KU2A 4OIRF 3DAGA 3AG3C 1TWCA 4YWQA 4AKRB 3CPZA 1HG2A 5EK2A 2A69F 5HAXA 1QSDA 3ABKC 3B13A 1QZXA 3DXJF 4QX7B 4IRUA 4BJ5A 4BJ6A 4C3EA 2YU2A 4OIOF 2CA5A 4UVBB 5F5FA 1FFHA 2E8IA 3L0IA 3RC8A 2Q9CA 4UEMA 4CI1B 4GYTA 3EDVA 3VAYA 2KWIB 4CS7A 2B0JA 2RP4A 1Z23A 4AE4A 3KMIA 2YINA 5LNKA 2NW7A 1OXZA 3CKDA 3Q7LA 5ETWA 2W4MA 1Z63A 4TN7B 4YLHA 3ZC4A 2CNWA 4UELA 4AX2A 3UTKA 4H9NC 5F3JA 2X9YA 2Q9QC 2KNHA 5E2QA 4F4BA 3OBVE 1MIYA 3LNRA 5FY0A 3N24A 2J7PA 3JT1A 3ZVRA 3WI3A 2V26A 3ITFA 4KNWA 4HEAJ 3FHDA 2H7OA 5FMNA 1M2VB 4FJOA 2YZSA 4CZZB 4P0AA 3NYMA 3UGPA 4FX5A 2Y3HA 1O87A 5E0OA 3W2VA 2W45A 2R7WA 2WL8A 2XUEA 4PK5A 2CWYA 3PU3A 2PBIA 4PFOA 3LS1A 1FMVA 2OA5A 2R7RA 3Q6NA 2I59A 4EZHA 5LHHB 2MOZA 4UF0A 3HJCA 3E70C 3SOLA 3FBLA 4MBQA 1S7ZA 4CIHA 1EZ3A 2CMRA 1HTJF 4C3DA 3MXZA 1KK7A 2O9XA 4FI5A 2Y39A 3EDUA 3VHLA 3MLGA 3HR0A 4C7OB 2X68A 4WNKA 1WLXA 4HFKB 2R7SA 2FFHA 2YEVA 3FXEB 3LLIA 1OCZC 1OKKD 4P0BA 4EYYR 2NP9A 2GK9A 5H6RB 3JYHA 2J1DG 3MX3A 3NDBB 3EVYA 4HFVA 2ZM2A 2D0UA 3S4UA 1SA0E 2MYSA 3E9VA 1MNDA 1M57C 2K9AA 4AKLA 3SRZA 2NOXA 3F2EA 5LHIB 4G0HA 3ANWA 2C5JA 4X20E 3ABLC 4OIQF 4H9PC 3SWHA 3DJUB 2P9BA 2Y6XA 4O8SA 3N2KE 4U5DE 1ZHYA 4OIPF 5C8YE 3DJNB 3WG7C 3OYXA 1WYBA 2Z15A 2XHEB 1D1AA 3UNGC 3AVRA 2W4BA 4EXTA 3EG9A 2Q9QA 3LS0A 4DBRA 1U4QA 4G2AA 2KT9A 2MWQA 3FAJA 4O4IE 4M63A 4QXBB 4EAHA 4PJJA 3RYIE 2EHOC 5KYYB 5LA6E 2VB6A 4I55E 5L3CB 2OG2A 1RJ9A 4OD5A 3ZN1B 1G8XA 2LSYA 4OHFA 2E87A 5LBQB 2QY9A 3SNHA 4L9IA 3DJBA 3RYFE 4OK0A 2G3VA 4DO0A 2LSIA 1B7TA 4JJGA 5CI8A 3ZMUB 4AI6A 3C4ZA 2JPFA 1UX4A 4L5GA 2DYRC 2ZMAA 3NYJA 2V3CC 2V7MA 1ZHXA 3AAIA 3C50A 2W9YA 3PUAA 4EZ4A 4W8KA 2XAFB 4UVCB 3QUJA 1FMWA 1S35A 5LXTE 3HA4A 4TUYE 2CEAA 4EIWA 4YFSA 1NU7D 5H6QB 3EGXB 2N9DA 3SP1A 3Q7GA 1D0ZA 4JURI 3K1HA 4XBFB 4DMVA 2ZXRA 5BMVE 3EH1A 2EIJC 2M67A 2C04A 5B1AC 4QXHB 5J2UE 3RKOA 1BR0A 1ZYRF 4BJTA 4CI3B 4O6NA 3F31A 1OCCC 3RRWA 4IE7A 4QDLA 3NRHA 2X51A 4I4TE 1FTSA 3GODA 3KH2A 4K0DA 3UUMA 1LVKA 4BG0A 4Q4ZF 5HXRA 4HE8A 3I9WA 3KV9A 3N2ZB 2P7VA 4CXXA 2QA7A 5KYXA 3CQGB 3UT5E 4IGUA 4G7HF 1IJ5A 4HKAA 2H7BA 3CX7B 4YJWA 5HXSA 2IC6A 2W61A 3HLZA 2XXAA 1US7B 4U72A 4O6YA 3EPVA 3ZCJA 3K7DA 3EFOB 4U5EE 3AVSA 4O4HE 3EHMA 2X67A 4YT5A 4K0UA 3N9OA 5L3FB 5T1DB 3F57A 3Q9DA 3B0UX 3CQXC 1ZEEA 3ZN0B 4J2CA 2J9UA 4CI2B 3NKEA 4CSAA 4IJJA 3J7Yq 4J32B 1OKKA 1O5HA 4XTKA 5HXHA 3M1CB 3EGDB 1MMDA 1D0YA 2KJGA 3KVAA 4XAXB 3NZQA 1LRZA 1SZIA 3K3OA 2Z6EA 3I4UA 3N0TA 3O9XA 3KDSE 1LS1A 1WYCA 2IXPA 5E33A 3RH3A 4MALA 3C4WA 1VK5A 3ZC0A 3PUGA 2NUPA 2P6VA 5FYMA 2NUTA 2LJLA 3S0XA 2ZXPA 2C03A 3RFYA 2WSSV 1YD8G 3E08A 4U5BE 4GK5E 1OWAA 3ZYMA 4KMCA 3B0VC 2A6EF 3L34A 2C5KT 4GK0E 3PE0A 3Q5WA 4MFRA 3NG1A 3FVYA 4LACB 4CS9C 3C51A 1FEWA 3LK3B 4XZCA 3F47A 4P6IC 3OWTA 1ZKEA 2NUPB 2NUTB 2C0SA 3PU8A 3I5PA 2MTQA 3O1IA 2WBLA 3DD7A 3AB3B 2ES0A 4CXYA 3GA8A 5FCLA 3VKHA 1M2VA 4Q7CA 2LHNA 3EUHA 1HG5A 4O4JE 4I1MA 4NUVA 2XTLA 2J46A 2JMKA 3KFWX 3ZPOA 2VL8A 3ECSA 3S27A 4GYRA 3LG7A 4BEJA 2E9XB 3GWHA 3EH2A 5JDFA 4AKHA 3LEVA 4EYUA 3E22E 1NZEA 3I1AA 3R6NA 5B3SC 3RC3A 3FDQA 2WB7A 4O6MA 4ZI3D 2DLRA 3QMKA 1SF8A 2WMOA 3AAAB 3K6BA 4DVYP 4HN9A 4C7OA 4IHJE 2R7UA 1H7CA 4TV9E 1ZHCA 3UUNA 4UVAB 3MJXA 1YKHB 1PCXA 2WVNA 4N06A 5FY1A 3SYNA 2ZLYA 1QLEC 4V1Av 5DS5A 4AKGA 2V1DB 3U78A 4TZ4C 3UMHA 5F5HA 3UR3C 4H9RC 2DNXA 4U5CE 1VYIA 2CW0F 5DABA 4C3BA 2YK0A 2LOPA 2IXNA 3S29A 2K24A 4BA9A 4BJMA 5HWYA 2PP4A 5E3CA 4RBNA 3O1HA 1ZHWA 2R7TA 2X9XA 2BVMA 4I3MA 1M2OA 5DS6A 2WAUA 4M1PA 2LEHA 1UCUA 5KYWA 3AG4C 2UXXB 3CWZB 3KL4A 3KV6A 3ZSUA 1N1CA 5BUOA 5CA0E 5HWXA 4PAGA 2ZM8A 3ONXA 2G62A 3DMDA 3MK7C 2LSJA 5DS4A 4KNVA 2W62A 1BR2A 4CS9A 5IHYA 2JRKA 1J8YF 2L81A 2CXLA 4ANJA 4PK4A 4WJ0A 3UMKA 5CB4E 3EZIA 1BR4A 3I0OA 5KYWB 2X66A 5EZYE 5CA1E 2VASA 1HFAA 5KYYA 2YU1A 1HCIA 3IEEA 3BK9A 2WVQA 3N9MA 4IE0A 4ZI3C 2PX3A 1MNEA 4ZHQE 1W2WA 2E9XD 2DWKA 2FGYA 3IBPA 4RDAA 4MHCA 3OA1A 4EB6E 4H4KC 3LESA 4TV8E 1ZHZA 1WR6A 1IAPA 1Y64B 4UV9B 2Y8DA 2ODVA 4KI2A 3VYWA 4ZS3A 3I0QA 3ZJ1A 4OINF 3PTRB 3KV4A 4DVDA 2KQ9A 3WODF 4O79A 2PFVA 4ZI2D 5L3EB 5LHGB 5L3GB 5CI9A 3FBZA 3ZMVB 3N5LA 4DNDA 2KW3C 3LJBA 3LBXA 1TWHA 2CLYB 2I8BA 4CBEA 4H9QC 2MBGA 5T3WA 1AJ3A 5JH7E 5JR9B 3RKOF 4YN0B 3EGXA 2NW8A 2PFDA 4CSAC 4G63A 1VYKA 4CS8C 1S94A 1ZHTA 4YJ3E 4C91A 3EJNA 3LK42 2DCFA 2A72A 2GFHA 3D0TA 2PJQA 3IHRA 5GONE 4CXWA 1PD1A 3H3AA 3F46A 3LBXB 2J7PD 3OYZA 3HI2A 4EOZB 4LLEA 5EHHA 4E7SA 1ST6A 3BQIA 2EILC 2NG1A 3PUQA 4U5FE 3P7IA 1HX8A 3WAKA 1ZU4A 3J9X1 2BVLA 5HSWA 3NZPA 3AG1C 4WBNE 2XQYA 1M56C 4DBQA 4UXNB 4N78D 4OFZA 4JW1A 4L0RA 4XWJA 1E1HB 4G7ZF 2IAKA 2IXMA 5EGYA 4XLPF 4B6XA 2L9JA 5FY7A 4FWVA 2LHRA 4HFFB 2XAQB 5J2TE 2E9XC 2C5IT 2BE5F 3ZLIA 3B9QA 3LFMA 4IE6A 3RX6A 2XAGB 2EINC 4GOUA 3X1OA 3EFOA 3AA0B 3ZJ2A 2G3KA 2D0TA 3K3NA 3LAYA 2PG8A 4U74A 2KWHA 5T3TA 3HKCE 4P09A 2N2NA 2LSGA 4EBBA 3CVRA 4ZI2C 1HF8A 5LJMA 1QUUA 1V55C 2A3DA 4ILUA 1NU9C 4NUUA 4QI0A 1TWAA 3PURA 5LJNA 4I44A 5FXVA 1UX5A 3N2OA 2R7VA 3N9QA 2IOQA 2KGOA 5HXCA 3EGDA 4QXCB 5FP3A 4BJ1A 2B1EA 3NRXA 3GMIA 4PJNA 2XSEA 3DM5A 4JUYA 2HV6A 2KZ7B 3DTOA 3JSZA 1MIWA 3A5XA 5DQWA 4IIJE 3PUSA 3T6BA 4X0RA 2J0WA 3QC9A 3RRCA 2ZM0A 5D91A 1JPNA 4O7GA 4CS8A 5JRCB 1T98A 1MMGA 2IXOA 3NRYA 4F6RC 1KNZA 4IE4A 4JCHA 4AQFC 2N1GA 1G73A 1O3XA 5JQGE 2CGEA 2LE8A 3LLKA 4PNIA 4YT2A 3ABMC 4ZS2A 3ZYKA 4WW0A 2LSEA 1BR1A 3LK2B 1J8MF 3HL6A 5L2LA 3OKQA 3C98B 3O1JA 5B1BC 4YT4A 4KP3C 2WWUA 4I43B 2ODUA 3E0ZA 3JCUQ 4YT8A 2WZLA 4MQ9F 3KVBA 3ZG1A 4ZOLE 4YHJA 5KYNA 4JZAA 4CQIA 3N2GE 3U3IA 3GN5B 4AXPA 5DQZA 2WZFA 3Q6MA 3DM9B 2X0LB 3JC6D 4OD4A 3BQKA 2Q9AA 2J0XA 2NTYA 4HTEA 3TKLB 2LT3A 3DP7A 2E9XA 4O2AE 2JD3A 3FB2A 1VOMA 2VH3A 5A1LA 2K48A 3LJCA 2KLQA 3SS1A 3VU7H 1Z3IX 3UUXB 2HPJA 3ZIBA 1MMNA 4B6IA 3C64A 3K1IC 3KBTA 4KUMB 3MZKB 3WAJA 5L3QA 3VKGA 5DQTA 3EQLF 2VKJA 2HV7A 4G7OF 2A6HF 2JMHA 2V7IA 1ZU5A 4I1OB 5JDQA 2Y69C 5JVDE 2LOSA 2CLYC 1X79A 3I9YA 3N9LA 5LYJE 3RYCE 1OCRC 4GYSA 5JR9C 5EK3A 3UULA 4MNDA 3ASNC 4XLNF 1Z0PA 4PFPA 2J45A 3CQCB 2VWAA 3ZMSB 4MLKA 1TR2A 1FIOA 3C4XA 4HE8D 3N9NA 2KXPB 3Q2MA 3CMLA 3PDYA 3BQLA 3AA6B 5LCYA 3ASOC 2JJ9A 5HXEA 4AE4B 4QI2A 4AQFA 5FNVE 2Q9BA 5LOVE 3T8OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RH3 A;  3IEE A;  4YJW A; 
#chains in the Genus database with same CATH topology
 4Z8X A;  3U5S A;  2MHR A;  1A7D A;  3ZMT B;  3POV A;  2CCY A;  3QZC A;  3TLU A;  1OXK A;  5KDM C;  2CHO A;  2EHO D;  4HGA A;  2CXF A;  1TWG A;  1PD0 A;  5COF A;  3NMJ A;  4JVS A;  3CX8 B;  2H88 A;  5KX5 E;  1Y4C A;  4FES A;  2XAH B;  4EBK A;  1KNR A;  4RD9 A;  2K5B B;  2J62 A;  3W8I A;  2IYL D;  3CSK A;  4U5G A;  5AFU L;  3BRJ A;  3PHF 2;  4A2N B;  4X1K E;  2WDR A;  2J9W A;  3HKE E;  1FFT C;  3JC6 C;  1ORS C;  2GWW A;  3P8C D;  2RA1 A;  2QE9 A;  2BG9 B;  4AQG A;  1T6I A;  2DGJ A;  3MKD A;  4HWC A;  1FNT c;  2CPT A;  3MA9 A;  2CM0 A;  2SPC A;  5D92 A;  2BZB A;  2DHR A;  3RIP A;  4LML A;  1WRD A;  1D0X A;  2OOC A;  5JVE A;  3WHN A;  5DLJ A;  1LVF A;  4GKK T;  2Y3D A;  2R7O A;  3EHN A;  3V5Z A;  4YSX A;  4KC9 A;  3T6J A;  3UUB A;  2CXD A;  1T9K A;  1YQ4 A;  4AKI A;  2XAS B;  2LRL A;  2HMZ A;  2KMF A;  4ISS A;  1VRB A;  2YOE A;  1L0V A;  1YVI A;  4R32 A;  4MVR A;  4QX8 B;  4ZXL A;  4DV4 T;  1LI5 A;  1NWM X;  3QB5 K;  4UF0 B;  3NMK A;  2OCC C;  3KV5 A;  5KMG P;  3QVY A;  4JTA B;  3C7J A;  4OYK A;  1OED E;  2VKO A;  1C02 A;  4IT4 A;  4OYJ A;  4A56 A;  1ORY A;  4LDQ A;  5L0H A;  1EA8 A;  4Q5S F;  2LM9 A;  3TD7 A;  2R7X A;  2CBJ A;  2UU9 T;  2BS4 A;  3HKB E;  4ZLD A;  4IDN A;  2OV9 A;  4JEU B;  3H37 A;  3B5M A;  2VCA A;  2R7Q A;  4IWB A;  2Q3T A;  2CE7 A;  2XM0 A;  5HCJ A;  3B57 A;  3ZQY A;  2X9H A;  1A0B A;  3ZEF B;  2L9Q A;  4JE9 A;  3K1I A;  4X1I E;  4O4L E;  2IDO B;  4E7Z A;  4EGW A;  2KIN B;  2WVO A;  1O3U A;  2A2F X;  3KIN B;  2WU2 A;  3UU3 A;  3RYH E;  4YL3 A;  2DYS C;  2HPL A;  1Z5Z A;  4DXW A;  5LP6 E;  1WAS A;  2Y3G A;  2FJD A;  2E5L T;  4CN6 A;  3RYL A;  4HFD A;  4GEH A;  2NR4 A;  3ETU A;  5HEJ A;  3V7O A;  2V7K A;  2VKD A;  1XWJ A;  1OXB A;  2BBH A;  2YHS A;  3GM2 A;  4IL9 A;  2XLW A;  4ZI7 E;  3K66 A;  2KK1 A;  5FL0 A;  3TK0 A;  3U3B A;  5CIV A;  2D5U A;  4HEA A;  1GGQ A;  3W2W A;  4NY3 A;  4WGZ A;  1JPJ A;  2OEX A;  3UGO A;  4MVQ A;  5JR9 A;  4ULW A;  4QHO A;  2XQ5 A;  3K3Q C;  5HEU A;  2V7L A;  4BAY B;  2YWA A;  1ZV4 X;  1VCS A;  2ASR A;  2CDQ A;  5L3D B;  2KND A;  1V9D A;  2BKO A;  2WM9 A;  3CX6 B;  1FR0 A;  1YKE B;  3ZMZ B;  5ABF B;  4IDP A;  3J06 A;  4WZX A;  4ER9 A;  4XEK A;  2EIM C;  4H9S E;  3ANW B;  3O10 A;  3L09 A;  3L8J A;  1VCT A;  2PF4 E;  3V5U A;  3PJA J;  3V5S A;  4UIG A;  1HX1 B;  1NLX A;  5JDM A;  5BR8 T;  2UXC T;  1HY5 A;  5DQV A;  3ESL A;  3LEO A;  2BDE A;  2E2A A;  1VTM P;  4A97 A;  3CZ6 A;  1JNR A;  1CUN A;  3NBX X;  5LB7 B;  1V54 C;  1WTY A;  3I5Q A;  1HNZ T;  2ZPA A;  2D2S A;  4N6H A;  2CCQ A;  2QVA A;  3TOL A;  4YL1 A;  2IC9 A;  2Y48 B;  1LE4 A;  1NAF A;  2Q4F A;  5LBM A;  2UXN B;  3M65 A;  3CQZ A;  2BS2 A;  4U7Y A;  3ETV A;  4IDZ A;  4QKN A;  1SMY F;  2CNW D;  1IJ6 A;  3EG9 B;  1DOV A;  2Q9Q B;  1MIV A;  5KYU A;  4ZLC A;  3RHW A;  3S84 A;  3T4R A;  2W0G A;  1I4Z A;  5L0C A;  2XAJ B;  3RVY A;  2R02 A;  3UU4 A;  4X1Y E;  1HMD A;  4AL0 A;  3P50 A;  4LER A;  3O39 A;  3GM1 A;  2V8S V;  1RJ9 B;  2IW5 B;  3JRT A;  3G4X A;  4IAQ A;  4H63 V;  3RF3 A;  2VC9 A;  3PMR A;  2H7V C;  3RLF F;  2NW9 A;  5J1G A;  3OEO A;  3PUX F;  1E84 A;  3LDQ B;  1T72 A;  2UXB T;  2L8K A;  2NTX A;  3B0P A;  3O55 A;  3RPU A;  3KBU A;  3AAE B;  4JLE A;  4CN4 A;  1IW7 F;  2P0N A;  2XSB A;  3DZA A;  4JI3 T;  2EIK C;  1ZVZ A;  5L3B B;  2BL2 A;  2WP9 A;  2WZH A;  5HYA A;  2WZG A;  5E3A A;  4ADZ A;  3AA7 B;  2H3R A;  5IY5 C;  2HH7 A;  4HWI B;  2W66 A;  2ZXW C;  3SFD A;  5KYU B;  5M4Y A;  4AK9 A;  2L7A A;  4ERR A;  2YLD A;  2W4X A;  3ZC1 A;  1Z6A A;  1BBH A;  1OW6 A;  3FXD B;  3GEH A;  3X2Q C;  5TAO A;  5IYZ E;  3FMS A;  2QUP A;  5AQV B;  2R9R B;  2XQ6 A;  4I50 E;  4K7B A;  4GIW A;  3RIF A;  4H9O C;  4KBM B;  3GM3 A;  2CWO A;  3ZCI A;  1LKX A;  4KBL A;  2XS8 A;  2J9V A;  4EWC A;  2OJQ A;  3FHN A;  1VMA A;  4ZZC A;  2W00 A;  4TX5 A;  3H65 A;  5ADX L;  5LGN B;  4DVZ A;  2X9W A;  5LGT B;  3KYI A;  3M4C A;  1U5P A;  5AQK B;  4JJF A;  4BJ5 C;  4BJ6 C;  3UFE A;  5EK4 A;  3SEO A;  4JEB A;  3H2U A;  3K33 A;  5JDH A;  3PUW F;  3OJA A;  4BJN A;  2Y3B A;  2AE9 A;  2IM8 A;  5FXZ A;  4CJG A;  1CHU A;  3L3P A;  3EZH A;  4PK6 A;  3RQF A;  4DR7 T;  4JEH B;  3IF8 B;  2V7J A;  5F8P A;  3QVZ A;  3AEC A;  4JI1 T;  3R84 B;  3HKD E;  3GWN A;  4HFI A;  2WWV A;  3JAD A;  4X66 T;  3AJM A;  5JRC A;  2VCB A;  3N9P A;  3PUZ F;  4U5H A;  3RQW A;  1OW7 A;  3AE1 A;  4KHZ F;  2W63 A;  2D5R B;  3K8P C;  3AQC A;  5DVW A;  3U0C A;  2A68 F;  4WBO A;  3OTO T;  1SHZ C;  2ACX A;  2EPK X;  3ZYL A;  2OQM A;  3NYL A;  1MMA A;  3KKB A;  5A6J A;  1D1C A;  3W15 B;  4PJL A;  4NXM T;  4IST A;  5JRE A;  2PX0 A;  3SXZ A;  5LG4 A;  5L3V A;  2EHO A;  5JDN A;  2BKP A;  4AL1 A;  3ABV A;  4PJM A;  2XRH A;  2LSK A;  3Q5X A;  1LI7 A;  2G0U A;  1IZM A;  3G4Z A;  1NG1 A;  2JPU A;  4EEB A;  2XL4 A;  3QK6 A;  3SXK A;  1JOG A;  1TKN A;  3DAF A;  3UMI A;  1OCO C;  1WFD A;  2L3L A;  3AE4 A;  4ASK A;  3C8G D;  2FJA A;  3SZR A;  4DMW A;  4COF A;  1JAF A;  5AC5 A;  2VQE T;  4CJO A;  5KYX B;  4JI2 T;  3O4X E;  2BG9 C;  3NKD A;  3S28 A;  2QTV A;  5AQG B;  5FVL A;  3W8H A;  4JI7 T;  4HWH A;  2Q9Q D;  3M79 A;  4E0I A;  4KHP T;  4UV8 B;  5L0J A;  3GN5 A;  3P4W A;  3GOR A;  2NWB A;  3AQB A;  3M15 A;  2WMN A;  2OJE D;  5FXX A;  2XXA B;  2NPU A;  2EHO B;  3O6X A;  2JQQ A;  2PBE A;  3HKK A;  2VKH A;  4IE5 A;  1HS7 A;  3KPH A;  1IZN B;  5JDG A;  3V5X A;  3TOM A;  1E86 A;  2VL0 A;  5LGU B;  4H63 H;  3HNK A;  4EIY A;  5JDL A;  3AA1 B;  1I5N A;  3AG2 C;  1E85 A;  4C90 A;  2ACZ A;  3VRA A;  4YJ2 E;  2YVK A;  2IUB A;  1YW0 A;  3FOO A;  1CGM E;  3TLV A;  1HNX T;  2ZXO A;  1KFY A;  1XMQ T;  2M4E A;  4J30 B;  4NIQ A;  4QWN B;  1WGW A;  4PW8 A;  4DOZ A;  5JP7 A;  3FAP B;  3HTK C;  3S9O A;  5FXW A;  256B A;  2A1D D;  4O2B E;  3RI5 A;  4IAO A;  4A5X A;  1D1B A;  5AQT B;  4DJ9 A;  3MAC A;  2UUA T;  2YEV C;  4JI6 T;  2VK9 A;  2QGS A;  4LLC A;  2DI4 A;  5DJQ C;  1V4A A;  4JI5 T;  2GDC A;  2DWG A;  3GAN A;  1KU2 A;  4OIR F;  3DAG A;  1NEN A;  3T9O A;  3AG3 C;  1TWC A;  4YWQ A;  4AKR B;  3CPZ A;  1HG2 A;  5EK2 A;  2A69 F;  5HAX A;  2I0M A;  1QSD A;  3ABK C;  3B13 A;  1QZX A;  1EI7 A;  3TJ6 A;  4IAR A;  3DXJ F;  1Z8U A;  4QX7 B;  2JIW A;  2XL8 A;  4IRU A;  4BJ5 A;  2I6H A;  2XQ8 A;  4BJ6 A;  1J5E T;  4MVZ A;  4C3E A;  2YU2 A;  4JTD B;  2WDV A;  4DV6 T;  4J7T A;  4OIO F;  4JI0 T;  2CA5 A;  1YAU O;  1YA7 O;  4UVB B;  5F5F A;  3AEF A;  5A6A A;  2YDR A;  1FFH A;  2E8I A;  4D4X A;  1YAR O;  3L0I A;  3RC8 A;  2Q9C A;  1Q0K A;  2ZM6 T;  2LK4 A;  4UEM A;  4CI1 B;  4LF5 T;  4GYT A;  3EDV A;  1QSP A;  3VAY A;  2KWI B;  2XL6 A;  1SUM B;  4CS7 A;  2B0J A;  2RP4 A;  1Z23 A;  4AE4 A;  2B76 A;  3IA3 A;  1CGO A;  3KMI A;  5AQF B;  3AEA A;  2YIN A;  1OR3 A;  5LNK A;  2NW7 A;  1OXZ A;  3CKD A;  3Q7L A;  3RQE A;  5ETW A;  3ZKR A;  1T01 A;  2W4M A;  1A7E A;  1Z63 A;  4TN7 B;  4YLH A;  3ZC4 A;  2CNW A;  4UEL A;  4AX2 A;  3UTK A;  4H9N C;  4DV2 T;  2JX0 A;  1LS4 A;  5F3J A;  2X9Y A;  2Q9Q C;  2KNH A;  4DV5 T;  5E2Q A;  5K0I A;  1YQ3 A;  2QLA A;  4Z9I A;  1EKY A;  4F4B A;  3OBV E;  1MIY A;  3LNR A;  5FY0 A;  3N24 A;  2J7P A;  5FL1 A;  3JT1 A;  3ZVR A;  3WI3 A;  2V26 A;  4YY3 T;  3ITF A;  4KNW A;  4X64 T;  4HEA J;  1AUE A;  3FHD A;  1UUS A;  2H7O A;  4IRE A;  5FMN A;  1M2V B;  1E2X A;  3P4Q A;  4FJO A;  1TFK B;  2YZS A;  2ICW G;  4CZZ B;  4P0A A;  3NYM A;  5JUA A;  3FOP A;  3UGP A;  4FX5 A;  2Y3H A;  1O87 A;  3TJ5 A;  3US6 A;  5E0O A;  2BKN A;  3W2V A;  3AE3 A;  2W45 A;  3ZWI A;  3R7C A;  2R7W A;  2WL8 A;  2XUE A;  4PK5 A;  2CWY A;  3AE8 A;  3PU3 A;  1KNY A;  2OLT A;  4WGY A;  2D9D A;  2PBI A;  3MYI A;  4PFO A;  3LS1 A;  3DE9 A;  1FMV A;  3QW0 A;  2OA5 A;  2R7R A;  3V5Y A;  3Q6N A;  2I59 A;  1A7V A;  4EZH A;  5LHH B;  2MOZ A;  3MFN A;  1U0B B;  4UF0 A;  3HJC A;  3E70 C;  3SOL A;  3K1S A;  3FBL A;  4MBQ A;  3IQT A;  2XQA A;  1S7Z A;  2FJB A;  4CIH A;  1EZ3 A;  2CMR A;  3LUT B;  1HTJ F;  2V5C A;  3MXZ A;  4C3D A;  1KK7 A;  1K04 A;  2O9X A;  4FI5 A;  2Y39 A;  5ABH A;  1T8B A;  3EDU A;  3VHL A;  3L1M A;  3MLG A;  3FZH B;  3HR0 A;  4C7O B;  2X68 A;  4WNK A;  1WLX A;  3SXY A;  1T6Q A;  2XS1 A;  4IB4 A;  4HFK B;  1QPU A;  3AED A;  4XQ1 A;  2LKH A;  2FFH A;  2YEV A;  3FXE B;  2R7S A;  3LLI A;  3IHU A;  1OCZ C;  3AXJ B;  1XNQ T;  1NSG B;  2X0Y A;  1OKK D;  5A69 A;  4P0B A;  4EYY R;  4DUZ T;  4U2Y A;  1U89 A;  2F22 A;  2WU5 A;  2NP9 A;  4CN1 A;  2VQF T;  2HHH T;  2GK9 A;  5H6R B;  4B3T T;  3JYH A;  4EHP A;  2J1D G;  4I0U A;  3MX3 A;  4MVM A;  3NDB B;  1YLM A;  3EVY A;  4HFV A;  2ZM2 A;  2D0U A;  1R8I A;  3S4U A;  1SA0 E;  2MYS A;  5IUX A;  4XPY A;  4DR5 T;  1M7K A;  2CRB A;  3E9V A;  1J1J A;  1MND A;  1M57 C;  5ABF A;  1AVO B;  2K9A A;  1JR8 A;  4AKL A;  1YJG A;  3SRZ A;  3TUL A;  2NOX A;  1XZQ A;  3F2E A;  5LHI B;  4G0H A;  3ANW A;  2C5J A;  4X20 E;  3ABL C;  3TLS A;  3P4R A;  4H9P C;  1V74 B;  4OIQ F;  3P4S A;  3SWH A;  3JRM O;  3DJU B;  2P9B A;  2Y6X A;  4O8S A;  2A9U A;  3N2K E;  3EAB A;  4U5D E;  2XZE A;  1ZHY A;  4OIP F;  4LFC T;  2WZI A;  3RKG A;  5C8Y E;  3DJN B;  3WG7 C;  3C8G A;  3OYX A;  4DUY T;  1WYB A;  1E7P A;  2Z15 A;  2XHE B;  4MTO A;  1HW2 A;  1GQE A;  1C03 A;  4JTC B;  1D1A A;  2X0C A;  3UNG C;  2R03 A;  3AVR A;  2W4B A;  4EXT A;  2XM4 A;  3EG9 A;  4DR2 T;  2Q9Q A;  3LS0 A;  4YK5 A;  4DBR A;  1U4Q A;  4G2A A;  2KT9 A;  4B3R T;  5CGM A;  2XLH A;  3UU6 A;  2YRF A;  2MWQ A;  2AWC A;  2X0H A;  5CJ5 A;  4O4I E;  3FAJ A;  4M63 A;  4DV7 T;  4QXB B;  4EAH A;  4PJJ A;  3RYI E;  2EHO C;  4X65 T;  5JSL A;  3T6G B;  2A0U A;  2XLV A;  3A11 A;  1CPQ A;  2LIG A;  5KYY B;  5LA6 E;  2VB6 A;  4I55 E;  4IDO A;  5L3C B;  2OG2 A;  1RJ9 A;  2P1A A;  1EQ1 A;  2XLO A;  4OD5 A;  3UFG A;  3ZN1 B;  1G8X A;  2LSY A;  4YHH T;  4OHF A;  1E83 A;  3C8G B;  2E87 A;  1H9G A;  3RGL A;  5LBQ B;  2QY9 A;  3AGU A;  1YZA A;  3SNH A;  1YZC A;  4L9I A;  3DJB A;  3RYF E;  5LMU T;  2LFF A;  4OK0 A;  2VVN A;  4DO0 A;  2G3V A;  3RIU A;  2LSI A;  4KX6 A;  2B0H A;  5LG3 A;  1B7T A;  2V5D A;  1UUR A;  4JJG A;  5CI8 A;  3ZMU B;  2HN1 A;  1R4T A;  2KSF A;  3BEH A;  4AI6 A;  4K1O A;  3C4Z A;  2JPF A;  1W0B A;  1UX4 A;  4L5G A;  2DYR C;  2YL3 A;  2ZMA A;  1IBL T;  3NYJ A;  1RKC A;  2LM2 A;  1GM5 A;  2XQ3 A;  1ZZP A;  2V7M A;  4LDR A;  2V3C C;  1ZHX A;  3AAI A;  3C50 A;  3PCV A;  3PV0 F;  2W9Y A;  3G06 A;  3PUA A;  4EZ4 A;  2BBJ A;  2WY2 A;  4W8K A;  3U9J A;  2XAF B;  4UVC B;  3QUJ A;  3AEE A;  1N33 T;  4CIP A;  1FMW A;  1S35 A;  5LXT E;  3CAX A;  3HA4 A;  4TUY E;  2CEA A;  2J9B A;  4HFB A;  4EIW A;  4YFS A;  1LM3 B;  2UUC T;  1NU7 D;  2OU6 A;  5KXJ A;  5H6Q B;  1WR0 A;  3EGX B;  2N9D A;  1N36 T;  3SP1 A;  3Q7G A;  1D0Z A;  1ZW2 A;  3VM6 A;  4JUR I;  5IWA T;  3K1H A;  4XBF B;  2IBF A;  1BDJ B;  4DMV A;  2XY8 B;  2ZXR A;  3FZL B;  4JC7 A;  5BMV E;  3EH1 A;  1HE9 A;  1FJG T;  1LE2 A;  4AIU A;  2EIJ C;  2M67 A;  2C04 A;  5B1A C;  4QXH B;  5J2U E;  3DI5 A;  3RKO A;  4TNW A;  3JZ0 A;  4ONS A;  1XDO A;  1BR0 A;  1ZYR F;  1OQC A;  3A7M A;  4BJT A;  4CI3 B;  1WAT A;  4O6N A;  4MW3 A;  3F31 A;  3RQU A;  3W4Y A;  1OCC C;  3RRW A;  1I6Z A;  1M62 A;  5AQL B;  4JKV A;  3ZT6 A;  1I94 T;  4IE7 A;  1APC A;  1T5O A;  5CFB A;  1KTM A;  4QDL A;  2LD6 A;  3NRH A;  4MVO A;  4E17 A;  2X51 A;  4I4T E;  1FTS A;  1ORJ A;  3GOD A;  3KH2 A;  4NQF A;  4K0D A;  3UUM A;  1LVK A;  4BG0 A;  4Q4Z F;  4D4N A;  5HXR A;  4HE8 A;  3I9W A;  3KV9 A;  2CHN A;  1UG7 A;  2IIU A;  4LFB T;  1OED A;  3N2Z B;  2P7V A;  4CXX A;  2QA7 A;  1JRA A;  2NSF A;  3C8Z A;  1YYJ A;  3HNJ A;  5KYX A;  4P9T A;  3CQG B;  1W09 A;  3UT5 E;  4IGU A;  2XM2 A;  4G7H F;  1IJ5 A;  2XSA A;  4HKA A;  3PDM P;  1DU2 A;  2LP4 A;  4LF9 T;  2BG9 E;  2H7B A;  3S90 A;  3CX7 B;  4YJW A;  3OPC A;  5HXS A;  2YKZ A;  3G50 A;  4XPW A;  4G78 A;  2MAW A;  3LSV A;  2IC6 A;  1WCR A;  4L6R A;  2W61 A;  3HLZ A;  3U2L A;  2XXA A;  1US7 B;  4U72 A;  4O6Y A;  3EPV A;  3ZCJ A;  3K7D A;  3EFO B;  2GA0 A;  2HN2 A;  4U5E E;  4AQY T;  3AVS A;  1KF6 A;  4O4H E;  3EHM A;  5JLI A;  2X67 A;  4YT5 A;  4K0U A;  1OED B;  2HS5 A;  3N9O A;  5L3F B;  5T1D B;  3M3Z B;  2HSB A;  3F57 A;  3ZT7 A;  2R25 A;  3U8P A;  4YSY A;  1Y6D A;  3Q9D A;  3B0U X;  3CQX C;  4MS2 A;  1ZEE A;  3ZN0 B;  3ZTZ A;  4J2C A;  2J9U A;  4CI2 B;  3NKE A;  3TLT A;  2CBI A;  4CSA A;  2NSG A;  4IJJ A;  1WOL A;  3J7Y q;  1A41 A;  5AQS B;  5L4E A;  4J32 B;  3R2P A;  1OKK A;  1O5H A;  2YL1 A;  4XTK A;  5HXH A;  3M1C B;  4MTG A;  4TWF A;  3EGD B;  1MMD A;  4EBJ A;  5ABG A;  1D0Y A;  1H7I A;  2KJG A;  2YDQ A;  4BPM A;  3KVA A;  3QOF A;  4XAX B;  4N6C A;  3DE8 A;  4Z9J A;  2W2U A;  4YT0 A;  3NZQ A;  1LRZ A;  2EPO A;  2YLG A;  1SZI A;  2KC3 A;  4H54 A;  3K3O A;  4XPX A;  1IBM T;  2Z6E A;  3I4U A;  3MYF A;  3N0T A;  2BC5 A;  4KI0 F;  3O9X A;  3KDS E;  4NXN T;  2XLM A;  1LS1 A;  1WYC A;  2IXP A;  5E33 A;  3VR8 A;  3RH3 A;  4MAL A;  3VF0 A;  3C4W A;  1VK5 A;  1SE7 A;  5L4H A;  4EUK B;  3ZC0 A;  3PUG A;  2NUP A;  1W9R A;  4QH5 A;  1ZP0 A;  4NPP A;  2P6V A;  2YLI A;  5FYM A;  2NUT A;  2LJL A;  3S0X A;  1JNZ A;  2ZXP A;  2D4U A;  2YQY A;  3AE2 A;  2C03 A;  3RFY A;  4F8H A;  2WSS V;  1YD8 G;  3E08 A;  2YL0 A;  4GK5 E;  4U5B E;  1OWA A;  3ZYM A;  4KMC A;  3B0V C;  5J0Z A;  2A6E F;  3L34 A;  2C5K T;  4GK0 E;  2YL7 A;  1K40 A;  2L6G A;  3PE0 A;  3Q5W A;  4MFR A;  3OVU A;  3NG1 A;  4HWD A;  3FVY A;  4MW8 A;  4LAC B;  2K3W A;  3H3M A;  2R05 A;  2F4V T;  4CS9 C;  4X5T A;  3C51 A;  2EPN A;  4NC3 A;  1FEW A;  3LK3 B;  4XZC A;  3F47 A;  1RXQ A;  3OWT A;  1ZKE A;  4P6I C;  2NUP B;  2NUT B;  2C0S A;  3PU8 A;  3I5P A;  2MTQ A;  2HZ8 A;  3O1I A;  4NCQ A;  4CDV A;  5AQQ B;  2WBL A;  3DD7 A;  3AB3 B;  2ES0 A;  1QVX A;  2XQ7 A;  4CXY A;  3GA8 A;  5FCL A;  2RD9 A;  3VKH A;  1M2V A;  4Q7C A;  2LHN A;  3EUH A;  1NEK A;  1HG5 A;  1VLS A;  2YN6 A;  4O4J E;  4I1M A;  4NUV A;  2XTL A;  1HNW T;  2JMK A;  4AIS A;  2J46 A;  3KFW X;  4W8P A;  4YTM A;  3ZPO A;  2VL8 A;  3DWW A;  3ECS A;  3ZT5 A;  2XLE A;  4GYR A;  4NTF A;  3S27 A;  3LG7 A;  1RKE B;  3RW0 A;  4U9E A;  4BEJ A;  2E9X B;  3GWH A;  3EH2 A;  4CDA A;  5JDF A;  4AKH A;  3LEV A;  4EYU A;  3E22 E;  4MVU A;  3AE6 A;  3I1A A;  3R6N A;  1GQA A;  1NZE A;  5B3S C;  5GPG B;  5AQH B;  2UUB T;  5HCM A;  3RC3 A;  3FDQ A;  3IPM O;  2WB7 A;  3GEI A;  4O6M A;  2HUJ A;  4ZI3 D;  2DLR A;  4ILA A;  2I15 A;  3EHZ A;  1T6U A;  3QMK A;  4LMK A;  5F28 E;  2AXD S;  1E2A A;  2FUP A;  2WDQ A;  1SF8 A;  2WMO A;  5B3I A;  2OEV A;  3AAA B;  4NTA A;  3K6B A;  4DVY P;  5L0F A;  5BQG A;  4HFH A;  4HN9 A;  4C7O A;  2HJM A;  4IHJ E;  2R7U A;  2EPM X;  1H7C A;  4TV9 E;  1ZHC A;  3UUN A;  4UVA B;  3MJX A;  5AQO B;  4N4W A;  1YKH B;  1PCX A;  2WVN A;  4N06 A;  1NBB A;  1YA9 A;  3AXJ A;  3RIU C;  1Q0F A;  3C63 A;  5FY1 A;  4ILB A;  3SYN A;  1UGO A;  2ZLY A;  1QLE C;  4V1A v;  5DS5 A;  4AKG A;  2V1D B;  3ZDL A;  4JV5 T;  3IQC A;  3U78 A;  1IBK T;  4MVS A;  1KNP A;  4TZ4 C;  3UMH A;  5AC4 A;  5F5H A;  3UR3 C;  1UFB A;  2WB5 A;  4H9R C;  2DNX A;  4U5C E;  1VYI A;  2CW0 F;  1RMV A;  4TWH A;  1Q0M A;  2AU5 A;  5DAB A;  4C3B A;  5JTG A;  4U9D A;  2YK0 A;  2LOP A;  4A98 A;  4XEV A;  2IXN A;  3IQ5 A;  3S29 A;  2K24 A;  4BA9 A;  4BJM A;  1H9T A;  4BEM J;  4QH1 A;  5HWY A;  1GS9 A;  2PP4 A;  5E3C A;  2YDS A;  3JTL O;  4RBN A;  3O1H A;  1ZHW A;  5HEO A;  2R7T A;  2X9X A;  4WYV A;  2BVM A;  1G4W R;  1LPE A;  1M2O A;  4I3M A;  5DS6 A;  5BQH A;  2WAU A;  2AVK A;  4M1P A;  3PUV F;  2LEH A;  3FZK B;  1M6T A;  1UCU A;  3NVO A;  5KYW A;  3AG4 C;  2UXX B;  3CWZ B;  1HE1 A;  3KV6 A;  3KL4 A;  3ZSU A;  2TMV P;  1N1C A;  5BUO A;  5CA0 E;  3JAF A;  5HWX A;  4PAG A;  2ZM8 A;  3ONX A;  2MPK A;  3KYJ A;  2G62 A;  5TJ5 E;  3UU5 A;  3QNU A;  3DMD A;  3QTH A;  1Y01 A;  3MK7 C;  2RSE B;  2LSJ A;  5DS4 A;  4KNV A;  5AQU B;  2GAQ A;  2LKG A;  2W62 A;  1BR2 A;  1YYX A;  5FKY A;  4CS9 A;  5IHY A;  3ONL C;  3A9C A;  2JRK A;  1J8Y F;  2XPK A;  2L81 A;  3B71 A;  2CXL A;  1PV3 A;  3L39 A;  4ANJ A;  5L47 A;  4JRZ A;  4PK4 A;  4DR3 T;  4WJ0 A;  4FAP B;  1I4Y A;  3UMK A;  5CB4 E;  3EZI A;  1MQV A;  1BR4 A;  3I0O A;  2PTF A;  5KYW B;  2FJE A;  2X66 A;  2H8A A;  5EZY E;  5CA1 E;  2XQ4 A;  2VAS A;  1HFA A;  5KYY A;  2YU1 A;  1HCI A;  3IEE A;  3UQ4 A;  3BK9 A;  2WVQ A;  2QNL A;  3N9M A;  5A6B D;  2KSR A;  1SR2 A;  1W0A A;  3GWL A;  4IE0 A;  4ZI3 C;  4ULV A;  2PX3 A;  1MNE A;  2FBW A;  4ZHQ E;  1W2W A;  2E9X D;  1OED C;  2DWK A;  2FGY A;  4JYA T;  3IBP A;  2JQH A;  4RDA A;  5LMN T;  4MHC A;  3OA1 A;  4EB6 E;  1HR0 T;  4H4K C;  3LES A;  4TV8 E;  2LLY A;  4B3M T;  4LF8 T;  4U33 A;  4ILC A;  1ZHZ A;  1WR6 A;  3QW1 A;  1IAP A;  2BS3 A;  1Y64 B;  4UV9 B;  4JI8 T;  2Y8D A;  2ODV A;  4KI2 A;  3VYW A;  4ZS3 A;  1VB5 A;  3I0Q A;  3ZJ1 A;  2J8W A;  5AGF A;  4OIN F;  4HFE A;  3PTR B;  3KV4 A;  2J47 A;  4DVD A;  2KQ9 A;  3WOD F;  3P4P A;  3AOU A;  4Z91 A;  2QYW A;  1BZ4 A;  3ONJ A;  1S05 A;  4O79 A;  2PFV A;  4ZI2 D;  3PUY F;  1LIH A;  5L3E B;  5LHG B;  2IHR 1;  5L3G B;  5CI9 A;  3FBZ A;  3ZMV B;  3N5L A;  4DND A;  4Q25 A;  5AQI B;  4GKJ T;  2KW3 C;  3LJB A;  3LBX A;  2HMQ A;  1TWH A;  2CLY B;  5AQP B;  2EPL X;  5FVK A;  2I8B A;  4CBE A;  4H9Q C;  2MBG A;  2QRX A;  2V6X A;  4DRJ B;  3AE5 A;  5T3W A;  3ZQV A;  1AJ3 A;  2UUI A;  5JH7 E;  5JR9 B;  3RKO F;  4YN0 B;  2E5V A;  3H2V A;  3EGX A;  2NW8 A;  2PFD A;  4CSA C;  4G63 A;  1VYK A;  2KYH A;  4CS8 C;  3RQG A;  4TWD A;  1S94 A;  3U8V A;  5JT4 A;  1N34 T;  5FZT A;  1ZHT A;  4YJ3 E;  2M6B A;  4C91 A;  3EJN A;  5A6K A;  3AGT A;  3LK4 2;  4YSZ A;  2DCF A;  1R5I D;  3FXH A;  4JEA A;  2A72 A;  2GFH A;  3D0T A;  2L6H A;  1VLT A;  5BQI A;  4YXD A;  5HV9 A;  2PJQ A;  1TQG A;  3IHR A;  5GON E;  4X62 T;  4PR9 A;  4CXW A;  1PD1 A;  2DB4 A;  3H3A A;  4YTN A;  3F46 A;  3Q5D A;  3LBX B;  1OW8 A;  2J7P D;  3CK6 A;  3EAM A;  2XJ7 A;  3OYZ A;  2V6Y A;  3HI2 A;  4EOZ B;  4LLE A;  2H89 A;  5EHH A;  3JYY A;  1CPR A;  1QLB A;  4E7S A;  3JAE A;  1ST6 A;  1J5W A;  1B68 A;  3BQI A;  5ABE A;  2EIL C;  2NG1 A;  1XDP A;  3QB5 A;  3PUQ A;  4U5F E;  1Q0D A;  3P7I A;  1HX8 A;  3WAK A;  1ZU4 A;  3ZTM A;  1OR2 A;  3J9X 1;  2BVL A;  5HSW A;  3NZP A;  3AG1 C;  4WBN E;  5C3J A;  5COG A;  2XQY A;  1M56 C;  4DBQ A;  4UXN B;  4N78 D;  4DV1 T;  2LFD A;  3RIA A;  4OFZ A;  4JW1 A;  4L0R A;  4XWJ A;  1E1H B;  3AEG A;  4G7Z F;  4DV3 T;  4EKW A;  2W67 A;  1YXR A;  2IAK A;  2IXM A;  2RPA A;  4DV0 T;  2HSQ A;  5EGY A;  4DRH B;  4XLP F;  1C17 M;  4B6X A;  2L9J A;  2IML A;  5FY7 A;  2V6Y B;  1X9B A;  3HNI A;  4FWV A;  2LHR A;  2CYD A;  4HFF B;  4UDV A;  2XAQ B;  4LF7 T;  4IDQ A;  5EK0 A;  5J2T E;  2ETS A;  2E9X C;  2C5I T;  2BE5 F;  4P9F A;  3ZLI A;  1Z7Q c;  1QKR A;  3B9Q A;  3LFM A;  4IE6 A;  3RX6 A;  2XAG B;  2WCA A;  2EIN C;  4NTB A;  4GOU A;  3X1O A;  3EFO A;  1TFO B;  3AA0 B;  1CGN A;  3ZJ2 A;  2Q00 A;  2G3K A;  2D0T A;  3VRC A;  3K3N A;  4LMJ A;  3LAY A;  3ZSS A;  4YTP A;  4B3S T;  2PG8 A;  4U74 A;  2AWY A;  2KWH A;  1HW1 A;  5T3T A;  3HKC E;  4P09 A;  2N2N A;  5F5W A;  2LSG A;  1L3P A;  3PJA A;  1QQ3 A;  2VUR A;  4JCZ A;  3CEX A;  3JCF A;  4EBB A;  4DRI B;  1KEY A;  1XWM A;  3CVR A;  4ZI2 C;  1HF8 A;  2LQG A;  4XEF A;  5LJM A;  2UXD T;  1QUU A;  2VVS A;  1FAP B;  1V55 C;  2A3D A;  1XNR T;  2FAP B;  4ILU A;  1L7C A;  2Q7R A;  1NU9 C;  4NUU A;  4QI0 A;  1ZW3 A;  1TWA A;  3PUR A;  5LJN A;  4I44 A;  4MTF A;  5FXV A;  3AE7 A;  1UX5 A;  4E0H A;  4JIO A;  2JQ9 A;  3UU8 A;  3N2O A;  2R7V A;  3N9Q A;  2IOQ A;  2KGO A;  4PAC A;  5HXC A;  4LDK A;  4IGG A;  3EGD A;  3T1H T;  4QXC B;  5JRA A;  5FP3 A;  4BJ1 A;  3MBG A;  4J7Y A;  2B1E A;  3NRX A;  3GMI A;  2XLD A;  4CX9 A;  4DR4 T;  4PJN A;  2XSE A;  1K05 A;  1F1M A;  3DM5 A;  2DI3 A;  4Z9H A;  4JUY A;  2HV6 A;  2OKU A;  2KZ7 B;  3DTO A;  4U3C A;  2J4G A;  2WQY A;  3JSZ A;  5COM A;  1MIW A;  3A5X A;  5DQW A;  4IIJ E;  3PUS A;  4IL4 A;  3T6B A;  3B29 A;  4X0R A;  2J0W A;  3QC9 A;  3RRC A;  2ZM0 A;  5D91 A;  1Q0G A;  5C2T A;  1JPN A;  4O7G A;  3GEE A;  4CS8 A;  4OX9 T;  1NFN A;  5JRC B;  3U2M A;  1T98 A;  1MMG A;  1HMO A;  2IXO A;  3NRY A;  4F6R C;  1KNZ A;  3C62 A;  2P61 A;  3L8R A;  2XQ9 A;  4GQH A;  4IE4 A;  4WAB A;  4DR6 T;  4JCH A;  4UR9 A;  3JSE O;  3U9M A;  4AQF C;  3FZM B;  4HWF A;  2N1G A;  1G73 A;  1O3X A;  5JQG E;  2CGE A;  2LE8 A;  3LLK A;  4ZEY A;  2UUH A;  5AQR B;  1SYQ A;  4PNI A;  1G4U S;  4DID B;  4YT2 A;  3ABM C;  4ZS2 A;  3L8I A;  3ZYK A;  4LF4 T;  4QH4 A;  4WW0 A;  3ATP A;  2LSE A;  1BR1 A;  3LK2 B;  1J8M F;  3HL6 A;  5L2L A;  3OKQ A;  3C98 B;  3O1J A;  1XZP A;  5B1B C;  4YT4 A;  4KP3 C;  4LFA T;  3SXM A;  2WWU A;  3LNM B;  2XM1 A;  1G5Z A;  4I43 B;  3FZF B;  5L0D A;  2ODU A;  3E0Z A;  3VRB A;  3JCU Q;  4YT8 A;  2WZL A;  4MQ9 F;  1NFO A;  3KVB A;  3ZG1 A;  2VCC A;  3AEB A;  2ZD9 A;  3C18 A;  2AP3 A;  5AQN B;  4ZOL E;  3TLW A;  2HKV A;  4YHJ A;  5KYN A;  3RF1 A;  4JZA A;  4CQI A;  4U2Z A;  3HNL A;  3N2G E;  3U3I A;  1H6G A;  3GN5 B;  4AXP A;  5DQZ A;  2WZF A;  3Q6M A;  3DM9 B;  2X0L B;  3JC6 D;  4OD4 A;  5HEG A;  3BQK A;  1DOW A;  5A6B A;  3Q5E A;  3UQ7 A;  2Q9A A;  2J0X A;  2NTY A;  4HTE A;  1RKE A;  3TKL B;  2LT3 A;  3DP7 A;  2E9X A;  1ZOY A;  4O2A E;  2JD3 A;  3FB2 A;  1N32 T;  1VOM A;  4JBW F;  5HEH A;  4U7I A;  2VH3 A;  5A1L A;  2PNO A;  2K48 A;  3LJC A;  2KLQ A;  2YKS A;  3SS1 A;  3ZST A;  3VU7 H;  1Z3I X;  1U6H A;  3SFE A;  3T1Y T;  3UUX B;  2HPJ A;  3NWI A;  3ZIB A;  4E18 A;  4U31 A;  1MMN A;  4CDY A;  4B6I A;  3NMI A;  3C64 A;  3K1I C;  3KBT A;  4KUM B;  2HJ3 A;  3MZK B;  5L0G A;  3WAJ A;  4EV6 A;  2DL1 A;  5L3Q A;  3VKG A;  5DQT A;  2LRK A;  1YDI A;  3EQL F;  3AE9 A;  2VKJ A;  2HV7 A;  4G7O F;  2A6H F;  2LCH A;  2A0B A;  2JMH A;  2V7I A;  2M64 A;  2L6F A;  1ZU5 A;  3X1D A;  3NKZ A;  4I1O B;  5JDQ A;  2Y69 C;  4K0K T;  5JVD E;  2LOS A;  2CLY C;  1X79 A;  3RVZ A;  1RCP A;  4ZZB A;  3I9Y A;  4DR1 T;  3N9L A;  5LYJ E;  4A4A A;  1XZY A;  1JMW A;  3U3F A;  3RYC E;  1OCR C;  4GYS A;  5JR9 C;  5EK3 A;  3UUL A;  4HFC A;  3A8Y C;  2R6G F;  3VR9 A;  4MND A;  3ASN C;  4XLN F;  1Z0P A;  4PFP A;  2J45 A;  3IQ6 A;  1WN0 A;  4EED A;  3CQC B;  2VWA A;  3ZMS B;  4MLK A;  1TR2 A;  1FIO A;  3C4X A;  5L0I A;  3WAQ A;  4HE8 D;  1AEP A;  2WS3 A;  4P1N A;  3N9N A;  4TNV A;  2KXP B;  5AQJ B;  3Q2M A;  3TQO A;  3CML A;  5JS5 A;  3PDY A;  3BQL A;  4Z90 A;  2BG9 A;  3AA6 B;  2M6I A;  1T7S A;  5LCY A;  3ASO C;  2JJ9 A;  3EI0 A;  3DKA A;  2JQK A;  5HXE A;  3M4B A;  4JI4 T;  5AQM B;  4AE4 B;  3CIR A;  4LF6 T;  1WWP A;  2HFI A;  4YL0 A;  1UK5 A;  4QI2 A;  4AQF A;  5FNV E;  1XMO T;  2Q9B A;  5LOV E;  3T8O A; 
#chains in the Genus database with same CATH homology
 4Z8X A;  3ZMT B;  3POV A;  3QZC A;  5KDM C;  2EHO D;  4HGA A;  1TWG A;  2CXF A;  1PD0 A;  4JVS A;  3CX8 B;  5KX5 E;  4FES A;  2XAH B;  4RD9 A;  2K5B B;  3W8I A;  2IYL D;  3CSK A;  4U5G A;  5AFU L;  3PHF 2;  4A2N B;  4X1K E;  2J9W A;  3HKE E;  1FFT C;  3JC6 C;  3P8C D;  2RA1 A;  4AQG A;  2DGJ A;  3MKD A;  3MA9 A;  2CM0 A;  2SPC A;  5D92 A;  2BZB A;  2DHR A;  3RIP A;  1WRD A;  1D0X A;  5DLJ A;  1LVF A;  2Y3D A;  2R7O A;  3EHN A;  4KC9 A;  3T6J A;  2CXD A;  4AKI A;  2XAS B;  2KMF A;  4ISS A;  1VRB A;  4QX8 B;  1NWM X;  4UF0 B;  2OCC C;  3KV5 A;  5KMG P;  4OYK A;  2VKO A;  4OYJ A;  4A56 A;  4Q5S F;  2LM9 A;  3TD7 A;  2R7X A;  3HKB E;  4ZLD A;  2R7Q A;  4JEU B;  3H37 A;  4IWB A;  2Q3T A;  2CE7 A;  3B57 A;  2X9H A;  3ZEF B;  2L9Q A;  4X1I E;  4O4L E;  4E7Z A;  2KIN B;  2WVO A;  2A2F X;  3KIN B;  3RYH E;  2DYS C;  2HPL A;  1Z5Z A;  5LP6 E;  2Y3G A;  3RYL A;  4GEH A;  3ETU A;  3V7O A;  2V7K A;  2VKD A;  2YHS A;  4ZI7 E;  3K66 A;  2D5U A;  4HEA A;  3W2W A;  4NY3 A;  1JPJ A;  3UGO A;  5JR9 A;  4ULW A;  4QHO A;  3K3Q C;  4BAY B;  2V7L A;  1ZV4 X;  2CDQ A;  5L3D B;  2KND A;  1V9D A;  2WM9 A;  3CX6 B;  1YKE B;  3ZMZ B;  2EIM C;  4H9S E;  3ANW B;  3L09 A;  2PF4 E;  3V5U A;  3V5S A;  4UIG A;  5JDM A;  5DQV A;  3ESL A;  2BDE A;  3CZ6 A;  1CUN A;  3NBX X;  3I5Q A;  1V54 C;  2ZPA A;  2D2S A;  2CCQ A;  2IC9 A;  2Y48 B;  1NAF A;  5LBM A;  2UXN B;  3M65 A;  3CQZ A;  3ETV A;  4IDZ A;  4QKN A;  1SMY F;  2CNW D;  1IJ6 A;  3EG9 B;  2Q9Q B;  1MIV A;  5KYU A;  4ZLC A;  3T4R A;  2W0G A;  2XAJ B;  4X1Y E;  4LER A;  3O39 A;  1RJ9 B;  2IW5 B;  3JRT A;  4H63 V;  3PMR A;  2H7V C;  2NW9 A;  5J1G A;  3OEO A;  2L8K A;  2NTX A;  3B0P A;  3RPU A;  3KBU A;  3AAE B;  4JLE A;  1IW7 F;  3DZA A;  2EIK C;  5L3B B;  5HYA A;  2WZG A;  5E3A A;  4ADZ A;  3AA7 B;  2H3R A;  5IY5 C;  2HH7 A;  2ZXW C;  5KYU B;  5M4Y A;  4AK9 A;  4ERR A;  3ZC1 A;  1Z6A A;  3FXD B;  3X2Q C;  5TAO A;  5IYZ E;  4I50 E;  4K7B A;  4GIW A;  4H9O C;  4KBM B;  2CWO A;  3ZCI A;  1LKX A;  4KBL A;  2J9V A;  4EWC A;  3FHN A;  1VMA A;  2W00 A;  4TX5 A;  3H65 A;  5ADX L;  5LGN B;  4DVZ A;  2X9W A;  5LGT B;  1U5P A;  4JJF A;  4BJ5 C;  4BJ6 C;  3UFE A;  5EK4 A;  3SEO A;  3K33 A;  5JDH A;  2Y3B A;  3OJA A;  4BJN A;  5FXZ A;  3L3P A;  3EZH A;  4PK6 A;  4JEH B;  3IF8 B;  2V7J A;  5F8P A;  3R84 B;  3HKD E;  5JRC A;  3N9P A;  4U5H A;  2W63 A;  2D5R B;  3K8P C;  3AQC A;  5DVW A;  2A68 F;  4WBO A;  1SHZ C;  2ACX A;  3ZYL A;  3NYL A;  1MMA A;  3KKB A;  1D1C A;  3W15 B;  4PJL A;  4IST A;  5JRE A;  2PX0 A;  5L3V A;  5LG4 A;  2EHO A;  5JDN A;  4PJM A;  2XRH A;  2LSK A;  3Q5X A;  2G0U A;  1IZM A;  1NG1 A;  2XL4 A;  3QK6 A;  1TKN A;  3DAF A;  3UMI A;  1OCO C;  2L3L A;  4ASK A;  3SZR A;  4DMW A;  5KYX B;  3O4X E;  3NKD A;  3S28 A;  2QTV A;  3W8H A;  2Q9Q D;  4UV8 B;  3GN5 A;  2NWB A;  3AQB A;  2WMN A;  5FXX A;  2XXA B;  2EHO B;  3O6X A;  2JQQ A;  2VKH A;  4IE5 A;  1HS7 A;  1IZN B;  5JDG A;  5LGU B;  4H63 H;  5JDL A;  3AA1 B;  3AG2 C;  4C90 A;  4YJ2 E;  1YW0 A;  2ZXO A;  2M4E A;  4J30 B;  4QWN B;  1WGW A;  4PW8 A;  4DOZ A;  3HTK C;  5FXW A;  2A1D D;  4O2B E;  4IAO A;  1D1B A;  3MAC A;  2YEV C;  2VK9 A;  2QGS A;  4LLC A;  2DI4 A;  5DJQ C;  2DWG A;  3GAN A;  1KU2 A;  4OIR F;  3DAG A;  3AG3 C;  1TWC A;  4YWQ A;  4AKR B;  3CPZ A;  1HG2 A;  5EK2 A;  2A69 F;  5HAX A;  1QSD A;  3ABK C;  3B13 A;  1QZX A;  3DXJ F;  4QX7 B;  4IRU A;  4BJ5 A;  4BJ6 A;  4C3E A;  2YU2 A;  4OIO F;  2CA5 A;  4UVB B;  5F5F A;  1FFH A;  2E8I A;  3L0I A;  3RC8 A;  2Q9C A;  4UEM A;  4CI1 B;  4GYT A;  3EDV A;  3VAY A;  2KWI B;  4CS7 A;  2B0J A;  2RP4 A;  1Z23 A;  4AE4 A;  3KMI A;  2YIN A;  5LNK A;  2NW7 A;  1OXZ A;  3CKD A;  3Q7L A;  5ETW A;  2W4M A;  1Z63 A;  4TN7 B;  4YLH A;  3ZC4 A;  2CNW A;  4UEL A;  4AX2 A;  3UTK A;  4H9N C;  5F3J A;  2X9Y A;  2Q9Q C;  2KNH A;  5E2Q A;  4F4B A;  3OBV E;  1MIY A;  3LNR A;  5FY0 A;  3N24 A;  2J7P A;  3JT1 A;  3ZVR A;  3WI3 A;  2V26 A;  3ITF A;  4KNW A;  4HEA J;  3FHD A;  2H7O A;  5FMN A;  1M2V B;  4FJO A;  2YZS A;  4CZZ B;  4P0A A;  3NYM A;  3UGP A;  4FX5 A;  2Y3H A;  1O87 A;  5E0O A;  3W2V A;  2W45 A;  2R7W A;  2WL8 A;  2XUE A;  4PK5 A;  2CWY A;  3PU3 A;  2PBI A;  4PFO A;  3LS1 A;  1FMV A;  2OA5 A;  2R7R A;  3Q6N A;  2I59 A;  4EZH A;  5LHH B;  2MOZ A;  4UF0 A;  3HJC A;  3E70 C;  3SOL A;  3FBL A;  4MBQ A;  1S7Z A;  4CIH A;  1EZ3 A;  2CMR A;  1HTJ F;  4C3D A;  3MXZ A;  1KK7 A;  2O9X A;  4FI5 A;  2Y39 A;  3EDU A;  3VHL A;  3MLG A;  3HR0 A;  4C7O B;  2X68 A;  4WNK A;  1WLX A;  4HFK B;  2R7S A;  2FFH A;  2YEV A;  3FXE B;  3LLI A;  1OCZ C;  1OKK D;  4P0B A;  4EYY R;  2NP9 A;  2GK9 A;  5H6R B;  3JYH A;  2J1D G;  3MX3 A;  3NDB B;  3EVY A;  4HFV A;  2ZM2 A;  2D0U A;  3S4U A;  1SA0 E;  2MYS A;  3E9V A;  1MND A;  1M57 C;  2K9A A;  4AKL A;  3SRZ A;  2NOX A;  3F2E A;  5LHI B;  4G0H A;  3ANW A;  2C5J A;  4X20 E;  3ABL C;  4OIQ F;  4H9P C;  3SWH A;  3DJU B;  2P9B A;  2Y6X A;  4O8S A;  3N2K E;  4U5D E;  1ZHY A;  4OIP F;  5C8Y E;  3DJN B;  3WG7 C;  3OYX A;  1WYB A;  2Z15 A;  2XHE B;  1D1A A;  3UNG C;  3AVR A;  2W4B A;  4EXT A;  3EG9 A;  2Q9Q A;  3LS0 A;  4DBR A;  1U4Q A;  4G2A A;  2KT9 A;  2MWQ A;  3FAJ A;  4O4I E;  4M63 A;  4QXB B;  4EAH A;  4PJJ A;  3RYI E;  2EHO C;  5KYY B;  5LA6 E;  2VB6 A;  4I55 E;  5L3C B;  2OG2 A;  1RJ9 A;  4OD5 A;  3ZN1 B;  1G8X A;  2LSY A;  4OHF A;  2E87 A;  5LBQ B;  2QY9 A;  3SNH A;  4L9I A;  3DJB A;  3RYF E;  4OK0 A;  2G3V A;  4DO0 A;  2LSI A;  1B7T A;  4JJG A;  5CI8 A;  3ZMU B;  4AI6 A;  3C4Z A;  2JPF A;  1UX4 A;  4L5G A;  2DYR C;  2ZMA A;  3NYJ A;  2V3C C;  2V7M A;  1ZHX A;  3AAI A;  3C50 A;  2W9Y A;  3PUA A;  4EZ4 A;  4W8K A;  2XAF B;  4UVC B;  3QUJ A;  1FMW A;  1S35 A;  5LXT E;  3HA4 A;  4TUY E;  2CEA A;  4EIW A;  4YFS A;  1NU7 D;  5H6Q B;  3EGX B;  2N9D A;  3SP1 A;  3Q7G A;  1D0Z A;  4JUR I;  3K1H A;  4XBF B;  4DMV A;  2ZXR A;  5BMV E;  3EH1 A;  2EIJ C;  2M67 A;  2C04 A;  5B1A C;  4QXH B;  5J2U E;  3RKO A;  1BR0 A;  1ZYR F;  4BJT A;  4CI3 B;  4O6N A;  3F31 A;  1OCC C;  3RRW A;  4IE7 A;  4QDL A;  3NRH A;  2X51 A;  4I4T E;  1FTS A;  3GOD A;  3KH2 A;  4K0D A;  3UUM A;  1LVK A;  4BG0 A;  4Q4Z F;  5HXR A;  4HE8 A;  3I9W A;  3KV9 A;  3N2Z B;  2P7V A;  4CXX A;  2QA7 A;  5KYX A;  3CQG B;  3UT5 E;  4IGU A;  4G7H F;  1IJ5 A;  4HKA A;  2H7B A;  3CX7 B;  4YJW A;  5HXS A;  2IC6 A;  2W61 A;  3HLZ A;  2XXA A;  1US7 B;  4U72 A;  4O6Y A;  3EPV A;  3ZCJ A;  3K7D A;  3EFO B;  4U5E E;  3AVS A;  4O4H E;  3EHM A;  2X67 A;  4YT5 A;  4K0U A;  3N9O A;  5L3F B;  5T1D B;  3F57 A;  3Q9D A;  3B0U X;  3CQX C;  1ZEE A;  3ZN0 B;  4J2C A;  2J9U A;  4CI2 B;  3NKE A;  4CSA A;  4IJJ A;  3J7Y q;  4J32 B;  1OKK A;  1O5H A;  4XTK A;  5HXH A;  3M1C B;  3EGD B;  1MMD A;  1D0Y A;  2KJG A;  3KVA A;  4XAX B;  3NZQ A;  1LRZ A;  1SZI A;  3K3O A;  2Z6E A;  3I4U A;  3N0T A;  3O9X A;  3KDS E;  1LS1 A;  1WYC A;  2IXP A;  5E33 A;  3RH3 A;  4MAL A;  3C4W A;  1VK5 A;  3ZC0 A;  3PUG A;  2NUP A;  2P6V A;  5FYM A;  2NUT A;  2LJL A;  3S0X A;  2ZXP A;  2C03 A;  3RFY A;  2WSS V;  1YD8 G;  3E08 A;  4U5B E;  4GK5 E;  1OWA A;  3ZYM A;  4KMC A;  3B0V C;  2A6E F;  3L34 A;  2C5K T;  4GK0 E;  3PE0 A;  3Q5W A;  4MFR A;  3NG1 A;  3FVY A;  4LAC B;  4CS9 C;  3C51 A;  1FEW A;  3LK3 B;  4XZC A;  3F47 A;  4P6I C;  3OWT A;  1ZKE A;  2NUP B;  2NUT B;  2C0S A;  3PU8 A;  3I5P A;  2MTQ A;  3O1I A;  2WBL A;  3DD7 A;  3AB3 B;  2ES0 A;  4CXY A;  3GA8 A;  5FCL A;  3VKH A;  1M2V A;  4Q7C A;  2LHN A;  3EUH A;  1HG5 A;  4O4J E;  4I1M A;  4NUV A;  2XTL A;  2J46 A;  2JMK A;  3KFW X;  3ZPO A;  2VL8 A;  3ECS A;  3S27 A;  4GYR A;  3LG7 A;  4BEJ A;  2E9X B;  3GWH A;  3EH2 A;  5JDF A;  4AKH A;  3LEV A;  4EYU A;  3E22 E;  1NZE A;  3I1A A;  3R6N A;  5B3S C;  3RC3 A;  3FDQ A;  2WB7 A;  4O6M A;  4ZI3 D;  2DLR A;  3QMK A;  1SF8 A;  2WMO A;  3AAA B;  3K6B A;  4DVY P;  4HN9 A;  4C7O A;  4IHJ E;  2R7U A;  1H7C A;  4TV9 E;  1ZHC A;  3UUN A;  4UVA B;  3MJX A;  1YKH B;  1PCX A;  2WVN A;  4N06 A;  5FY1 A;  3SYN A;  2ZLY A;  1QLE C;  4V1A v;  5DS5 A;  4AKG A;  2V1D B;  3U78 A;  4TZ4 C;  3UMH A;  5F5H A;  3UR3 C;  4H9R C;  2DNX A;  4U5C E;  1VYI A;  2CW0 F;  5DAB A;  4C3B A;  2YK0 A;  2LOP A;  2IXN A;  3S29 A;  2K24 A;  4BA9 A;  4BJM A;  5HWY A;  2PP4 A;  5E3C A;  4RBN A;  3O1H A;  1ZHW A;  2R7T A;  2X9X A;  2BVM A;  4I3M A;  1M2O A;  5DS6 A;  2WAU A;  4M1P A;  2LEH A;  1UCU A;  5KYW A;  3AG4 C;  2UXX B;  3CWZ B;  3KL4 A;  3KV6 A;  3ZSU A;  1N1C A;  5BUO A;  5CA0 E;  5HWX A;  4PAG A;  2ZM8 A;  3ONX A;  2G62 A;  3DMD A;  3MK7 C;  2LSJ A;  5DS4 A;  4KNV A;  2W62 A;  1BR2 A;  4CS9 A;  5IHY A;  2JRK A;  1J8Y F;  2L81 A;  2CXL A;  4ANJ A;  4PK4 A;  4WJ0 A;  3UMK A;  5CB4 E;  3EZI A;  1BR4 A;  3I0O A;  5KYW B;  2X66 A;  5EZY E;  5CA1 E;  2VAS A;  1HFA A;  5KYY A;  2YU1 A;  1HCI A;  3IEE A;  3BK9 A;  2WVQ A;  3N9M A;  4IE0 A;  4ZI3 C;  2PX3 A;  1MNE A;  4ZHQ E;  1W2W A;  2E9X D;  2DWK A;  2FGY A;  3IBP A;  4RDA A;  4MHC A;  3OA1 A;  4EB6 E;  4H4K C;  3LES A;  4TV8 E;  1ZHZ A;  1WR6 A;  1IAP A;  1Y64 B;  4UV9 B;  2Y8D A;  2ODV A;  4KI2 A;  3VYW A;  4ZS3 A;  3I0Q A;  3ZJ1 A;  4OIN F;  3PTR B;  3KV4 A;  4DVD A;  2KQ9 A;  3WOD F;  4O79 A;  2PFV A;  4ZI2 D;  5L3E B;  5LHG B;  5L3G B;  5CI9 A;  3FBZ A;  3ZMV B;  3N5L A;  4DND A;  2KW3 C;  3LJB A;  3LBX A;  1TWH A;  2CLY B;  2I8B A;  4CBE A;  4H9Q C;  2MBG A;  5T3W A;  1AJ3 A;  5JH7 E;  5JR9 B;  3RKO F;  4YN0 B;  3EGX A;  2NW8 A;  2PFD A;  4CSA C;  4G63 A;  1VYK A;  4CS8 C;  1S94 A;  1ZHT A;  4YJ3 E;  4C91 A;  3EJN A;  3LK4 2;  2DCF A;  2A72 A;  2GFH A;  3D0T A;  2PJQ A;  3IHR A;  5GON E;  4CXW A;  1PD1 A;  3H3A A;  3F46 A;  3LBX B;  2J7P D;  3OYZ A;  3HI2 A;  4EOZ B;  4LLE A;  5EHH A;  4E7S A;  1ST6 A;  3BQI A;  2EIL C;  2NG1 A;  3PUQ A;  4U5F E;  3P7I A;  1HX8 A;  3WAK A;  1ZU4 A;  3J9X 1;  2BVL A;  5HSW A;  3NZP A;  3AG1 C;  4WBN E;  2XQY A;  1M56 C;  4DBQ A;  4UXN B;  4N78 D;  4OFZ A;  4JW1 A;  4L0R A;  4XWJ A;  1E1H B;  4G7Z F;  2IAK A;  2IXM A;  5EGY A;  4XLP F;  4B6X A;  2L9J A;  5FY7 A;  4FWV A;  2LHR A;  4HFF B;  2XAQ B;  5J2T E;  2E9X C;  2C5I T;  2BE5 F;  3ZLI A;  3B9Q A;  3LFM A;  4IE6 A;  3RX6 A;  2XAG B;  2EIN C;  4GOU A;  3X1O A;  3EFO A;  3AA0 B;  3ZJ2 A;  2G3K A;  2D0T A;  3K3N A;  3LAY A;  2PG8 A;  4U74 A;  2KWH A;  5T3T A;  3HKC E;  4P09 A;  2N2N A;  2LSG A;  4EBB A;  3CVR A;  4ZI2 C;  1HF8 A;  5LJM A;  1QUU A;  1V55 C;  2A3D A;  4ILU A;  1NU9 C;  4NUU A;  4QI0 A;  1TWA A;  3PUR A;  5LJN A;  4I44 A;  5FXV A;  1UX5 A;  3N2O A;  2R7V A;  3N9Q A;  2IOQ A;  2KGO A;  5HXC A;  3EGD A;  4QXC B;  5FP3 A;  4BJ1 A;  2B1E A;  3NRX A;  3GMI A;  4PJN A;  2XSE A;  3DM5 A;  4JUY A;  2HV6 A;  2KZ7 B;  3DTO A;  3JSZ A;  1MIW A;  3A5X A;  5DQW A;  4IIJ E;  3PUS A;  3T6B A;  4X0R A;  2J0W A;  3QC9 A;  3RRC A;  2ZM0 A;  5D91 A;  1JPN A;  4O7G A;  4CS8 A;  5JRC B;  1T98 A;  1MMG A;  2IXO A;  3NRY A;  4F6R C;  1KNZ A;  4IE4 A;  4JCH A;  4AQF C;  2N1G A;  1G73 A;  1O3X A;  5JQG E;  2CGE A;  2LE8 A;  3LLK A;  4PNI A;  4YT2 A;  3ABM C;  4ZS2 A;  3ZYK A;  4WW0 A;  2LSE A;  1BR1 A;  3LK2 B;  1J8M F;  3HL6 A;  5L2L A;  3OKQ A;  3C98 B;  3O1J A;  5B1B C;  4YT4 A;  4KP3 C;  2WWU A;  4I43 B;  2ODU A;  3E0Z A;  3JCU Q;  4YT8 A;  2WZL A;  4MQ9 F;  3KVB A;  3ZG1 A;  4ZOL E;  4YHJ A;  5KYN A;  4JZA A;  4CQI A;  3N2G E;  3U3I A;  3GN5 B;  4AXP A;  5DQZ A;  2WZF A;  3Q6M A;  3DM9 B;  2X0L B;  3JC6 D;  4OD4 A;  3BQK A;  2Q9A A;  2J0X A;  2NTY A;  4HTE A;  3TKL B;  2LT3 A;  3DP7 A;  2E9X A;  4O2A E;  2JD3 A;  3FB2 A;  1VOM A;  2VH3 A;  5A1L A;  2K48 A;  3LJC A;  2KLQ A;  3SS1 A;  3VU7 H;  1Z3I X;  3UUX B;  2HPJ A;  3ZIB A;  1MMN A;  4B6I A;  3C64 A;  3K1I C;  3KBT A;  4KUM B;  3MZK B;  3WAJ A;  5L3Q A;  3VKG A;  5DQT A;  3EQL F;  2VKJ A;  2HV7 A;  4G7O F;  2A6H F;  2JMH A;  2V7I A;  1ZU5 A;  4I1O B;  5JDQ A;  2Y69 C;  5JVD E;  2LOS A;  2CLY C;  1X79 A;  3I9Y A;  3N9L A;  5LYJ E;  3RYC E;  1OCR C;  4GYS A;  5JR9 C;  5EK3 A;  3UUL A;  4MND A;  3ASN C;  4XLN F;  1Z0P A;  4PFP A;  2J45 A;  3CQC B;  2VWA A;  3ZMS B;  4MLK A;  1TR2 A;  1FIO A;  3C4X A;  4HE8 D;  3N9N A;  2KXP B;  3Q2M A;  3CML A;  3PDY A;  3BQL A;  3AA6 B;  5LCY A;  3ASO C;  2JJ9 A;  5HXE A;  4AE4 B;  4QI2 A;  4AQF A;  5FNV E;  2Q9B A;  5LOV E;  3T8O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...