3RH3A

Crystal structure of an uncharacterized duf3829-like protein (bt_1908) from bacteroides thetaiotaomicron vpi-5482 at 2.10 a resolution
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
256
structure length
239
Chain Sequence
TEELDDASKVINYYHMSLAVLRHVANAKDINAVLGYMEQTGTAELLDPGDYFNPEVRQNLKQNYAGLFNVRTQFYDNFNKFLAYKKSKDTAKTAQLLDENYKLSVELSEYKQVIFDILSPLTEQAESELLADEPLKDQIMAMRKMSGTVQSIMNLYSRKHAMDGVRIDLKMAELEKELKAAEKIPAVTGYDEELKNFQSFLSTVKSFMNDMQKARSKGAYSDKEYQAMSEAYEYGLSVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized DUF3829-like protein
publication title Crystal structure of an Uncharacterized DUF3829-like protein (BT_1908) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution
rcsb
source organism Bacteroides thetaiotaomicron
total genus 89
structure length 239
sequence length 256
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-04-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.820 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3rh3A02
1.20.120.930 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3rh3A01
3IEEA 4YJWA 3RH3A
chains in the Genus database with same CATH superfamily
4PFOA 3N2ZB 2PP4A 1VK5A 2XJ7A 4TV9E 4CXYA 2VVNA 2YN6A 2QTVA 4HWDA 3DMDA 3W2WA 1DOWA 2QVAA 5F8PA 1NZEA 3QC9A 3EGXA 4EOZB 4IIJE 4JEUB 4EWCA 3NVOA 2WZIA 4X64T 4LMJA 3PTRB 4NPPA 2KNHA 3S0XA 2V7KA 3BEHA 2DHRA 1FIOA 2FJDA 5IUXA 2A72A 2UXXB 4JJFA 1VMAA 2Q9QC 3RYHE 3JZ0A 5BQGA 3AXJB 4GYRA 1LRZA 1Y01A 2UXNB 1T72A 2W00A 2ZM8A 4PK6A 5JREA 1HFAA 1I94T 3DTOA 4O2AE 2XXAA 1YYXA 2LKGA 4DVDA 2M6IA 3OA1A 2QA7A 3TULA 1M6TA 4KX6A 2JPFA 2PTFA 3HNIA 4ISSA 3LNMB 4E0HA 1IJ6A 2BKPA 3AE4A 1L7CA 1O87A 3R6NA 5AQRB 2V7IA 1RJ9B 2LQGA 2YQYA 3ZMTB 3UULA 5A6KA 2HSQA 4FI5A 5KX5E 4AKHA 2KC3A 1YQ4A 2CWOA 4DUYT 2UUIA 5AGFA 2Q9QD 1T6IA 4H9RC 2Q9AA 4I44A 1GM5A 1H7IA 1SYQA 1HY5A 4A98A 4G7OF 3HKBE 3RIUC 5FCLA 4N78D 3NYMA 2BS4A 4ZZBA 4C7OB 3LEOA 3E22E 4IL9A 3SXYA 3FBZA 4A97A 4FAPB 5GONE 3RIAA 4GEHA 2YEVC 4MVMA 2NWBA 5JDHA 4JTAB 3PUZF 3B57A 1T9KA 1QLBA 5EK4A 2JIWA 3I0QA 1K05A 1US7B 5HXSA 4Z90A 3TLVA 3KBTA 4XPXA 3ZC4A 4B3ST 1N36T 4XTKA 2Y3GA 3IEEA 4U72A 3IPMO 3AA7B 1LIHA 2DGJA 2XM4A 1UK5A 1Z23A 2J7PA 1T98A 2WQYA 1WTYA 1K40A 1TKNA 3H3AA 2JX0A 4DMWA 4UV8B 4ULWA 2P0NA 2L7AA 3M3ZB 3ZMZB 2J0XA 1XZPA 2PFDA 3W8HA 3KPHA 3OWTA 2N1GA 1J8MF 2IC9A 2NR4A 4HWHA 5LA6E 4JTDB 3DM5A 3ZLIA 3ZSTA 2X0CA 3ZVRA 4DV0T 2HJ3A 2EHOA 3CQCB 5JH7E 3ETVA 3ZCIA 1K04A 1G4US 3U9JA 2Y3DA 4O4LE 1J5ET 1OW7A 1M62A 2W45A 3QW0A 3OJAA 4FESA 2V5CA 1O3XA 1EA8A 1JOGA 1YZAA 5T3TA 3RHWA 4MVOA 4CIPA 2CEAA 5FY7A 3FAJA 3MLGA 1WRDA 3ZMSB 1H6GA 2FAPB 1KEYA 3TKLB 3EHNA 4C3BA 3T6GB 3QZCA 4DV4T 5LOVE 5COMA 4PW8A 4JZAA 3VHLA 4ERRA 4PK4A 3WAQA 3QB5K 3CX8B 4YL3A 4AIUA 3FBLA 2ES0A 3KKBA 2FJEA 1ZP0A 3AEAA 3CPZA 3F31A 1ZHXA 4O4IE 5DS6A 2NG1A 3WAJA 2V8SV 5J2UE 4AQYT 3FXEB 2DYSC 4AL1A 3EVYA 3SYNA 3F2EA 2LJLA 2OEVA 2XQYA 4HE8A 3F46A 5D92A 4MVSA 4QI0A 4BJ6C 5FY0A 1YAUO 5KYXB 2EPLX 4K0UA 1HW1A 4EUKB 2EPMX 3AQCA 2Q9BA 3C8GD 5LP6E 3RC8A 1Z6AA 2IDOB 2W2UA 2ZMAA 1FFHA 2XS8A 2LFDA 2J9WA 1MMAA 2BS2A 2EPNA 5KYYA 3EPVA 2LKHA 4U33A 3CSKA 1OCCC 2W0GA 5B3SC 5HXHA 4YY3T 4LF8T 3L0IA 2MBGA 4CDYA 2K24A 3AG2C 1D0XA 3CAXA 1MQVA 4TUYE 2JPUA 4EBKA 5IY5C 4N6CA 1L0VA 4LFAT 4ILUA 1M2VB 4WGZA 3S90A 5L0IA 5K0IA 4P0BA 2VC9A 3AG1C 4JURI 1RKEB 4L5GA 1NU9C 4DIDB 3W8IA 2XZEA 2J8WA 4X62T 2M67A 1M56C 4DVZA 2VWAA 4IE7A 5BQHA 3U2LA 3ETUA 1LE4A 3ZC0A 2LP4A 2L81A 3UFEA 1ZHWA 2Y48B 3LESA 2CBJA 4CBEA 3PU3A 2GK9A 5JVEA 4QI2A 3UMIA 4ILCA 1ZW3A 4ZI7E 3NZQA 3O6XA 4DMVA 1AJ3A 4WABA 3LG7A 2E87A 1SUMB 2OV9A 3LS0A 2FFHA 1QZXA 2AU5A 3C7JA 4LF4T 2LSYA 5HEHA 3US6A 4N6HA 1CPQA 3FZLB 1IJ5A 2CA5A 1UUSA 2R02A 3KMIA 3EH1A 4DR6T 4Z9JA 5FMNA 4WYVA 3ONXA 4IL4A 3Q7LA 1ZZPA 4OFZA 1JRAA 2ZLYA 3OVUA 4GKKT 3VKHA 2YU2A 2W61A 2ZM2A 2X66A 2JRKA 4HEAJ 2KW3C 4M63A 1R5ID 4YWQA 3ZQYA 3G4ZA 3ABVA 3PUXF 2R7XA 1HG2A 3ANWA 3W15B 1UGOA 4OK0A 3N9QA 4GQHA 1OQCA 4ZLCA 4U9DA 4HEAA 1TWHA 1ZW2A 1MMGA 4ISTA 4BJMA 5AQSB 2XASB 3POVA 2CXFA 5JTGA 2J9BA 1EI7A 5HXCA 4RD9A 2IXNA 3ANWB 2BKNA 5H6RB 4CS9A 5ABFA 2AWCA 1I5NA 2R7QA 3OKQA 5JSLA 1UX4A 4PAGA 1QKRA 4AKGA 5A1LA 2X67A 4JV5T 1NFOA 2QRXA 4F6RC 4BPMA 4YL1A 5IWAT 5JRCB 2G3KA 3ATPA 4KNWA 3E70C 1W0AA 3GORA 2GDCA 4OD4A 2W63A 1BZ4A 4LDKA 2A3DA 3LJCA 5KYWB 5L3CB 1IBMT 3FVYA 3T1HT 4PFPA 4KI0F 1R4TA 2J9UA 5JQGE 5AQKB 5EK3A 2PNOA 1CGME 2L8KA 2ACXA 3ITFA 5E0OA 3EDVA 2CNWD 1WASA 4QXCB 3MZKB 4ANJA 2XM1A 3HTKC 1CUNA 4AQGA 3RF3A 4X66T 2AP3A 4I0UA 3AAIA 3FZFB 3M15A 1XDPA 4U5FE 2JQQA 3Q6MA 3U3FA 3FZKB 4DBRA 1OWAA 5LHHB 5AQNB 4PJNA 4H9OC 2N2NA 4MVRA 3Q5WA 3PHF2 2AXDS 3JCFA 4XEVA 2YKSA 4KI2A 3N2OA 5AQIB 2LHNA 5JVDE 3P4SA 1HG5A 5FKYA 2B0JA 1YLMA 5C8YE 3RC3A 3CZ6A 2PX3A 1M7KA 3C62A 4OIOF 2DL1A 4FJOA 4EXTA 4AISA 1ORYA 4YHJA 1LI7A 1HE9A 4O6NA 2DNXA 5F5FA 4LF6T 2P6VA 2VKDA 4WJ0A 4LF7T 5L47A 3MKDA 4IDQA 1LI5A 2R7WA 1ORJA 3UT5E 3AA1B 1NSGB 2OOCA 2XLVA 4X1YE 4HFHA 3J9X1 2V26A 4HFCA 2MAWA 2F4VT 5DLJA 2WU2A 4YK5A 2LSKA 5COGA 2A69F 2P1AA 3DJBA 2D0TA 3K1HA 3ZIBA 3RFYA 2D0UA 4AI6A 3WG7C 3SXMA 2MOZA 3NYJA 2IC6A 3UFGA 4HN9A 1YARO 2ZD9A 3MBGA 3T8OA 2Q9CA 1I6ZA 1OCZC 3CMLA 2XAFB 2L9JA 3KV4A 1Q0FA 3DM9B 2W67A 4BJTA 2KINB 1QSPA 3X1DA 3KL4A 4JJGA 3S27A 2ETSA 3CK6A 4QWNB 2EHOC 4EAHA 3PJAJ 3U3IA 3NRXA 4I55E 2IYLD 4PJJA 4M1PA 3ZKRA 1BR4A 1U6HA 3PJAA 3AQBA 1EKYA 3RGLA 4G0HA 3L3PA 4X0RA 4JI2T 5ADXL 1NBBA 4I3MA 4IDOA 4F4BA 5JT4A 1VYKA 2R7RA 3X2QC 4U9EA 3LFMA 4YHHT 4O6YA 4HFDA 2HN2A 3GWLA 2HJMA 2DYRC 1MIWA 3RYCE 2OA5A 1ZHTA 2LSIA 2OLTA 2EPKX 2EHOD 4IARA 5HWXA 4MW8A 3EGDB 4WZXA 4LFBT 1KF6A 2X9XA 2YL0A 5LBQB 4D4XA 4CXXA 2C5KT 5IYZE 1WYBA 3LLKA 2CRBA 4HFIA 1I4ZA 4MFRA 4I1OB 2G3VA 2XQAA 2KJGA 2WZLA 1EZ3A 2V6YA 2HSBA 5JRAA 2KSRA 4ASKA 4U2ZA 3AE6A 1M2OA 3O9XA 1J8YF 5AQFB 2R7OA 3EG9A 4IHJE 4AK9A 4CN1A 4TWDA 2D9DA 2C04A 2J47A 3PUVF 2YL1A 3ASNC 2F22A 4OHFA 4D4NA 5JDGA 2WVOA 4BEJA 4JI7T 4EKWA 2UUAT 4CI2B 3JRTA 4PR9A 2Y39A 3EG9B 3GEEA 2NP9A 4IJJA 3ZJ1A 4I43B 2HMQA 3QTHA 1HNWT 5LXTE 1NAFA 1FNTc 3UGOA 3E0ZA 5FXWA 4IAOA 3KYIA 3NKZA 2L6GA 1RMVA 4ZI3C 2ICWG 5KYUA 5FNVE 4HE8D 2MWQA 4JUYA 2ZXPA 3UUMA 3PUAA 3SFDA 2NUPA 3EAMA 2NPUA 3ZG1A 2WDVA 3U3BA 4OIPF 4MVQA 4HTEA 5AQOB 3SFEA 3RIFA 2HN1A 2C5IT 4C90A 2WWVA 2Q4FA 2NW8A 1XWMA 3K3OA 1Z5ZA 2NW9A 5KYUB 1OCRC 5F28E 2UXBT 1GQEA 3C18A 3PMRA 5BR8T 1T01A 5AQLB 1QPUA 3PCVA 4DR1T 3K66A 2Y6XA 1X9BA 3UR3C 3HLZA 3UU3A 4ZI3D 3M4CA 4ULVA 3ZJ2A 2XL4A 4YT0A 1YD8G 1H7CA 3AEDA 2XL8A 4YTMA 3EGXB 1J1JA 3RYFE 4P9TA 4EBJA 2WL8A 4I1MA 2R6GF 3SWHA 2KNDA 1Q0GA 4JEBA 1T7SA 2XQ4A 4KBLA 4DRJB 5F5HA 2LK4A 4IGGA 1ZYRF 3LSVA 4U5CE 2IXOA 5JDMA 4EZHA 4U3CA 1WFDA 2V7LA 1CHUA 3TQOA 2LM2A 3CQXC 4OIQF 2WCAA 3KBUA 1QQ3A 4AXPA 4XAXB 1LM3B 4AKRB 1ZHZA 1LVFA 3P8CD 1DOVA 3JCUQ 4ONSA 3ZWIA 3M79A 2ACZA 1XWJA 4YTNA 2J46A 4JEHB 4ZHQE 3OBVE 2XXAB 1S7ZA 2MHRA 4IE4A 4K7BA 3RW0A 3VRBA 1A41A 2FBWA 4H63H 3K6BA 1OEDA 4W8KA 4XLNF 1SHZC 2Y69C 4CJOA 1NLXA 2J4GA 4PNIA 1OEDE 5L0CA 4CS8A 5AQJB 2NSGA 4IT4A 2C03A 4MW3A 4CS9C 4JCHA 2BG9E 4O2BE 4PACA 4EZ4A 4XPYA 4XEKA 1NWMX 2J1DG 4WGYA 3LK3B 2W9YA 1B7TA 3N9OA 2I15A 2CLYC 2DB4A 3TD7A 4BJNA 3AE2A 5FYMA 2YL7A 4ZLDA 2XY8B 3LK2B 3PUSA 1E84A 4UVCB 2XSEA 3V5SA 4Z91A 1TWCA 2JD3A 3HNLA 3S28A 1HMOA 1T6UA 3TOMA 3PV0F 2JJ9A 3N9PA 4QH4A 3ABKC 1WLXA 4EIYA 4A5XA 2RD9A 5DS4A 5L0DA 3P7IA 3G4XA 3C4ZA 2K48A 3ABLC 1G8XA 2WB5A 2EPOA 4GYTA 3BQKA 3UUXB 3ZEFB 3N2KE 3RPUA 4L0RA 3MJXA 4CJGA 1ZKEA 3KDSE 2I8BA 4U5DE 1PD0A 1NFNA 4MBQA 2R03A 2KT9A 2C0SA 3BQLA 4LDQA 1G4WR 2V7MA 3K7DA 1UG7A 2ZXOA 4H54A 4MVZA 3NKDA 4MTFA 5L3GB 1VLSA 2WZHA 3EFOA 4RDAA 2PF4E 2A6HF 3L09A 4JBWF 1YKHB 3FMSA 2UUBT 2LSEA 5ETWA 3Q2MA 1Y4CA 1OW8A 4H4KC 3TK0A 4ZI2C 3DAGA 4O8SA 4UF0A 2B1EA 2EHOB 5A6BA 1VCSA 3AOUA 3UU8A 5AFUL 3EFOB 1JNRA 3JT1A 3HKCE 2LLYA 5DJQC 3ZTZA 4U74A 3ZYKA 2XL6A 3L34A 2CWYA 4NQFA 1QLEC 3S4UA 4IE5A 4UF0B 3LJBA 1V55C 4ZS3A 3ABMC 3U8VA 4EHPA 3Q5XA 1XNRT 2IIUA 2DCFA 3H2UA 1UX5A 4AQFA 5L3QA 4ZS2A 5KXJA 4Q7CA 5T3WA 5CB4E 5J0ZA 2VCBA 4UDVA 4J30B 2WDQA 4E0IA 4JYAT 5JDQA 3CEXA 5AQHB 2WMNA 4AKIA 1KU2A 1Z7Qc 2LHRA 2X0YA 3GN5A 2ZM6T 2H8AA 5HCJA 2V3CC 3NWIA 3P4WA 2KZ7B 3GM2A 4NUVA 1ZHCA 3EUHA 4U7YA 5AC5A 3U78A 3VU7H 2VQFT 3OEOA 2R7TA 4YSZA 3AG3C 3QVZA 4WNKA 4DO0A 3PDYA 3HL6A 2R7UA 3NMKA 3GN5B 4IREA 1ZOYA 1JMWA 3UNGC 2WSSV 3ZT6A 4JW1A 2VKHA 2CDQA 2X68A 5AQGB 4IE0A 1BR0A 4XWJA 3QW1A 3FOOA 3RVYA 5ABEA 3AAEB 4CDVA 3A5XA 4LMKA 2R05A 3BK9A 4MTGA 2NTYA 3SZRA 1FMVA 5ABHA 5J2TE 3NZPA 5KYYB 3IQTA 2BBHA 4CQIA 1KFYA 3AGUA 1SR2A 4YSYA 1N1CA 3C51A 2CMRA 2ZM0A 5LG3A 2B76A 4DR5T 5DVWA 2HUJA 4PK5A 4OYJA 2WVNA 2OG2A 1RCPA 2CXLA 2VURA 3NYLA 1D0ZA 3A9CA 2Q7RA 5DQZA 1VYIA 2NW7A 2IAKA 4KC9A 4KBMB 1U0BB 2XQ5A 4NXMT 2LRKA 4QKNA 2PFVA 2NUTA 4O6MA 1SZIA 3FHNA 1QUUA 4X65T 4Q4ZF 4LDRA 3TOLA 5LB7B 2X9WA 1RKCA 4BAYB 5FXVA 3JSZA 3JAEA 4P09A 3RKGA 5HAXA 3ZPOA 2DWGA 1N32T 1OXBA 3EZHA 3N24A 4U5BE 4U5HA 2WY2A 256BA 3MX3A 4G7HF 2NUTB 4H9NC 2I6HA 3I1AA 4UV9B 2KQ9A 2A6EF 4Q25A 3HKDE 3IQ5A 4K1OA 1JPNA 3HR0A 3HKKA 2KXPB 4B6IA 3AE9A 3GWNA 2FJAA 3K3NA 4P6IC 3RKOA 2I59A 2J62A 4UXNB 2XRHA 4DRIB 2LM9A 1V54C 5LHIB 1B68A 4J32B 1Y64B 4EGWA 1KNZA 2RPAA 3SXZA 4X5TA 3DE9A 1Z0PA 2AVKA 4ZEYA 1IW7F 2H7OA 2QGSA 2Z15A 3O1HA 5HEGA 3RRWA 3G50A 4LF9T 1MNEA 3ECSA 5FZTA 4WW0A 3GMIA 1OKKA 4YJ2E 4XQ1A 3F57A 2QNLA 3B71A 1HE1A 2YHSA 2R9RB 2CM0A 3PUGA 3GEIA 4YN0B 2Y3BA 3BRJA 1UURA 1V9DA 3KV5A 1XNQT 2H7VC 3GWHA 5ABFB 3Q7GA 3W2VA 3PUQA 4DR2T 4MNDA 1AUEA 1A7EA 2XQ9A 2CLYB 4GYSA 2HZ8A 2R7SA 5AQQB 2FUPA 3M4BA 1L3PA 2NSFA 2JQHA 1WCRA 3I9WA 4BJ1A 4DV2T 4JI1T 2DLRA 4UEMA 5FXZA 2XQ3A 5HEJA 3AEEA 5HYAA 1XMOT 4JI0T 2GFHA 3AE3A 5LCYA 1PCXA 3AEFA 1HTJF 1CPRA 2OQMA 5JDNA 2VKJA 2YLGA 4CS8C 3T9OA 3PUYF 4RBNA 3Q9DA 4DR4T 2LOSA 1E85A 3AG4C 4CN6A 4OINF 4JI8T 3HNKA 4L9IA 3DD7A 4Z9IA 3FDQA 4ILBA 1A7DA 3A8YC 1WATA 3EZIA 2LFFA 3KV9A 2Y8DA 4TX5A 2HFIA 5E3AA 3DP7A 4G2AA 3LK42 2XLWA 2V6XA 2EILC 3EJNA 2OCCC 1YA9A 3RKOF 4EEBA 5DS5A 1T6QA 4LERA 2LE8A 4O7GA 4E7ZA 1WWPA 2E9XA 5LGTB 1JPJA 2YDSA 1U4QA 1KNRA 5TJ5E 5DQWA 2X51A 4JI5T 3MA9A 2XAGB 5DQVA 2WB7A 1OCOC 3ZN0B 4LACB 2XLDA 2QYWA 2LEHA 3EDUA 4Z8XA 2E9XB 3C8GA 1OXZA 3QNUA 4DV5T 4JCZA 1SF8A 1H9TA 1XZYA 2CYDA 3ZCJA 1EQ1A 2MPKA 1IZNB 3JTLO 2J7PD 2GWWA 3VF0A 4JTCB 2XQ7A 4YLHA 2TMVP 3HJCA 4DNDA 1E7PA 3OPCA 2B0HA 4AL0A 4IRUA 4C91A 3VR8A 1S94A 4TV8E 4HFKB 5EZYE 3LS1A 4WBOA 3C64A 2N9DA 1F1MA 3P50A 5BUOA 2QY9A 4MHCA 5IHYA 5JDLA 2OKUA 3VYWA 2P9BA 2KWIB 3ZTMA 3B0VC 4DRHB 5EK2A 1O3UA 3A11A 2VB6A 5KDMC 4CI3B 2ZPAA 5TAOA 2L6HA 4IWBA 5E33A 1NG1A 2QLAA 1YKEB 3CQGB 3NKEA 1AEPA 4AQFC 3U2MA 2UUCT 4LLEA 3RIPA 2VK9A 1TFKB 4NTBA 5LMNT 3M65A 5A6BD 1HS7A 2O9XA 3T6JA 3DXJF 1QVXA 3DE8A 4NY3A 3UQ7A 3ONJA 3WHNA 4TWFA 2E8IA 3K8PC 5DQTA 5CJ5A 2JMHA 2R25A 4NCQA 4HGAA 3UGPA 3H37A 4QX8B 5HEOA 3K1IA 2V6YB 3DZAA 4QXHB 3JRMO 5AQUB 2BDEA 5AQMB 5LJMA 3GA8A 3H3MA 3HI2A 3J7Yq 1FEWA 2VKOA 5HXEA 5L3BB 2W62A 4X20E 4R32A 3WODF 5JLIA 5CA1E 3I4UA 2E2AA 1OXKA 1TR2A 4HWCA 3EABA 4GIWA 4O79A 4Z9HA 3UMHA 3QVYA 4IDZA 1KNYA 2VASA 2HKVA 4OIRF 2FJBA 3T6BA 4IE6A 4EV6A 1ST6A 1SE7A 1LVKA 4TZ4C 1U89A 2JMKA 2E5LT 2EIKC 1C17M 4J7YA 3JAFA 3DAFA 2WU5A 1HNXT 5CIVA 4I50E 2HPJA 2NUPB 1LS4A 3RQEA 1J5WA 4CSAA 3FZHB 4AX2A 3AA6B 4DOZA 3KFWX 3ZMUB 3SP1A 3V5UA 1IBKT 2WBLA 1GGQA 2YU1A 3B0PA 4DUZT 2KMFA 5EK0A 2XSAA 1VCTA 4GKJT 4G63A 2PJQA 3RYLA 4H63V 1W2WA 3GM1A 1AVOB 2HV7A 3O1IA 2WP9A 3AXJA 4CN4A 2CNWA 3FXHA 4IGUA 4JC7A 3T4RA 3LLIA 5JP7A 4OYKA 3Q6NA 5LGNB 1YXRA 1E1HB 2HHHT 3LUTB 2IMLA 3B13A 2IXMA 3TJ6A 3UQ4A 4U31A 3KVBA 3IBPA 2XQ6A 1ZHYA 2AWYA 1RJ9A 2X9HA 3AECA 3MYFA 2A0UA 3UU4A 5L3DB 4QH1A 1OW6A 2RA1A 2WS3A 3CQZA 3PE0A 3ZQVA 5FVKA 3G06A 3P4QA 5M4YA 5L0GA 2H89A 3AA0B 3K3QC 3QOFA 3NRHA 1MNDA 3EQLF 4UR9A 2J0WA 3C50A 2JQKA 4C7OA 3H65A 2D5UA 4IAQA 3PURA 3I0OA 3R84B 4BJ5A 4JE9A 4UIGA 2BG9A 5E2QA 2NOXA 3WI3A 3GEHA 3SRZA 2V5DA 4CZZB 2KLQA 3B0UX 2RSEB 2WDRA 5BMVE 5A6JA 1YDIA 1OEDB 4H9PC 1WGWA 1XDOA 1DU2A 3DI5A 2ODUA 3GM3A 1W9RA 4JEAA 4JKVA 2BG9B 4HFFB 2UXCT 1BDJB 3O10A 1HR0T 3NDBB 1WYCA 2YLIA 1W09A 1LPEA 3O4XE 4G78A 3SNHA 5JUAA 2WMOA 2YLDA 2VQET 5CA0E 2XS1A 2HMZA 1GS9A 2CHOA 5L0HA 4MTOA 1FFTC 2UUHA 3UUNA 3UMKA 5HCMA 2LT3A 1OR3A 4IB4A 1T8BA 1H9GA 2YVKA 3AVRA 5EHHA 3C4XA 2WZGA 4YSXA 4EIWA 4B6XA 2IM8A 1OKKD 2UU9T 3GANA 3Q5EA 3RQGA 1TFOB 4EB6E 3TLWA 1E83A 3AAAB 4I4TE 1LE2A 5L0JA 5FL0A 2KSFA 5A69A 3S84A 3JYHA 3E08A 3P4RA 4DXWA 3I5PA 4ZZCA 1D1BA 5LGUB 4YFSA 1V74B 3F47A 5HEUA 1Z8UA 3EI0A 4CS7A 3UU5A 2W4MA 4U5EE 2V1DB 3DJNB 4ZXLA 2GA0A 3NBXX 3ASOC 4P9FA 2CE7A 3U5SA 2RP4A 1MIVA 1BR1A 2BVMA 3JSEO 2Q3TA 3O1JA 5JDFA 3H2VA 3X1OA 4DBQA 5JR9A 2IUBA 4KP3C 3S29A 2WZFA 3P4PA 4DV1T 1QSDA 4YXDA 3IQCA 2D2SA 4HKAA 1W0BA 2Y3HA 3R7CA 3E9VA 4KNVA 5HXRA 3DJUB 2E9XC 3RYIE 4N06A 3N9MA 2WVQA 3TLSA 4TNVA 4A56A 1IBLT 4E7SA 4AE4A 4CI1B 4H9QC 1HF8A 4ZI2D 5JR9B 3JADA 3R2PA 3FHDA 2YK0A 1YQ3A 3NRYA 5L2LA 2D5RB 2W66A 1D0YA 1LS1A 3FZMB 1TWAA 4DV3T 1FTSA 1Y6DA 4J2CA 3PU8A 3DKAA 4AE4B 4KHZF 5KYXA 1U5PA 4JLEA 2WWUA 3RX6A 3RLFF 1WR0A 1ZEEA 3AE1A 4PJMA 3AVSA 2BS3A 3J06A 1FMWA 4XLPF 3N9LA 4YTPA 2VL0A 2YRFA 4EYUA 1UCUA 4JIOA 2E9XD 2Z6EA 2HPLA 1JR8A 3LBXA 4XEFA 3MFNA 4U2YA 1HCIA 2V7JA 1NENA 4DJ9A 1FJGT 3Q5DA 1YJGA 3ZT5A 2YWAA 1FR0A 4KHPT 1S35A 2OJED 1WR6A 3GODA 3QUJA 1A0BA 3ZT7A 3QMKA 4H9SE 1UFBA 1RXQA 1O5HA 3UU6A 2ZXWC 5COFA 3LBXB 2XQ8A 5L0FA 1IAPA 2BZBA 3O55A 4BA9A 2MTQA 1KNPA 2M6BA 3L8RA 1E2XA 2K3WA 3AB3B 4A2NB 3C4WA 1M2VA 4B3TT 1C03A 3RH3A 2HV6A 4OD5A 2YINA 2X0HA 4X1KE 1VOMA 4JRZA 1RKEA 4Q5SF 2SPCA 1ZU5A 3V5ZA 2EINC 3FB2A 2XAJB 3MYIA 3RRCA 4BJ6A 5CI8A 2IW5B 4QXBB 3CIRA 1D1AA 4G7ZF 3LEVA 3SEOA 4DV6T 1HMDA 4ILAA 3IF8B 3K1IC 2XM2A 4YJWA 2XLMA 1KTMA 2P7VA 5E3CA 2A2FX 5AQTB 5D91A 5GPGB 1ZU4A 3U9MA 4YJ3E 1TQGA 2UXDT 5B1AC 2H7BA 3VR9A 3AE7A 4EYYR 4E18A 3FOPA 1D1CA 3KVAA 3ZDLA 1HX8A 4W8PA 4N4WA 4CDAA 3L39A 2Q9QA 4YT4A 4FX5A 1IZMA 2LCHA 4F8HA 4XBFB 2EIJC 3OYXA 2M4EA 2OJQA 1MMNA 2CCQA 1FAPB 3ZMVB 3HKEE 2KYHA 3RF1A 5T1DB 5CI9A 3CKDA 2P61A 5JS5A 3IHUA 1MIYA 2DI3A 3RQFA 3UTKA 2LRLA 3MK7C 3OYZA 4FWVA 4BEMJ 2G62A 5LBMA 1VRBA 2Q9QB 3CVRA 3OTOT 3LDQB 5FL1A 3U0CA 2PG8A 4O4HE 2K9AA 3VAYA 2KWHA 2IXPA 5HV9A 4UVBB 4LF5T 2HH7A 3SXKA 4TN7B 2L9QA 2MYSA 2DI4A 4CSAC 1YA7O 5L4EA 2KGOA 2ASRA 1OR2A 3ONLC 5H6QB 2L3LA 5FVLA 4AKLA 5CGMA 3KYJA 4L6RA 4YT5A 3L8JA 3RIUA 2BL2A 1APCA 4XPWA 1PV3A 3CWZB 4QH5A 2LSJA 3PDMP 2A1DD 5JRCA 5L3EB 2YEVA 5AC4A 2CHNA 1N34T 2PX0A 2X0LB 3O39A 2GAQA 4P1NA 4QX7B 3C63A 3PUWF 5KYWA 1KK7A 4NTAA 4U5GA 3VRCA 3RQWA 3L1MA 5CFBA 3MACA 1YYJA 4B3RT 4COFA 4UVAB 2XSBA 4NUUA 4U7IA 1SA0E 2NTXA 2HS5A 2PBIA 2ZXRA 3ESLA 2XAQB 2OU6A 2LD6A 4NC3A 5C3JA 5L4HA 2XLEA 2W4XA 1XMQT 2WAUA 2OEXA 2CW0F 3LNRA 5B1BC 1G73A 1OEDC 3BQIA 4HFVA 1X79A 5LHGB 1VTMP 3IQ6A 1PD1A 4QDLA 5HSWA 2WM9A 4ZOLE 3VRAA 4BJ5C 2YZSA 2L6FA 4K0DA 2BG9C 1Q0KA 4YT2A 3KH2A 4MVUA 1XZQA 1M57C 4EEDA 1JAFA 3FAPB 3C98B 1YW0A 3ZSSA 4XZCA 1NEKA 4CX9A 2CCYA 5FXXA 5KMGP 2A68F 1BBHA 2W4BA 3DWWA 5C2TA 4HFEA 3D0TA 2KK1A 3ZC1A 3IHRA 2BKOA 2CGEA 3TLTA 2YKZA 2BC5A 3V5YA 1WOLA 1N33T 4B3MT 1G5ZA 2XM0A 3SS1A 2YL3A 3B29A 1GQAA 3B9QA 4GK5E 3RI5A 4EBBA 2H88A 4C3EA 2BBJA 2Q00A 5L3VA 2E5VA 2AE9A 3TLUA 3M1CB 1E86A 4MLKA 2CXDA 3N9NA 1Z63A 2PBEA 3N5LA 1TWGA 5F3JA 1CGOA 4J7TA 1C02A 3U8PA 3ZYMA 4ER9A 2D4UA 3QK6A 3N2GE 4DR7T 4MQ9F 3RQUA 2XTLA 5LG4A 2X9YA 3WAKA 1HNZT 4MALA 2M64A 4P0AA 2YDRA 4IDNA 4NTFA 4DV7T 3HA4A 3ZN1B 2H3RA 2IBFA 1ZV4X 1E2AA 2J45A 1Z3IX 2QE9A 1ORSC 3W4YA 2LIGA 2R7VA 1A7VA 2CPTA 2CBIA 3VKGA 5AQVB 2K5BB 4NXNT 4O4JE 2QUPA 3LAYA 3IA3A 4YT8A 2A0BA 3HNJA 4JVSA 4CXWA 3C8GB 3MXZA 4LFCT 2LOPA 2XPKA 3QB5A 2BVLA 3AE8A 1HX1B 2I0MA 1YVIA 4JI4T 4UELA 3K1SA 1WN0A 1SMYF 2VH3A 3ZSUA 3S9OA 5JR9C 4A4AA 4K0KT 5AQPB 5A6AA 4E17A 1T5OA 1CGNA 3AEGA 3V5XA 4IDPA 2VL8A 3EGDA 2IOQA 2VCCA 2DWKA 3A7MA 3CX7B 4LMLA 2LSGA 5BQIA 1NU7D 4TNWA 3JYYA 2XAHB 4BG0A 5LYJE 5HWYA 5LJNA 3FXDB 3L8IA 4QHOA 5B3IA 3EHMA 1LKXA 2XLOA 2VVSA 3JC6C 4JI6T 3KV6A 3EHZA 5F5WA 5EGYA 2JQ9A 5KYNA 3CX6B 4C3DA 1Q0MA 3T1YT 4PJLA 3K33A 3TJ5A 3AEBA 4HFBA 4CIHA 5J1GA 4DR3T 3UUBA 5ABGA 4YL0A 4WBNE 3RVZA 4HWIB 2YOEA 3NMJA 2IHR1 3V7OA 4LLCA 4NIQA 1Q0DA 2C5JA 2XHEB 5DABA 3B5MA 2EIMC 4V1Av 3I9YA 4KUMB 2G0UA 1I4YA 2YDQA 2BE5F 3NG1A 3AE5A 1VLTA 3VM6A 5LMUT 1R8IA 3JC6D 4DVYP 1JNZA 4TWHA 3C8ZA 4GK0E 5FP3A 2XLHA 3NMIA 1V4AA 1ZVZA 2ODVA 2A9UA 3SOLA 2J9VA 2XUEA 4OX9T 1VB5A 3AGTA 3N0TA 4GOUA 5LNKA 4JI3T 1MMDA 3EH2A 4HWFA 4KMCA 3I5QA 5FY1A 2VCAA 1HW2A 5L3FB 1S05A 1YZCA 2FGYA 4ADZA 4X1IE 3ZYLA 1BR2A 4MS2A 3AJMA 3KINB
chains in the Genus database with same CATH topology
4PFOA 3N2ZB 2PP4A 1VK5A 4TV9E 4CXYA 2QTVA 3DMDA 3W2WA 5F8PA 1NZEA 3QC9A 3EGXA 4EOZB 4IIJE 4JEUB 4EWCA 3PTRB 2KNHA 3S0XA 2V7KA 2DHRA 1FIOA 2A72A 2UXXB 4JJFA 1VMAA 2Q9QC 3RYHE 4GYRA 1LRZA 2UXNB 2W00A 2ZM8A 4PK6A 5JREA 1HFAA 3DTOA 4O2AE 2XXAA 4DVDA 3OA1A 2QA7A 2JPFA 4ISSA 1IJ6A 1O87A 3R6NA 2V7IA 1RJ9B 3ZMTB 3UULA 4FI5A 5KX5E 4AKHA 2CWOA 2Q9QD 4H9RC 2Q9AA 4I44A 4G7OF 3HKBE 5FCLA 4N78D 3NYMA 4C7OB 3E22E 3FBZA 5GONE 4GEHA 2YEVC 2NWBA 5JDHA 3B57A 5EK4A 3I0QA 1US7B 5HXSA 3KBTA 3ZC4A 4XTKA 2Y3GA 3IEEA 4U72A 3AA7B 2DGJA 1Z23A 2J7PA 1T98A 1TKNA 3H3AA 4DMWA 4UV8B 4ULWA 3ZMZB 2J0XA 2PFDA 3W8HA 3OWTA 2N1GA 1J8MF 2IC9A 5LA6E 3DM5A 3ZLIA 3ZVRA 2EHOA 3CQCB 5JH7E 3ETVA 3ZCIA 2Y3DA 4O4LE 2W45A 3OJAA 4FESA 1O3XA 5T3TA 2CEAA 5FY7A 3FAJA 3MLGA 1WRDA 3ZMSB 4C3BA 3EHNA 3TKLB 3QZCA 5LOVE 4PW8A 4JZAA 3VHLA 4ERRA 4PK4A 3CX8B 3FBLA 2ES0A 3KKBA 3CPZA 3F31A 1ZHXA 4O4IE 5DS6A 2NG1A 3WAJA 5J2UE 3FXEB 2DYSC 3EVYA 3SYNA 3F2EA 2LJLA 2XQYA 4HE8A 3F46A 5D92A 4QI0A 5FY0A 5KYXB 4K0UA 3AQCA 2Q9BA 5LP6E 3RC8A 1Z6AA 2ZMAA 1FFHA 2J9WA 1MMAA 5KYYA 3EPVA 3CSKA 1OCCC 2W0GA 5B3SC 5HXHA 3L0IA 2MBGA 2K24A 3AG2C 1D0XA 4TUYE 5IY5C 4ILUA 1M2VB 4P0BA 3AG1C 4JURI 4L5GA 1NU9C 3W8IA 2M67A 1M56C 4DVZA 2VWAA 4IE7A 3ETUA 3ZC0A 2L81A 3UFEA 1ZHWA 2Y48B 3LESA 4CBEA 3PU3A 2GK9A 4QI2A 3UMIA 4ZI7E 3NZQA 3O6XA 4DMVA 1AJ3A 3LG7A 2E87A 3LS0A 2FFHA 1QZXA 2LSYA 1IJ5A 2CA5A 3KMIA 3EH1A 5FMNA 3ONXA 3Q7LA 4OFZA 2ZLYA 3VKHA 2YU2A 2W61A 2ZM2A 2X66A 2JRKA 4HEAJ 2KW3C 4M63A 4YWQA 2R7XA 1HG2A 3ANWA 3W15B 4OK0A 3N9QA 4ZLCA 4HEAA 1TWHA 1MMGA 4ISTA 4BJMA 2XASB 3POVA 2CXFA 5HXCA 4RD9A 2IXNA 3ANWB 5H6RB 4CS9A 2R7QA 3OKQA 1UX4A 4PAGA 4AKGA 5A1LA 2X67A 4F6RC 5JRCB 2G3KA 4KNWA 3E70C 4OD4A 2W63A 2A3DA 3LJCA 5KYWB 5L3CB 3FVYA 4PFPA 2J9UA 5JQGE 5EK3A 2L8KA 2ACXA 3ITFA 5E0OA 3EDVA 2CNWD 4QXCB 3MZKB 4ANJA 3HTKC 1CUNA 4AQGA 3AAIA 4U5FE 2JQQA 3Q6MA 4DBRA 1OWAA 5LHHB 4PJNA 4H9OC 2N2NA 3Q5WA 3PHF2 4KI2A 3N2OA 2LHNA 5JVDE 1HG5A 2B0JA 5C8YE 3RC3A 3CZ6A 2PX3A 4OIOF 4FJOA 4EXTA 4YHJA 4O6NA 2DNXA 5F5FA 2P6VA 2VKDA 4WJ0A 3MKDA 2R7WA 3UT5E 3AA1B 4X1YE 3J9X1 2V26A 5DLJA 2LSKA 2A69F 3DJBA 2D0TA 3K1HA 3ZIBA 3RFYA 2D0UA 4AI6A 3WG7C 2MOZA 3NYJA 2IC6A 4HN9A 3T8OA 2Q9CA 1OCZC 3CMLA 2XAFB 2L9JA 3KV4A 3DM9B 4BJTA 2KINB 3KL4A 4JJGA 3S27A 4QWNB 2EHOC 4EAHA 3U3IA 3NRXA 4I55E 2IYLD 4PJJA 4M1PA 1BR4A 3AQBA 4G0HA 3L3PA 4X0RA 5ADXL 4I3MA 4F4BA 1VYKA 2R7RA 3X2QC 3LFMA 4O6YA 2DYRC 1MIWA 3RYCE 2OA5A 1ZHTA 2LSIA 2EHOD 5HWXA 3EGDB 2X9XA 5LBQB 4CXXA 2C5KT 5IYZE 1WYBA 3LLKA 4MFRA 4I1OB 2G3VA 2WZLA 2KJGA 1EZ3A 4ASKA 1M2OA 3O9XA 1J8YF 2R7OA 3EG9A 4IHJE 4AK9A 2C04A 3ASNC 4OHFA 5JDGA 2WVOA 4BEJA 4CI2B 3JRTA 2Y39A 3EG9B 2NP9A 4IJJA 3ZJ1A 4I43B 5LXTE 1NAFA 3UGOA 3E0ZA 5FXWA 4IAOA 4ZI3C 5KYUA 5FNVE 4HE8D 2MWQA 4JUYA 2ZXPA 3UUMA 3PUAA 2NUPA 3ZG1A 4OIPF 4HTEA 2C5IT 4C90A 2NW8A 3K3OA 1Z5ZA 2NW9A 5KYUB 1OCRC 3PMRA 3K66A 2Y6XA 3UR3C 3HLZA 4ZI3D 3ZJ2A 2XL4A 1YD8G 1H7CA 3EGXB 3RYFE 2WL8A 4I1MA 3SWHA 2KNDA 4KBLA 5F5HA 1ZYRF 4U5CE 2IXOA 4EZHA 5JDMA 2V7LA 3CQXC 4OIQF 3KBUA 4AXPA 4XAXB 4AKRB 1ZHZA 1LVFA 3P8CD 3JCUQ 2J46A 4JEHB 4ZHQE 3OBVE 2XXAB 1S7ZA 4IE4A 4K7BA 4H63H 3K6BA 4W8KA 4XLNF 1SHZC 2Y69C 4PNIA 4CS8A 2C03A 4CS9C 4JCHA 4O2BE 4EZ4A 1NWMX 2J1DG 3LK3B 2W9YA 1B7TA 3N9OA 2CLYC 3TD7A 4BJNA 5FYMA 4ZLDA 3LK2B 3PUSA 4UVCB 2XSEA 3V5SA 1TWCA 2JD3A 3S28A 2JJ9A 3N9PA 3ABKC 1WLXA 5DS4A 3P7IA 3C4ZA 2K48A 3ABLC 1G8XA 4GYTA 3BQKA 3UUXB 3ZEFB 3N2KE 3RPUA 4L0RA 3MJXA 1ZKEA 3KDSE 2I8BA 4U5DE 1PD0A 4MBQA 2KT9A 2C0SA 3BQLA 2V7MA 3K7DA 2ZXOA 3NKDA 5L3GB 3EFOA 4RDAA 2PF4E 2A6HF 3L09A 1YKHB 2LSEA 5ETWA 3Q2MA 4H4KC 4ZI2C 3DAGA 4O8SA 4UF0A 2B1EA 2EHOB 5AFUL 3EFOB 3JT1A 3HKCE 5DJQC 4U74A 3ZYKA 3L34A 2CWYA 1QLEC 3S4UA 4IE5A 4UF0B 3LJBA 1V55C 4ZS3A 3ABMC 3Q5XA 2DCFA 1UX5A 4AQFA 5L3QA 4ZS2A 4Q7CA 5T3WA 5CB4E 4J30B 5JDQA 2WMNA 4AKIA 1KU2A 2LHRA 3GN5A 2V3CC 2KZ7B 4NUVA 1ZHCA 3EUHA 3U78A 3VU7H 3OEOA 2R7TA 3AG3C 4WNKA 4DO0A 3PDYA 3HL6A 2R7UA 3GN5B 3UNGC 2WSSV 4JW1A 2VKHA 2CDQA 2X68A 4IE0A 1BR0A 4XWJA 3AAEB 3A5XA 3BK9A 2NTYA 3SZRA 1FMVA 5J2TE 3NZPA 5KYYB 4CQIA 1N1CA 3C51A 2CMRA 2ZM0A 5DVWA 4PK5A 4OYJA 2WVNA 2OG2A 2CXLA 3NYLA 1D0ZA 5DQZA 1VYIA 2NW7A 2IAKA 4KC9A 4KBMB 4QKNA 2PFVA 2NUTA 4O6MA 1SZIA 3FHNA 1QUUA 4Q4ZF 2X9WA 4BAYB 5FXVA 3JSZA 4P09A 5HAXA 3ZPOA 2DWGA 3EZHA 3N24A 4U5BE 4U5HA 3MX3A 4G7HF 2NUTB 4H9NC 4UV9B 3I1AA 2KQ9A 2A6EF 3HKDE 1JPNA 3HR0A 4B6IA 2KXPB 3K3NA 4P6IC 3RKOA 2I59A 4UXNB 2XRHA 2LM9A 1V54C 5LHIB 4J32B 1Y64B 1KNZA 1Z0PA 1IW7F 2H7OA 2QGSA 2Z15A 3O1HA 3RRWA 1MNEA 3ECSA 4WW0A 3GMIA 1OKKA 4YJ2E 3F57A 2YHSA 2CM0A 3PUGA 4YN0B 2Y3BA 1V9DA 3KV5A 3Q7GA 2H7VC 3GWHA 3W2VA 3PUQA 4MNDA 2CLYB 4GYSA 2R7SA 3I9WA 4BJ1A 2DLRA 4UEMA 5FXZA 5HYAA 2GFHA 5LCYA 1PCXA 1HTJF 5JDNA 2VKJA 4CS8C 4RBNA 3Q9DA 2LOSA 3AG4C 4OINF 4L9IA 3DD7A 3FDQA 3EZIA 3KV9A 2Y8DA 4TX5A 5E3AA 3DP7A 4G2AA 3LK42 2EILC 3EJNA 2OCCC 3RKOF 5DS5A 4LERA 2LE8A 4O7GA 4E7ZA 2E9XA 5LGTB 1JPJA 1U4QA 5DQWA 2X51A 3MA9A 2XAGB 5DQVA 2WB7A 1OCOC 3ZN0B 4LACB 2LEHA 3EDUA 4Z8XA 2E9XB 1OXZA 1SF8A 3ZCJA 1IZNB 2J7PD 4YLHA 3HJCA 4DNDA 4IRUA 4C91A 1S94A 4TV8E 4HFKB 5EZYE 3LS1A 4WBOA 3C64A 2N9DA 5BUOA 2QY9A 4MHCA 5IHYA 5JDLA 3VYWA 2P9BA 2KWIB 3B0VC 5EK2A 2VB6A 5KDMC 4CI3B 2ZPAA 5TAOA 4IWBA 5E33A 1NG1A 1YKEB 3CQGB 3NKEA 4AQFC 4LLEA 3RIPA 2VK9A 3M65A 1HS7A 2O9XA 3T6JA 3DXJF 4NY3A 2E8IA 3K8PC 5DQTA 2JMHA 4HGAA 3UGPA 3H37A 4QX8B 3DZAA 4QXHB 2BDEA 5LJMA 3GA8A 3HI2A 1FEWA 5HXEA 2VKOA 5L3BB 3J7Yq 2W62A 4X20E 3WODF 5CA1E 3I4UA 1TR2A 4GIWA 4O79A 3UMHA 4IDZA 2VASA 4OIRF 3T6BA 4IE6A 1ST6A 1LVKA 4TZ4C 2JMKA 2EIKC 3DAFA 4I50E 2HPJA 2NUPB 4CSAA 4AX2A 3AA6B 4DOZA 3KFWX 3ZMUB 3SP1A 3V5UA 2WBLA 2YU1A 3B0PA 2KMFA 4G63A 2PJQA 3RYLA 4H63V 1W2WA 2HV7A 3O1IA 2CNWA 4IGUA 3T4RA 3LLIA 4OYKA 3Q6NA 5LGNB 1E1HB 3B13A 2IXMA 3KVBA 3IBPA 1ZHYA 1RJ9A 2X9HA 5L3DB 2RA1A 3CQZA 3PE0A 5M4YA 3AA0B 3NRHA 3K3QC 1MNDA 3EQLF 2J0WA 3C50A 4C7OA 3H65A 2D5UA 3PURA 3I0OA 3R84B 4BJ5A 4UIGA 5E2QA 2NOXA 3WI3A 3SRZA 4CZZB 2KLQA 3B0UX 5BMVE 4H9PC 1WGWA 2ODUA 4HFFB 3NDBB 1WYCA 3O4XE 3SNHA 2WMOA 5CA0E 1FFTC 3UUNA 3UMKA 2LT3A 3AVRA 5EHHA 3C4XA 2WZGA 4EIWA 4B6XA 1OKKD 3GANA 4EB6E 3AAAB 4I4TE 3JYHA 3E08A 3I5PA 1D1BA 5LGUB 4YFSA 3F47A 4CS7A 2W4MA 4U5EE 2V1DB 3DJNB 3NBXX 3ASOC 2CE7A 2RP4A 1MIVA 1BR1A 2BVMA 2Q3TA 3O1JA 5JDFA 3X1OA 4DBQA 5JR9A 4KP3C 3S29A 2WZFA 1QSDA 2D2SA 4HKAA 2Y3HA 3E9VA 4KNVA 5HXRA 3DJUB 2E9XC 3RYIE 4N06A 3N9MA 2WVQA 4A56A 4E7SA 4AE4A 4CI1B 4H9QC 1HF8A 4ZI2D 5JR9B 3FHDA 2YK0A 3NRYA 5L2LA 2D5RB 1D0YA 1LS1A 1TWAA 1FTSA 4J2CA 3PU8A 4AE4B 5KYXA 1U5PA 4JLEA 2WWUA 3RX6A 1ZEEA 4PJMA 3AVSA 1FMWA 4XLPF 3N9LA 4EYUA 1UCUA 2E9XD 2Z6EA 2HPLA 3LBXA 1HCIA 2V7JA 1S35A 1WR6A 3GODA 3QUJA 3QMKA 4H9SE 1O5HA 2ZXWC 3LBXB 1IAPA 2BZBA 4BA9A 2MTQA 3AB3B 4A2NB 3C4WA 1M2VA 3RH3A 2HV6A 4OD5A 2YINA 4X1KE 1VOMA 4Q5SF 2SPCA 1ZU5A 2EINC 3FB2A 2XAJB 4BJ6A 3RRCA 5CI8A 2IW5B 4QXBB 1D1AA 4G7ZF 3LEVA 3SEOA 3IF8B 3K1IC 4YJWA 2P7VA 5E3CA 2A2FX 5D91A 1ZU4A 4YJ3E 5B1AC 2H7BA 4EYYR 1D1CA 3KVAA 1HX8A 2Q9QA 4YT4A 4FX5A 1IZMA 4XBFB 2EIJC 3OYXA 2M4EA 1MMNA 2CCQA 3ZMVB 3HKEE 5T1DB 5CI9A 3CKDA 1MIYA 3UTKA 3MK7C 3OYZA 4FWVA 2G62A 5LBMA 1VRBA 2Q9QB 3CVRA 2PG8A 4O4HE 2K9AA 3VAYA 2KWHA 2IXPA 4UVBB 2HH7A 4TN7B 2L9QA 2MYSA 2DI4A 4CSAC 2KGOA 5H6QB 2L3LA 4AKLA 4YT5A 3CWZB 2LSJA 2A1DD 5JRCA 5L3EB 2YEVA 2PX0A 2X0LB 3O39A 4QX7B 5KYWA 1KK7A 4U5GA 3MACA 4UVAB 4NUUA 1SA0E 2NTXA 2ZXRA 2PBIA 3ESLA 2XAQB 2WAUA 3LNRA 2CW0F 5B1BC 1G73A 3BQIA 4HFVA 1X79A 5LHGB 1PD1A 4QDLA 5HSWA 2WM9A 4ZOLE 4BJ5C 2YZSA 4K0DA 4YT2A 3KH2A 1M57C 3C98B 1YW0A 4XZCA 5FXXA 5KMGP 2A68F 2W4BA 3D0TA 3ZC1A 3IHRA 2CGEA 3SS1A 3B9QA 4GK5E 4EBBA 4C3EA 5L3VA 3M1CB 4MLKA 2CXDA 3N9NA 1Z63A 3N5LA 1TWGA 5F3JA 3ZYMA 3QK6A 3N2GE 4MQ9F 5LG4A 2XTLA 2X9YA 3WAKA 4MALA 4P0AA 3HA4A 3ZN1B 2H3RA 1ZV4X 2J45A 1Z3IX 2R7VA 3VKGA 2K5BB 4O4JE 3LAYA 4YT8A 4JVSA 4CXWA 3MXZA 2LOPA 2BVLA 4UELA 1SMYF 2VH3A 3ZSUA 5JR9C 2VL8A 3EGDA 2IOQA 2DWKA 3CX7B 2LSGA 1NU7D 2XAHB 4BG0A 5LYJE 5HWYA 5LJNA 3FXDB 4QHOA 3EHMA 1LKXA 3JC6C 3KV6A 5EGYA 5KYNA 3CX6B 4C3DA 3K33A 4PJLA 4CIHA 5J1GA 4WBNE 3V7OA 4LLCA 2C5JA 2XHEB 5DABA 2EIMC 4V1Av 3I9YA 4KUMB 2G0UA 2BE5F 3NG1A 3JC6D 4DVYP 4GK0E 5FP3A 2ODVA 3SOLA 2J9VA 2XUEA 3N0TA 4GOUA 5LNKA 1MMDA 3EH2A 4KMCA 3I5QA 5FY1A 5L3FB 2FGYA 4ADZA 4X1IE 3ZYLA 1BR2A 4BJ6C 3KINB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IEE A;  4YJW A;  3RH3 A; 
#chains in the Genus database with same CATH topology
 4PFO A;  3N2Z B;  2PP4 A;  1VK5 A;  2XJ7 A;  4TV9 E;  4CXY A;  2VVN A;  2YN6 A;  2QTV A;  4HWD A;  3DMD A;  3W2W A;  1DOW A;  2QVA A;  5F8P A;  1NZE A;  3QC9 A;  3EGX A;  4EOZ B;  4IIJ E;  4JEU B;  4EWC A;  3NVO A;  2WZI A;  4X64 T;  4LMJ A;  3PTR B;  4NPP A;  2KNH A;  3S0X A;  2V7K A;  3BEH A;  2DHR A;  1FIO A;  2FJD A;  5IUX A;  2A72 A;  2UXX B;  4JJF A;  1VMA A;  2Q9Q C;  3RYH E;  3JZ0 A;  5BQG A;  3AXJ B;  4GYR A;  1LRZ A;  1Y01 A;  2UXN B;  1T72 A;  2W00 A;  2ZM8 A;  4PK6 A;  5JRE A;  1HFA A;  1I94 T;  3DTO A;  4O2A E;  2XXA A;  1YYX A;  2LKG A;  4DVD A;  2M6I A;  3OA1 A;  2QA7 A;  3TUL A;  1M6T A;  4KX6 A;  2JPF A;  2PTF A;  3HNI A;  4ISS A;  3LNM B;  4E0H A;  1IJ6 A;  2BKP A;  3AE4 A;  1L7C A;  1O87 A;  3R6N A;  5AQR B;  2V7I A;  1RJ9 B;  2LQG A;  2YQY A;  3ZMT B;  3UUL A;  5A6K A;  2HSQ A;  4FI5 A;  5KX5 E;  4AKH A;  2KC3 A;  1YQ4 A;  2CWO A;  4DUY T;  2UUI A;  5AGF A;  2Q9Q D;  1T6I A;  4H9R C;  2Q9A A;  4I44 A;  1GM5 A;  1H7I A;  1SYQ A;  1HY5 A;  4A98 A;  4G7O F;  3HKB E;  3RIU C;  5FCL A;  4N78 D;  3NYM A;  2BS4 A;  4ZZB A;  4C7O B;  3LEO A;  3E22 E;  4IL9 A;  3SXY A;  3FBZ A;  4A97 A;  4FAP B;  5GON E;  3RIA A;  4GEH A;  2YEV C;  4MVM A;  2NWB A;  5JDH A;  4JTA B;  3PUZ F;  3B57 A;  1T9K A;  1QLB A;  5EK4 A;  2JIW A;  3I0Q A;  1K05 A;  1US7 B;  5HXS A;  4Z90 A;  3TLV A;  3KBT A;  4XPX A;  3ZC4 A;  4B3S T;  1N36 T;  4XTK A;  2Y3G A;  3IEE A;  4U72 A;  3IPM O;  3AA7 B;  1LIH A;  2DGJ A;  2XM4 A;  1UK5 A;  1Z23 A;  2J7P A;  1T98 A;  2WQY A;  1WTY A;  1K40 A;  1TKN A;  3H3A A;  2JX0 A;  4DMW A;  4UV8 B;  4ULW A;  2P0N A;  2L7A A;  3M3Z B;  3ZMZ B;  2J0X A;  1XZP A;  2PFD A;  3W8H A;  3KPH A;  3OWT A;  2N1G A;  1J8M F;  2IC9 A;  2NR4 A;  4HWH A;  5LA6 E;  4JTD B;  3DM5 A;  3ZLI A;  3ZST A;  2X0C A;  3ZVR A;  4DV0 T;  2HJ3 A;  2EHO A;  3CQC B;  5JH7 E;  3ETV A;  3ZCI A;  1K04 A;  1G4U S;  3U9J A;  2Y3D A;  4O4L E;  1J5E T;  1OW7 A;  1M62 A;  2W45 A;  3QW0 A;  3OJA A;  4FES A;  2V5C A;  1O3X A;  1EA8 A;  1JOG A;  1YZA A;  5T3T A;  3RHW A;  4MVO A;  4CIP A;  2CEA A;  5FY7 A;  3FAJ A;  3MLG A;  1WRD A;  3ZMS B;  1H6G A;  2FAP B;  1KEY A;  3TKL B;  3EHN A;  4C3B A;  3T6G B;  3QZC A;  4DV4 T;  5LOV E;  5COM A;  4PW8 A;  4JZA A;  3VHL A;  4ERR A;  4PK4 A;  3WAQ A;  3QB5 K;  3CX8 B;  4YL3 A;  4AIU A;  3FBL A;  2ES0 A;  3KKB A;  2FJE A;  1ZP0 A;  3AEA A;  3CPZ A;  3F31 A;  1ZHX A;  4O4I E;  5DS6 A;  2NG1 A;  3WAJ A;  2V8S V;  5J2U E;  4AQY T;  3FXE B;  2DYS C;  4AL1 A;  3EVY A;  3SYN A;  3F2E A;  2LJL A;  2OEV A;  2XQY A;  4HE8 A;  3F46 A;  5D92 A;  4MVS A;  4QI0 A;  4BJ6 C;  5FY0 A;  1YAU O;  5KYX B;  2EPL X;  4K0U A;  1HW1 A;  4EUK B;  2EPM X;  3AQC A;  2Q9B A;  3C8G D;  5LP6 E;  3RC8 A;  1Z6A A;  2IDO B;  2W2U A;  2ZMA A;  1FFH A;  2XS8 A;  2LFD A;  2J9W A;  1MMA A;  2BS2 A;  2EPN A;  5KYY A;  3EPV A;  2LKH A;  4U33 A;  3CSK A;  1OCC C;  2W0G A;  5B3S C;  5HXH A;  4YY3 T;  4LF8 T;  3L0I A;  2MBG A;  4CDY A;  2K24 A;  3AG2 C;  1D0X A;  3CAX A;  1MQV A;  4TUY E;  2JPU A;  4EBK A;  5IY5 C;  4N6C A;  1L0V A;  4LFA T;  4ILU A;  1M2V B;  4WGZ A;  3S90 A;  5L0I A;  5K0I A;  4P0B A;  2VC9 A;  3AG1 C;  4JUR I;  1RKE B;  4L5G A;  1NU9 C;  4DID B;  3W8I A;  2XZE A;  2J8W A;  4X62 T;  2M67 A;  1M56 C;  4DVZ A;  2VWA A;  4IE7 A;  5BQH A;  3U2L A;  3ETU A;  1LE4 A;  3ZC0 A;  2LP4 A;  2L81 A;  3UFE A;  1ZHW A;  2Y48 B;  3LES A;  2CBJ A;  4CBE A;  3PU3 A;  2GK9 A;  5JVE A;  4QI2 A;  3UMI A;  4ILC A;  1ZW3 A;  4ZI7 E;  3NZQ A;  3O6X A;  4DMV A;  1AJ3 A;  4WAB A;  3LG7 A;  2E87 A;  1SUM B;  2OV9 A;  3LS0 A;  2FFH A;  1QZX A;  2AU5 A;  3C7J A;  4LF4 T;  2LSY A;  5HEH A;  3US6 A;  4N6H A;  1CPQ A;  3FZL B;  1IJ5 A;  2CA5 A;  1UUS A;  2R02 A;  3KMI A;  3EH1 A;  4DR6 T;  4Z9J A;  5FMN A;  4WYV A;  3ONX A;  4IL4 A;  3Q7L A;  1ZZP A;  4OFZ A;  1JRA A;  2ZLY A;  3OVU A;  4GKK T;  3VKH A;  2YU2 A;  2W61 A;  2ZM2 A;  2X66 A;  2JRK A;  4HEA J;  2KW3 C;  4M63 A;  1R5I D;  4YWQ A;  3ZQY A;  3G4Z A;  3ABV A;  3PUX F;  2R7X A;  1HG2 A;  3ANW A;  3W15 B;  1UGO A;  4OK0 A;  3N9Q A;  4GQH A;  1OQC A;  4ZLC A;  4U9D A;  4HEA A;  1TWH A;  1ZW2 A;  1MMG A;  4IST A;  4BJM A;  5AQS B;  2XAS B;  3POV A;  2CXF A;  5JTG A;  2J9B A;  1EI7 A;  5HXC A;  4RD9 A;  2IXN A;  3ANW B;  2BKN A;  5H6R B;  4CS9 A;  5ABF A;  2AWC A;  1I5N A;  2R7Q A;  3OKQ A;  5JSL A;  1UX4 A;  4PAG A;  1QKR A;  4AKG A;  5A1L A;  2X67 A;  4JV5 T;  1NFO A;  2QRX A;  4F6R C;  4BPM A;  4YL1 A;  5IWA T;  5JRC B;  2G3K A;  3ATP A;  4KNW A;  3E70 C;  1W0A A;  3GOR A;  2GDC A;  4OD4 A;  2W63 A;  1BZ4 A;  4LDK A;  2A3D A;  3LJC A;  5KYW B;  5L3C B;  1IBM T;  3FVY A;  3T1H T;  4PFP A;  4KI0 F;  1R4T A;  2J9U A;  5JQG E;  5AQK B;  5EK3 A;  2PNO A;  1CGM E;  2L8K A;  2ACX A;  3ITF A;  5E0O A;  3EDV A;  2CNW D;  1WAS A;  4QXC B;  3MZK B;  4ANJ A;  2XM1 A;  3HTK C;  1CUN A;  4AQG A;  3RF3 A;  4X66 T;  2AP3 A;  4I0U A;  3AAI A;  3FZF B;  3M15 A;  1XDP A;  4U5F E;  2JQQ A;  3Q6M A;  3U3F A;  3FZK B;  4DBR A;  1OWA A;  5LHH B;  5AQN B;  4PJN A;  4H9O C;  2N2N A;  4MVR A;  3Q5W A;  3PHF 2;  2AXD S;  3JCF A;  4XEV A;  2YKS A;  4KI2 A;  3N2O A;  5AQI B;  2LHN A;  5JVD E;  3P4S A;  1HG5 A;  5FKY A;  2B0J A;  1YLM A;  5C8Y E;  3RC3 A;  3CZ6 A;  2PX3 A;  1M7K A;  3C62 A;  4OIO F;  2DL1 A;  4FJO A;  4EXT A;  4AIS A;  1ORY A;  4YHJ A;  1LI7 A;  1HE9 A;  4O6N A;  2DNX A;  5F5F A;  4LF6 T;  2P6V A;  2VKD A;  4WJ0 A;  4LF7 T;  5L47 A;  3MKD A;  4IDQ A;  1LI5 A;  2R7W A;  1ORJ A;  3UT5 E;  3AA1 B;  1NSG B;  2OOC A;  2XLV A;  4X1Y E;  4HFH A;  3J9X 1;  2V26 A;  4HFC A;  2MAW A;  2F4V T;  5DLJ A;  2WU2 A;  4YK5 A;  2LSK A;  5COG A;  2A69 F;  2P1A A;  3DJB A;  2D0T A;  3K1H A;  3ZIB A;  3RFY A;  2D0U A;  4AI6 A;  3WG7 C;  3SXM A;  2MOZ A;  3NYJ A;  2IC6 A;  3UFG A;  4HN9 A;  1YAR O;  2ZD9 A;  3MBG A;  3T8O A;  2Q9C A;  1I6Z A;  1OCZ C;  3CML A;  2XAF B;  2L9J A;  3KV4 A;  1Q0F A;  3DM9 B;  2W67 A;  4BJT A;  2KIN B;  1QSP A;  3X1D A;  3KL4 A;  4JJG A;  3S27 A;  2ETS A;  3CK6 A;  4QWN B;  2EHO C;  4EAH A;  3PJA J;  3U3I A;  3NRX A;  4I55 E;  2IYL D;  4PJJ A;  4M1P A;  3ZKR A;  1BR4 A;  1U6H A;  3PJA A;  3AQB A;  1EKY A;  3RGL A;  4G0H A;  3L3P A;  4X0R A;  4JI2 T;  5ADX L;  1NBB A;  4I3M A;  4IDO A;  4F4B A;  5JT4 A;  1VYK A;  2R7R A;  3X2Q C;  4U9E A;  3LFM A;  4YHH T;  4O6Y A;  4HFD A;  2HN2 A;  3GWL A;  2HJM A;  2DYR C;  1MIW A;  3RYC E;  2OA5 A;  1ZHT A;  2LSI A;  2OLT A;  2EPK X;  2EHO D;  4IAR A;  5HWX A;  4MW8 A;  3EGD B;  4WZX A;  4LFB T;  1KF6 A;  2X9X A;  2YL0 A;  5LBQ B;  4D4X A;  4CXX A;  2C5K T;  5IYZ E;  1WYB A;  3LLK A;  2CRB A;  4HFI A;  1I4Z A;  4MFR A;  4I1O B;  2G3V A;  2XQA A;  2KJG A;  2WZL A;  1EZ3 A;  2V6Y A;  2HSB A;  5JRA A;  2KSR A;  4ASK A;  4U2Z A;  3AE6 A;  1M2O A;  3O9X A;  1J8Y F;  5AQF B;  2R7O A;  3EG9 A;  4IHJ E;  4AK9 A;  4CN1 A;  4TWD A;  2D9D A;  2C04 A;  2J47 A;  3PUV F;  2YL1 A;  3ASN C;  2F22 A;  4OHF A;  4D4N A;  5JDG A;  2WVO A;  4BEJ A;  4JI7 T;  4EKW A;  2UUA T;  4CI2 B;  3JRT A;  4PR9 A;  2Y39 A;  3EG9 B;  3GEE A;  2NP9 A;  4IJJ A;  3ZJ1 A;  4I43 B;  2HMQ A;  3QTH A;  1HNW T;  5LXT E;  1NAF A;  1FNT c;  3UGO A;  3E0Z A;  5FXW A;  4IAO A;  3KYI A;  3NKZ A;  2L6G A;  1RMV A;  4ZI3 C;  2ICW G;  5KYU A;  5FNV E;  4HE8 D;  2MWQ A;  4JUY A;  2ZXP A;  3UUM A;  3PUA A;  3SFD A;  2NUP A;  3EAM A;  2NPU A;  3ZG1 A;  2WDV A;  3U3B A;  4OIP F;  4MVQ A;  4HTE A;  5AQO B;  3SFE A;  3RIF A;  2HN1 A;  2C5I T;  4C90 A;  2WWV A;  2Q4F A;  2NW8 A;  1XWM A;  3K3O A;  1Z5Z A;  2NW9 A;  5KYU B;  1OCR C;  5F28 E;  2UXB T;  1GQE A;  3C18 A;  3PMR A;  5BR8 T;  1T01 A;  5AQL B;  1QPU A;  3PCV A;  4DR1 T;  3K66 A;  2Y6X A;  1X9B A;  3UR3 C;  3HLZ A;  3UU3 A;  4ZI3 D;  3M4C A;  4ULV A;  3ZJ2 A;  2XL4 A;  4YT0 A;  1YD8 G;  1H7C A;  3AED A;  2XL8 A;  4YTM A;  3EGX B;  1J1J A;  3RYF E;  4P9T A;  4EBJ A;  2WL8 A;  4I1M A;  2R6G F;  3SWH A;  2KND A;  1Q0G A;  4JEB A;  1T7S A;  2XQ4 A;  4KBL A;  4DRJ B;  5F5H A;  2LK4 A;  4IGG A;  1ZYR F;  3LSV A;  4U5C E;  2IXO A;  5JDM A;  4EZH A;  4U3C A;  1WFD A;  2V7L A;  1CHU A;  3TQO A;  2LM2 A;  3CQX C;  4OIQ F;  2WCA A;  3KBU A;  1QQ3 A;  4AXP A;  4XAX B;  1LM3 B;  4AKR B;  1ZHZ A;  1LVF A;  3P8C D;  1DOV A;  3JCU Q;  4ONS A;  3ZWI A;  3M79 A;  2ACZ A;  1XWJ A;  4YTN A;  2J46 A;  4JEH B;  4ZHQ E;  3OBV E;  2XXA B;  1S7Z A;  2MHR A;  4IE4 A;  4K7B A;  3RW0 A;  3VRB A;  1A41 A;  2FBW A;  4H63 H;  3K6B A;  1OED A;  4W8K A;  4XLN F;  1SHZ C;  2Y69 C;  4CJO A;  1NLX A;  2J4G A;  4PNI A;  1OED E;  5L0C A;  4CS8 A;  5AQJ B;  2NSG A;  4IT4 A;  2C03 A;  4MW3 A;  4CS9 C;  4JCH A;  2BG9 E;  4O2B E;  4PAC A;  4EZ4 A;  4XPY A;  4XEK A;  1NWM X;  2J1D G;  4WGY A;  3LK3 B;  2W9Y A;  1B7T A;  3N9O A;  2I15 A;  2CLY C;  2DB4 A;  3TD7 A;  4BJN A;  3AE2 A;  5FYM A;  2YL7 A;  4ZLD A;  2XY8 B;  3LK2 B;  3PUS A;  1E84 A;  4UVC B;  2XSE A;  3V5S A;  4Z91 A;  1TWC A;  2JD3 A;  3HNL A;  3S28 A;  1HMO A;  1T6U A;  3TOM A;  3PV0 F;  2JJ9 A;  3N9P A;  4QH4 A;  3ABK C;  1WLX A;  4EIY A;  4A5X A;  2RD9 A;  5DS4 A;  5L0D A;  3P7I A;  3G4X A;  3C4Z A;  2K48 A;  3ABL C;  1G8X A;  2WB5 A;  2EPO A;  4GYT A;  3BQK A;  3UUX B;  3ZEF B;  3N2K E;  3RPU A;  4L0R A;  3MJX A;  4CJG A;  1ZKE A;  3KDS E;  2I8B A;  4U5D E;  1PD0 A;  1NFN A;  4MBQ A;  2R03 A;  2KT9 A;  2C0S A;  3BQL A;  4LDQ A;  1G4W R;  2V7M A;  3K7D A;  1UG7 A;  2ZXO A;  4H54 A;  4MVZ A;  3NKD A;  4MTF A;  5L3G B;  1VLS A;  2WZH A;  3EFO A;  4RDA A;  2PF4 E;  2A6H F;  3L09 A;  4JBW F;  1YKH B;  3FMS A;  2UUB T;  2LSE A;  5ETW A;  3Q2M A;  1Y4C A;  1OW8 A;  4H4K C;  3TK0 A;  4ZI2 C;  3DAG A;  4O8S A;  4UF0 A;  2B1E A;  2EHO B;  5A6B A;  1VCS A;  3AOU A;  3UU8 A;  5AFU L;  3EFO B;  1JNR A;  3JT1 A;  3HKC E;  2LLY A;  5DJQ C;  3ZTZ A;  4U74 A;  3ZYK A;  2XL6 A;  3L34 A;  2CWY A;  4NQF A;  1QLE C;  3S4U A;  4IE5 A;  4UF0 B;  3LJB A;  1V55 C;  4ZS3 A;  3ABM C;  3U8V A;  4EHP A;  3Q5X A;  1XNR T;  2IIU A;  2DCF A;  3H2U A;  1UX5 A;  4AQF A;  5L3Q A;  4ZS2 A;  5KXJ A;  4Q7C A;  5T3W A;  5CB4 E;  5J0Z A;  2VCB A;  4UDV A;  4J30 B;  2WDQ A;  4E0I A;  4JYA T;  5JDQ A;  3CEX A;  5AQH B;  2WMN A;  4AKI A;  1KU2 A;  1Z7Q c;  2LHR A;  2X0Y A;  3GN5 A;  2ZM6 T;  2H8A A;  5HCJ A;  2V3C C;  3NWI A;  3P4W A;  2KZ7 B;  3GM2 A;  4NUV A;  1ZHC A;  3EUH A;  4U7Y A;  5AC5 A;  3U78 A;  3VU7 H;  2VQF T;  3OEO A;  2R7T A;  4YSZ A;  3AG3 C;  3QVZ A;  4WNK A;  4DO0 A;  3PDY A;  3HL6 A;  2R7U A;  3NMK A;  3GN5 B;  4IRE A;  1ZOY A;  1JMW A;  3UNG C;  2WSS V;  3ZT6 A;  4JW1 A;  2VKH A;  2CDQ A;  2X68 A;  5AQG B;  4IE0 A;  1BR0 A;  4XWJ A;  3QW1 A;  3FOO A;  3RVY A;  5ABE A;  3AAE B;  4CDV A;  3A5X A;  4LMK A;  2R05 A;  3BK9 A;  4MTG A;  2NTY A;  3SZR A;  1FMV A;  5ABH A;  5J2T E;  3NZP A;  5KYY B;  3IQT A;  2BBH A;  4CQI A;  1KFY A;  3AGU A;  1SR2 A;  4YSY A;  1N1C A;  3C51 A;  2CMR A;  2ZM0 A;  5LG3 A;  2B76 A;  4DR5 T;  5DVW A;  2HUJ A;  4PK5 A;  4OYJ A;  2WVN A;  2OG2 A;  1RCP A;  2CXL A;  2VUR A;  3NYL A;  1D0Z A;  3A9C A;  2Q7R A;  5DQZ A;  1VYI A;  2NW7 A;  2IAK A;  4KC9 A;  4KBM B;  1U0B B;  2XQ5 A;  4NXM T;  2LRK A;  4QKN A;  2PFV A;  2NUT A;  4O6M A;  1SZI A;  3FHN A;  1QUU A;  4X65 T;  4Q4Z F;  4LDR A;  3TOL A;  5LB7 B;  2X9W A;  1RKC A;  4BAY B;  5FXV A;  3JSZ A;  3JAE A;  4P09 A;  3RKG A;  5HAX A;  3ZPO A;  2DWG A;  1N32 T;  1OXB A;  3EZH A;  3N24 A;  4U5B E;  4U5H A;  2WY2 A;  256B A;  3MX3 A;  4G7H F;  2NUT B;  4H9N C;  2I6H A;  3I1A A;  4UV9 B;  2KQ9 A;  2A6E F;  4Q25 A;  3HKD E;  3IQ5 A;  4K1O A;  1JPN A;  3HR0 A;  3HKK A;  2KXP B;  4B6I A;  3AE9 A;  3GWN A;  2FJA A;  3K3N A;  4P6I C;  3RKO A;  2I59 A;  2J62 A;  4UXN B;  2XRH A;  4DRI B;  2LM9 A;  1V54 C;  5LHI B;  1B68 A;  4J32 B;  1Y64 B;  4EGW A;  1KNZ A;  2RPA A;  3SXZ A;  4X5T A;  3DE9 A;  1Z0P A;  2AVK A;  4ZEY A;  1IW7 F;  2H7O A;  2QGS A;  2Z15 A;  3O1H A;  5HEG A;  3RRW A;  3G50 A;  4LF9 T;  1MNE A;  3ECS A;  5FZT A;  4WW0 A;  3GMI A;  1OKK A;  4YJ2 E;  4XQ1 A;  3F57 A;  2QNL A;  3B71 A;  1HE1 A;  2YHS A;  2R9R B;  2CM0 A;  3PUG A;  3GEI A;  4YN0 B;  2Y3B A;  3BRJ A;  1UUR A;  1V9D A;  3KV5 A;  1XNQ T;  2H7V C;  3GWH A;  5ABF B;  3Q7G A;  3W2V A;  3PUQ A;  4DR2 T;  4MND A;  1AUE A;  1A7E A;  2XQ9 A;  2CLY B;  4GYS A;  2HZ8 A;  2R7S A;  5AQQ B;  2FUP A;  3M4B A;  1L3P A;  2NSF A;  2JQH A;  1WCR A;  3I9W A;  4BJ1 A;  4DV2 T;  4JI1 T;  2DLR A;  4UEM A;  5FXZ A;  2XQ3 A;  5HEJ A;  3AEE A;  5HYA A;  1XMO T;  4JI0 T;  2GFH A;  3AE3 A;  5LCY A;  1PCX A;  3AEF A;  1HTJ F;  1CPR A;  2OQM A;  5JDN A;  2VKJ A;  2YLG A;  4CS8 C;  3T9O A;  3PUY F;  4RBN A;  3Q9D A;  4DR4 T;  2LOS A;  1E85 A;  3AG4 C;  4CN6 A;  4OIN F;  4JI8 T;  3HNK A;  4L9I A;  3DD7 A;  4Z9I A;  3FDQ A;  4ILB A;  1A7D A;  3A8Y C;  1WAT A;  3EZI A;  2LFF A;  3KV9 A;  2Y8D A;  4TX5 A;  2HFI A;  5E3A A;  3DP7 A;  4G2A A;  3LK4 2;  2XLW A;  2V6X A;  2EIL C;  3EJN A;  2OCC C;  1YA9 A;  3RKO F;  4EEB A;  5DS5 A;  1T6Q A;  4LER A;  2LE8 A;  4O7G A;  4E7Z A;  1WWP A;  2E9X A;  5LGT B;  1JPJ A;  2YDS A;  1U4Q A;  1KNR A;  5TJ5 E;  5DQW A;  2X51 A;  4JI5 T;  3MA9 A;  2XAG B;  5DQV A;  2WB7 A;  1OCO C;  3ZN0 B;  4LAC B;  2XLD A;  2QYW A;  2LEH A;  3EDU A;  4Z8X A;  2E9X B;  3C8G A;  1OXZ A;  3QNU A;  4DV5 T;  4JCZ A;  1SF8 A;  1H9T A;  1XZY A;  2CYD A;  3ZCJ A;  1EQ1 A;  2MPK A;  1IZN B;  3JTL O;  2J7P D;  2GWW A;  3VF0 A;  4JTC B;  2XQ7 A;  4YLH A;  2TMV P;  3HJC A;  4DND A;  1E7P A;  3OPC A;  2B0H A;  4AL0 A;  4IRU A;  4C91 A;  3VR8 A;  1S94 A;  4TV8 E;  4HFK B;  5EZY E;  3LS1 A;  4WBO A;  3C64 A;  2N9D A;  1F1M A;  3P50 A;  5BUO A;  2QY9 A;  4MHC A;  5IHY A;  5JDL A;  2OKU A;  3VYW A;  2P9B A;  2KWI B;  3ZTM A;  3B0V C;  4DRH B;  5EK2 A;  1O3U A;  3A11 A;  2VB6 A;  5KDM C;  4CI3 B;  2ZPA A;  5TAO A;  2L6H A;  4IWB A;  5E33 A;  1NG1 A;  2QLA A;  1YKE B;  3CQG B;  3NKE A;  1AEP A;  4AQF C;  3U2M A;  2UUC T;  4LLE A;  3RIP A;  2VK9 A;  1TFK B;  4NTB A;  5LMN T;  3M65 A;  5A6B D;  1HS7 A;  2O9X A;  3T6J A;  3DXJ F;  1QVX A;  3DE8 A;  4NY3 A;  3UQ7 A;  3ONJ A;  3WHN A;  4TWF A;  2E8I A;  3K8P C;  5DQT A;  5CJ5 A;  2JMH A;  2R25 A;  4NCQ A;  4HGA A;  3UGP A;  3H37 A;  4QX8 B;  5HEO A;  3K1I A;  2V6Y B;  3DZA A;  4QXH B;  3JRM O;  5AQU B;  2BDE A;  5AQM B;  5LJM A;  3GA8 A;  3H3M A;  3HI2 A;  3J7Y q;  1FEW A;  2VKO A;  5HXE A;  5L3B B;  2W62 A;  4X20 E;  4R32 A;  3WOD F;  5JLI A;  5CA1 E;  3I4U A;  2E2A A;  1OXK A;  1TR2 A;  4HWC A;  3EAB A;  4GIW A;  4O79 A;  4Z9H A;  3UMH A;  3QVY A;  4IDZ A;  1KNY A;  2VAS A;  2HKV A;  4OIR F;  2FJB A;  3T6B A;  4IE6 A;  4EV6 A;  1ST6 A;  1SE7 A;  1LVK A;  4TZ4 C;  1U89 A;  2JMK A;  2E5L T;  2EIK C;  1C17 M;  4J7Y A;  3JAF A;  3DAF A;  2WU5 A;  1HNX T;  5CIV A;  4I50 E;  2HPJ A;  2NUP B;  1LS4 A;  3RQE A;  1J5W A;  4CSA A;  3FZH B;  4AX2 A;  3AA6 B;  4DOZ A;  3KFW X;  3ZMU B;  3SP1 A;  3V5U A;  1IBK T;  2WBL A;  1GGQ A;  2YU1 A;  3B0P A;  4DUZ T;  2KMF A;  5EK0 A;  2XSA A;  1VCT A;  4GKJ T;  4G63 A;  2PJQ A;  3RYL A;  4H63 V;  1W2W A;  3GM1 A;  1AVO B;  2HV7 A;  3O1I A;  2WP9 A;  3AXJ A;  4CN4 A;  2CNW A;  3FXH A;  4IGU A;  4JC7 A;  3T4R A;  3LLI A;  5JP7 A;  4OYK A;  3Q6N A;  5LGN B;  1YXR A;  1E1H B;  2HHH T;  3LUT B;  2IML A;  3B13 A;  2IXM A;  3TJ6 A;  3UQ4 A;  4U31 A;  3KVB A;  3IBP A;  2XQ6 A;  1ZHY A;  2AWY A;  1RJ9 A;  2X9H A;  3AEC A;  3MYF A;  2A0U A;  3UU4 A;  5L3D B;  4QH1 A;  1OW6 A;  2RA1 A;  2WS3 A;  3CQZ A;  3PE0 A;  3ZQV A;  5FVK A;  3G06 A;  3P4Q A;  5M4Y A;  5L0G A;  2H89 A;  3AA0 B;  3K3Q C;  3QOF A;  3NRH A;  1MND A;  3EQL F;  4UR9 A;  2J0W A;  3C50 A;  2JQK A;  4C7O A;  3H65 A;  2D5U A;  4IAQ A;  3PUR A;  3I0O A;  3R84 B;  4BJ5 A;  4JE9 A;  4UIG A;  2BG9 A;  5E2Q A;  2NOX A;  3WI3 A;  3GEH A;  3SRZ A;  2V5D A;  4CZZ B;  2KLQ A;  3B0U X;  2RSE B;  2WDR A;  5BMV E;  5A6J A;  1YDI A;  1OED B;  4H9P C;  1WGW A;  1XDO A;  1DU2 A;  3DI5 A;  2ODU A;  3GM3 A;  1W9R A;  4JEA A;  4JKV A;  2BG9 B;  4HFF B;  2UXC T;  1BDJ B;  3O10 A;  1HR0 T;  3NDB B;  1WYC A;  2YLI A;  1W09 A;  1LPE A;  3O4X E;  4G78 A;  3SNH A;  5JUA A;  2WMO A;  2YLD A;  2VQE T;  5CA0 E;  2XS1 A;  2HMZ A;  1GS9 A;  2CHO A;  5L0H A;  4MTO A;  1FFT C;  2UUH A;  3UUN A;  3UMK A;  5HCM A;  2LT3 A;  1OR3 A;  4IB4 A;  1T8B A;  1H9G A;  2YVK A;  3AVR A;  5EHH A;  3C4X A;  2WZG A;  4YSX A;  4EIW A;  4B6X A;  2IM8 A;  1OKK D;  2UU9 T;  3GAN A;  3Q5E A;  3RQG A;  1TFO B;  4EB6 E;  3TLW A;  1E83 A;  3AAA B;  4I4T E;  1LE2 A;  5L0J A;  5FL0 A;  2KSF A;  5A69 A;  3S84 A;  3JYH A;  3E08 A;  3P4R A;  4DXW A;  3I5P A;  4ZZC A;  1D1B A;  5LGU B;  4YFS A;  1V74 B;  3F47 A;  5HEU A;  1Z8U A;  3EI0 A;  4CS7 A;  3UU5 A;  2W4M A;  4U5E E;  2V1D B;  3DJN B;  4ZXL A;  2GA0 A;  3NBX X;  3ASO C;  4P9F A;  2CE7 A;  3U5S A;  2RP4 A;  1MIV A;  1BR1 A;  2BVM A;  3JSE O;  2Q3T A;  3O1J A;  5JDF A;  3H2V A;  3X1O A;  4DBQ A;  5JR9 A;  2IUB A;  4KP3 C;  3S29 A;  2WZF A;  3P4P A;  4DV1 T;  1QSD A;  4YXD A;  3IQC A;  2D2S A;  4HKA A;  1W0B A;  2Y3H A;  3R7C A;  3E9V A;  4KNV A;  5HXR A;  3DJU B;  2E9X C;  3RYI E;  4N06 A;  3N9M A;  2WVQ A;  3TLS A;  4TNV A;  4A56 A;  1IBL T;  4E7S A;  4AE4 A;  4CI1 B;  4H9Q C;  1HF8 A;  4ZI2 D;  5JR9 B;  3JAD A;  3R2P A;  3FHD A;  2YK0 A;  1YQ3 A;  3NRY A;  5L2L A;  2D5R B;  2W66 A;  1D0Y A;  1LS1 A;  3FZM B;  1TWA A;  4DV3 T;  1FTS A;  1Y6D A;  4J2C A;  3PU8 A;  3DKA A;  4AE4 B;  4KHZ F;  5KYX A;  1U5P A;  4JLE A;  2WWU A;  3RX6 A;  3RLF F;  1WR0 A;  1ZEE A;  3AE1 A;  4PJM A;  3AVS A;  2BS3 A;  3J06 A;  1FMW A;  4XLP F;  3N9L A;  4YTP A;  2VL0 A;  2YRF A;  4EYU A;  1UCU A;  4JIO A;  2E9X D;  2Z6E A;  2HPL A;  1JR8 A;  3LBX A;  4XEF A;  3MFN A;  4U2Y A;  1HCI A;  2V7J A;  1NEN A;  4DJ9 A;  1FJG T;  3Q5D A;  1YJG A;  3ZT5 A;  2YWA A;  1FR0 A;  4KHP T;  1S35 A;  2OJE D;  1WR6 A;  3GOD A;  3QUJ A;  1A0B A;  3ZT7 A;  3QMK A;  4H9S E;  1UFB A;  1RXQ A;  1O5H A;  3UU6 A;  2ZXW C;  5COF A;  3LBX B;  2XQ8 A;  5L0F A;  1IAP A;  2BZB A;  3O55 A;  4BA9 A;  2MTQ A;  1KNP A;  2M6B A;  3L8R A;  1E2X A;  2K3W A;  3AB3 B;  4A2N B;  3C4W A;  1M2V A;  4B3T T;  1C03 A;  3RH3 A;  2HV6 A;  4OD5 A;  2YIN A;  2X0H A;  4X1K E;  1VOM A;  4JRZ A;  1RKE A;  4Q5S F;  2SPC A;  1ZU5 A;  3V5Z A;  2EIN C;  3FB2 A;  2XAJ B;  3MYI A;  3RRC A;  4BJ6 A;  5CI8 A;  2IW5 B;  4QXB B;  3CIR A;  1D1A A;  4G7Z F;  3LEV A;  3SEO A;  4DV6 T;  1HMD A;  4ILA A;  3IF8 B;  3K1I C;  2XM2 A;  4YJW A;  2XLM A;  1KTM A;  2P7V A;  5E3C A;  2A2F X;  5AQT B;  5D91 A;  5GPG B;  1ZU4 A;  3U9M A;  4YJ3 E;  1TQG A;  2UXD T;  5B1A C;  2H7B A;  3VR9 A;  3AE7 A;  4EYY R;  4E18 A;  3FOP A;  1D1C A;  3KVA A;  3ZDL A;  1HX8 A;  4W8P A;  4N4W A;  4CDA A;  3L39 A;  2Q9Q A;  4YT4 A;  4FX5 A;  1IZM A;  2LCH A;  4F8H A;  4XBF B;  2EIJ C;  3OYX A;  2M4E A;  2OJQ A;  1MMN A;  2CCQ A;  1FAP B;  3ZMV B;  3HKE E;  2KYH A;  3RF1 A;  5T1D B;  5CI9 A;  3CKD A;  2P61 A;  5JS5 A;  3IHU A;  1MIY A;  2DI3 A;  3RQF A;  3UTK A;  2LRL A;  3MK7 C;  3OYZ A;  4FWV A;  4BEM J;  2G62 A;  5LBM A;  1VRB A;  2Q9Q B;  3CVR A;  3OTO T;  3LDQ B;  5FL1 A;  3U0C A;  2PG8 A;  4O4H E;  2K9A A;  3VAY A;  2KWH A;  2IXP A;  5HV9 A;  4UVB B;  4LF5 T;  2HH7 A;  3SXK A;  4TN7 B;  2L9Q A;  2MYS A;  2DI4 A;  4CSA C;  1YA7 O;  5L4E A;  2KGO A;  2ASR A;  1OR2 A;  3ONL C;  5H6Q B;  2L3L A;  5FVL A;  4AKL A;  5CGM A;  3KYJ A;  4L6R A;  4YT5 A;  3L8J A;  3RIU A;  2BL2 A;  1APC A;  4XPW A;  1PV3 A;  3CWZ B;  4QH5 A;  2LSJ A;  3PDM P;  2A1D D;  5JRC A;  5L3E B;  2YEV A;  5AC4 A;  2CHN A;  1N34 T;  2PX0 A;  2X0L B;  3O39 A;  2GAQ A;  4P1N A;  4QX7 B;  3C63 A;  3PUW F;  5KYW A;  1KK7 A;  4NTA A;  4U5G A;  3VRC A;  3RQW A;  3L1M A;  5CFB A;  3MAC A;  1YYJ A;  4B3R T;  4COF A;  4UVA B;  2XSB A;  4NUU A;  4U7I A;  1SA0 E;  2NTX A;  2HS5 A;  2PBI A;  2ZXR A;  3ESL A;  2XAQ B;  2OU6 A;  2LD6 A;  4NC3 A;  5C3J A;  5L4H A;  2XLE A;  2W4X A;  1XMQ T;  2WAU A;  2OEX A;  2CW0 F;  3LNR A;  5B1B C;  1G73 A;  1OED C;  3BQI A;  4HFV A;  1X79 A;  5LHG B;  1VTM P;  3IQ6 A;  1PD1 A;  4QDL A;  5HSW A;  2WM9 A;  4ZOL E;  3VRA A;  4BJ5 C;  2YZS A;  2L6F A;  4K0D A;  2BG9 C;  1Q0K A;  4YT2 A;  3KH2 A;  4MVU A;  1XZQ A;  1M57 C;  4EED A;  1JAF A;  3FAP B;  3C98 B;  1YW0 A;  3ZSS A;  4XZC A;  1NEK A;  4CX9 A;  2CCY A;  5FXX A;  5KMG P;  2A68 F;  1BBH A;  2W4B A;  3DWW A;  5C2T A;  4HFE A;  3D0T A;  2KK1 A;  3ZC1 A;  3IHR A;  2BKO A;  2CGE A;  3TLT A;  2YKZ A;  2BC5 A;  3V5Y A;  1WOL A;  1N33 T;  4B3M T;  1G5Z A;  2XM0 A;  3SS1 A;  2YL3 A;  3B29 A;  1GQA A;  3B9Q A;  4GK5 E;  3RI5 A;  4EBB A;  2H88 A;  4C3E A;  2BBJ A;  2Q00 A;  5L3V A;  2E5V A;  2AE9 A;  3TLU A;  3M1C B;  1E86 A;  4MLK A;  2CXD A;  3N9N A;  1Z63 A;  2PBE A;  3N5L A;  1TWG A;  5F3J A;  1CGO A;  4J7T A;  1C02 A;  3U8P A;  3ZYM A;  4ER9 A;  2D4U A;  3QK6 A;  3N2G E;  4DR7 T;  4MQ9 F;  3RQU A;  2XTL A;  5LG4 A;  2X9Y A;  3WAK A;  1HNZ T;  4MAL A;  2M64 A;  4P0A A;  2YDR A;  4IDN A;  4NTF A;  4DV7 T;  3HA4 A;  3ZN1 B;  2H3R A;  2IBF A;  1ZV4 X;  1E2A A;  2J45 A;  1Z3I X;  2QE9 A;  1ORS C;  3W4Y A;  2LIG A;  2R7V A;  1A7V A;  2CPT A;  2CBI A;  3VKG A;  5AQV B;  2K5B B;  4NXN T;  4O4J E;  2QUP A;  3LAY A;  3IA3 A;  4YT8 A;  2A0B A;  3HNJ A;  4JVS A;  4CXW A;  3C8G B;  3MXZ A;  4LFC T;  2LOP A;  2XPK A;  3QB5 A;  2BVL A;  3AE8 A;  1HX1 B;  2I0M A;  1YVI A;  4JI4 T;  4UEL A;  3K1S A;  1WN0 A;  1SMY F;  2VH3 A;  3ZSU A;  3S9O A;  5JR9 C;  4A4A A;  4K0K T;  5AQP B;  5A6A A;  4E17 A;  1T5O A;  1CGN A;  3AEG A;  3V5X A;  4IDP A;  2VL8 A;  3EGD A;  2IOQ A;  2VCC A;  2DWK A;  3A7M A;  3CX7 B;  4LML A;  2LSG A;  5BQI A;  1NU7 D;  4TNW A;  3JYY A;  2XAH B;  4BG0 A;  5LYJ E;  5HWY A;  5LJN A;  3FXD B;  3L8I A;  4QHO A;  5B3I A;  3EHM A;  1LKX A;  2XLO A;  2VVS A;  3JC6 C;  4JI6 T;  3KV6 A;  3EHZ A;  5F5W A;  5EGY A;  2JQ9 A;  5KYN A;  3CX6 B;  4C3D A;  1Q0M A;  3T1Y T;  4PJL A;  3K33 A;  3TJ5 A;  3AEB A;  4HFB A;  4CIH A;  5J1G A;  4DR3 T;  3UUB A;  5ABG A;  4YL0 A;  4WBN E;  3RVZ A;  4HWI B;  2YOE A;  3NMJ A;  2IHR 1;  3V7O A;  4LLC A;  4NIQ A;  1Q0D A;  2C5J A;  2XHE B;  5DAB A;  3B5M A;  2EIM C;  4V1A v;  3I9Y A;  4KUM B;  2G0U A;  1I4Y A;  2YDQ A;  2BE5 F;  3NG1 A;  3AE5 A;  1VLT A;  3VM6 A;  5LMU T;  1R8I A;  3JC6 D;  4DVY P;  1JNZ A;  4TWH A;  3C8Z A;  4GK0 E;  5FP3 A;  2XLH A;  3NMI A;  1V4A A;  1ZVZ A;  2ODV A;  2A9U A;  3SOL A;  2J9V A;  2XUE A;  4OX9 T;  1VB5 A;  3AGT A;  3N0T A;  4GOU A;  5LNK A;  4JI3 T;  1MMD A;  3EH2 A;  4HWF A;  4KMC A;  3I5Q A;  5FY1 A;  2VCA A;  1HW2 A;  5L3F B;  1S05 A;  1YZC A;  2FGY A;  4ADZ A;  4X1I E;  3ZYL A;  1BR2 A;  4MS2 A;  3AJM A;  3KIN B; 
#chains in the Genus database with same CATH homology
 4PFO A;  3N2Z B;  2PP4 A;  1VK5 A;  4TV9 E;  4CXY A;  2QTV A;  3DMD A;  3W2W A;  5F8P A;  1NZE A;  3QC9 A;  3EGX A;  4EOZ B;  4IIJ E;  4JEU B;  4EWC A;  3PTR B;  2KNH A;  3S0X A;  2V7K A;  2DHR A;  1FIO A;  2A72 A;  2UXX B;  4JJF A;  1VMA A;  2Q9Q C;  3RYH E;  4GYR A;  1LRZ A;  2UXN B;  2W00 A;  2ZM8 A;  4PK6 A;  5JRE A;  1HFA A;  3DTO A;  4O2A E;  2XXA A;  4DVD A;  3OA1 A;  2QA7 A;  2JPF A;  4ISS A;  1IJ6 A;  1O87 A;  3R6N A;  2V7I A;  1RJ9 B;  3ZMT B;  3UUL A;  4FI5 A;  5KX5 E;  4AKH A;  2CWO A;  2Q9Q D;  4H9R C;  2Q9A A;  4I44 A;  4G7O F;  3HKB E;  5FCL A;  4N78 D;  3NYM A;  4C7O B;  3E22 E;  3FBZ A;  5GON E;  4GEH A;  2YEV C;  2NWB A;  5JDH A;  3B57 A;  5EK4 A;  3I0Q A;  1US7 B;  5HXS A;  3KBT A;  3ZC4 A;  4XTK A;  2Y3G A;  3IEE A;  4U72 A;  3AA7 B;  2DGJ A;  1Z23 A;  2J7P A;  1T98 A;  1TKN A;  3H3A A;  4DMW A;  4UV8 B;  4ULW A;  3ZMZ B;  2J0X A;  2PFD A;  3W8H A;  3OWT A;  2N1G A;  1J8M F;  2IC9 A;  5LA6 E;  3DM5 A;  3ZLI A;  3ZVR A;  2EHO A;  3CQC B;  5JH7 E;  3ETV A;  3ZCI A;  2Y3D A;  4O4L E;  2W45 A;  3OJA A;  4FES A;  1O3X A;  5T3T A;  2CEA A;  5FY7 A;  3FAJ A;  3MLG A;  1WRD A;  3ZMS B;  4C3B A;  3EHN A;  3TKL B;  3QZC A;  5LOV E;  4PW8 A;  4JZA A;  3VHL A;  4ERR A;  4PK4 A;  3CX8 B;  3FBL A;  2ES0 A;  3KKB A;  3CPZ A;  3F31 A;  1ZHX A;  4O4I E;  5DS6 A;  2NG1 A;  3WAJ A;  5J2U E;  3FXE B;  2DYS C;  3EVY A;  3SYN A;  3F2E A;  2LJL A;  2XQY A;  4HE8 A;  3F46 A;  5D92 A;  4QI0 A;  5FY0 A;  5KYX B;  4K0U A;  3AQC A;  2Q9B A;  5LP6 E;  3RC8 A;  1Z6A A;  2ZMA A;  1FFH A;  2J9W A;  1MMA A;  5KYY A;  3EPV A;  3CSK A;  1OCC C;  2W0G A;  5B3S C;  5HXH A;  3L0I A;  2MBG A;  2K24 A;  3AG2 C;  1D0X A;  4TUY E;  5IY5 C;  4ILU A;  1M2V B;  4P0B A;  3AG1 C;  4JUR I;  4L5G A;  1NU9 C;  3W8I A;  2M67 A;  1M56 C;  4DVZ A;  2VWA A;  4IE7 A;  3ETU A;  3ZC0 A;  2L81 A;  3UFE A;  1ZHW A;  2Y48 B;  3LES A;  4CBE A;  3PU3 A;  2GK9 A;  4QI2 A;  3UMI A;  4ZI7 E;  3NZQ A;  3O6X A;  4DMV A;  1AJ3 A;  3LG7 A;  2E87 A;  3LS0 A;  2FFH A;  1QZX A;  2LSY A;  1IJ5 A;  2CA5 A;  3KMI A;  3EH1 A;  5FMN A;  3ONX A;  3Q7L A;  4OFZ A;  2ZLY A;  3VKH A;  2YU2 A;  2W61 A;  2ZM2 A;  2X66 A;  2JRK A;  4HEA J;  2KW3 C;  4M63 A;  4YWQ A;  2R7X A;  1HG2 A;  3ANW A;  3W15 B;  4OK0 A;  3N9Q A;  4ZLC A;  4HEA A;  1TWH A;  1MMG A;  4IST A;  4BJM A;  2XAS B;  3POV A;  2CXF A;  5HXC A;  4RD9 A;  2IXN A;  3ANW B;  5H6R B;  4CS9 A;  2R7Q A;  3OKQ A;  1UX4 A;  4PAG A;  4AKG A;  5A1L A;  2X67 A;  4F6R C;  5JRC B;  2G3K A;  4KNW A;  3E70 C;  4OD4 A;  2W63 A;  2A3D A;  3LJC A;  5KYW B;  5L3C B;  3FVY A;  4PFP A;  2J9U A;  5JQG E;  5EK3 A;  2L8K A;  2ACX A;  3ITF A;  5E0O A;  3EDV A;  2CNW D;  4QXC B;  3MZK B;  4ANJ A;  3HTK C;  1CUN A;  4AQG A;  3AAI A;  4U5F E;  2JQQ A;  3Q6M A;  4DBR A;  1OWA A;  5LHH B;  4PJN A;  4H9O C;  2N2N A;  3Q5W A;  3PHF 2;  4KI2 A;  3N2O A;  2LHN A;  5JVD E;  1HG5 A;  2B0J A;  5C8Y E;  3RC3 A;  3CZ6 A;  2PX3 A;  4OIO F;  4FJO A;  4EXT A;  4YHJ A;  4O6N A;  2DNX A;  5F5F A;  2P6V A;  2VKD A;  4WJ0 A;  3MKD A;  2R7W A;  3UT5 E;  3AA1 B;  4X1Y E;  3J9X 1;  2V26 A;  5DLJ A;  2LSK A;  2A69 F;  3DJB A;  2D0T A;  3K1H A;  3ZIB A;  3RFY A;  2D0U A;  4AI6 A;  3WG7 C;  2MOZ A;  3NYJ A;  2IC6 A;  4HN9 A;  3T8O A;  2Q9C A;  1OCZ C;  3CML A;  2XAF B;  2L9J A;  3KV4 A;  3DM9 B;  4BJT A;  2KIN B;  3KL4 A;  4JJG A;  3S27 A;  4QWN B;  2EHO C;  4EAH A;  3U3I A;  3NRX A;  4I55 E;  2IYL D;  4PJJ A;  4M1P A;  1BR4 A;  3AQB A;  4G0H A;  3L3P A;  4X0R A;  5ADX L;  4I3M A;  4F4B A;  1VYK A;  2R7R A;  3X2Q C;  3LFM A;  4O6Y A;  2DYR C;  1MIW A;  3RYC E;  2OA5 A;  1ZHT A;  2LSI A;  2EHO D;  5HWX A;  3EGD B;  2X9X A;  5LBQ B;  4CXX A;  2C5K T;  5IYZ E;  1WYB A;  3LLK A;  4MFR A;  4I1O B;  2G3V A;  2WZL A;  2KJG A;  1EZ3 A;  4ASK A;  1M2O A;  3O9X A;  1J8Y F;  2R7O A;  3EG9 A;  4IHJ E;  4AK9 A;  2C04 A;  3ASN C;  4OHF A;  5JDG A;  2WVO A;  4BEJ A;  4CI2 B;  3JRT A;  2Y39 A;  3EG9 B;  2NP9 A;  4IJJ A;  3ZJ1 A;  4I43 B;  5LXT E;  1NAF A;  3UGO A;  3E0Z A;  5FXW A;  4IAO A;  4ZI3 C;  5KYU A;  5FNV E;  4HE8 D;  2MWQ A;  4JUY A;  2ZXP A;  3UUM A;  3PUA A;  2NUP A;  3ZG1 A;  4OIP F;  4HTE A;  2C5I T;  4C90 A;  2NW8 A;  3K3O A;  1Z5Z A;  2NW9 A;  5KYU B;  1OCR C;  3PMR A;  3K66 A;  2Y6X A;  3UR3 C;  3HLZ A;  4ZI3 D;  3ZJ2 A;  2XL4 A;  1YD8 G;  1H7C A;  3EGX B;  3RYF E;  2WL8 A;  4I1M A;  3SWH A;  2KND A;  4KBL A;  5F5H A;  1ZYR F;  4U5C E;  2IXO A;  4EZH A;  5JDM A;  2V7L A;  3CQX C;  4OIQ F;  3KBU A;  4AXP A;  4XAX B;  4AKR B;  1ZHZ A;  1LVF A;  3P8C D;  3JCU Q;  2J46 A;  4JEH B;  4ZHQ E;  3OBV E;  2XXA B;  1S7Z A;  4IE4 A;  4K7B A;  4H63 H;  3K6B A;  4W8K A;  4XLN F;  1SHZ C;  2Y69 C;  4PNI A;  4CS8 A;  2C03 A;  4CS9 C;  4JCH A;  4O2B E;  4EZ4 A;  1NWM X;  2J1D G;  3LK3 B;  2W9Y A;  1B7T A;  3N9O A;  2CLY C;  3TD7 A;  4BJN A;  5FYM A;  4ZLD A;  3LK2 B;  3PUS A;  4UVC B;  2XSE A;  3V5S A;  1TWC A;  2JD3 A;  3S28 A;  2JJ9 A;  3N9P A;  3ABK C;  1WLX A;  5DS4 A;  3P7I A;  3C4Z A;  2K48 A;  3ABL C;  1G8X A;  4GYT A;  3BQK A;  3UUX B;  3ZEF B;  3N2K E;  3RPU A;  4L0R A;  3MJX A;  1ZKE A;  3KDS E;  2I8B A;  4U5D E;  1PD0 A;  4MBQ A;  2KT9 A;  2C0S A;  3BQL A;  2V7M A;  3K7D A;  2ZXO A;  3NKD A;  5L3G B;  3EFO A;  4RDA A;  2PF4 E;  2A6H F;  3L09 A;  1YKH B;  2LSE A;  5ETW A;  3Q2M A;  4H4K C;  4ZI2 C;  3DAG A;  4O8S A;  4UF0 A;  2B1E A;  2EHO B;  5AFU L;  3EFO B;  3JT1 A;  3HKC E;  5DJQ C;  4U74 A;  3ZYK A;  3L34 A;  2CWY A;  1QLE C;  3S4U A;  4IE5 A;  4UF0 B;  3LJB A;  1V55 C;  4ZS3 A;  3ABM C;  3Q5X A;  2DCF A;  1UX5 A;  4AQF A;  5L3Q A;  4ZS2 A;  4Q7C A;  5T3W A;  5CB4 E;  4J30 B;  5JDQ A;  2WMN A;  4AKI A;  1KU2 A;  2LHR A;  3GN5 A;  2V3C C;  2KZ7 B;  4NUV A;  1ZHC A;  3EUH A;  3U78 A;  3VU7 H;  3OEO A;  2R7T A;  3AG3 C;  4WNK A;  4DO0 A;  3PDY A;  3HL6 A;  2R7U A;  3GN5 B;  3UNG C;  2WSS V;  4JW1 A;  2VKH A;  2CDQ A;  2X68 A;  4IE0 A;  1BR0 A;  4XWJ A;  3AAE B;  3A5X A;  3BK9 A;  2NTY A;  3SZR A;  1FMV A;  5J2T E;  3NZP A;  5KYY B;  4CQI A;  1N1C A;  3C51 A;  2CMR A;  2ZM0 A;  5DVW A;  4PK5 A;  4OYJ A;  2WVN A;  2OG2 A;  2CXL A;  3NYL A;  1D0Z A;  5DQZ A;  1VYI A;  2NW7 A;  2IAK A;  4KC9 A;  4KBM B;  4QKN A;  2PFV A;  2NUT A;  4O6M A;  1SZI A;  3FHN A;  1QUU A;  4Q4Z F;  2X9W A;  4BAY B;  5FXV A;  3JSZ A;  4P09 A;  5HAX A;  3ZPO A;  2DWG A;  3EZH A;  3N24 A;  4U5B E;  4U5H A;  3MX3 A;  4G7H F;  2NUT B;  4H9N C;  4UV9 B;  3I1A A;  2KQ9 A;  2A6E F;  3HKD E;  1JPN A;  3HR0 A;  4B6I A;  2KXP B;  3K3N A;  4P6I C;  3RKO A;  2I59 A;  4UXN B;  2XRH A;  2LM9 A;  1V54 C;  5LHI B;  4J32 B;  1Y64 B;  1KNZ A;  1Z0P A;  1IW7 F;  2H7O A;  2QGS A;  2Z15 A;  3O1H A;  3RRW A;  1MNE A;  3ECS A;  4WW0 A;  3GMI A;  1OKK A;  4YJ2 E;  3F57 A;  2YHS A;  2CM0 A;  3PUG A;  4YN0 B;  2Y3B A;  1V9D A;  3KV5 A;  3Q7G A;  2H7V C;  3GWH A;  3W2V A;  3PUQ A;  4MND A;  2CLY B;  4GYS A;  2R7S A;  3I9W A;  4BJ1 A;  2DLR A;  4UEM A;  5FXZ A;  5HYA A;  2GFH A;  5LCY A;  1PCX A;  1HTJ F;  5JDN A;  2VKJ A;  4CS8 C;  4RBN A;  3Q9D A;  2LOS A;  3AG4 C;  4OIN F;  4L9I A;  3DD7 A;  3FDQ A;  3EZI A;  3KV9 A;  2Y8D A;  4TX5 A;  5E3A A;  3DP7 A;  4G2A A;  3LK4 2;  2EIL C;  3EJN A;  2OCC C;  3RKO F;  5DS5 A;  4LER A;  2LE8 A;  4O7G A;  4E7Z A;  2E9X A;  5LGT B;  1JPJ A;  1U4Q A;  5DQW A;  2X51 A;  3MA9 A;  2XAG B;  5DQV A;  2WB7 A;  1OCO C;  3ZN0 B;  4LAC B;  2LEH A;  3EDU A;  4Z8X A;  2E9X B;  1OXZ A;  1SF8 A;  3ZCJ A;  1IZN B;  2J7P D;  4YLH A;  3HJC A;  4DND A;  4IRU A;  4C91 A;  1S94 A;  4TV8 E;  4HFK B;  5EZY E;  3LS1 A;  4WBO A;  3C64 A;  2N9D A;  5BUO A;  2QY9 A;  4MHC A;  5IHY A;  5JDL A;  3VYW A;  2P9B A;  2KWI B;  3B0V C;  5EK2 A;  2VB6 A;  5KDM C;  4CI3 B;  2ZPA A;  5TAO A;  4IWB A;  5E33 A;  1NG1 A;  1YKE B;  3CQG B;  3NKE A;  4AQF C;  4LLE A;  3RIP A;  2VK9 A;  3M65 A;  1HS7 A;  2O9X A;  3T6J A;  3DXJ F;  4NY3 A;  2E8I A;  3K8P C;  5DQT A;  2JMH A;  4HGA A;  3UGP A;  3H37 A;  4QX8 B;  3DZA A;  4QXH B;  2BDE A;  5LJM A;  3GA8 A;  3HI2 A;  1FEW A;  5HXE A;  2VKO A;  5L3B B;  3J7Y q;  2W62 A;  4X20 E;  3WOD F;  5CA1 E;  3I4U A;  1TR2 A;  4GIW A;  4O79 A;  3UMH A;  4IDZ A;  2VAS A;  4OIR F;  3T6B A;  4IE6 A;  1ST6 A;  1LVK A;  4TZ4 C;  2JMK A;  2EIK C;  3DAF A;  4I50 E;  2HPJ A;  2NUP B;  4CSA A;  4AX2 A;  3AA6 B;  4DOZ A;  3KFW X;  3ZMU B;  3SP1 A;  3V5U A;  2WBL A;  2YU1 A;  3B0P A;  2KMF A;  4G63 A;  2PJQ A;  3RYL A;  4H63 V;  1W2W A;  2HV7 A;  3O1I A;  2CNW A;  4IGU A;  3T4R A;  3LLI A;  4OYK A;  3Q6N A;  5LGN B;  1E1H B;  3B13 A;  2IXM A;  3KVB A;  3IBP A;  1ZHY A;  1RJ9 A;  2X9H A;  5L3D B;  2RA1 A;  3CQZ A;  3PE0 A;  5M4Y A;  3AA0 B;  3NRH A;  3K3Q C;  1MND A;  3EQL F;  2J0W A;  3C50 A;  4C7O A;  3H65 A;  2D5U A;  3PUR A;  3I0O A;  3R84 B;  4BJ5 A;  4UIG A;  5E2Q A;  2NOX A;  3WI3 A;  3SRZ A;  4CZZ B;  2KLQ A;  3B0U X;  5BMV E;  4H9P C;  1WGW A;  2ODU A;  4HFF B;  3NDB B;  1WYC A;  3O4X E;  3SNH A;  2WMO A;  5CA0 E;  1FFT C;  3UUN A;  3UMK A;  2LT3 A;  3AVR A;  5EHH A;  3C4X A;  2WZG A;  4EIW A;  4B6X A;  1OKK D;  3GAN A;  4EB6 E;  3AAA B;  4I4T E;  3JYH A;  3E08 A;  3I5P A;  1D1B A;  5LGU B;  4YFS A;  3F47 A;  4CS7 A;  2W4M A;  4U5E E;  2V1D B;  3DJN B;  3NBX X;  3ASO C;  2CE7 A;  2RP4 A;  1MIV A;  1BR1 A;  2BVM A;  2Q3T A;  3O1J A;  5JDF A;  3X1O A;  4DBQ A;  5JR9 A;  4KP3 C;  3S29 A;  2WZF A;  1QSD A;  2D2S A;  4HKA A;  2Y3H A;  3E9V A;  4KNV A;  5HXR A;  3DJU B;  2E9X C;  3RYI E;  4N06 A;  3N9M A;  2WVQ A;  4A56 A;  4E7S A;  4AE4 A;  4CI1 B;  4H9Q C;  1HF8 A;  4ZI2 D;  5JR9 B;  3FHD A;  2YK0 A;  3NRY A;  5L2L A;  2D5R B;  1D0Y A;  1LS1 A;  1TWA A;  1FTS A;  4J2C A;  3PU8 A;  4AE4 B;  5KYX A;  1U5P A;  4JLE A;  2WWU A;  3RX6 A;  1ZEE A;  4PJM A;  3AVS A;  1FMW A;  4XLP F;  3N9L A;  4EYU A;  1UCU A;  2E9X D;  2Z6E A;  2HPL A;  3LBX A;  1HCI A;  2V7J A;  1S35 A;  1WR6 A;  3GOD A;  3QUJ A;  3QMK A;  4H9S E;  1O5H A;  2ZXW C;  3LBX B;  1IAP A;  2BZB A;  4BA9 A;  2MTQ A;  3AB3 B;  4A2N B;  3C4W A;  1M2V A;  3RH3 A;  2HV6 A;  4OD5 A;  2YIN A;  4X1K E;  1VOM A;  4Q5S F;  2SPC A;  1ZU5 A;  2EIN C;  3FB2 A;  2XAJ B;  4BJ6 A;  3RRC A;  5CI8 A;  2IW5 B;  4QXB B;  1D1A A;  4G7Z F;  3LEV A;  3SEO A;  3IF8 B;  3K1I C;  4YJW A;  2P7V A;  5E3C A;  2A2F X;  5D91 A;  1ZU4 A;  4YJ3 E;  5B1A C;  2H7B A;  4EYY R;  1D1C A;  3KVA A;  1HX8 A;  2Q9Q A;  4YT4 A;  4FX5 A;  1IZM A;  4XBF B;  2EIJ C;  3OYX A;  2M4E A;  1MMN A;  2CCQ A;  3ZMV B;  3HKE E;  5T1D B;  5CI9 A;  3CKD A;  1MIY A;  3UTK A;  3MK7 C;  3OYZ A;  4FWV A;  2G62 A;  5LBM A;  1VRB A;  2Q9Q B;  3CVR A;  2PG8 A;  4O4H E;  2K9A A;  3VAY A;  2KWH A;  2IXP A;  4UVB B;  2HH7 A;  4TN7 B;  2L9Q A;  2MYS A;  2DI4 A;  4CSA C;  2KGO A;  5H6Q B;  2L3L A;  4AKL A;  4YT5 A;  3CWZ B;  2LSJ A;  2A1D D;  5JRC A;  5L3E B;  2YEV A;  2PX0 A;  2X0L B;  3O39 A;  4QX7 B;  5KYW A;  1KK7 A;  4U5G A;  3MAC A;  4UVA B;  4NUU A;  1SA0 E;  2NTX A;  2ZXR A;  2PBI A;  3ESL A;  2XAQ B;  2WAU A;  3LNR A;  2CW0 F;  5B1B C;  1G73 A;  3BQI A;  4HFV A;  1X79 A;  5LHG B;  1PD1 A;  4QDL A;  5HSW A;  2WM9 A;  4ZOL E;  4BJ5 C;  2YZS A;  4K0D A;  4YT2 A;  3KH2 A;  1M57 C;  3C98 B;  1YW0 A;  4XZC A;  5FXX A;  5KMG P;  2A68 F;  2W4B A;  3D0T A;  3ZC1 A;  3IHR A;  2CGE A;  3SS1 A;  3B9Q A;  4GK5 E;  4EBB A;  4C3E A;  5L3V A;  3M1C B;  4MLK A;  2CXD A;  3N9N A;  1Z63 A;  3N5L A;  1TWG A;  5F3J A;  3ZYM A;  3QK6 A;  3N2G E;  4MQ9 F;  5LG4 A;  2XTL A;  2X9Y A;  3WAK A;  4MAL A;  4P0A A;  3HA4 A;  3ZN1 B;  2H3R A;  1ZV4 X;  2J45 A;  1Z3I X;  2R7V A;  3VKG A;  2K5B B;  4O4J E;  3LAY A;  4YT8 A;  4JVS A;  4CXW A;  3MXZ A;  2LOP A;  2BVL A;  4UEL A;  1SMY F;  2VH3 A;  3ZSU A;  5JR9 C;  2VL8 A;  3EGD A;  2IOQ A;  2DWK A;  3CX7 B;  2LSG A;  1NU7 D;  2XAH B;  4BG0 A;  5LYJ E;  5HWY A;  5LJN A;  3FXD B;  4QHO A;  3EHM A;  1LKX A;  3JC6 C;  3KV6 A;  5EGY A;  5KYN A;  3CX6 B;  4C3D A;  3K33 A;  4PJL A;  4CIH A;  5J1G A;  4WBN E;  3V7O A;  4LLC A;  2C5J A;  2XHE B;  5DAB A;  2EIM C;  4V1A v;  3I9Y A;  4KUM B;  2G0U A;  2BE5 F;  3NG1 A;  3JC6 D;  4DVY P;  4GK0 E;  5FP3 A;  2ODV A;  3SOL A;  2J9V A;  2XUE A;  3N0T A;  4GOU A;  5LNK A;  1MMD A;  3EH2 A;  4KMC A;  3I5Q A;  5FY1 A;  5L3F B;  2FGY A;  4ADZ A;  4X1I E;  3ZYL A;  1BR2 A;  4BJ6 C;  3KIN B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...