3RH3A

Crystal structure of an uncharacterized duf3829-like protein (bt_1908) from bacteroides thetaiotaomicron vpi-5482 at 2.10 a resolution
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
256
structure length
239
Chain Sequence
TEELDDASKVINYYHMSLAVLRHVANAKDINAVLGYMEQTGTAELLDPGDYFNPEVRQNLKQNYAGLFNVRTQFYDNFNKFLAYKKSKDTAKTAQLLDENYKLSVELSEYKQVIFDILSPLTEQAESELLADEPLKDQIMAMRKMSGTVQSIMNLYSRKHAMDGVRIDLKMAELEKELKAAEKIPAVTGYDEELKNFQSFLSTVKSFMNDMQKARSKGAYSDKEYQAMSEAYEYGLSVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized DUF3829-like protein
publication title Crystal structure of an Uncharacterized DUF3829-like protein (BT_1908) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution
rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Structural genomics, unknown function
total genus 89
structure length 239
sequence length 256
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-04-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.820 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3rh3A02
1.20.120.930 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3rh3A01
3RH3A 3IEEA 4YJWA
chains in the Genus database with same CATH superfamily
1D0ZA 5F5WA 4YSXA 4CDAA 3R7CA 2NSGA 3RH3A 4I1MA 4JTCB 1D1AA 2RPAA 1YAUO 2EHOD 2PFDA 2VB6A 4IB4A 2Q9QD 2IMLA 1TR2A 3DD7A 3ZMZB 2XJ7A 4A4AA 5L3DB 3AGUA 2F22A 2PBEA 5FL1A 1WYCA 4L6RA 4N6CA 2CNWA 4CS8A 4D4NA 1FFHA 3HNJA 3AE1A 4IE4A 5BUOA 2WWUA 3L3PA 2XAFB 2X51A 1HG2A 4N4WA 2V7MA 2HS5A 1H7CA 1QLBA 3HKEE 2XLOA 4EIYA 3G4ZA 4U7IA 3NWIA 5AQGB 5HCJA 3PTRB 1YLMA 4HKAA 4JKVA 4I55E 5HEOA 5AQNB 4A98A 3K7DA 3US6A 2C5KT 2W66A 3UGOA 3DKAA 2KK1A 2ZM0A 4H63H 3Q9DA 5L3BB 4JI7T 4PJMA 3CQZA 3LK2B 2R03A 4DIDB 2LD6A 4YT8A 1O5HA 1F1MA 2YL3A 2FJEA 5L0FA 5L3QA 2XSEA 1O87A 1E83A 1LVKA 4TWHA 4V1Av 5LCYA 2QY9A 1M6TA 2XRHA 3T4RA 4YHHT 2NG1A 3AQBA 1FJGT 4GOUA 3LS1A 2DWKA 2L81A 4IGUA 3ONJA 4JCZA 2YDQA 4I1OB 4Z9IA 2W2UA 1RJ9A 4AK9A 4GK5E 1HMOA 4AL1A 1YA7O 2Y39A 5FMNA 2J0WA 1NU9C 2ACXA 2YK0A 4JC7A 4HFDA 5AQHB 2E8IA 3AA6B 1DOVA 4K7BA 2CBJA 4OYKA 2UXCT 3PU8A 4C7OB 2XM4A 4O4JE 1E2XA 3FOPA 3C63A 3BQKA 2W4XA 1GGQA 2HKVA 3VRBA 3IEEA 1YVIA 3VR9A 3CX8B 4TV9E 2UUCT 4UF0B 4LLCA 2XQ4A 2V1DB 3A5XA 3RKOF 5BMVE 1VLTA 4EBJA 4ILBA 2EPOA 5FXVA 3JTLO 3RQGA 3K1IC 4X64T 2ZXRA 1ZP0A 3ZWIA 5KYXA 4DBQA 2XM0A 4BJ6A 4WJ0A 1A7DA 1MIVA 4BPMA 2R7RA 2V6YB 2NW7A 2LE8A 1Q0MA 1YQ3A 4YL3A 2DWGA 2WMNA 2ZM6T 5L0IA 4OIOF 4EOZB 4HWDA 5HXCA 2BG9C 4DOZA 1TWCA 4ISTA 1UURA 3M4BA 5LBQB 4LF5T 4G7OF 3UMHA 3AE6A 4PFOA 4ILCA 2D0UA 1OKKD 2JX0A 4DVZA 4H54A 2E87A 3LBXB 3N2GE 3WI3A 2KNHA 2X9YA 3PHF2 3GA8A 4HFVA 1QSPA 4K1OA 5HV9A 5JVDE 4H9QC 2HUJA 5LG4A 2QA7A 4MVZA 4AQFC 5IHYA 4LACB 3SFEA 1XZYA 4UVBB 3EQLF 2NW9A 2DYSC 4RD9A 4BA9A 4L0RA 4Z90A 4O4HE 4ZEYA 1US7B 5JDNA 5FNVE 5LB7B 3SRZA 5LHIB 5JR9C 5HWYA 3SP1A 2LSIA 2HV7A 1M2VA 3LNMB 2V6XA 4DR6T 2HSBA 2YINA 5FP3A 1TWHA 4IE5A 2BBHA 1VLSA 4O79A 2IXOA 4HFFB 3SYNA 5LOVE 2JD3A 2JQQA 3S27A 3K8PC 1SF8A 5LBMA 3RVYA 3I1AA 4NPPA 3TJ5A 4U3CA 2FBWA 3IPMO 4ZHQE 3DM5A 5LP6E 3U0CA 2B1EA 3Q2MA 2XLVA 4LF8T 3T6JA 2BG9E 2WVNA 3L09A 4O4LE 3RRCA 3FZFB 3NRYA 2ZLYA 4P0AA 5ABHA 3NKDA 4GKJT 5H6RB 2R6GF 2XAHB 3PE0A 3ZKRA 5L4EA 3VHLA 2AU5A 3HKKA 2FFHA 1UX5A 4RBNA 1YZCA 2V7KA 2W67A 4Z91A 2XM2A 1QPUA 1V9DA 3EGXB 1IBMT 2GA0A 2J9VA 2M4EA 3ZMVB 3IQTA 2BL2A 3RHWA 5CGMA 4LMLA 1RKCA 2W45A 2A72A 3U8VA 5A6BD 5F8PA 2P9BA 3EVYA 1O3XA 4EYUA 4A97A 1M57C 2CWYA 4MQ9F 2XSBA 1WN0A 3C18A 2KMFA 4DXWA 3UUXB 1GQAA 3EDUA 2OKUA 2V26A 4LFAT 3CVRA 3D0TA 1FMVA 1J8YF 1L0VA 1NSGB 5JS5A 2UXNB 3L34A 3FHDA 2JMHA 3AG2C 1Z7Qc 3AG4C 4JCHA 1HF8A 2ES0A 1LIHA 3FXDB 5LA6E 4CN1A 1ZHZA 4JVSA 4Z8XA 3Q5DA 5HEHA 1HMDA 1ST6A 3EGDA 3P50A 2BC5A 1W0AA 2Q9QC 4YHJA 2Y3DA 3JSZA 1EZ3A 3RYHE 3V7OA 2ZM2A 1XDOA 4Q25A 3RF1A 2LM9A 4KNWA 1LM3B 4IDOA 3RVZA 4DV6T 4EKWA 4G0HA 3UFEA 3OYXA 4DR2T 1N36T 2CHNA 3ITFA 4DVDA 4GEHA 4TV8E 2NW8A 4GKKT 2KZ7B 3ZSUA 1WLXA 1HG5A 1ZZPA 2N9DA 3P4SA 3ZVRA 4JUYA 1ORYA 3T6BA 4BEMJ 3LLIA 3E08A 4ASKA 4QXHB 4HFIA 2GDCA 4BAYB 3LESA 4C3BA 1MQVA 1SZIA 3ZT5A 2HMZA 5L3FB 4KX6A 3H2UA 1VYKA 2D5UA 3E9VA 2E9XC 2OJED 3FOOA 3GWNA 2H7OA 4PACA 3UUBA 3N9PA 4PK6A 2CM0A 2I8BA 2IM8A 1OR3A 2NUTA 3KBTA 4JTDB 1SE7A 1U6HA 1WATA 1A7EA 3TLSA 2FGYA 1YD8G 4MVUA 3Q7GA 3UT5E 2WZGA 5HAXA 3AEFA 1I6ZA 5JDGA 3ZQVA 3CX7B 2M6IA 2CXDA 2JPFA 2A2FX 4LFCT 3QTHA 4HFKB 5JTGA 1OXBA 2P6VA 4H9SE 4X65T 4HWHA 4ZS2A 3GM2A 2J45A 2X9HA 2O9XA 1N33T 3GM3A 5AQOB 2DYRC 4EUKB 2ZMAA 4O6YA 2WB7A 2H7VC 2R7XA 2VURA 5KMGP 3EI0A 1JOGA 3AEAA 1E85A 2EPKX 1J8MF 2A9UA 3W4YA 1HW2A 1Y4CA 4AE4A 3CEXA 2CCQA 2GWWA 2OLTA 1OEDE 3E22E 3RIAA 1Z6AA 3Q6MA 4IE0A 1M7KA 2LFFA 5T3WA 5HEUA 3JCUQ 4XPWA 4X1KE 3HKCE 3CWZB 3PJAA 2VWAA 4CN6A 4GYSA 2CWOA 2FJAA 3DE8A 2LP4A 3I9YA 3H65A 3S28A 2HN1A 4IDZA 3DTOA 2QE9A 1N1CA 4OD4A 3ONXA 4XAXB 1Z8UA 4IIJE 2UU9T 3VRCA 3K1IA 3RQWA 1T6UA 3H2VA 1YKHB 3FAPB 5LHGB 5CA1E 1YJGA 4Q4ZF 2G62A 1BZ4A 1IAPA 1ZKEA 5DABA 3RIUC 3EG9B 4G7HF 2R25A 4EEDA 2J9UA 3A7MA 3T1HT 1WCRA 3KV9A 2IXNA 4M63A 5JRAA 1M2OA 4LDKA 4PJNA 2FJDA 2L6HA 1T6QA 1NWMX 1N32T 3MFNA 5AQTB 3X1DA 4U5EE 5CA0E 3AXJB 4ILAA 2DCFA 3HLZA 4LLEA 1VMAA 2Z6EA 3BQIA 5JDQA 2VK9A 4WZXA 4ZS3A 2LSKA 4JI1T 2BS4A 2JMKA 4LDQA 4IAOA 2QRXA 3JCFA 4JTAB 2XQ3A 3RYFE 4AQFA 5FY7A 4BJ5C 2MYSA 3B5MA 2IW5B 4BG0A 2IHR1 3IQ6A 4P9TA 4IWBA 5COMA 3FXHA 4X66T 4ZZCA 2LQGA 4CDYA 2W61A 5ABFA 3TQOA 4D4XA 2MPKA 4JJGA 5EZYE 1XNQT 1S35A 1OCCC 2HMQA 2BZBA 4YT0A 3UUNA 2C04A 3QOFA 3PJAJ 2KLQA 4OK0A 3QZCA 1FMWA 2BE5F 1U4QA 1BDJB 2E5VA 5AQRB 5JRCB 2HSQA 3KV6A 1SMYF 4EBBA 3I4UA 2X67A 5ADXL 1QKRA 3ZJ1A 4MALA 1Q0FA 2LT3A 4OIRF 5BQIA 3FZKB 3LJBA 3NMKA 1PCXA 2LHNA 3ZN1B 2PJQA 3JC6D 3UU4A 1YYXA 3IA3A 5E0OA 1UX4A 3TD7A 2MBGA 1XZQA 4EV6A 3N24A 4DR5T 4IAQA 4CXYA 1I94T 4ZOLE 2P61A 5COGA 2K9AA 4EYYR 1CGOA 4DRIB 5FL0A 1NLXA 3G4XA 2P0NA 4H9NC 1OXZA 2HJMA 4JI8T 2IXMA 3VU7H 2UXBT 2Y3BA 3NRHA 5L3VA 2VCBA 3IQCA 1KU2A 3S4UA 4NTBA 3SOLA 5GPGB 1LE4A 3AEDA 4EGWA 1XMQT 3AE3A 4M1PA 2R7VA 3MLGA 2WU2A 3Q5XA 1QLEC 2LCHA 2CW0F 1V74B 1KNRA 4I44A 4O6NA 5A1LA 4FWVA 2Q00A 5DQZA 5AQKB 5BR8T 3JT1A 1TWGA 5JUAA 1NZEA 5AQFB 3C8GB 4B3MT 1ZHTA 4EAHA 1TKNA 3TOLA 4HGAA 2EHOA 4K0UA 5JP7A 1IZNB 4CS7A 4IRUA 2AXDS 1WRDA 2Q9QA 2D4UA 5A6KA 3U8PA 2OV9A 4P09A 1VB5A 3I5PA 4EB6E 2CEAA 1WR6A 5AQVB 4ANJA 1G73A 1X9BA 3PV0F 3X2QC 1CPRA 2OG2A 5HWXA 2XZEA 1CPQA 2WM9A 4FJOA 1KK7A 2HH7A 3O1HA 2Y48B 1QZXA 4U5FE 3ZIBA 2YEVC 3Q7LA 3X1OA 3U9JA 3DZAA 4I0UA 2YVKA 3EJNA 5HXEA 4U5CE 3ECSA 2XPKA 2NTYA 4U33A 2Q9AA 4B6XA 5F5HA 5JREA 3HNLA 3UU5A 5KDMC 4HN9A 3QVYA 3EZHA 3SZRA 5FY1A 4LF9T 2MOZA 3ETVA 3W2VA 5B1AC 3Q5EA 3N9NA 1YYJA 4OD5A 2LM2A 5AQLB 2WVOA 3HNKA 1AVOB 2RP4A 2B0HA 3AEGA 3PDYA 3H3AA 4QKNA 3DJNB 3UFGA 1ZW3A 3LDQB 3QUJA 3WAJA 1JAFA 1RJ9B 5JVEA 4CXWA 1S94A 4YY3T 1SR2A 3NZQA 3ZT7A 2L9JA 4YWQA 1YQ4A 2R7SA 3GORA 4CIHA 3F57A 2E9XD 3QB5K 4HE8D 4YFSA 4DUYT 5EK3A 4A56A 3C8GD 1B7TA 2LLYA 3ZTMA 4E0IA 2LRLA 2XY8B 3ETUA 2DLRA 4WYVA 3ZDLA 5KYWA 2K3WA 3NG1A 3FAJA 3M65A 1HR0T 4C3EA 3JZ0A 3UNGC 1ZHYA 4UELA 1TQGA 2W63A 2WZHA 1CHUA 4GQHA 4LFBT 3CQGB 2Y3GA 1ORJA 4JV5T 5B1BC 4C3DA 2EIMC 2PTFA 3PUQA 1E86A 1TFOB 5KYXB 5T1DB 3TLUA 5KYUA 5AQQB 3N2ZB 4LMJA 4EZHA 1IW7F 5KX5E 1S05A 4WGZA 2V7IA 2BDEA 4XTKA 4IL4A 3KVBA 2L3LA 3ZCJA 1H7IA 3AAEB 2XXAA 5LMNT 2WSSV 3L39A 3P4PA 2YQYA 2HN2A 3GEEA 3QW1A 2IDOB 5L3CB 2H88A 3LJCA 1C03A 1QQ3A 2KINB 5IYZE 2EPLX 4IDPA 3RX6A 1J5WA 4U5BE 3M3ZB 4JIOA 2KNDA 1OKKA 3VR8A 3WAQA 4DNDA 4NTAA 1CUNA 1WYBA 4UVCB 1MNEA 5E3CA 2TMVP 4AKLA 1LI7A 5TAOA 3U3IA 4QH4A 3WAKA 3PUYF 3OKQA 3DI5A 2I15A 4U5DE 4YSYA 3W8HA 4TN7B 4O2BE 5DVWA 1N34T 1OCZC 3NBXX 4WBNE 3FVYA 5HXHA 4CS9C 4CI2B 4DVYP 5LJNA 1M2VB 4N6HA 3AAIA 3R6NA 3LEVA 4BJ5A 5JT4A 1JPNA 2J62A 2ODUA 3CKDA 3N9OA 2R7OA 3TLTA 2WDRA 4UEMA 1D1CA 5AQMB 1KNPA 3OTOT 2OA5A 2LIGA 3LG7A 2EPMX 3UMIA 4K0DA 2A1DD 4B3TT 5D91A 2LSJA 5LYJE 3E70C 4GK0E 4ZZBA 4DMWA 1PD0A 4MW3A 3CMLA 5E33A 2J8WA 5CI8A 2ACZA 4OYJA 1JR8A 5HSWA 4FX5A 1VK5A 3NMJA 1HW1A 5JDFA 4DV5T 4WABA 4Q7CA 2WZFA 3KYJA 3JC6C 4LF7T 4HFEA 5FVKA 1NU7D 2JQ9A 2K48A 3KH2A 4DO0A 2EPNA 4ZLCA 3EFOA 3CQXC 2A0BA 2YLGA 2KSRA 2LEHA 3ABKC 2B76A 2CPTA 4CDVA 2XL4A 1Y01A 2VL0A 4ZI3C 4KNVA 1LS1A 3M4CA 2W00A 4H9RC 4WW0A 4AQGA 2NPUA 2LKHA 4CQIA 4PK5A 4E18A 2MAWA 4HEAA 4EZ4A 4KI0F 1LS4A 4IE6A 2QLAA 5A6BA 4J30B 2UUAT 2UXDT 1IBKT 1MMDA 1NG1A 2XQ5A 3O1JA 4TZ4C 4L9IA 2E2AA 2V7JA 3OJAA 3FBZA 1YA9A 1UUSA 4GIWA 2XTLA 4JRZA 4K0KT 3UGPA 1IBLT 3LLKA 2F4VT 4DV0T 1MMNA 4QI2A 5BQGA 1W2WA 4XZCA 1V54C 4KMCA 3A9CA 2DGJA 1ZU5A 2W4BA 1GQEA 3JRTA 4UIGA 2R7TA 4TUYE 5LGUB 2OOCA 1G4US 2R7UA 2YL7A 4JI2T 4XLPF 2BKOA 1WOLA 2L7AA 2W0GA 3GEIA 4XLNF 5HEGA 4J32B 3HR0A 4YLHA 5F28E 3U3FA 5AQJB 2LSGA 3KV4A 3UTKA 2UXXB 5E3AA 4OHFA 2LOSA 5LG3A 4U5GA 1IJ5A 1MNDA 1IZMA 3SEOA 5LJMA 1WASA 4ER9A 5DQVA 5HEJA 4L5GA 2A3DA 2H3RA 4YT5A 4QH1A 3GWLA 3ABVA 2P7VA 1OEDC 3AG3C 3FZLB 4X5TA 2Q4FA 4YK5A 4Z9HA 1B68A 1LI5A 2A69F 3QB5A 5L0JA 2M64A 1Z3IX 4DV3T 4QX8B 3S9OA 3ZSSA 4X62T 3RYIE 4DR1T 2X9WA 1VTMP 4MTFA 4XEKA 2PFVA 1E1HB 4DRHB 3GN5A 1OR2A 3K3OA 3MJXA 4ONSA 2XS1A 2BBJA 5CIVA 4YSZA 4HEAJ 1Q0KA 1UGOA 3G06A 5EGYA 4KHZF 2KYHA 4XEFA 3PU3A 3UU6A 3ZCIA 1KFYA 2PP4A 3SS1A 1JNZA 2BS2A 1APCA 1YDIA 4XEVA 2PG8A 2OCCC 3G50A 1UK5A 4CI3B 2KQ9A 2ODVA 1H9TA 1C17M 1W09A 4U9EA 4NC3A 3W15B 5KYNA 5M4YA 4DV2T 4MNDA 4NIQA 3SXZA 4TWDA 4U72A 3HKDE 1HY5A 2UUHA 3RF3A 3ZMTB 3P7IA 3SNHA 2LK4A 3F31A 3N2OA 2JRKA 2QYWA 1FAPB 1D1BA 3V5ZA 5K0IA 2BS3A 3B71A 2X0YA 1MMAA 2CHOA 3QK6A 4YL0A 2UUBT 1HE9A 3E0ZA 3C4XA 5T3TA 3AEEA 3A8YC 5FY0A 1LPEA 2YDSA 4MTGA 1NAFA 2XQAA 4KHPT 3VF0A 5JLIA 3VRAA 3SXMA 4MVRA 1HTJF 2E5LT 1A0BA 2FAPB 3OYZA 3CSKA 2J4GA 4DJ9A 3L8IA 2M6BA 1JMWA 2KT9A 3JAFA 3ZQYA 5IUXA 2CBIA 4XQ1A 3JADA 2XAQB 5DS4A 4DR3T 2D9DA 3O39A 3P8CD 3ZC4A 3KKBA 3PMRA 3RYLA 3VM6A 4IARA 3FHNA 4U2ZA 4BJTA 2NR4A 1WFDA 4DR4T 2Y3HA 4LF6T 4JYAT 2YL0A 1UCUA 2WVQA 3NYJA 4NUUA 3C8ZA 3AE4A 3C4WA 2BG9A 3DP7A 3UUMA 4ZI2D 1HCIA 4ADZA 2WDQA 1OCOC 3RQUA 5ABFB 1U5PA 2CXFA 4CS9A 1NENA 4OFZA 5LGTB 4PR9A 4GYTA 4A2NB 3RQFA 3V5SA 5J2TE 2VL8A 5GONE 2CCYA 3JSEO 2NUPA 4X0RA 2XHEB 2KJGA 2Q9BA 2X0LB 2XM1A 4DR7T 2R7QA 5FXXA 3OA1A 3M79A 4G63A 5JQGE 3PUWF 3KMIA 3NKEA 1JPJA 1ORSC 4LERA 5E2QA 2SPCA 4O7GA 4PJJA 2W62A 3DXJF 5JR9A 3EG9A 5EHHA 3ZYKA 4DBRA 1TWAA 1KNYA 4XPYA 5ABGA 2WAUA 2XQYA 1V55C 3TJ6A 2Y8DA 2J1DG 4I50E 5L3EB 3NYMA 4E0HA 5DJQC 2AP3A 3JAEA 3UMKA 4W8KA 2H8AA 2IC9A 3ASNC 3GWHA 4F6RC 1LRZA 4JEHB 1RKEA 3ZYLA 4CBEA 1O3UA 2YLIA 3K6BA 2JQKA 1JNRA 4H4KC 3T9OA 4AX2A 3ANWA 4HWFA 3EDVA 1Q0GA 4LF4T 3BEHA 1T7SA 5HCMA 3C50A 1QVXA 4ZI3D 2ASRA 2I6HA 2N1GA 3ONLC 3DM9B 1ZHCA 5DQWA 2YL1A 3LSVA 3U3BA 2NSFA 1FIOA 2CLYB 4ULVA 3FXEB 4C91A 2J7PD 2EHOB 5L0GA 2A6EF 3AOUA 2YU1A 1VRBA 2QGSA 3U2LA 4JI0T 3ASOC 2XLEA 3PUZF 1NBBA 3CQCB 1K40A 3BRJA 3ZMSB 4OIPF 2GAQA 2AE9A 2WZIA 3IBPA 3N9QA 3UULA 2Q7RA 3ZLIA 3RPUA 4DRJB 2X0CA 3B13A 4P9FA 3K66A 1R5ID 3AVSA 3Q6NA 5IY5C 3KL4A 5FZTA 4NY3A 3C64A 3QVZA 4W8PA 3V5YA 4ZLDA 3DMDA 3OVUA 1K04A 3RIFA 1MIWA 4N78D 2YRFA 1T8BA 4UDVA 3B29A 4HFCA 4LDRA 1I5NA 2KGOA 3AECA 2XL6A 5L47A 4I43B 2C5JA 4CJGA 3LNRA 3C62A 4MVSA 4OX9T 4PFPA 1ZW2A 2G3VA 2MTQA 3AQCA 3MZKB 4J7TA 5JH7E 3RKOA 4EBKA 5F5FA 2X9XA 2XLMA 1HX8A 1OEDA 4IE7A 4AXPA 1R8IA 2EIJC 4J7YA 2XAGB 4MVOA 3LFMA 1KF6A 1ZU4A 2VCCA 1DU2A 4PJLA 3SXKA 1RMVA 3OPCA 3AE9A 5DLJA 5EK2A 3MX3A 3AG1C 2IBFA 2WCAA 3J9X1 4G78A 2VKJA 3LK3B 1R4TA 2E9XA 2XSAA 2MWQA 5KYWB 1SA0E 4HE8A 4JI3T 3V5UA 1HNZT 3ZPOA 3EAMA 3C8GA 1XMOT 2I59A 5BQHA 5FYMA 3KBUA 5KYYA 1Y64B 4IGGA 5H6QB 3CIRA 5L3GB 3KV5A 1M56C 4CX9A 3OEOA 3PUXF 4IDQA 3FZMB 3LAYA 3U5SA 1H6GA 1HE1A 2C03A 2IAKA 4MBQA 5JDLA 2UUIA 3NMIA 5KYUB 1E84A 3N9MA 4YN0B 3N9LA 4PW8A 1BR2A 4B6IA 3FDQA 4H63V 2VH3A 2VKDA 1SUMB 3CK6A 3SWHA 4AQYT 4DUZT 2R9RB 3F47A 4TWFA 3NVOA 2XXAB 5JSLA 2HFIA 1EI7A 2CNWD 4J2CA 1EKYA 4UXNB 3CAXA 2V3CC 2IUBA 3TKLB 2LFDA 2PX3A 1YXRA 4MHCA 4CZZB 3UU8A 3T6GB 4MLKA 4NXMT 2BVMA 3L0IA 1GS9A 2CYDA 2WQYA 4G7ZF 4EWCA 5DS5A 4ULWA 1LKXA 3TOMA 2N2NA 1FTSA 3V5XA 2VQET 3OWTA 2DI4A 2Q9CA 2C0SA 1L7CA 2JJ9A 2XASB 2XLHA 2ZPAA 2J0XA 3TLWA 1BR0A 2JQHA 3ZJ2A 4U74A 4DV4T 1RXQA 3EH1A 4JEUB 4PK4A 3ZEFB 5ABEA 1XWMA 3RIUA 4HFBA 3ZSTA 3RQEA 4P6IC 3ZC0A 4ZI2C 3ESLA 4KUMB 1Z0PA 2CDQA 2PF4E 2KC3A 2YKZA 2QNLA 3T1YT 3RC8A 1WGWA 2H7BA 4B3ST 2DL1A 5CFBA 4WGYA 2LOPA 4ERRA 2R02A 1T72A 4UVAB 1WWPA 3NDBB 4ILUA 1WTYA 4JURI 5L0CA 1FFTC 1BR4A 5ETWA 4QWNB 3FMSA 2XQ7A 2JIWA 2V5DA 5C8YE 2OJQA 1CGNA 5AGFA 1KEYA 4C7OA 3RYCE 1VCTA 4OIQF 3PURA 3S0XA 5B3IA 3PUSA 2WY2A 3EFOB 4PAGA 5KXJA 4ISSA 5CJ5A 4KC9A 1UFBA 5A6AA 2V8SV 4XBFB 1TFKB 4UF0A 3B0VC 5LGNB 4JEAA 1HS7A 4CN4A 3K3NA 3EHZA 3U78A 2OQMA 2J46A 2LHRA 3PUGA 1W9RA 4MVQA 3ZT6A 2DNXA 4O2AE 4TNWA 2NOXA 3M15A 4QI0A 3DJBA 2CXLA 4ZXLA 1XNRT 4JEBA 3NZPA 4UV8B 3S29A 2V6YA 4Z9JA 3TK0A 3AE7A 3EHNA 4O6MA 3RKGA 3KVAA 2VASA 1C02A 1Y6DA 2D5RB 3QC9A 1QUUA 3KYIA 4QDLA 2YN6A 2EIKC 3CZ6A 3BK9A 3ZMUB 3KPHA 4EEBA 5CI9A 4Q5SF 4JJFA 2WP9A 2RSEB 2ZM8A 3TLVA 4JBWF 1A41A 1PV3A 4P0BA 3I0OA 3LBXA 2W9YA 4IHJE 1L3PA 3RI5A 2DB4A 2YU2A 1E2AA 4WNKA 2XS8A 2H89A 1OWAA 2P1AA 3AA7B 3VAYA 1W0BA 4AKIA 1T98A 4KP3C 3P4WA 3O4XE 2WS3A 1M62A 3N0TA 5J1GA 3PDMP 3ZC1A 2IC6A 5A6JA 3DAGA 3C4ZA 5FXWA 3I5QA 2LRKA 3ATPA 2ETSA 5EK0A 5DQTA 4EHPA 2BKNA 2YHSA 4U31A 3EGDB 4YL1A 4NUVA 3RC3A 1OQCA 3MYFA 5EK4A 1G5ZA 1XZPA 5J0ZA 3TULA 3SFDA 1NFOA 2IIUA 2VC9A 1QSDA 3F2EA 1G4WR 1FNTc 4QX7B 4RDAA 3LEOA 4GYRA 2NP9A 4I4TE 3B0UX 1NFNA 3GANA 2WMOA 5TJ5E 2WDVA 2KW3C 3UQ7A 2GK9A 4JZAA 2QVAA 2VVSA 4YTNA 4FESA 4YT4A 4AI6A 3ZN0B 3AVRA 1FEWA 5AFUL 5LXTE 2ICWG 3NKZA 2LJLA 3HA4A 4MW8A 2KXPB 3GN5B 3ZYMA 2ZXOA 4AKHA 3HNIA 5FCLA 1SHZC 4CIPA 3DJUB 3IHUA 3I9WA 4NXNT 3GODA 2YEVA 4BEJA 3KINB 2L6GA 3J7Yq 4MFRA 3U2MA 4AL0A 1HNWT 3BQLA 2WL8A 1ZHXA 3Q5WA 4YTPA 2CLYC 4CSAC 4COFA 2NUTB 2EHOC 3FZHB 3P4RA 5FVLA 5J2UE 3EGXA 1ZHWA 3JYYA 3L8RA 3PUVF 2X0HA 3HJCA 1VOMA 2PX0A 2RA1A 3WHNA 1PD1A 5FXZA 3RRWA 5L4HA 3C51A 3MA9A 2L6FA 3UR3C 2YLDA 3I0QA 2LKGA 1FR0A 2AVKA 1RCPA 3B9QA 1OW8A 4H9OC 3HTKC 1T01A 1K05A 5F3JA 3SXYA 4AE4B 4DV1T 3EZIA 1YKEB 2WU5A 4FAPB 3S90A 3VKGA 1MIYA 3O9XA 4R32A 2OEXA 3UQ4A 2IXPA 3IQ5A 4IJJA 4YT2A 1ZOYA 2ZXPA 4KI2A 2HPJA 1G8XA 2KSFA 4CS8C 4OINF 1CGME 4JI5T 4HWCA 5LHHB 2L8KA 5LMUT 3W2WA 3JRMO 3L1MA 3RIPA 4JW1A 3MXZA 3FBLA 2V5CA 3IF8B 4QXBB 3N2KE 4FI5A 5L2LA 2HJ3A 2K5BB 2XQ6A 1A7VA 3AGTA 3RGLA 4DMVA 2D2SA 1ZYRF 1J1JA 2OU6A 4LMKA 3K3QC 2C5IT 5AQSB 1HNXT 1MMGA 1T9KA 5L0HA 2IOQA 3ZTZA 2RD9A 1AUEA 3MYIA 1S7ZA 5JDHA 5D92A 4CJOA 1T6IA 2G3KA 2L9QA 2YDRA 2K24A 4YJ3E 2VKHA 3ABLC 3KFWX 4MVMA 3UU3A 3NYLA 2BG9B 4YTMA 5HXSA 4XPXA 4HTEA 5HXRA 5COFA 5HYAA 3A11A 2M67A 2NTXA 2FUPA 4JI4T 3EABA 3RLFF 4X1IE 3U9MA 2YOEA 4B3RT 3OBVE 1X79A 5JDMA 3AB3B 3DE9A 5DS6A 2VCAA 3AA1B 1LVFA 4JI6T 3LS0A 1ZEEA 2NUPB 2X68A 3R84B 4NCQA 3WODF 3H37A 4P1NA 2OEVA 4EXTA 1OXKA 3DWWA 2CE7A 3MACA 1VCSA 3HI2A 4PNIA 1JRAA 2X66A 2I0MA 1EA8A 4MTOA 2J9WA 3CPZA 2BVLA 2KWHA 1KTMA 3GEHA 4O8SA 4N06A 3QNUA 4X20E 1KNZA 2YKSA 4BJ1A 4O4IE 3EH2A 4UR9A 1J5ET 2B0JA 5JR9B 2XQ9A 4U9DA 3C7JA 2QTVA 2FJBA 1ZVZA 3LK42 4I3MA 1OW7A 4KBMB 2XLDA 4X1YE 2IYLD 2VKOA 4YXDA 2EILC 1LE2A 1V4AA 4BJ6C 2HHHT 1NEKA 5C3JA 4AISA 5AQPB 4EIWA 1I4ZA 1UG7A 4QXCB 2EINC 3RW0A 2HV6A 3J06A 2QUPA 4U5HA 4MS2A 4XWJA 1RKEB 2Y6XA 2VQFT 5C2TA 4JE9A 5A69A 2WZLA 2JPUA 3K1SA 1D0YA 4H9PC 3ANWB 4YJWA 3GMIA 4CI1B 4NTFA 3O6XA 1D0XA 2NWBA 4C90A 2HZ8A 3ABMC 3PCVA 4BJNA 3L8JA 2GFHA 4E17A 2Z15A 3C98B 2ZXWC 2LSEA 1OCRC 4TX5A 2WB5A 3MK7C 4IL9A 1T5OA 5IWAT 1AJ3A 3AJMA 5FKYA 4AKRB 1GM5A 3K33A 1VYIA 2XQ8A 3AE2A 1Z63A 3VKHA 3RFYA 2CRBA 4HFHA 3AXJA 4AKGA 5AQIB 2J7PA 3QMKA 2WBLA 4TNVA 4U7YA 2G0UA 2PBIA 1WR0A 1ZV4X 1YZAA 3MBGA 3EUHA 1IJ6A 1EQ1A 1I4YA 4F8HA 1YARO 4G2AA 3M1CB 4E7ZA 2LSYA 1XWJA 3QW0A 3NRXA 4A5XA 4IREA 1SYQA 4NQFA 3W8IA 4IT4A 2YWAA 3PUAA 2DHRA 3POVA 1U89A 5LNKA 2A0UA 3HKBE 4QHOA 2CGEA 3AA0B 1Z23A 3K1HA 3MKDA 2PNOA 4U2YA 2ZD9A 2Q9QB 3N5LA 3S84A 3GM1A 2Q3TA 4CXXA 3R2PA 2A68F 4AIUA 3P4QA 3AEBA 2R7WA 2XLWA 4KBLA 2WWVA 2KWIB 1DOWA 3O10A 2W4MA 3AE8A 5L0DA 1OEDB 1Q0DA 3EPVA 5JRCA 256BA 1YW0A 4F4BA 4UV9B 3AAAB 5AQUB 2BKPA 5CB4E 3O1IA 2D0TA 3CX6B 2V7LA 3HL6A 2AWYA 3KDSE 2J9BA 3B0PA 3B57A 1HX1B 1BBHA 2A6HF 2R05A 5AC5A 2MHRA 4E7SA 2DI3A 4DV7T 3O55A 2HPLA 3VYWA 1OW6A 3WG7C 3T8OA 1U0BB 3JYHA 3H3MA 4QH5A 2YZSA 2XUEA 2XAJB 3AE5A 4IDNA 5AC4A 2E9XB 2CMRA 2CA5A 4JLEA 4YJ2E 3FB2A 1BR1A 2VVNA 4ZI7E 2J47A 4CSAA 1H9GA 3EHMA 2XL8A 1E7PA 1AEPA 5KYYB 3F46A 1XDPA 1Z5ZA 3ZG1A 4HWIB 3IHRA 3LUTB 2Y69C 3DAFA 1HFAA 4WBOA 5B3SC 4BJMA 2AWCA
chains in the Genus database with same CATH topology
1D0ZA 3RH3A 4I1MA 1D1AA 2EHOD 2PFDA 2VB6A 2Q9QD 1TR2A 3DD7A 3ZMZB 5L3DB 1WYCA 2CNWA 4CS8A 1FFHA 4IE4A 5BUOA 2WWUA 3L3PA 2XAFB 2X51A 1HG2A 2V7MA 1H7CA 3HKEE 3PTRB 4HKAA 4I55E 3K7DA 2C5KT 3UGOA 2ZM0A 4H63H 3Q9DA 5L3BB 4PJMA 3CQZA 3LK2B 4YT8A 1O5HA 5L3QA 2XSEA 1O87A 1LVKA 4V1Av 5LCYA 2QY9A 2XRHA 3T4RA 3AQBA 2NG1A 4GOUA 3LS1A 2DWKA 2L81A 4IGUA 4I1OB 1RJ9A 4AK9A 4GK5E 2Y39A 5FMNA 2J0WA 1NU9C 2ACXA 2YK0A 2E8IA 3AA6B 4K7BA 4OYKA 3PU8A 4C7OB 4O4JE 3BQKA 3IEEA 3CX8B 4TV9E 4UF0B 4LLCA 2V1DB 3A5XA 3RKOF 5BMVE 5FXVA 3K1IC 2ZXRA 5KYXA 4DBQA 4BJ6A 4WJ0A 1MIVA 2R7RA 2NW7A 2LE8A 2DWGA 2WMNA 4OIOF 4EOZB 5HXCA 4DOZA 1TWCA 4ISTA 5LBQB 4G7OF 3UMHA 4PFOA 2D0UA 1OKKD 4DVZA 2E87A 3LBXB 3N2GE 3WI3A 2KNHA 2X9YA 3PHF2 3GA8A 4HFVA 5JVDE 4H9QC 5LG4A 2QA7A 4AQFC 5IHYA 4LACB 3EQLF 4UVBB 2NW9A 2DYSC 4RD9A 4BA9A 4L0RA 4O4HE 1US7B 5JDNA 5FNVE 3SRZA 5LHIB 5JR9C 5HWYA 3SP1A 2LSIA 2HV7A 1M2VA 2YINA 5FP3A 1TWHA 4IE5A 4O79A 2IXOA 4HFFB 3SYNA 5LOVE 2JD3A 2JQQA 3S27A 3K8PC 1SF8A 5LBMA 3I1AA 4ZHQE 3DM5A 5LP6E 2B1EA 3Q2MA 3T6JA 2WVNA 3L09A 4O4LE 3RRCA 3NRYA 2ZLYA 4P0AA 3NKDA 5H6RB 2XAHB 3PE0A 3VHLA 2FFHA 1UX5A 4RBNA 2V7KA 1V9DA 3EGXB 2J9VA 2M4EA 3ZMVB 2W45A 2A72A 5F8PA 2P9BA 3EVYA 1O3XA 4EYUA 1M57C 2CWYA 4MQ9F 2KMFA 3UUXB 3EDUA 2V26A 3CVRA 3D0TA 1FMVA 1J8YF 2UXNB 3L34A 3FHDA 2JMHA 3AG2C 3AG4C 4JCHA 1HF8A 2ES0A 3FXDB 5LA6E 1ZHZA 4JVSA 4Z8XA 1ST6A 3EGDA 2Q9QC 4YHJA 2Y3DA 3JSZA 1EZ3A 3RYHE 3V7OA 2ZM2A 2LM9A 4KNWA 4G0HA 3UFEA 3OYXA 3ITFA 4DVDA 4GEHA 4TV8E 2NW8A 2KZ7B 3ZSUA 1WLXA 1HG5A 2N9DA 3ZVRA 4JUYA 3T6BA 3LLIA 3E08A 4ASKA 4QXHB 4BAYB 3LESA 4C3BA 1SZIA 5L3FB 1VYKA 2D5UA 3E9VA 2E9XC 2H7OA 3N9PA 2NUTA 4PK6A 2CM0A 2I8BA 3KBTA 2FGYA 1YD8G 3Q7GA 3UT5E 2WZGA 5HAXA 5JDGA 3CX7B 2CXDA 2JPFA 2A2FX 4HFKB 2P6VA 4H9SE 4ZS2A 2J45A 2X9HA 2O9XA 2DYRC 2ZMAA 4O6YA 2WB7A 2H7VC 2R7XA 5KMGP 1J8MF 4AE4A 2CCQA 3E22E 3Q6MA 1Z6AA 4IE0A 5T3WA 3JCUQ 4X1KE 3HKCE 3CWZB 2VWAA 4GYSA 2CWOA 3I9YA 3H65A 3S28A 4IDZA 3DTOA 1N1CA 4OD4A 3ONXA 4XAXB 4IIJE 1YKHB 5LHGB 5CA1E 4Q4ZF 2G62A 1IAPA 1ZKEA 5DABA 3EG9B 4G7HF 2J9UA 3KV9A 2IXNA 4M63A 1M2OA 4PJNA 1NWMX 4U5EE 5CA0E 2DCFA 3HLZA 4LLEA 1VMAA 2Z6EA 3BQIA 5JDQA 2VK9A 4ZS3A 2LSKA 2JMKA 4IAOA 3RYFE 4AQFA 5FY7A 4BJ5C 2MYSA 2IW5B 4BG0A 4IWBA 2W61A 4JJGA 5EZYE 1S35A 1OCCC 2BZBA 3UUNA 2C04A 2KLQA 4OK0A 3QZCA 1FMWA 2BE5F 1U4QA 5JRCB 3KV6A 1SMYF 4EBBA 3I4UA 2X67A 5ADXL 3ZJ1A 4MALA 2LT3A 4OIRF 3LJBA 1PCXA 2LHNA 3ZN1B 2PJQA 3JC6D 5E0OA 1UX4A 3TD7A 2MBGA 3N24A 4CXYA 4ZOLE 2K9AA 4EYYR 4H9NC 1OXZA 2IXMA 3VU7H 2Y3BA 3NRHA 5L3VA 1KU2A 3S4UA 3SOLA 4M1PA 2R7VA 3MLGA 3Q5XA 1QLEC 2CW0F 4I44A 4O6NA 5A1LA 4FWVA 5DQZA 3JT1A 1TWGA 1NZEA 1ZHTA 4EAHA 1TKNA 4HGAA 2EHOA 4K0UA 1IZNB 4CS7A 4IRUA 1WRDA 2Q9QA 4P09A 3I5PA 4EB6E 2CEAA 1WR6A 4ANJA 1G73A 3X2QC 2OG2A 5HWXA 2WM9A 4FJOA 1KK7A 2HH7A 3O1HA 2Y48B 1QZXA 4U5FE 3ZIBA 2YEVC 3Q7LA 3X1OA 3DZAA 3EJNA 5HXEA 4U5CE 3ECSA 2NTYA 2Q9AA 5F5HA 4B6XA 5JREA 5KDMC 4HN9A 3EZHA 3SZRA 5FY1A 2MOZA 3ETVA 3W2VA 5B1AC 3N9NA 4OD5A 2WVOA 2RP4A 3PDYA 3H3AA 4QKNA 3DJNB 3QUJA 3WAJA 1RJ9B 4CXWA 1S94A 3NZQA 2L9JA 4YWQA 2R7SA 4CIHA 3F57A 2E9XD 4HE8D 4YFSA 5EK3A 4A56A 1B7TA 3ETUA 2DLRA 5KYWA 3NG1A 3FAJA 3M65A 4C3EA 3UNGC 1ZHYA 4UELA 2W63A 3CQGB 2Y3GA 5B1BC 4C3DA 2EIMC 3PUQA 5KYXB 5T1DB 5KYUA 3N2ZB 4EZHA 1IW7F 5KX5E 2V7IA 2BDEA 4XTKA 3KVBA 2L3LA 3ZCJA 3AAEB 2XXAA 2WSSV 5L3CB 3LJCA 2KINB 5IYZE 3RX6A 4U5BE 2KNDA 1OKKA 4DNDA 1CUNA 1WYBA 4UVCB 1MNEA 5E3CA 4AKLA 5TAOA 3U3IA 3WAKA 3OKQA 4U5DE 3W8HA 4TN7B 4O2BE 5DVWA 1OCZC 3NBXX 4WBNE 3FVYA 5HXHA 4CS9C 4CI2B 4DVYP 5LJNA 1M2VB 3AAIA 3R6NA 3LEVA 4BJ5A 1JPNA 2ODUA 3CKDA 3N9OA 2R7OA 4UEMA 1D1CA 2OA5A 3LG7A 3UMIA 4K0DA 2A1DD 5D91A 2LSJA 5LYJE 3E70C 4GK0E 4DMWA 1PD0A 5E33A 3CMLA 5CI8A 4OYJA 5HSWA 4FX5A 1VK5A 5JDFA 4Q7CA 2WZFA 3KH2A 3JC6C 1NU7D 2K48A 4ZLCA 4DO0A 3EFOA 3CQXC 2LEHA 3ABKC 2XL4A 4ZI3C 4KNVA 1LS1A 2W00A 4H9RC 4WW0A 4AQGA 4CQIA 4PK5A 4HEAA 4EZ4A 4IE6A 4J30B 1MMDA 1NG1A 3O1JA 4TZ4C 4L9IA 2V7JA 3OJAA 3FBZA 4GIWA 2XTLA 3UGPA 3LLKA 1MMNA 4QI2A 1W2WA 4XZCA 1V54C 4KMCA 2DGJA 1ZU5A 2W4BA 3JRTA 4UIGA 2R7TA 4TUYE 5LGUB 2R7UA 4XLPF 2W0GA 4XLNF 4J32B 3HR0A 4YLHA 2LSGA 3KV4A 3UTKA 2UXXB 5E3AA 4OHFA 2LOSA 4U5GA 1IJ5A 1MNDA 1IZMA 3SEOA 5LJMA 5DQVA 4L5GA 2A3DA 2H3RA 4YT5A 2P7VA 3AG3C 2A69F 1Z3IX 4QX8B 3RYIE 2X9WA 2PFVA 1E1HB 3GN5A 3K3OA 3MJXA 4HEAJ 5EGYA 3PU3A 3ZCIA 2PP4A 3SS1A 2PG8A 2OCCC 4CI3B 2KQ9A 2ODVA 3W15B 5KYNA 5M4YA 4MNDA 4U72A 3HKDE 3ZMTB 3P7IA 3SNHA 3F31A 3N2OA 2JRKA 1D1BA 1MMAA 3QK6A 3E0ZA 3C4XA 5T3TA 5FY0A 1NAFA 1HTJF 3OYZA 3CSKA 2KT9A 2XAQB 5DS4A 3O39A 3P8CD 3ZC4A 3KKBA 3PMRA 3RYLA 3FHNA 4BJTA 2Y3HA 1UCUA 2WVQA 3NYJA 4NUUA 3C4WA 3DP7A 3UUMA 4ZI2D 1HCIA 4ADZA 1OCOC 1U5PA 2CXFA 4CS9A 4OFZA 5LGTB 4GYTA 4A2NB 3V5SA 5J2TE 2VL8A 5GONE 2NUPA 4X0RA 2XHEB 2KJGA 2Q9BA 2X0LB 2R7QA 5FXXA 3OA1A 4G63A 5JQGE 3KMIA 3NKEA 1JPJA 4LERA 5E2QA 2SPCA 4O7GA 4PJJA 2W62A 3DXJF 5JR9A 3EG9A 5EHHA 3ZYKA 4DBRA 1TWAA 2WAUA 2XQYA 1V55C 2Y8DA 2J1DG 4I50E 5L3EB 3NYMA 5DJQC 3UMKA 4W8KA 2IC9A 3ASNC 3GWHA 4F6RC 1LRZA 4JEHB 4CBEA 3ZYLA 3K6BA 4H4KC 4AX2A 3ANWA 3EDVA 3C50A 4ZI3D 2N1GA 3DM9B 1ZHCA 5DQWA 1FIOA 2CLYB 3FXEB 4C91A 2J7PD 2EHOB 2A6EF 2YU1A 1VRBA 2QGSA 3ASOC 3CQCB 3ZMSB 4OIPF 3IBPA 3N9QA 3UULA 3ZLIA 3RPUA 3B13A 3K66A 3AVSA 3Q6NA 5IY5C 3KL4A 4NY3A 3C64A 4ZLDA 3DMDA 1MIWA 4N78D 2KGOA 4I43B 2C5JA 3LNRA 4PFPA 2G3VA 2MTQA 3AQCA 3MZKB 5JH7E 3RKOA 5F5FA 2X9XA 1HX8A 4IE7A 4AXPA 2EIJC 2XAGB 3LFMA 1ZU4A 4PJLA 5DLJA 5EK2A 3MX3A 3AG1C 3J9X1 2VKJA 3LK3B 2E9XA 2MWQA 5KYWB 1SA0E 4HE8A 3V5UA 3ZPOA 2I59A 5FYMA 3KBUA 5KYYA 1Y64B 5H6QB 5L3GB 3KV5A 1M56C 3OEOA 3LAYA 2C03A 2IAKA 4MBQA 5JDLA 5KYUB 3N9MA 4YN0B 3N9LA 4PW8A 1BR2A 4B6IA 3FDQA 4H63V 2VH3A 2VKDA 3SWHA 3F47A 2XXAB 2CNWD 4J2CA 4UXNB 2V3CC 3TKLB 2PX3A 4MHCA 4CZZB 4MLKA 2BVMA 3L0IA 4G7ZF 4EWCA 5DS5A 4ULWA 1LKXA 2N2NA 1FTSA 3OWTA 2DI4A 2Q9CA 2C0SA 2JJ9A 2XASB 2ZPAA 2J0XA 1BR0A 3ZJ2A 4U74A 3EH1A 4JEUB 4PK4A 3ZEFB 4P6IC 3ZC0A 4ZI2C 3ESLA 4KUMB 1Z0PA 2CDQA 2PF4E 3RC8A 1WGWA 2H7BA 2LOPA 4ERRA 4UVAB 3NDBB 4ILUA 4JURI 1FFTC 1BR4A 5ETWA 4QWNB 5C8YE 4C7OA 3RYCE 4OIQF 3PURA 3S0XA 3PUSA 3EFOB 4PAGA 4ISSA 4KC9A 4XBFB 4UF0A 3B0VC 5LGNB 1HS7A 3K3NA 3U78A 2J46A 2LHRA 3PUGA 2DNXA 4O2AE 2NOXA 4QI0A 3DJBA 2CXLA 3NZPA 4UV8B 3S29A 3EHNA 4O6MA 3KVAA 2VASA 2D5RB 3QC9A 1QUUA 4QDLA 2EIKC 3CZ6A 3BK9A 3ZMUB 5CI9A 4Q5SF 4JJFA 2ZM8A 4P0BA 3I0OA 3LBXA 2W9YA 4IHJE 2YU2A 4WNKA 1OWAA 3AA7B 3VAYA 4AKIA 1T98A 4KP3C 3O4XE 3N0TA 5J1GA 3ZC1A 2IC6A 3DAGA 3C4ZA 5FXWA 3I5QA 5DQTA 2YHSA 3EGDB 4NUVA 3RC3A 5EK4A 1QSDA 3F2EA 4QX7B 4RDAA 4GYRA 2NP9A 4I4TE 3B0UX 3GANA 2WMOA 2KW3C 2GK9A 4JZAA 4FESA 4YT4A 4AI6A 3ZN0B 3AVRA 1FEWA 5AFUL 5LXTE 2LJLA 3HA4A 2KXPB 3GN5B 3ZYMA 2ZXOA 4AKHA 5FCLA 1SHZC 3DJUB 3I9WA 3GODA 2YEVA 4BEJA 3KINB 3J7Yq 4MFRA 3BQLA 2WL8A 1ZHXA 3Q5WA 2CLYC 4CSAC 2NUTB 2EHOC 5J2UE 3EGXA 1ZHWA 3HJCA 1VOMA 2PX0A 2RA1A 1PD1A 5FXZA 3RRWA 3C51A 3MA9A 3UR3C 3I0QA 3B9QA 4H9OC 3HTKC 5F3JA 4AE4B 3EZIA 1YKEB 3VKGA 1MIYA 3O9XA 2IXPA 4IJJA 4YT2A 2ZXPA 4KI2A 2HPJA 1G8XA 4CS8C 4OINF 5LHHB 2L8KA 3W2WA 3RIPA 4JW1A 3MXZA 3FBLA 3IF8B 4QXBB 3N2KE 4FI5A 5L2LA 2K5BB 4DMVA 2D2SA 1ZYRF 3K3QC 2C5IT 1MMGA 2IOQA 1S7ZA 5JDHA 5D92A 2G3KA 2L9QA 2K24A 4YJ3E 2VKHA 3ABLC 3KFWX 3NYLA 5HXSA 4HTEA 5HXRA 5HYAA 2M67A 2NTXA 4X1IE 3OBVE 1X79A 5JDMA 3AB3B 5DS6A 3AA1B 1LVFA 3LS0A 1ZEEA 2NUPB 2X68A 3R84B 3WODF 3H37A 4EXTA 2CE7A 3MACA 3HI2A 4PNIA 2X66A 2J9WA 3CPZA 2BVLA 2KWHA 4O8SA 4N06A 4X20E 1KNZA 4BJ1A 4O4IE 3EH2A 2B0JA 5JR9B 2QTVA 3LK42 4I3MA 4KBMB 4X1YE 2IYLD 2VKOA 2EILC 4BJ6C 4EIWA 4QXCB 2EINC 2HV6A 4U5HA 4XWJA 2Y6XA 2WZLA 1D0YA 4H9PC 3ANWB 4YJWA 3GMIA 4CI1B 3O6XA 1D0XA 2NWBA 4C90A 3ABMC 4BJNA 2GFHA 2Z15A 3C98B 2ZXWC 2LSEA 1OCRC 4TX5A 3MK7C 1AJ3A 4AKRB 3K33A 1VYIA 1Z63A 3VKHA 3RFYA 4AKGA 2J7PA 3QMKA 2WBLA 2G0UA 2PBIA 1ZV4X 3EUHA 1IJ6A 4G2AA 3M1CB 4E7ZA 2LSYA 3NRXA 3W8IA 3PUAA 2DHRA 3POVA 5LNKA 3HKBE 4QHOA 2CGEA 3AA0B 1Z23A 3K1HA 3MKDA 2Q9QB 3N5LA 2Q3TA 4CXXA 2A68F 2R7WA 4KBLA 2KWIB 2W4MA 3EPVA 5JRCA 4F4BA 1YW0A 4UV9B 3AAAB 5CB4E 3O1IA 2D0TA 3CX6B 2V7LA 3HL6A 3B0PA 3KDSE 3B57A 2A6HF 4E7SA 2HPLA 3VYWA 3WG7C 3T8OA 3JYHA 2YZSA 2XUEA 2XAJB 2E9XB 2CMRA 2CA5A 4JLEA 4YJ2E 3FB2A 1BR1A 4ZI7E 4CSAA 3EHMA 5KYYB 3F46A 1Z5ZA 3ZG1A 3IHRA 2Y69C 3DAFA 1HFAA 4WBOA 5B3SC 4BJMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RH3 A;  3IEE A;  4YJW A; 
#chains in the Genus database with same CATH topology
 1D0Z A;  5F5W A;  4YSX A;  4CDA A;  3R7C A;  2NSG A;  3RH3 A;  4I1M A;  4JTC B;  1D1A A;  2RPA A;  1YAU O;  2EHO D;  2PFD A;  2VB6 A;  4IB4 A;  2Q9Q D;  2IML A;  1TR2 A;  3DD7 A;  3ZMZ B;  2XJ7 A;  4A4A A;  5L3D B;  3AGU A;  2F22 A;  2PBE A;  5FL1 A;  1WYC A;  4L6R A;  4N6C A;  2CNW A;  4CS8 A;  4D4N A;  1FFH A;  3HNJ A;  3AE1 A;  4IE4 A;  5BUO A;  2WWU A;  3L3P A;  2XAF B;  2X51 A;  1HG2 A;  4N4W A;  2V7M A;  2HS5 A;  1H7C A;  1QLB A;  3HKE E;  2XLO A;  4EIY A;  3G4Z A;  4U7I A;  3NWI A;  5AQG B;  5HCJ A;  3PTR B;  1YLM A;  4HKA A;  4JKV A;  4I55 E;  5HEO A;  5AQN B;  4A98 A;  3K7D A;  3US6 A;  2C5K T;  2W66 A;  3UGO A;  3DKA A;  2KK1 A;  2ZM0 A;  4H63 H;  3Q9D A;  5L3B B;  4JI7 T;  4PJM A;  3CQZ A;  3LK2 B;  2R03 A;  4DID B;  2LD6 A;  4YT8 A;  1O5H A;  1F1M A;  2YL3 A;  2FJE A;  5L0F A;  5L3Q A;  2XSE A;  1O87 A;  1E83 A;  1LVK A;  4TWH A;  4V1A v;  5LCY A;  2QY9 A;  1M6T A;  2XRH A;  3T4R A;  4YHH T;  2NG1 A;  3AQB A;  1FJG T;  4GOU A;  3LS1 A;  2DWK A;  2L81 A;  4IGU A;  3ONJ A;  4JCZ A;  2YDQ A;  4I1O B;  4Z9I A;  2W2U A;  1RJ9 A;  4AK9 A;  4GK5 E;  1HMO A;  4AL1 A;  1YA7 O;  2Y39 A;  5FMN A;  2J0W A;  1NU9 C;  2ACX A;  2YK0 A;  4JC7 A;  4HFD A;  5AQH B;  2E8I A;  3AA6 B;  1DOV A;  4K7B A;  2CBJ A;  4OYK A;  2UXC T;  3PU8 A;  4C7O B;  2XM4 A;  4O4J E;  1E2X A;  3FOP A;  3C63 A;  3BQK A;  2W4X A;  1GGQ A;  2HKV A;  3VRB A;  3IEE A;  1YVI A;  3VR9 A;  3CX8 B;  4TV9 E;  2UUC T;  4UF0 B;  4LLC A;  2XQ4 A;  2V1D B;  3A5X A;  3RKO F;  5BMV E;  1VLT A;  4EBJ A;  4ILB A;  2EPO A;  5FXV A;  3JTL O;  3RQG A;  3K1I C;  4X64 T;  2ZXR A;  1ZP0 A;  3ZWI A;  5KYX A;  4DBQ A;  2XM0 A;  4BJ6 A;  4WJ0 A;  1A7D A;  1MIV A;  4BPM A;  2R7R A;  2V6Y B;  2NW7 A;  2LE8 A;  1Q0M A;  1YQ3 A;  4YL3 A;  2DWG A;  2WMN A;  2ZM6 T;  5L0I A;  4OIO F;  4EOZ B;  4HWD A;  5HXC A;  2BG9 C;  4DOZ A;  1TWC A;  4IST A;  1UUR A;  3M4B A;  5LBQ B;  4LF5 T;  4G7O F;  3UMH A;  3AE6 A;  4PFO A;  4ILC A;  2D0U A;  1OKK D;  2JX0 A;  4DVZ A;  4H54 A;  2E87 A;  3LBX B;  3N2G E;  3WI3 A;  2KNH A;  2X9Y A;  3PHF 2;  3GA8 A;  4HFV A;  1QSP A;  4K1O A;  5HV9 A;  5JVD E;  4H9Q C;  2HUJ A;  5LG4 A;  2QA7 A;  4MVZ A;  4AQF C;  5IHY A;  4LAC B;  3SFE A;  1XZY A;  4UVB B;  3EQL F;  2NW9 A;  2DYS C;  4RD9 A;  4BA9 A;  4L0R A;  4Z90 A;  4O4H E;  4ZEY A;  1US7 B;  5JDN A;  5FNV E;  5LB7 B;  3SRZ A;  5LHI B;  5JR9 C;  5HWY A;  3SP1 A;  2LSI A;  2HV7 A;  1M2V A;  3LNM B;  2V6X A;  4DR6 T;  2HSB A;  2YIN A;  5FP3 A;  1TWH A;  4IE5 A;  2BBH A;  1VLS A;  4O79 A;  2IXO A;  4HFF B;  3SYN A;  5LOV E;  2JD3 A;  2JQQ A;  3S27 A;  3K8P C;  1SF8 A;  5LBM A;  3RVY A;  3I1A A;  4NPP A;  3TJ5 A;  4U3C A;  2FBW A;  3IPM O;  4ZHQ E;  3DM5 A;  5LP6 E;  3U0C A;  2B1E A;  3Q2M A;  2XLV A;  4LF8 T;  3T6J A;  2BG9 E;  2WVN A;  3L09 A;  4O4L E;  3RRC A;  3FZF B;  3NRY A;  2ZLY A;  4P0A A;  5ABH A;  3NKD A;  4GKJ T;  5H6R B;  2R6G F;  2XAH B;  3PE0 A;  3ZKR A;  5L4E A;  3VHL A;  2AU5 A;  3HKK A;  2FFH A;  1UX5 A;  4RBN A;  1YZC A;  2V7K A;  2W67 A;  4Z91 A;  2XM2 A;  1QPU A;  1V9D A;  3EGX B;  1IBM T;  2GA0 A;  2J9V A;  2M4E A;  3ZMV B;  3IQT A;  2BL2 A;  3RHW A;  5CGM A;  4LML A;  1RKC A;  2W45 A;  2A72 A;  3U8V A;  5A6B D;  5F8P A;  2P9B A;  3EVY A;  1O3X A;  4EYU A;  4A97 A;  1M57 C;  2CWY A;  4MQ9 F;  2XSB A;  1WN0 A;  3C18 A;  2KMF A;  4DXW A;  3UUX B;  1GQA A;  3EDU A;  2OKU A;  2V26 A;  4LFA T;  3CVR A;  3D0T A;  1FMV A;  1J8Y F;  1L0V A;  1NSG B;  5JS5 A;  2UXN B;  3L34 A;  3FHD A;  2JMH A;  3AG2 C;  1Z7Q c;  3AG4 C;  4JCH A;  1HF8 A;  2ES0 A;  1LIH A;  3FXD B;  5LA6 E;  4CN1 A;  1ZHZ A;  4JVS A;  4Z8X A;  3Q5D A;  5HEH A;  1HMD A;  1ST6 A;  3EGD A;  3P50 A;  2BC5 A;  1W0A A;  2Q9Q C;  4YHJ A;  2Y3D A;  3JSZ A;  1EZ3 A;  3RYH E;  3V7O A;  2ZM2 A;  1XDO A;  4Q25 A;  3RF1 A;  2LM9 A;  4KNW A;  1LM3 B;  4IDO A;  3RVZ A;  4DV6 T;  4EKW A;  4G0H A;  3UFE A;  3OYX A;  4DR2 T;  1N36 T;  2CHN A;  3ITF A;  4DVD A;  4GEH A;  4TV8 E;  2NW8 A;  4GKK T;  2KZ7 B;  3ZSU A;  1WLX A;  1HG5 A;  1ZZP A;  2N9D A;  3P4S A;  3ZVR A;  4JUY A;  1ORY A;  3T6B A;  4BEM J;  3LLI A;  3E08 A;  4ASK A;  4QXH B;  4HFI A;  2GDC A;  4BAY B;  3LES A;  4C3B A;  1MQV A;  1SZI A;  3ZT5 A;  2HMZ A;  5L3F B;  4KX6 A;  3H2U A;  1VYK A;  2D5U A;  3E9V A;  2E9X C;  2OJE D;  3FOO A;  3GWN A;  2H7O A;  4PAC A;  3UUB A;  3N9P A;  4PK6 A;  2CM0 A;  2I8B A;  2IM8 A;  1OR3 A;  2NUT A;  3KBT A;  4JTD B;  1SE7 A;  1U6H A;  1WAT A;  1A7E A;  3TLS A;  2FGY A;  1YD8 G;  4MVU A;  3Q7G A;  3UT5 E;  2WZG A;  5HAX A;  3AEF A;  1I6Z A;  5JDG A;  3ZQV A;  3CX7 B;  2M6I A;  2CXD A;  2JPF A;  2A2F X;  4LFC T;  3QTH A;  4HFK B;  5JTG A;  1OXB A;  2P6V A;  4H9S E;  4X65 T;  4HWH A;  4ZS2 A;  3GM2 A;  2J45 A;  2X9H A;  2O9X A;  1N33 T;  3GM3 A;  5AQO B;  2DYR C;  4EUK B;  2ZMA A;  4O6Y A;  2WB7 A;  2H7V C;  2R7X A;  2VUR A;  5KMG P;  3EI0 A;  1JOG A;  3AEA A;  1E85 A;  2EPK X;  1J8M F;  2A9U A;  3W4Y A;  1HW2 A;  1Y4C A;  4AE4 A;  3CEX A;  2CCQ A;  2GWW A;  2OLT A;  1OED E;  3E22 E;  3RIA A;  1Z6A A;  3Q6M A;  4IE0 A;  1M7K A;  2LFF A;  5T3W A;  5HEU A;  3JCU Q;  4XPW A;  4X1K E;  3HKC E;  3CWZ B;  3PJA A;  2VWA A;  4CN6 A;  4GYS A;  2CWO A;  2FJA A;  3DE8 A;  2LP4 A;  3I9Y A;  3H65 A;  3S28 A;  2HN1 A;  4IDZ A;  3DTO A;  2QE9 A;  1N1C A;  4OD4 A;  3ONX A;  4XAX B;  1Z8U A;  4IIJ E;  2UU9 T;  3VRC A;  3K1I A;  3RQW A;  1T6U A;  3H2V A;  1YKH B;  3FAP B;  5LHG B;  5CA1 E;  1YJG A;  4Q4Z F;  2G62 A;  1BZ4 A;  1IAP A;  1ZKE A;  5DAB A;  3RIU C;  3EG9 B;  4G7H F;  2R25 A;  4EED A;  2J9U A;  3A7M A;  3T1H T;  1WCR A;  3KV9 A;  2IXN A;  4M63 A;  5JRA A;  1M2O A;  4LDK A;  4PJN A;  2FJD A;  2L6H A;  1T6Q A;  1NWM X;  1N32 T;  3MFN A;  5AQT B;  3X1D A;  4U5E E;  5CA0 E;  3AXJ B;  4ILA A;  2DCF A;  3HLZ A;  4LLE A;  1VMA A;  2Z6E A;  3BQI A;  5JDQ A;  2VK9 A;  4WZX A;  4ZS3 A;  2LSK A;  4JI1 T;  2BS4 A;  2JMK A;  4LDQ A;  4IAO A;  2QRX A;  3JCF A;  4JTA B;  2XQ3 A;  3RYF E;  4AQF A;  5FY7 A;  4BJ5 C;  2MYS A;  3B5M A;  2IW5 B;  4BG0 A;  2IHR 1;  3IQ6 A;  4P9T A;  4IWB A;  5COM A;  3FXH A;  4X66 T;  4ZZC A;  2LQG A;  4CDY A;  2W61 A;  5ABF A;  3TQO A;  4D4X A;  2MPK A;  4JJG A;  5EZY E;  1XNQ T;  1S35 A;  1OCC C;  2HMQ A;  2BZB A;  4YT0 A;  3UUN A;  2C04 A;  3QOF A;  3PJA J;  2KLQ A;  4OK0 A;  3QZC A;  1FMW A;  2BE5 F;  1U4Q A;  1BDJ B;  2E5V A;  5AQR B;  5JRC B;  2HSQ A;  3KV6 A;  1SMY F;  4EBB A;  3I4U A;  2X67 A;  5ADX L;  1QKR A;  3ZJ1 A;  4MAL A;  1Q0F A;  2LT3 A;  4OIR F;  5BQI A;  3FZK B;  3LJB A;  3NMK A;  1PCX A;  2LHN A;  3ZN1 B;  2PJQ A;  3JC6 D;  3UU4 A;  1YYX A;  3IA3 A;  5E0O A;  1UX4 A;  3TD7 A;  2MBG A;  1XZQ A;  4EV6 A;  3N24 A;  4DR5 T;  4IAQ A;  4CXY A;  1I94 T;  4ZOL E;  2P61 A;  5COG A;  2K9A A;  4EYY R;  1CGO A;  4DRI B;  5FL0 A;  1NLX A;  3G4X A;  2P0N A;  4H9N C;  1OXZ A;  2HJM A;  4JI8 T;  2IXM A;  3VU7 H;  2UXB T;  2Y3B A;  3NRH A;  5L3V A;  2VCB A;  3IQC A;  1KU2 A;  3S4U A;  4NTB A;  3SOL A;  5GPG B;  1LE4 A;  3AED A;  4EGW A;  1XMQ T;  3AE3 A;  4M1P A;  2R7V A;  3MLG A;  2WU2 A;  3Q5X A;  1QLE C;  2LCH A;  2CW0 F;  1V74 B;  1KNR A;  4I44 A;  4O6N A;  5A1L A;  4FWV A;  2Q00 A;  5DQZ A;  5AQK B;  5BR8 T;  3JT1 A;  1TWG A;  5JUA A;  1NZE A;  5AQF B;  3C8G B;  4B3M T;  1ZHT A;  4EAH A;  1TKN A;  3TOL A;  4HGA A;  2EHO A;  4K0U A;  5JP7 A;  1IZN B;  4CS7 A;  4IRU A;  2AXD S;  1WRD A;  2Q9Q A;  2D4U A;  5A6K A;  3U8P A;  2OV9 A;  4P09 A;  1VB5 A;  3I5P A;  4EB6 E;  2CEA A;  1WR6 A;  5AQV B;  4ANJ A;  1G73 A;  1X9B A;  3PV0 F;  3X2Q C;  1CPR A;  2OG2 A;  5HWX A;  2XZE A;  1CPQ A;  2WM9 A;  4FJO A;  1KK7 A;  2HH7 A;  3O1H A;  2Y48 B;  1QZX A;  4U5F E;  3ZIB A;  2YEV C;  3Q7L A;  3X1O A;  3U9J A;  3DZA A;  4I0U A;  2YVK A;  3EJN A;  5HXE A;  4U5C E;  3ECS A;  2XPK A;  2NTY A;  4U33 A;  2Q9A A;  4B6X A;  5F5H A;  5JRE A;  3HNL A;  3UU5 A;  5KDM C;  4HN9 A;  3QVY A;  3EZH A;  3SZR A;  5FY1 A;  4LF9 T;  2MOZ A;  3ETV A;  3W2V A;  5B1A C;  3Q5E A;  3N9N A;  1YYJ A;  4OD5 A;  2LM2 A;  5AQL B;  2WVO A;  3HNK A;  1AVO B;  2RP4 A;  2B0H A;  3AEG A;  3PDY A;  3H3A A;  4QKN A;  3DJN B;  3UFG A;  1ZW3 A;  3LDQ B;  3QUJ A;  3WAJ A;  1JAF A;  1RJ9 B;  5JVE A;  4CXW A;  1S94 A;  4YY3 T;  1SR2 A;  3NZQ A;  3ZT7 A;  2L9J A;  4YWQ A;  1YQ4 A;  2R7S A;  3GOR A;  4CIH A;  3F57 A;  2E9X D;  3QB5 K;  4HE8 D;  4YFS A;  4DUY T;  5EK3 A;  4A56 A;  3C8G D;  1B7T A;  2LLY A;  3ZTM A;  4E0I A;  2LRL A;  2XY8 B;  3ETU A;  2DLR A;  4WYV A;  3ZDL A;  5KYW A;  2K3W A;  3NG1 A;  3FAJ A;  3M65 A;  1HR0 T;  4C3E A;  3JZ0 A;  3UNG C;  1ZHY A;  4UEL A;  1TQG A;  2W63 A;  2WZH A;  1CHU A;  4GQH A;  4LFB T;  3CQG B;  2Y3G A;  1ORJ A;  4JV5 T;  5B1B C;  4C3D A;  2EIM C;  2PTF A;  3PUQ A;  1E86 A;  1TFO B;  5KYX B;  5T1D B;  3TLU A;  5KYU A;  5AQQ B;  3N2Z B;  4LMJ A;  4EZH A;  1IW7 F;  5KX5 E;  1S05 A;  4WGZ A;  2V7I A;  2BDE A;  4XTK A;  4IL4 A;  3KVB A;  2L3L A;  3ZCJ A;  1H7I A;  3AAE B;  2XXA A;  5LMN T;  2WSS V;  3L39 A;  3P4P A;  2YQY A;  2HN2 A;  3GEE A;  3QW1 A;  2IDO B;  5L3C B;  2H88 A;  3LJC A;  1C03 A;  1QQ3 A;  2KIN B;  5IYZ E;  2EPL X;  4IDP A;  3RX6 A;  1J5W A;  4U5B E;  3M3Z B;  4JIO A;  2KND A;  1OKK A;  3VR8 A;  3WAQ A;  4DND A;  4NTA A;  1CUN A;  1WYB A;  4UVC B;  1MNE A;  5E3C A;  2TMV P;  4AKL A;  1LI7 A;  5TAO A;  3U3I A;  4QH4 A;  3WAK A;  3PUY F;  3OKQ A;  3DI5 A;  2I15 A;  4U5D E;  4YSY A;  3W8H A;  4TN7 B;  4O2B E;  5DVW A;  1N34 T;  1OCZ C;  3NBX X;  4WBN E;  3FVY A;  5HXH A;  4CS9 C;  4CI2 B;  4DVY P;  5LJN A;  1M2V B;  4N6H A;  3AAI A;  3R6N A;  3LEV A;  4BJ5 A;  5JT4 A;  1JPN A;  2J62 A;  2ODU A;  3CKD A;  3N9O A;  2R7O A;  3TLT A;  2WDR A;  4UEM A;  1D1C A;  5AQM B;  1KNP A;  3OTO T;  2OA5 A;  2LIG A;  3LG7 A;  2EPM X;  3UMI A;  4K0D A;  2A1D D;  4B3T T;  5D91 A;  2LSJ A;  5LYJ E;  3E70 C;  4GK0 E;  4ZZB A;  4DMW A;  1PD0 A;  4MW3 A;  3CML A;  5E33 A;  2J8W A;  5CI8 A;  2ACZ A;  4OYJ A;  1JR8 A;  5HSW A;  4FX5 A;  1VK5 A;  3NMJ A;  1HW1 A;  5JDF A;  4DV5 T;  4WAB A;  4Q7C A;  2WZF A;  3KYJ A;  3JC6 C;  4LF7 T;  4HFE A;  5FVK A;  1NU7 D;  2JQ9 A;  2K48 A;  3KH2 A;  4DO0 A;  2EPN A;  4ZLC A;  3EFO A;  3CQX C;  2A0B A;  2YLG A;  2KSR A;  2LEH A;  3ABK C;  2B76 A;  2CPT A;  4CDV A;  2XL4 A;  1Y01 A;  2VL0 A;  4ZI3 C;  4KNV A;  1LS1 A;  3M4C A;  2W00 A;  4H9R C;  4WW0 A;  4AQG A;  2NPU A;  2LKH A;  4CQI A;  4PK5 A;  4E18 A;  2MAW A;  4HEA A;  4EZ4 A;  4KI0 F;  1LS4 A;  4IE6 A;  2QLA A;  5A6B A;  4J30 B;  2UUA T;  2UXD T;  1IBK T;  1MMD A;  1NG1 A;  2XQ5 A;  3O1J A;  4TZ4 C;  4L9I A;  2E2A A;  2V7J A;  3OJA A;  3FBZ A;  1YA9 A;  1UUS A;  4GIW A;  2XTL A;  4JRZ A;  4K0K T;  3UGP A;  1IBL T;  3LLK A;  2F4V T;  4DV0 T;  1MMN A;  4QI2 A;  5BQG A;  1W2W A;  4XZC A;  1V54 C;  4KMC A;  3A9C A;  2DGJ A;  1ZU5 A;  2W4B A;  1GQE A;  3JRT A;  4UIG A;  2R7T A;  4TUY E;  5LGU B;  2OOC A;  1G4U S;  2R7U A;  2YL7 A;  4JI2 T;  4XLP F;  2BKO A;  1WOL A;  2L7A A;  2W0G A;  3GEI A;  4XLN F;  5HEG A;  4J32 B;  3HR0 A;  4YLH A;  5F28 E;  3U3F A;  5AQJ B;  2LSG A;  3KV4 A;  3UTK A;  2UXX B;  5E3A A;  4OHF A;  2LOS A;  5LG3 A;  4U5G A;  1IJ5 A;  1MND A;  1IZM A;  3SEO A;  5LJM A;  1WAS A;  4ER9 A;  5DQV A;  5HEJ A;  4L5G A;  2A3D A;  2H3R A;  4YT5 A;  4QH1 A;  3GWL A;  3ABV A;  2P7V A;  1OED C;  3AG3 C;  3FZL B;  4X5T A;  2Q4F A;  4YK5 A;  4Z9H A;  1B68 A;  1LI5 A;  2A69 F;  3QB5 A;  5L0J A;  2M64 A;  1Z3I X;  4DV3 T;  4QX8 B;  3S9O A;  3ZSS A;  4X62 T;  3RYI E;  4DR1 T;  2X9W A;  1VTM P;  4MTF A;  4XEK A;  2PFV A;  1E1H B;  4DRH B;  3GN5 A;  1OR2 A;  3K3O A;  3MJX A;  4ONS A;  2XS1 A;  2BBJ A;  5CIV A;  4YSZ A;  4HEA J;  1Q0K A;  1UGO A;  3G06 A;  5EGY A;  4KHZ F;  2KYH A;  4XEF A;  3PU3 A;  3UU6 A;  3ZCI A;  1KFY A;  2PP4 A;  3SS1 A;  1JNZ A;  2BS2 A;  1APC A;  1YDI A;  4XEV A;  2PG8 A;  2OCC C;  3G50 A;  1UK5 A;  4CI3 B;  2KQ9 A;  2ODV A;  1H9T A;  1C17 M;  1W09 A;  4U9E A;  4NC3 A;  3W15 B;  5KYN A;  5M4Y A;  4DV2 T;  4MND A;  4NIQ A;  3SXZ A;  4TWD A;  4U72 A;  3HKD E;  1HY5 A;  2UUH A;  3RF3 A;  3ZMT B;  3P7I A;  3SNH A;  2LK4 A;  3F31 A;  3N2O A;  2JRK A;  2QYW A;  1FAP B;  1D1B A;  3V5Z A;  5K0I A;  2BS3 A;  3B71 A;  2X0Y A;  1MMA A;  2CHO A;  3QK6 A;  4YL0 A;  2UUB T;  1HE9 A;  3E0Z A;  3C4X A;  5T3T A;  3AEE A;  3A8Y C;  5FY0 A;  1LPE A;  2YDS A;  4MTG A;  1NAF A;  2XQA A;  4KHP T;  3VF0 A;  5JLI A;  3VRA A;  3SXM A;  4MVR A;  1HTJ F;  2E5L T;  1A0B A;  2FAP B;  3OYZ A;  3CSK A;  2J4G A;  4DJ9 A;  3L8I A;  2M6B A;  1JMW A;  2KT9 A;  3JAF A;  3ZQY A;  5IUX A;  2CBI A;  4XQ1 A;  3JAD A;  2XAQ B;  5DS4 A;  4DR3 T;  2D9D A;  3O39 A;  3P8C D;  3ZC4 A;  3KKB A;  3PMR A;  3RYL A;  3VM6 A;  4IAR A;  3FHN A;  4U2Z A;  4BJT A;  2NR4 A;  1WFD A;  4DR4 T;  2Y3H A;  4LF6 T;  4JYA T;  2YL0 A;  1UCU A;  2WVQ A;  3NYJ A;  4NUU A;  3C8Z A;  3AE4 A;  3C4W A;  2BG9 A;  3DP7 A;  3UUM A;  4ZI2 D;  1HCI A;  4ADZ A;  2WDQ A;  1OCO C;  3RQU A;  5ABF B;  1U5P A;  2CXF A;  4CS9 A;  1NEN A;  4OFZ A;  5LGT B;  4PR9 A;  4GYT A;  4A2N B;  3RQF A;  3V5S A;  5J2T E;  2VL8 A;  5GON E;  2CCY A;  3JSE O;  2NUP A;  4X0R A;  2XHE B;  2KJG A;  2Q9B A;  2X0L B;  2XM1 A;  4DR7 T;  2R7Q A;  5FXX A;  3OA1 A;  3M79 A;  4G63 A;  5JQG E;  3PUW F;  3KMI A;  3NKE A;  1JPJ A;  1ORS C;  4LER A;  5E2Q A;  2SPC A;  4O7G A;  4PJJ A;  2W62 A;  3DXJ F;  5JR9 A;  3EG9 A;  5EHH A;  3ZYK A;  4DBR A;  1TWA A;  1KNY A;  4XPY A;  5ABG A;  2WAU A;  2XQY A;  1V55 C;  3TJ6 A;  2Y8D A;  2J1D G;  4I50 E;  5L3E B;  3NYM A;  4E0H A;  5DJQ C;  2AP3 A;  3JAE A;  3UMK A;  4W8K A;  2H8A A;  2IC9 A;  3ASN C;  3GWH A;  4F6R C;  1LRZ A;  4JEH B;  1RKE A;  3ZYL A;  4CBE A;  1O3U A;  2YLI A;  3K6B A;  2JQK A;  1JNR A;  4H4K C;  3T9O A;  4AX2 A;  3ANW A;  4HWF A;  3EDV A;  1Q0G A;  4LF4 T;  3BEH A;  1T7S A;  5HCM A;  3C50 A;  1QVX A;  4ZI3 D;  2ASR A;  2I6H A;  2N1G A;  3ONL C;  3DM9 B;  1ZHC A;  5DQW A;  2YL1 A;  3LSV A;  3U3B A;  2NSF A;  1FIO A;  2CLY B;  4ULV A;  3FXE B;  4C91 A;  2J7P D;  2EHO B;  5L0G A;  2A6E F;  3AOU A;  2YU1 A;  1VRB A;  2QGS A;  3U2L A;  4JI0 T;  3ASO C;  2XLE A;  3PUZ F;  1NBB A;  3CQC B;  1K40 A;  3BRJ A;  3ZMS B;  4OIP F;  2GAQ A;  2AE9 A;  2WZI A;  3IBP A;  3N9Q A;  3UUL A;  2Q7R A;  3ZLI A;  3RPU A;  4DRJ B;  2X0C A;  3B13 A;  4P9F A;  3K66 A;  1R5I D;  3AVS A;  3Q6N A;  5IY5 C;  3KL4 A;  5FZT A;  4NY3 A;  3C64 A;  3QVZ A;  4W8P A;  3V5Y A;  4ZLD A;  3DMD A;  3OVU A;  1K04 A;  3RIF A;  1MIW A;  4N78 D;  2YRF A;  1T8B A;  4UDV A;  3B29 A;  4HFC A;  4LDR A;  1I5N A;  2KGO A;  3AEC A;  2XL6 A;  5L47 A;  4I43 B;  2C5J A;  4CJG A;  3LNR A;  3C62 A;  4MVS A;  4OX9 T;  4PFP A;  1ZW2 A;  2G3V A;  2MTQ A;  3AQC A;  3MZK B;  4J7T A;  5JH7 E;  3RKO A;  4EBK A;  5F5F A;  2X9X A;  2XLM A;  1HX8 A;  1OED A;  4IE7 A;  4AXP A;  1R8I A;  2EIJ C;  4J7Y A;  2XAG B;  4MVO A;  3LFM A;  1KF6 A;  1ZU4 A;  2VCC A;  1DU2 A;  4PJL A;  3SXK A;  1RMV A;  3OPC A;  3AE9 A;  5DLJ A;  5EK2 A;  3MX3 A;  3AG1 C;  2IBF A;  2WCA A;  3J9X 1;  4G78 A;  2VKJ A;  3LK3 B;  1R4T A;  2E9X A;  2XSA A;  2MWQ A;  5KYW B;  1SA0 E;  4HE8 A;  4JI3 T;  3V5U A;  1HNZ T;  3ZPO A;  3EAM A;  3C8G A;  1XMO T;  2I59 A;  5BQH A;  5FYM A;  3KBU A;  5KYY A;  1Y64 B;  4IGG A;  5H6Q B;  3CIR A;  5L3G B;  3KV5 A;  1M56 C;  4CX9 A;  3OEO A;  3PUX F;  4IDQ A;  3FZM B;  3LAY A;  3U5S A;  1H6G A;  1HE1 A;  2C03 A;  2IAK A;  4MBQ A;  5JDL A;  2UUI A;  3NMI A;  5KYU B;  1E84 A;  3N9M A;  4YN0 B;  3N9L A;  4PW8 A;  1BR2 A;  4B6I A;  3FDQ A;  4H63 V;  2VH3 A;  2VKD A;  1SUM B;  3CK6 A;  3SWH A;  4AQY T;  4DUZ T;  2R9R B;  3F47 A;  4TWF A;  3NVO A;  2XXA B;  5JSL A;  2HFI A;  1EI7 A;  2CNW D;  4J2C A;  1EKY A;  4UXN B;  3CAX A;  2V3C C;  2IUB A;  3TKL B;  2LFD A;  2PX3 A;  1YXR A;  4MHC A;  4CZZ B;  3UU8 A;  3T6G B;  4MLK A;  4NXM T;  2BVM A;  3L0I A;  1GS9 A;  2CYD A;  2WQY A;  4G7Z F;  4EWC A;  5DS5 A;  4ULW A;  1LKX A;  3TOM A;  2N2N A;  1FTS A;  3V5X A;  2VQE T;  3OWT A;  2DI4 A;  2Q9C A;  2C0S A;  1L7C A;  2JJ9 A;  2XAS B;  2XLH A;  2ZPA A;  2J0X A;  3TLW A;  1BR0 A;  2JQH A;  3ZJ2 A;  4U74 A;  4DV4 T;  1RXQ A;  3EH1 A;  4JEU B;  4PK4 A;  3ZEF B;  5ABE A;  1XWM A;  3RIU A;  4HFB A;  3ZST A;  3RQE A;  4P6I C;  3ZC0 A;  4ZI2 C;  3ESL A;  4KUM B;  1Z0P A;  2CDQ A;  2PF4 E;  2KC3 A;  2YKZ A;  2QNL A;  3T1Y T;  3RC8 A;  1WGW A;  2H7B A;  4B3S T;  2DL1 A;  5CFB A;  4WGY A;  2LOP A;  4ERR A;  2R02 A;  1T72 A;  4UVA B;  1WWP A;  3NDB B;  4ILU A;  1WTY A;  4JUR I;  5L0C A;  1FFT C;  1BR4 A;  5ETW A;  4QWN B;  3FMS A;  2XQ7 A;  2JIW A;  2V5D A;  5C8Y E;  2OJQ A;  1CGN A;  5AGF A;  1KEY A;  4C7O A;  3RYC E;  1VCT A;  4OIQ F;  3PUR A;  3S0X A;  5B3I A;  3PUS A;  2WY2 A;  3EFO B;  4PAG A;  5KXJ A;  4ISS A;  5CJ5 A;  4KC9 A;  1UFB A;  5A6A A;  2V8S V;  4XBF B;  1TFK B;  4UF0 A;  3B0V C;  5LGN B;  4JEA A;  1HS7 A;  4CN4 A;  3K3N A;  3EHZ A;  3U78 A;  2OQM A;  2J46 A;  2LHR A;  3PUG A;  1W9R A;  4MVQ A;  3ZT6 A;  2DNX A;  4O2A E;  4TNW A;  2NOX A;  3M15 A;  4QI0 A;  3DJB A;  2CXL A;  4ZXL A;  1XNR T;  4JEB A;  3NZP A;  4UV8 B;  3S29 A;  2V6Y A;  4Z9J A;  3TK0 A;  3AE7 A;  3EHN A;  4O6M A;  3RKG A;  3KVA A;  2VAS A;  1C02 A;  1Y6D A;  2D5R B;  3QC9 A;  1QUU A;  3KYI A;  4QDL A;  2YN6 A;  2EIK C;  3CZ6 A;  3BK9 A;  3ZMU B;  3KPH A;  4EEB A;  5CI9 A;  4Q5S F;  4JJF A;  2WP9 A;  2RSE B;  2ZM8 A;  3TLV A;  4JBW F;  1A41 A;  1PV3 A;  4P0B A;  3I0O A;  3LBX A;  2W9Y A;  4IHJ E;  1L3P A;  3RI5 A;  2DB4 A;  2YU2 A;  1E2A A;  4WNK A;  2XS8 A;  2H89 A;  1OWA A;  2P1A A;  3AA7 B;  3VAY A;  1W0B A;  4AKI A;  1T98 A;  4KP3 C;  3P4W A;  3O4X E;  2WS3 A;  1M62 A;  3N0T A;  5J1G A;  3PDM P;  3ZC1 A;  2IC6 A;  5A6J A;  3DAG A;  3C4Z A;  5FXW A;  3I5Q A;  2LRK A;  3ATP A;  2ETS A;  5EK0 A;  5DQT A;  4EHP A;  2BKN A;  2YHS A;  4U31 A;  3EGD B;  4YL1 A;  4NUV A;  3RC3 A;  1OQC A;  3MYF A;  5EK4 A;  1G5Z A;  1XZP A;  5J0Z A;  3TUL A;  3SFD A;  1NFO A;  2IIU A;  2VC9 A;  1QSD A;  3F2E A;  1G4W R;  1FNT c;  4QX7 B;  4RDA A;  3LEO A;  4GYR A;  2NP9 A;  4I4T E;  3B0U X;  1NFN A;  3GAN A;  2WMO A;  5TJ5 E;  2WDV A;  2KW3 C;  3UQ7 A;  2GK9 A;  4JZA A;  2QVA A;  2VVS A;  4YTN A;  4FES A;  4YT4 A;  4AI6 A;  3ZN0 B;  3AVR A;  1FEW A;  5AFU L;  5LXT E;  2ICW G;  3NKZ A;  2LJL A;  3HA4 A;  4MW8 A;  2KXP B;  3GN5 B;  3ZYM A;  2ZXO A;  4AKH A;  3HNI A;  5FCL A;  1SHZ C;  4CIP A;  3DJU B;  3IHU A;  3I9W A;  4NXN T;  3GOD A;  2YEV A;  4BEJ A;  3KIN B;  2L6G A;  3J7Y q;  4MFR A;  3U2M A;  4AL0 A;  1HNW T;  3BQL A;  2WL8 A;  1ZHX A;  3Q5W A;  4YTP A;  2CLY C;  4CSA C;  4COF A;  2NUT B;  2EHO C;  3FZH B;  3P4R A;  5FVL A;  5J2U E;  3EGX A;  1ZHW A;  3JYY A;  3L8R A;  3PUV F;  2X0H A;  3HJC A;  1VOM A;  2PX0 A;  2RA1 A;  3WHN A;  1PD1 A;  5FXZ A;  3RRW A;  5L4H A;  3C51 A;  3MA9 A;  2L6F A;  3UR3 C;  2YLD A;  3I0Q A;  2LKG A;  1FR0 A;  2AVK A;  1RCP A;  3B9Q A;  1OW8 A;  4H9O C;  3HTK C;  1T01 A;  1K05 A;  5F3J A;  3SXY A;  4AE4 B;  4DV1 T;  3EZI A;  1YKE B;  2WU5 A;  4FAP B;  3S90 A;  3VKG A;  1MIY A;  3O9X A;  4R32 A;  2OEX A;  3UQ4 A;  2IXP A;  3IQ5 A;  4IJJ A;  4YT2 A;  1ZOY A;  2ZXP A;  4KI2 A;  2HPJ A;  1G8X A;  2KSF A;  4CS8 C;  4OIN F;  1CGM E;  4JI5 T;  4HWC A;  5LHH B;  2L8K A;  5LMU T;  3W2W A;  3JRM O;  3L1M A;  3RIP A;  4JW1 A;  3MXZ A;  3FBL A;  2V5C A;  3IF8 B;  4QXB B;  3N2K E;  4FI5 A;  5L2L A;  2HJ3 A;  2K5B B;  2XQ6 A;  1A7V A;  3AGT A;  3RGL A;  4DMV A;  2D2S A;  1ZYR F;  1J1J A;  2OU6 A;  4LMK A;  3K3Q C;  2C5I T;  5AQS B;  1HNX T;  1MMG A;  1T9K A;  5L0H A;  2IOQ A;  3ZTZ A;  2RD9 A;  1AUE A;  3MYI A;  1S7Z A;  5JDH A;  5D92 A;  4CJO A;  1T6I A;  2G3K A;  2L9Q A;  2YDR A;  2K24 A;  4YJ3 E;  2VKH A;  3ABL C;  3KFW X;  4MVM A;  3UU3 A;  3NYL A;  2BG9 B;  4YTM A;  5HXS A;  4XPX A;  4HTE A;  5HXR A;  5COF A;  5HYA A;  3A11 A;  2M67 A;  2NTX A;  2FUP A;  4JI4 T;  3EAB A;  3RLF F;  4X1I E;  3U9M A;  2YOE A;  4B3R T;  3OBV E;  1X79 A;  5JDM A;  3AB3 B;  3DE9 A;  5DS6 A;  2VCA A;  3AA1 B;  1LVF A;  4JI6 T;  3LS0 A;  1ZEE A;  2NUP B;  2X68 A;  3R84 B;  4NCQ A;  3WOD F;  3H37 A;  4P1N A;  2OEV A;  4EXT A;  1OXK A;  3DWW A;  2CE7 A;  3MAC A;  1VCS A;  3HI2 A;  4PNI A;  1JRA A;  2X66 A;  2I0M A;  1EA8 A;  4MTO A;  2J9W A;  3CPZ A;  2BVL A;  2KWH A;  1KTM A;  3GEH A;  4O8S A;  4N06 A;  3QNU A;  4X20 E;  1KNZ A;  2YKS A;  4BJ1 A;  4O4I E;  3EH2 A;  4UR9 A;  1J5E T;  2B0J A;  5JR9 B;  2XQ9 A;  4U9D A;  3C7J A;  2QTV A;  2FJB A;  1ZVZ A;  3LK4 2;  4I3M A;  1OW7 A;  4KBM B;  2XLD A;  4X1Y E;  2IYL D;  2VKO A;  4YXD A;  2EIL C;  1LE2 A;  1V4A A;  4BJ6 C;  2HHH T;  1NEK A;  5C3J A;  4AIS A;  5AQP B;  4EIW A;  1I4Z A;  1UG7 A;  4QXC B;  2EIN C;  3RW0 A;  2HV6 A;  3J06 A;  2QUP A;  4U5H A;  4MS2 A;  4XWJ A;  1RKE B;  2Y6X A;  2VQF T;  5C2T A;  4JE9 A;  5A69 A;  2WZL A;  2JPU A;  3K1S A;  1D0Y A;  4H9P C;  3ANW B;  4YJW A;  3GMI A;  4CI1 B;  4NTF A;  3O6X A;  1D0X A;  2NWB A;  4C90 A;  2HZ8 A;  3ABM C;  3PCV A;  4BJN A;  3L8J A;  2GFH A;  4E17 A;  2Z15 A;  3C98 B;  2ZXW C;  2LSE A;  1OCR C;  4TX5 A;  2WB5 A;  3MK7 C;  4IL9 A;  1T5O A;  5IWA T;  1AJ3 A;  3AJM A;  5FKY A;  4AKR B;  1GM5 A;  3K33 A;  1VYI A;  2XQ8 A;  3AE2 A;  1Z63 A;  3VKH A;  3RFY A;  2CRB A;  4HFH A;  3AXJ A;  4AKG A;  5AQI B;  2J7P A;  3QMK A;  2WBL A;  4TNV A;  4U7Y A;  2G0U A;  2PBI A;  1WR0 A;  1ZV4 X;  1YZA A;  3MBG A;  3EUH A;  1IJ6 A;  1EQ1 A;  1I4Y A;  4F8H A;  1YAR O;  4G2A A;  3M1C B;  4E7Z A;  2LSY A;  1XWJ A;  3QW0 A;  3NRX A;  4A5X A;  4IRE A;  1SYQ A;  4NQF A;  3W8I A;  4IT4 A;  2YWA A;  3PUA A;  2DHR A;  3POV A;  1U89 A;  5LNK A;  2A0U A;  3HKB E;  4QHO A;  2CGE A;  3AA0 B;  1Z23 A;  3K1H A;  3MKD A;  2PNO A;  4U2Y A;  2ZD9 A;  2Q9Q B;  3N5L A;  3S84 A;  3GM1 A;  2Q3T A;  4CXX A;  3R2P A;  2A68 F;  4AIU A;  3P4Q A;  3AEB A;  2R7W A;  2XLW A;  4KBL A;  2WWV A;  2KWI B;  1DOW A;  3O10 A;  2W4M A;  3AE8 A;  5L0D A;  1OED B;  1Q0D A;  3EPV A;  5JRC A;  256B A;  1YW0 A;  4F4B A;  4UV9 B;  3AAA B;  5AQU B;  2BKP A;  5CB4 E;  3O1I A;  2D0T A;  3CX6 B;  2V7L A;  3HL6 A;  2AWY A;  3KDS E;  2J9B A;  3B0P A;  3B57 A;  1HX1 B;  1BBH A;  2A6H F;  2R05 A;  5AC5 A;  2MHR A;  4E7S A;  2DI3 A;  4DV7 T;  3O55 A;  2HPL A;  3VYW A;  1OW6 A;  3WG7 C;  3T8O A;  1U0B B;  3JYH A;  3H3M A;  4QH5 A;  2YZS A;  2XUE A;  2XAJ B;  3AE5 A;  4IDN A;  5AC4 A;  2E9X B;  2CMR A;  2CA5 A;  4JLE A;  4YJ2 E;  3FB2 A;  1BR1 A;  2VVN A;  4ZI7 E;  2J47 A;  4CSA A;  1H9G A;  3EHM A;  2XL8 A;  1E7P A;  1AEP A;  5KYY B;  3F46 A;  1XDP A;  1Z5Z A;  3ZG1 A;  4HWI B;  3IHR A;  3LUT B;  2Y69 C;  3DAF A;  1HFA A;  4WBO A;  5B3S C;  4BJM A;  2AWC A; 
#chains in the Genus database with same CATH homology
 1D0Z A;  3RH3 A;  4I1M A;  1D1A A;  2EHO D;  2PFD A;  2VB6 A;  2Q9Q D;  1TR2 A;  3DD7 A;  3ZMZ B;  5L3D B;  1WYC A;  2CNW A;  4CS8 A;  1FFH A;  4IE4 A;  5BUO A;  2WWU A;  3L3P A;  2XAF B;  2X51 A;  1HG2 A;  2V7M A;  1H7C A;  3HKE E;  3PTR B;  4HKA A;  4I55 E;  3K7D A;  2C5K T;  3UGO A;  2ZM0 A;  4H63 H;  3Q9D A;  5L3B B;  4PJM A;  3CQZ A;  3LK2 B;  4YT8 A;  1O5H A;  5L3Q A;  2XSE A;  1O87 A;  1LVK A;  4V1A v;  5LCY A;  2QY9 A;  2XRH A;  3T4R A;  3AQB A;  2NG1 A;  4GOU A;  3LS1 A;  2DWK A;  2L81 A;  4IGU A;  4I1O B;  1RJ9 A;  4AK9 A;  4GK5 E;  2Y39 A;  5FMN A;  2J0W A;  1NU9 C;  2ACX A;  2YK0 A;  2E8I A;  3AA6 B;  4K7B A;  4OYK A;  3PU8 A;  4C7O B;  4O4J E;  3BQK A;  3IEE A;  3CX8 B;  4TV9 E;  4UF0 B;  4LLC A;  2V1D B;  3A5X A;  3RKO F;  5BMV E;  5FXV A;  3K1I C;  2ZXR A;  5KYX A;  4DBQ A;  4BJ6 A;  4WJ0 A;  1MIV A;  2R7R A;  2NW7 A;  2LE8 A;  2DWG A;  2WMN A;  4OIO F;  4EOZ B;  5HXC A;  4DOZ A;  1TWC A;  4IST A;  5LBQ B;  4G7O F;  3UMH A;  4PFO A;  2D0U A;  1OKK D;  4DVZ A;  2E87 A;  3LBX B;  3N2G E;  3WI3 A;  2KNH A;  2X9Y A;  3PHF 2;  3GA8 A;  4HFV A;  5JVD E;  4H9Q C;  5LG4 A;  2QA7 A;  4AQF C;  5IHY A;  4LAC B;  3EQL F;  4UVB B;  2NW9 A;  2DYS C;  4RD9 A;  4BA9 A;  4L0R A;  4O4H E;  1US7 B;  5JDN A;  5FNV E;  3SRZ A;  5LHI B;  5JR9 C;  5HWY A;  3SP1 A;  2LSI A;  2HV7 A;  1M2V A;  2YIN A;  5FP3 A;  1TWH A;  4IE5 A;  4O79 A;  2IXO A;  4HFF B;  3SYN A;  5LOV E;  2JD3 A;  2JQQ A;  3S27 A;  3K8P C;  1SF8 A;  5LBM A;  3I1A A;  4ZHQ E;  3DM5 A;  5LP6 E;  2B1E A;  3Q2M A;  3T6J A;  2WVN A;  3L09 A;  4O4L E;  3RRC A;  3NRY A;  2ZLY A;  4P0A A;  3NKD A;  5H6R B;  2XAH B;  3PE0 A;  3VHL A;  2FFH A;  1UX5 A;  4RBN A;  2V7K A;  1V9D A;  3EGX B;  2J9V A;  2M4E A;  3ZMV B;  2W45 A;  2A72 A;  5F8P A;  2P9B A;  3EVY A;  1O3X A;  4EYU A;  1M57 C;  2CWY A;  4MQ9 F;  2KMF A;  3UUX B;  3EDU A;  2V26 A;  3CVR A;  3D0T A;  1FMV A;  1J8Y F;  2UXN B;  3L34 A;  3FHD A;  2JMH A;  3AG2 C;  3AG4 C;  4JCH A;  1HF8 A;  2ES0 A;  3FXD B;  5LA6 E;  1ZHZ A;  4JVS A;  4Z8X A;  1ST6 A;  3EGD A;  2Q9Q C;  4YHJ A;  2Y3D A;  3JSZ A;  1EZ3 A;  3RYH E;  3V7O A;  2ZM2 A;  2LM9 A;  4KNW A;  4G0H A;  3UFE A;  3OYX A;  3ITF A;  4DVD A;  4GEH A;  4TV8 E;  2NW8 A;  2KZ7 B;  3ZSU A;  1WLX A;  1HG5 A;  2N9D A;  3ZVR A;  4JUY A;  3T6B A;  3LLI A;  3E08 A;  4ASK A;  4QXH B;  4BAY B;  3LES A;  4C3B A;  1SZI A;  5L3F B;  1VYK A;  2D5U A;  3E9V A;  2E9X C;  2H7O A;  3N9P A;  2NUT A;  4PK6 A;  2CM0 A;  2I8B A;  3KBT A;  2FGY A;  1YD8 G;  3Q7G A;  3UT5 E;  2WZG A;  5HAX A;  5JDG A;  3CX7 B;  2CXD A;  2JPF A;  2A2F X;  4HFK B;  2P6V A;  4H9S E;  4ZS2 A;  2J45 A;  2X9H A;  2O9X A;  2DYR C;  2ZMA A;  4O6Y A;  2WB7 A;  2H7V C;  2R7X A;  5KMG P;  1J8M F;  4AE4 A;  2CCQ A;  3E22 E;  3Q6M A;  1Z6A A;  4IE0 A;  5T3W A;  3JCU Q;  4X1K E;  3HKC E;  3CWZ B;  2VWA A;  4GYS A;  2CWO A;  3I9Y A;  3H65 A;  3S28 A;  4IDZ A;  3DTO A;  1N1C A;  4OD4 A;  3ONX A;  4XAX B;  4IIJ E;  1YKH B;  5LHG B;  5CA1 E;  4Q4Z F;  2G62 A;  1IAP A;  1ZKE A;  5DAB A;  3EG9 B;  4G7H F;  2J9U A;  3KV9 A;  2IXN A;  4M63 A;  1M2O A;  4PJN A;  1NWM X;  4U5E E;  5CA0 E;  2DCF A;  3HLZ A;  4LLE A;  1VMA A;  2Z6E A;  3BQI A;  5JDQ A;  2VK9 A;  4ZS3 A;  2LSK A;  2JMK A;  4IAO A;  3RYF E;  4AQF A;  5FY7 A;  4BJ5 C;  2MYS A;  2IW5 B;  4BG0 A;  4IWB A;  2W61 A;  4JJG A;  5EZY E;  1S35 A;  1OCC C;  2BZB A;  3UUN A;  2C04 A;  2KLQ A;  4OK0 A;  3QZC A;  1FMW A;  2BE5 F;  1U4Q A;  5JRC B;  3KV6 A;  1SMY F;  4EBB A;  3I4U A;  2X67 A;  5ADX L;  3ZJ1 A;  4MAL A;  2LT3 A;  4OIR F;  3LJB A;  1PCX A;  2LHN A;  3ZN1 B;  2PJQ A;  3JC6 D;  5E0O A;  1UX4 A;  3TD7 A;  2MBG A;  3N24 A;  4CXY A;  4ZOL E;  2K9A A;  4EYY R;  4H9N C;  1OXZ A;  2IXM A;  3VU7 H;  2Y3B A;  3NRH A;  5L3V A;  1KU2 A;  3S4U A;  3SOL A;  4M1P A;  2R7V A;  3MLG A;  3Q5X A;  1QLE C;  2CW0 F;  4I44 A;  4O6N A;  5A1L A;  4FWV A;  5DQZ A;  3JT1 A;  1TWG A;  1NZE A;  1ZHT A;  4EAH A;  1TKN A;  4HGA A;  2EHO A;  4K0U A;  1IZN B;  4CS7 A;  4IRU A;  1WRD A;  2Q9Q A;  4P09 A;  3I5P A;  4EB6 E;  2CEA A;  1WR6 A;  4ANJ A;  1G73 A;  3X2Q C;  2OG2 A;  5HWX A;  2WM9 A;  4FJO A;  1KK7 A;  2HH7 A;  3O1H A;  2Y48 B;  1QZX A;  4U5F E;  3ZIB A;  2YEV C;  3Q7L A;  3X1O A;  3DZA A;  3EJN A;  5HXE A;  4U5C E;  3ECS A;  2NTY A;  2Q9A A;  5F5H A;  4B6X A;  5JRE A;  5KDM C;  4HN9 A;  3EZH A;  3SZR A;  5FY1 A;  2MOZ A;  3ETV A;  3W2V A;  5B1A C;  3N9N A;  4OD5 A;  2WVO A;  2RP4 A;  3PDY A;  3H3A A;  4QKN A;  3DJN B;  3QUJ A;  3WAJ A;  1RJ9 B;  4CXW A;  1S94 A;  3NZQ A;  2L9J A;  4YWQ A;  2R7S A;  4CIH A;  3F57 A;  2E9X D;  4HE8 D;  4YFS A;  5EK3 A;  4A56 A;  1B7T A;  3ETU A;  2DLR A;  5KYW A;  3NG1 A;  3FAJ A;  3M65 A;  4C3E A;  3UNG C;  1ZHY A;  4UEL A;  2W63 A;  3CQG B;  2Y3G A;  5B1B C;  4C3D A;  2EIM C;  3PUQ A;  5KYX B;  5T1D B;  5KYU A;  3N2Z B;  4EZH A;  1IW7 F;  5KX5 E;  2V7I A;  2BDE A;  4XTK A;  3KVB A;  2L3L A;  3ZCJ A;  3AAE B;  2XXA A;  2WSS V;  5L3C B;  3LJC A;  2KIN B;  5IYZ E;  3RX6 A;  4U5B E;  2KND A;  1OKK A;  4DND A;  1CUN A;  1WYB A;  4UVC B;  1MNE A;  5E3C A;  4AKL A;  5TAO A;  3U3I A;  3WAK A;  3OKQ A;  4U5D E;  3W8H A;  4TN7 B;  4O2B E;  5DVW A;  1OCZ C;  3NBX X;  4WBN E;  3FVY A;  5HXH A;  4CS9 C;  4CI2 B;  4DVY P;  5LJN A;  1M2V B;  3AAI A;  3R6N A;  3LEV A;  4BJ5 A;  1JPN A;  2ODU A;  3CKD A;  3N9O A;  2R7O A;  4UEM A;  1D1C A;  2OA5 A;  3LG7 A;  3UMI A;  4K0D A;  2A1D D;  5D91 A;  2LSJ A;  5LYJ E;  3E70 C;  4GK0 E;  4DMW A;  1PD0 A;  5E33 A;  3CML A;  5CI8 A;  4OYJ A;  5HSW A;  4FX5 A;  1VK5 A;  5JDF A;  4Q7C A;  2WZF A;  3KH2 A;  3JC6 C;  1NU7 D;  2K48 A;  4ZLC A;  4DO0 A;  3EFO A;  3CQX C;  2LEH A;  3ABK C;  2XL4 A;  4ZI3 C;  4KNV A;  1LS1 A;  2W00 A;  4H9R C;  4WW0 A;  4AQG A;  4CQI A;  4PK5 A;  4HEA A;  4EZ4 A;  4IE6 A;  4J30 B;  1MMD A;  1NG1 A;  3O1J A;  4TZ4 C;  4L9I A;  2V7J A;  3OJA A;  3FBZ A;  4GIW A;  2XTL A;  3UGP A;  3LLK A;  1MMN A;  4QI2 A;  1W2W A;  4XZC A;  1V54 C;  4KMC A;  2DGJ A;  1ZU5 A;  2W4B A;  3JRT A;  4UIG A;  2R7T A;  4TUY E;  5LGU B;  2R7U A;  4XLP F;  2W0G A;  4XLN F;  4J32 B;  3HR0 A;  4YLH A;  2LSG A;  3KV4 A;  3UTK A;  2UXX B;  5E3A A;  4OHF A;  2LOS A;  4U5G A;  1IJ5 A;  1MND A;  1IZM A;  3SEO A;  5LJM A;  5DQV A;  4L5G A;  2A3D A;  2H3R A;  4YT5 A;  2P7V A;  3AG3 C;  2A69 F;  1Z3I X;  4QX8 B;  3RYI E;  2X9W A;  2PFV A;  1E1H B;  3GN5 A;  3K3O A;  3MJX A;  4HEA J;  5EGY A;  3PU3 A;  3ZCI A;  2PP4 A;  3SS1 A;  2PG8 A;  2OCC C;  4CI3 B;  2KQ9 A;  2ODV A;  3W15 B;  5KYN A;  5M4Y A;  4MND A;  4U72 A;  3HKD E;  3ZMT B;  3P7I A;  3SNH A;  3F31 A;  3N2O A;  2JRK A;  1D1B A;  1MMA A;  3QK6 A;  3E0Z A;  3C4X A;  5T3T A;  5FY0 A;  1NAF A;  1HTJ F;  3OYZ A;  3CSK A;  2KT9 A;  2XAQ B;  5DS4 A;  3O39 A;  3P8C D;  3ZC4 A;  3KKB A;  3PMR A;  3RYL A;  3FHN A;  4BJT A;  2Y3H A;  1UCU A;  2WVQ A;  3NYJ A;  4NUU A;  3C4W A;  3DP7 A;  3UUM A;  4ZI2 D;  1HCI A;  4ADZ A;  1OCO C;  1U5P A;  2CXF A;  4CS9 A;  4OFZ A;  5LGT B;  4GYT A;  4A2N B;  3V5S A;  5J2T E;  2VL8 A;  5GON E;  2NUP A;  4X0R A;  2XHE B;  2KJG A;  2Q9B A;  2X0L B;  2R7Q A;  5FXX A;  3OA1 A;  4G63 A;  5JQG E;  3KMI A;  3NKE A;  1JPJ A;  4LER A;  5E2Q A;  2SPC A;  4O7G A;  4PJJ A;  2W62 A;  3DXJ F;  5JR9 A;  3EG9 A;  5EHH A;  3ZYK A;  4DBR A;  1TWA A;  2WAU A;  2XQY A;  1V55 C;  2Y8D A;  2J1D G;  4I50 E;  5L3E B;  3NYM A;  5DJQ C;  3UMK A;  4W8K A;  2IC9 A;  3ASN C;  3GWH A;  4F6R C;  1LRZ A;  4JEH B;  4CBE A;  3ZYL A;  3K6B A;  4H4K C;  4AX2 A;  3ANW A;  3EDV A;  3C50 A;  4ZI3 D;  2N1G A;  3DM9 B;  1ZHC A;  5DQW A;  1FIO A;  2CLY B;  3FXE B;  4C91 A;  2J7P D;  2EHO B;  2A6E F;  2YU1 A;  1VRB A;  2QGS A;  3ASO C;  3CQC B;  3ZMS B;  4OIP F;  3IBP A;  3N9Q A;  3UUL A;  3ZLI A;  3RPU A;  3B13 A;  3K66 A;  3AVS A;  3Q6N A;  5IY5 C;  3KL4 A;  4NY3 A;  3C64 A;  4ZLD A;  3DMD A;  1MIW A;  4N78 D;  2KGO A;  4I43 B;  2C5J A;  3LNR A;  4PFP A;  2G3V A;  2MTQ A;  3AQC A;  3MZK B;  5JH7 E;  3RKO A;  5F5F A;  2X9X A;  1HX8 A;  4IE7 A;  4AXP A;  2EIJ C;  2XAG B;  3LFM A;  1ZU4 A;  4PJL A;  5DLJ A;  5EK2 A;  3MX3 A;  3AG1 C;  3J9X 1;  2VKJ A;  3LK3 B;  2E9X A;  2MWQ A;  5KYW B;  1SA0 E;  4HE8 A;  3V5U A;  3ZPO A;  2I59 A;  5FYM A;  3KBU A;  5KYY A;  1Y64 B;  5H6Q B;  5L3G B;  3KV5 A;  1M56 C;  3OEO A;  3LAY A;  2C03 A;  2IAK A;  4MBQ A;  5JDL A;  5KYU B;  3N9M A;  4YN0 B;  3N9L A;  4PW8 A;  1BR2 A;  4B6I A;  3FDQ A;  4H63 V;  2VH3 A;  2VKD A;  3SWH A;  3F47 A;  2XXA B;  2CNW D;  4J2C A;  4UXN B;  2V3C C;  3TKL B;  2PX3 A;  4MHC A;  4CZZ B;  4MLK A;  2BVM A;  3L0I A;  4G7Z F;  4EWC A;  5DS5 A;  4ULW A;  1LKX A;  2N2N A;  1FTS A;  3OWT A;  2DI4 A;  2Q9C A;  2C0S A;  2JJ9 A;  2XAS B;  2ZPA A;  2J0X A;  1BR0 A;  3ZJ2 A;  4U74 A;  3EH1 A;  4JEU B;  4PK4 A;  3ZEF B;  4P6I C;  3ZC0 A;  4ZI2 C;  3ESL A;  4KUM B;  1Z0P A;  2CDQ A;  2PF4 E;  3RC8 A;  1WGW A;  2H7B A;  2LOP A;  4ERR A;  4UVA B;  3NDB B;  4ILU A;  4JUR I;  1FFT C;  1BR4 A;  5ETW A;  4QWN B;  5C8Y E;  4C7O A;  3RYC E;  4OIQ F;  3PUR A;  3S0X A;  3PUS A;  3EFO B;  4PAG A;  4ISS A;  4KC9 A;  4XBF B;  4UF0 A;  3B0V C;  5LGN B;  1HS7 A;  3K3N A;  3U78 A;  2J46 A;  2LHR A;  3PUG A;  2DNX A;  4O2A E;  2NOX A;  4QI0 A;  3DJB A;  2CXL A;  3NZP A;  4UV8 B;  3S29 A;  3EHN A;  4O6M A;  3KVA A;  2VAS A;  2D5R B;  3QC9 A;  1QUU A;  4QDL A;  2EIK C;  3CZ6 A;  3BK9 A;  3ZMU B;  5CI9 A;  4Q5S F;  4JJF A;  2ZM8 A;  4P0B A;  3I0O A;  3LBX A;  2W9Y A;  4IHJ E;  2YU2 A;  4WNK A;  1OWA A;  3AA7 B;  3VAY A;  4AKI A;  1T98 A;  4KP3 C;  3O4X E;  3N0T A;  5J1G A;  3ZC1 A;  2IC6 A;  3DAG A;  3C4Z A;  5FXW A;  3I5Q A;  5DQT A;  2YHS A;  3EGD B;  4NUV A;  3RC3 A;  5EK4 A;  1QSD A;  3F2E A;  4QX7 B;  4RDA A;  4GYR A;  2NP9 A;  4I4T E;  3B0U X;  3GAN A;  2WMO A;  2KW3 C;  2GK9 A;  4JZA A;  4FES A;  4YT4 A;  4AI6 A;  3ZN0 B;  3AVR A;  1FEW A;  5AFU L;  5LXT E;  2LJL A;  3HA4 A;  2KXP B;  3GN5 B;  3ZYM A;  2ZXO A;  4AKH A;  5FCL A;  1SHZ C;  3DJU B;  3I9W A;  3GOD A;  2YEV A;  4BEJ A;  3KIN B;  3J7Y q;  4MFR A;  3BQL A;  2WL8 A;  1ZHX A;  3Q5W A;  2CLY C;  4CSA C;  2NUT B;  2EHO C;  5J2U E;  3EGX A;  1ZHW A;  3HJC A;  1VOM A;  2PX0 A;  2RA1 A;  1PD1 A;  5FXZ A;  3RRW A;  3C51 A;  3MA9 A;  3UR3 C;  3I0Q A;  3B9Q A;  4H9O C;  3HTK C;  5F3J A;  4AE4 B;  3EZI A;  1YKE B;  3VKG A;  1MIY A;  3O9X A;  2IXP A;  4IJJ A;  4YT2 A;  2ZXP A;  4KI2 A;  2HPJ A;  1G8X A;  4CS8 C;  4OIN F;  5LHH B;  2L8K A;  3W2W A;  3RIP A;  4JW1 A;  3MXZ A;  3FBL A;  3IF8 B;  4QXB B;  3N2K E;  4FI5 A;  5L2L A;  2K5B B;  4DMV A;  2D2S A;  1ZYR F;  3K3Q C;  2C5I T;  1MMG A;  2IOQ A;  1S7Z A;  5JDH A;  5D92 A;  2G3K A;  2L9Q A;  2K24 A;  4YJ3 E;  2VKH A;  3ABL C;  3KFW X;  3NYL A;  5HXS A;  4HTE A;  5HXR A;  5HYA A;  2M67 A;  2NTX A;  4X1I E;  3OBV E;  1X79 A;  5JDM A;  3AB3 B;  5DS6 A;  3AA1 B;  1LVF A;  3LS0 A;  1ZEE A;  2NUP B;  2X68 A;  3R84 B;  3WOD F;  3H37 A;  4EXT A;  2CE7 A;  3MAC A;  3HI2 A;  4PNI A;  2X66 A;  2J9W A;  3CPZ A;  2BVL A;  2KWH A;  4O8S A;  4N06 A;  4X20 E;  1KNZ A;  4BJ1 A;  4O4I E;  3EH2 A;  2B0J A;  5JR9 B;  2QTV A;  3LK4 2;  4I3M A;  4KBM B;  4X1Y E;  2IYL D;  2VKO A;  2EIL C;  4BJ6 C;  4EIW A;  4QXC B;  2EIN C;  2HV6 A;  4U5H A;  4XWJ A;  2Y6X A;  2WZL A;  1D0Y A;  4H9P C;  3ANW B;  4YJW A;  3GMI A;  4CI1 B;  3O6X A;  1D0X A;  2NWB A;  4C90 A;  3ABM C;  4BJN A;  2GFH A;  2Z15 A;  3C98 B;  2ZXW C;  2LSE A;  1OCR C;  4TX5 A;  3MK7 C;  1AJ3 A;  4AKR B;  3K33 A;  1VYI A;  1Z63 A;  3VKH A;  3RFY A;  4AKG A;  2J7P A;  3QMK A;  2WBL A;  2G0U A;  2PBI A;  1ZV4 X;  3EUH A;  1IJ6 A;  4G2A A;  3M1C B;  4E7Z A;  2LSY A;  3NRX A;  3W8I A;  3PUA A;  2DHR A;  3POV A;  5LNK A;  3HKB E;  4QHO A;  2CGE A;  3AA0 B;  1Z23 A;  3K1H A;  3MKD A;  2Q9Q B;  3N5L A;  2Q3T A;  4CXX A;  2A68 F;  2R7W A;  4KBL A;  2KWI B;  2W4M A;  3EPV A;  5JRC A;  4F4B A;  1YW0 A;  4UV9 B;  3AAA B;  5CB4 E;  3O1I A;  2D0T A;  3CX6 B;  2V7L A;  3HL6 A;  3B0P A;  3KDS E;  3B57 A;  2A6H F;  4E7S A;  2HPL A;  3VYW A;  3WG7 C;  3T8O A;  3JYH A;  2YZS A;  2XUE A;  2XAJ B;  2E9X B;  2CMR A;  2CA5 A;  4JLE A;  4YJ2 E;  3FB2 A;  1BR1 A;  4ZI7 E;  4CSA A;  3EHM A;  5KYY B;  3F46 A;  1Z5Z A;  3ZG1 A;  3IHR A;  2Y69 C;  3DAF A;  1HFA A;  4WBO A;  5B3S C;  4BJM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...