2F22A

Crystal structure of a putative dna damage-inducable (dinb) protein (bh3987) from bacillus halodurans at 1.42 a resolution
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
142
structure length
142
Chain Sequence
GMDTNGVLYAANMTNALAKEIPESKWDIQLIPELGTLRKLFIHIVRVRDVYRDGLKTGSIKFPGRLASDEHRLLDELERSMEELVFEFKQTTFNSIKMGENYLSIMELLGTVIQHEGIHQGQYYVALKQSGINLPKQWVQDW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of BH3987 from Bacillus halodurans at 1.42 A resolution
rcsb
source organism Bacillus halodurans
molecule tags Metal binding protein
molecule keywords BH3987
total genus 52
structure length 142
sequence length 142
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05163 DinB DinB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.450 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) dinb family like domain 2f22A00
3QTHA 2P1AA 2RD9A 2QE9A 5CIVA 2OQMA 2NSFA 5COGA 1RXQA 4N6CA 3DI5A 2YQYA 5COMA 3DKAA 5COFA 2QNLA 3GORA 3CEXA 2F22A 2HKVA 2OU6A 2NSGA
chains in the Genus database with same CATH superfamily
5L0GA 1BDJB 5L3QA 4PJNA 4EBBA 2AWCA 1TWAA 2XLMA 1HMOA 1MMDA 2WVOA 3CSKA 2XLHA 5L0FA 1A41A 4DVYP 1HW1A 4OD5A 3QVYA 4Q7CA 2EPKX 1NU7D 1ST6A 1D0ZA 1FFTC 2AP3A 5CIVA 2IXNA 1MNEA 4EUKB 5L0IA 1D1AA 3EFOA 2QNLA 4HFFB 4QI0A 4ZLDA 4X0RA 1QZXA 3OWTA 4U5CE 3GWNA 4DXWA 2XSEA 2ETSA 3ASOC 4J7TA 4G7HF 4U5BE 1HE9A 3I4UA 2KJGA 2PFDA 3G50A 2XLWA 2UUIA 4K1OA 2PF4E 1ORYA 2MYSA 4BJ6C 3F46A 3RFYA 1T6QA 4YJWA 3HKKA 3KYJA 3NYMA 3ZIBA 3DJNB 5T3TA 3CAXA 4CS9A 4EBJA 1JAFA 3TULA 2XXAA 2TMVP 2IXPA 1KU2A 2Q7RA 2GAQA 2XL4A 4JE9A 4MTGA 4YL1A 2WVNA 3I5QA 1SZIA 5F28E 4N6CA 3SXYA 4N4WA 2HSBA 3RH3A 2Q9CA 3C62A 3TD7A 1JPNA 1M56C 1VLSA 2KQ9A 1T6IA 2LFFA 2NG1A 2PX3A 3B29A 3DE8A 4KNVA 1LI5A 4E17A 2Y3GA 5KYUA 3EGXB 3IQCA 3Q6NA 3CQZA 1FFHA 4ANJA 3JT1A 3DMDA 3JYHA 2R7SA 4CIHA 2MWQA 4H4KC 1Q0KA 3FVYA 2Q3TA 3EGXA 2DI3A 5A6AA 3NDBB 1V74B 3KYIA 1YA7O 4JJFA 3WODF 2AVKA 2CGEA 3TOMA 1BR4A 1EA8A 4PFPA 1QVXA 2LK4A 3B0VC 1VYKA 1RJ9B 3JCUQ 3K1IC 1H6GA 1NFNA 2ASRA 2FFHA 3L8JA 3HNKA 5JP7A 3SP1A 4IWBA 3AG1C 5A6JA 1MMAA 3EG9B 3L8IA 4JCHA 4D4NA 4HFKB 5DS4A 5A6BA 4C7OA 1B68A 1EI7A 3H2UA 4MQ9F 1U6HA 2Y3DA 4O6NA 5CI9A 3FDQA 2FGYA 4G7ZF 1K40A 1QKRA 1T6UA 4I3MA 5B1AC 1NSGB 5KYWB 5DS5A 1ZW3A 1DOWA 4U5FE 1FMWA 1ZU5A 3B0PA 2KGOA 1LKXA 1JR8A 3NMKA 4NTFA 4CBEA 1GQAA 5EGYA 1L3PA 2L81A 4KC9A 1Z23A 1YDIA 4JZAA 4O6YA 4RD9A 1XWJA 3JYYA 1U89A 2WZGA 4LLEA 4MVRA 3U2MA 1WWPA 3GM1A 1YZAA 2E87A 1RKEA 1OXBA 1GS9A 3U3BA 1VYIA 3O6XA 2AU5A 4C3DA 4OIPF 3AG2C 3LAYA 3VM6A 2Q4FA 2R7WA 4MVZA 5K0IA 1TQGA 1ZHZA 1Z6AA 3BRJA 4XQ1A 4CDAA 4MTFA 2ICWG 1VK5A 4ER9A 3DKAA 3M1CB 2YL7A 3FAJA 1V54C 2R7RA 1GGQA 1A7DA 1M2VB 1ZHXA 2VASA 4NTBA 4EKWA 3QMKA 2A6EF 3C8ZA 1OW7A 2QY9A 1I4ZA 1OCRC 2R7QA 1OW8A 3EGDB 4N6HA 1OCOC 3FXHA 5DLJA 1A7VA 3QTHA 3B9QA 3LS0A 3HNIA 3Q7LA 3S28A 3PDMP 2YVKA 4MVUA 3ZVRA 4ZLCA 2C04A 3R7CA 2VH3A 1SF8A 3C18A 2HS5A 3SYNA 3M4BA 2XLEA 3KH2A 2ZXPA 2YL1A 4PR9A 1RKEB 2Z15A 2CDQA 5JT4A 5KYNA 2IYLD 4U5GA 2L7AA 2MHRA 3RW0A 4E18A 2YL3A 1WATA 5AGFA 3T6GB 3J06A 1H7IA 3DM5A 3EPVA 4YT8A 2W9YA 3G4XA 1OXKA 1LE4A 2YHSA 4MW8A 4WJ0A 5F5HA 3UGPA 2F22A 4NC3A 1LM3B 4BJ1A 1QPUA 4UDVA 1AEPA 4BEMJ 4JVSA 2OEVA 2HZ8A 1T9KA 4XPWA 1BR2A 2ZXWC 1M2VA 2J7PA 1LPEA 3C8GA 5GPGB 1TWCA 1HY5A 1HMDA 1NU9C 4XEFA 2C03A 4C7OB 4BG0A 5A6BD 1RKCA 1Y4CA 3QVZA 3TJ6A 1NG1A 3WG7C 1E2XA 3K1IA 1RXQA 5A6KA 4MVQA 1JOGA 1NFOA 2EIKC 1WTYA 3A9CA 1T01A 2GA0A 1UG7A 5HV9A 2R9RB 2M64A 1WGWA 3K33A 2GDCA 3GM3A 3HNLA 2NUPB 1Y6DA 3L0IA 3M79A 4IJJA 1JPJA 2JD3A 2WB7A 4GQHA 4U5EE 2CCYA 4QDLA 2H8AA 3FHDA 4MVOA 2AWYA 2OU6A 3NRHA 2IBFA 1SR2A 2HJ3A 3TOLA 4KBLA 4U9EA 2R7XA 2PNOA 4ONSA 3W8IA 4JURI 1WASA 5BQGA 3JRTA 2EIMC 3VRCA 3S27A 2YZSA 4GYTA 3ZTZA 2EPMX 2DGJA 4DRHB 5KYXB 2BL2A 3U2LA 5KYYB 3IQ6A 2H7BA 2EPLX 4NY3A 1LVKA 2G3KA 1HW2A 2DB4A 3DAGA 4EWCA 1IW7F 2ZD9A 3HLZA 3GODA 3DM9B 3ECSA 3K7DA 3M15A 1K04A 4WABA 2NPUA 1R5ID 1QQ3A 4XEVA 4LACB 2X51A 1YARO 2LCHA 2YL0A 1FMVA 4O79A 5BUOA 5JLIA 4P9FA 4XLPF 2XLVA 1A7EA 4C3EA 4AX2A 1XZPA 1K05A 3VYWA 4BJ6A 1N1CA 4IAOA 5DQTA 2VC9A 3EQLF 3MX3A 3R2PA 1IZMA 3UR3C 3VF0A 2QUPA 2QTVA 4IAQA 2OJQA 3O10A 4DVZA 4CJOA 1OCZC 2CYDA 3F47A 1V4AA 3W4YA 4XPXA 4DJ9A 3FAPB 3VAYA 3TQOA 1CGOA 1MQVA 3O39A 4RBNA 5E3CA 3LNMB 5IY5C 2XL6A 3RQFA 2G62A 4P6IC 5L0DA 2BC5A 3O55A 1YA9A 1PV3A 4EIYA 1G5ZA 3N2ZB 2R7TA 2M4EA 1TKNA 3H2VA 3U9JA 3A11A 3E9VA 2R03A 5KYYA 1DOVA 3QW0A 4HEAJ 2GWWA 3PCVA 3UGOA 5JRAA 1BZ4A 2HMQA 5FZTA 4CS9C 2YLDA 3GM2A 3V5XA 2YEVA 3N24A 1ZYRF 3ZTMA 4N06A 1Z5ZA 4JTCB 2RSEB 4XWJA 2J7PD 1LE2A 3C8GD 1G4WR 2J9WA 5T1DB 5T3WA 3EHMA 3DE9A 4WGZA 4JC7A 1E85A 3EH1A 3MLGA 4CS8C 2P7VA 4ULVA 3B71A 1CGME 3S9OA 4BJ5C 2IXOA 3GWLA 4CDYA 3HTKC 5E2QA 2A68F 1XZQA 3NKDA 4JJGA 1M57C 2LIGA 3V5YA 3U8VA 1Z3IX 4MW3A 2QE9A 5AC4A 4W8PA 4LDKA 2EILC 3GEEA 2PBEA 2Y39A 4E7SA 1Q0GA 2EINC 3OEOA 1TR2A 2L9JA 2XS8A 3DXJF 3NYJA 2JX0A 3QZCA 1VTMP 1SYQA 1NLXA 2XM0A 1VB5A 1TFKB 1ZW2A 3NMJA 2NUTA 4IB4A 1Z7Qc 4NTAA 2YRFA 4IARA 1VMAA 1ZHYA 4FX5A 4HE8D 3SXMA 1VLTA 5B3SC 3U3FA 3JTLO 4F4BA 2YKZA 3DJUB 3X2QC 4JEAA 2Q9AA 3ZWIA 2OOCA 1MMGA 2HV6A 5L0HA 2HJMA 4G0HA 3U8PA 4MVSA 2L6GA 2WL8A 3AG4C 4AE4A 2XL8A 3U5SA 1J8YF 2RD9A 4W8KA 2J45A 3KMIA 4BPMA 2L6FA 3ZSUA 4E7ZA 5L0JA 4XPYA 4G7OF 2XLOA 4PJJA 1E86A 1T5OA 1YJGA 3IPMO 4U5HA 2EIJC 3LS1A 2J9VA 3T4RA 1BBHA 3LNRA 1YVIA 3SNHA 4AL1A 3V7OA 3S84A 2V3CC 2YLIA 4JTAB 4E0IA 5HSWA 4I1OB 1YLMA 2HMZA 2Q9BA 4LDRA 2YQYA 3GEHA 1LIHA 2EPNA 4JIOA 1S7ZA 3IHUA 3LEOA 5JSLA 4YT4A 3W8HA 1QLEC 5EK0A 3EGDA 1M2OA 3V5ZA 3ABKC 3UMIA 4WGYA 3RKOF 1D0XA 3C8GB 3EJNA 1PCXA 4OD4A 5L3VA 2CNWD 5JUAA 3NKEA 4JW1A 2HV7A 4CIPA 3AOUA 4FWVA 2R7VA 3ZQYA 4OIRF 5BQHA 3Q7GA 1TFOB 2LP4A 2VCAA 2CNWA 4E0HA 3NG1A 4LERA 1H9TA 1OCCC 3LJBA 1TWGA 3T6JA 2R25A 2A0UA 4Q5SF 4JTDB 3E70C 3IEEA 2D4UA 2LD6A 4EBKA 2J8WA 1RJ9A 1FR0A 1H9GA 2OCCC 1C02A 3ITFA 1SMYF 2J46A 3RF3A 2W4BA 5DS6A 256BA 2UUHA 4R32A 4PFOA 5F5FA 3GORA 4EHPA 3LUTB 1J8MF 2BE5F 4LLCA 5B3IA 1JRAA 4MTOA 3UMKA 1OKKD 1S05A 2R02A 1Q0DA 1RCPA 2OG2A 4M63A 3AGTA 4PJMA 1MMNA 2HFIA 1AVOB 2Q00A 3X1OA 2I8BA 4AK9A 4I44A 4MS2A 5KYWA 5TJ5E 1O5HA 3T6BA 1YAUO 2KK1A 4NQFA 4J32B 3EG9A 2HUJA 3RQGA 1ZHTA 1O3UA 2A6HF 1C03A 3AGUA 3AJMA 3JRMO 4MNDA 4XTKA 2NSFA 5E33A 3JZ0A 3SEOA 1JMWA 2WVQA 5KYXA 2L6HA 4Z9IA 1CPRA 2XXAB 1KNYA 3DI5A 4JCZA 5EHHA 3US6A 4JEBA 1EQ1A 3KKBA 4U9DA 4BJTA 1KTMA 1G8XA 2P6VA 2X0CA 2VCBA 3RYLA 5A69A 3POVA 1F1MA 4YT5A 4U5DE 2PP4A 5AC5A 2NUPA 1MNDA 3FOPA 4DRJB 4A4AA 1LS1A 2DYSC 4BJ5A 4Z9HA 3NMIA 1A0BA 2OJED 2P1AA 4A2NB 3LLKA 2P61A 3RQEA 1YZCA 3TJ5A 1UFBA 4PJLA 2IM8A 3EHNA 4CJGA 2H7OA 1D0YA 4O7GA 2Y3BA 4NCQA 4Z9JA 1ZU4A 3U9MA 1OR3A 3CZ6A 3DAFA 1QSPA 3C7JA 1D1CA 3RVYA 5DQZA 3PHF2 1EKYA 2O9XA 1PD1A 3L34A 4H54A 2A0BA 3ATPA 2OEXA 3BEHA 1V55C 3AQCA 1I5NA 3GANA 4J30B 4DBRA 5BQIA 5COFA 3SXKA 4D4XA 2GFHA 4KNWA 3ABMC 1Q0MA 2CW0F 2J9BA 1ZVZA 3ZDLA 3MYFA 2KYHA 2NSGA 2YWAA 3G4ZA 5CI8A 1O87A 1ZZPA 3ZG1A 1CPQA 3K6BA 5D91A 2LSEA 4FESA 4G78A 1AUEA 4IGGA 2W45A 4YWQA 1VOMA 3L1MA 3DD7A 4OIQF 3TK0A 4I1MA 2R05A 1G4US 2LQGA 3ABLC 5KYUB 3FMSA 1R4TA 4JKVA 3AG3C 4CSAA 3N0TA 4CDVA 3Q6MA 1W2WA 2EPOA 5JS5A 4PACA 1L7CA 2D5RB 2OQMA 3LEVA 1OR2A 1D1BA 2HSQA 1LI7A 2G3VA 3PMRA 3SZRA 2B0HA 1CGNA 1OQCA 2KSFA 2XS1A 3W2VA 3U0CA 4ULWA 4QI2A 2A69F 3JSEO 3M4CA 5COMA 1Z63A 3MYIA 5D92A 3AQBA 2IOQA 1OKKA 1APCA 1PD0A 1TWHA 2VB6A 2YLGA 3EH2A 4IRUA 3KL4A 2Y3HA 2W4MA 4PK4A 3S29A 2FAPB 3FOOA 4P9TA 3WAQA 2LFDA 1C17M 2NUTB 3T9OA 3K1HA 1OW6A 1WOLA 2I15A 1M6TA 3OA1A 5E3AA 4C3BA 1FNTc 5JVEA 4BEJA 5L0CA 4XLNF 4O6MA 4LDQA 3S0XA 3IQ5A 3DWWA 1I4YA 4CSAC 3ZC4A 1E84A 4K7BA 2R7OA 3B0UX 2XRHA 2A1DD 3EZIA 4YL3A 4OIOF 3EFOB 2P0NA 4Q4ZF 4DRIB 4B6IA 3LESA 2KC3A 2KW3C 2OKUA 5B1BC 1GM5A 2WZFA 1RMVA 4FAPB 4XEKA 2KNHA 4RDAA 3MBGA 3GEIA 3QW1A 4K0DA 2QLAA 3CEXA 2ZPAA 4YN0B 4YK5A 4YL0A 2XM4A 2R7UA 3IQTA 3DZAA 1FAPB 4MVMA 4L6RA 3UMHA 2PX0A 1YYJA 5DVWA 2Y69C 3EZHA 3WHNA 2ZXRA 3C63A 3UNGC 3JSZA 1ZHWA 4DOZA 4YT2A 2B0JA 1ORJA 4CS7A 3LLIA 3RVZA 3ASNC 2WZLA 3NYLA 3KPHA 4CX9A 3H65A 5COGA 5FCLA 1WN0A 1Q0FA 3W2WA 3I5PA 3RIPA 2J9UA 2V26A 3SXZA 1NBBA 4DBQA 1LS4A 4J7YA 2VCCA 3ZQVA 1BR1A 1ORSC 1YYXA 3HJCA 3S90A 2JPUA 2DYRC 1FTSA 4OINF 1E83A 4AE4B 4AL0A 1NZEA 4KI2A 1U0BB 4GEHA 3HNJA 2ZXOA 2HKVA 2IXMA 2XLDA 3K66A 4JRZA 2J0XA 4CS8A 3MFNA 2H7VC 2J0WA 1HE1A
chains in the Genus database with same CATH topology
3QTHA 2P1AA 2RD9A 2QE9A 5CIVA 2OQMA 2NSFA 5COGA 1RXQA 4N6CA 3DI5A 2YQYA 5COMA 3DKAA 5COFA 2QNLA 3GORA 3CEXA 2F22A 2HKVA 2OU6A 2NSGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QTH A;  2P1A A;  2RD9 A;  2QE9 A;  5CIV A;  2OQM A;  2NSF A;  5COG A;  1RXQ A;  4N6C A;  3DI5 A;  2YQY A;  5COM A;  3DKA A;  5COF A;  2QNL A;  3GOR A;  3CEX A;  2F22 A;  2HKV A;  2OU6 A;  2NSG A; 
#chains in the Genus database with same CATH topology
 5L0G A;  1BDJ B;  5L3Q A;  4PJN A;  4EBB A;  2AWC A;  1TWA A;  2XLM A;  1HMO A;  1MMD A;  2WVO A;  3CSK A;  2XLH A;  5L0F A;  1A41 A;  4DVY P;  1HW1 A;  4OD5 A;  3QVY A;  4Q7C A;  2EPK X;  1NU7 D;  1ST6 A;  1D0Z A;  1FFT C;  2AP3 A;  5CIV A;  2IXN A;  1MNE A;  4EUK B;  5L0I A;  1D1A A;  3EFO A;  2QNL A;  4HFF B;  4QI0 A;  4ZLD A;  4X0R A;  1QZX A;  3OWT A;  4U5C E;  3GWN A;  4DXW A;  2XSE A;  2ETS A;  3ASO C;  4J7T A;  4G7H F;  4U5B E;  1HE9 A;  3I4U A;  2KJG A;  2PFD A;  3G50 A;  2XLW A;  2UUI A;  4K1O A;  2PF4 E;  1ORY A;  2MYS A;  4BJ6 C;  3F46 A;  3RFY A;  1T6Q A;  4YJW A;  3HKK A;  3KYJ A;  3NYM A;  3ZIB A;  3DJN B;  5T3T A;  3CAX A;  4CS9 A;  4EBJ A;  1JAF A;  3TUL A;  2XXA A;  2TMV P;  2IXP A;  1KU2 A;  2Q7R A;  2GAQ A;  2XL4 A;  4JE9 A;  4MTG A;  4YL1 A;  2WVN A;  3I5Q A;  1SZI A;  5F28 E;  4N6C A;  3SXY A;  4N4W A;  2HSB A;  3RH3 A;  2Q9C A;  3C62 A;  3TD7 A;  1JPN A;  1M56 C;  1VLS A;  2KQ9 A;  1T6I A;  2LFF A;  2NG1 A;  2PX3 A;  3B29 A;  3DE8 A;  4KNV A;  1LI5 A;  4E17 A;  2Y3G A;  5KYU A;  3EGX B;  3IQC A;  3Q6N A;  3CQZ A;  1FFH A;  4ANJ A;  3JT1 A;  3DMD A;  3JYH A;  2R7S A;  4CIH A;  2MWQ A;  4H4K C;  1Q0K A;  3FVY A;  2Q3T A;  3EGX A;  2DI3 A;  5A6A A;  3NDB B;  1V74 B;  3KYI A;  1YA7 O;  4JJF A;  3WOD F;  2AVK A;  2CGE A;  3TOM A;  1BR4 A;  1EA8 A;  4PFP A;  1QVX A;  2LK4 A;  3B0V C;  1VYK A;  1RJ9 B;  3JCU Q;  3K1I C;  1H6G A;  1NFN A;  2ASR A;  2FFH A;  3L8J A;  3HNK A;  5JP7 A;  3SP1 A;  4IWB A;  3AG1 C;  5A6J A;  1MMA A;  3EG9 B;  3L8I A;  4JCH A;  4D4N A;  4HFK B;  5DS4 A;  5A6B A;  4C7O A;  1B68 A;  1EI7 A;  3H2U A;  4MQ9 F;  1U6H A;  2Y3D A;  4O6N A;  5CI9 A;  3FDQ A;  2FGY A;  4G7Z F;  1K40 A;  1QKR A;  1T6U A;  4I3M A;  5B1A C;  1NSG B;  5KYW B;  5DS5 A;  1ZW3 A;  1DOW A;  4U5F E;  1FMW A;  1ZU5 A;  3B0P A;  2KGO A;  1LKX A;  1JR8 A;  3NMK A;  4NTF A;  4CBE A;  1GQA A;  5EGY A;  1L3P A;  2L81 A;  4KC9 A;  1Z23 A;  1YDI A;  4JZA A;  4O6Y A;  4RD9 A;  1XWJ A;  3JYY A;  1U89 A;  2WZG A;  4LLE A;  4MVR A;  3U2M A;  1WWP A;  3GM1 A;  1YZA A;  2E87 A;  1RKE A;  1OXB A;  1GS9 A;  3U3B A;  1VYI A;  3O6X A;  2AU5 A;  4C3D A;  4OIP F;  3AG2 C;  3LAY A;  3VM6 A;  2Q4F A;  2R7W A;  4MVZ A;  5K0I A;  1TQG A;  1ZHZ A;  1Z6A A;  3BRJ A;  4XQ1 A;  4CDA A;  4MTF A;  2ICW G;  1VK5 A;  4ER9 A;  3DKA A;  3M1C B;  2YL7 A;  3FAJ A;  1V54 C;  2R7R A;  1GGQ A;  1A7D A;  1M2V B;  1ZHX A;  2VAS A;  4NTB A;  4EKW A;  3QMK A;  2A6E F;  3C8Z A;  1OW7 A;  2QY9 A;  1I4Z A;  1OCR C;  2R7Q A;  1OW8 A;  3EGD B;  4N6H A;  1OCO C;  3FXH A;  5DLJ A;  1A7V A;  3QTH A;  3B9Q A;  3LS0 A;  3HNI A;  3Q7L A;  3S28 A;  3PDM P;  2YVK A;  4MVU A;  3ZVR A;  4ZLC A;  2C04 A;  3R7C A;  2VH3 A;  1SF8 A;  3C18 A;  2HS5 A;  3SYN A;  3M4B A;  2XLE A;  3KH2 A;  2ZXP A;  2YL1 A;  4PR9 A;  1RKE B;  2Z15 A;  2CDQ A;  5JT4 A;  5KYN A;  2IYL D;  4U5G A;  2L7A A;  2MHR A;  3RW0 A;  4E18 A;  2YL3 A;  1WAT A;  5AGF A;  3T6G B;  3J06 A;  1H7I A;  3DM5 A;  3EPV A;  4YT8 A;  2W9Y A;  3G4X A;  1OXK A;  1LE4 A;  2YHS A;  4MW8 A;  4WJ0 A;  5F5H A;  3UGP A;  2F22 A;  4NC3 A;  1LM3 B;  4BJ1 A;  1QPU A;  4UDV A;  1AEP A;  4BEM J;  4JVS A;  2OEV A;  2HZ8 A;  1T9K A;  4XPW A;  1BR2 A;  2ZXW C;  1M2V A;  2J7P A;  1LPE A;  3C8G A;  5GPG B;  1TWC A;  1HY5 A;  1HMD A;  1NU9 C;  4XEF A;  2C03 A;  4C7O B;  4BG0 A;  5A6B D;  1RKC A;  1Y4C A;  3QVZ A;  3TJ6 A;  1NG1 A;  3WG7 C;  1E2X A;  3K1I A;  1RXQ A;  5A6K A;  4MVQ A;  1JOG A;  1NFO A;  2EIK C;  1WTY A;  3A9C A;  1T01 A;  2GA0 A;  1UG7 A;  5HV9 A;  2R9R B;  2M64 A;  1WGW A;  3K33 A;  2GDC A;  3GM3 A;  3HNL A;  2NUP B;  1Y6D A;  3L0I A;  3M79 A;  4IJJ A;  1JPJ A;  2JD3 A;  2WB7 A;  4GQH A;  4U5E E;  2CCY A;  4QDL A;  2H8A A;  3FHD A;  4MVO A;  2AWY A;  2OU6 A;  3NRH A;  2IBF A;  1SR2 A;  2HJ3 A;  3TOL A;  4KBL A;  4U9E A;  2R7X A;  2PNO A;  4ONS A;  3W8I A;  4JUR I;  1WAS A;  5BQG A;  3JRT A;  2EIM C;  3VRC A;  3S27 A;  2YZS A;  4GYT A;  3ZTZ A;  2EPM X;  2DGJ A;  4DRH B;  5KYX B;  2BL2 A;  3U2L A;  5KYY B;  3IQ6 A;  2H7B A;  2EPL X;  4NY3 A;  1LVK A;  2G3K A;  1HW2 A;  2DB4 A;  3DAG A;  4EWC A;  1IW7 F;  2ZD9 A;  3HLZ A;  3GOD A;  3DM9 B;  3ECS A;  3K7D A;  3M15 A;  1K04 A;  4WAB A;  2NPU A;  1R5I D;  1QQ3 A;  4XEV A;  4LAC B;  2X51 A;  1YAR O;  2LCH A;  2YL0 A;  1FMV A;  4O79 A;  5BUO A;  5JLI A;  4P9F A;  4XLP F;  2XLV A;  1A7E A;  4C3E A;  4AX2 A;  1XZP A;  1K05 A;  3VYW A;  4BJ6 A;  1N1C A;  4IAO A;  5DQT A;  2VC9 A;  3EQL F;  3MX3 A;  3R2P A;  1IZM A;  3UR3 C;  3VF0 A;  2QUP A;  2QTV A;  4IAQ A;  2OJQ A;  3O10 A;  4DVZ A;  4CJO A;  1OCZ C;  2CYD A;  3F47 A;  1V4A A;  3W4Y A;  4XPX A;  4DJ9 A;  3FAP B;  3VAY A;  3TQO A;  1CGO A;  1MQV A;  3O39 A;  4RBN A;  5E3C A;  3LNM B;  5IY5 C;  2XL6 A;  3RQF A;  2G62 A;  4P6I C;  5L0D A;  2BC5 A;  3O55 A;  1YA9 A;  1PV3 A;  4EIY A;  1G5Z A;  3N2Z B;  2R7T A;  2M4E A;  1TKN A;  3H2V A;  3U9J A;  3A11 A;  3E9V A;  2R03 A;  5KYY A;  1DOV A;  3QW0 A;  4HEA J;  2GWW A;  3PCV A;  3UGO A;  5JRA A;  1BZ4 A;  2HMQ A;  5FZT A;  4CS9 C;  2YLD A;  3GM2 A;  3V5X A;  2YEV A;  3N24 A;  1ZYR F;  3ZTM A;  4N06 A;  1Z5Z A;  4JTC B;  2RSE B;  4XWJ A;  2J7P D;  1LE2 A;  3C8G D;  1G4W R;  2J9W A;  5T1D B;  5T3W A;  3EHM A;  3DE9 A;  4WGZ A;  4JC7 A;  1E85 A;  3EH1 A;  3MLG A;  4CS8 C;  2P7V A;  4ULV A;  3B71 A;  1CGM E;  3S9O A;  4BJ5 C;  2IXO A;  3GWL A;  4CDY A;  3HTK C;  5E2Q A;  2A68 F;  1XZQ A;  3NKD A;  4JJG A;  1M57 C;  2LIG A;  3V5Y A;  3U8V A;  1Z3I X;  4MW3 A;  2QE9 A;  5AC4 A;  4W8P A;  4LDK A;  2EIL C;  3GEE A;  2PBE A;  2Y39 A;  4E7S A;  1Q0G A;  2EIN C;  3OEO A;  1TR2 A;  2L9J A;  2XS8 A;  3DXJ F;  3NYJ A;  2JX0 A;  3QZC A;  1VTM P;  1SYQ A;  1NLX A;  2XM0 A;  1VB5 A;  1TFK B;  1ZW2 A;  3NMJ A;  2NUT A;  4IB4 A;  1Z7Q c;  4NTA A;  2YRF A;  4IAR A;  1VMA A;  1ZHY A;  4FX5 A;  4HE8 D;  3SXM A;  1VLT A;  5B3S C;  3U3F A;  3JTL O;  4F4B A;  2YKZ A;  3DJU B;  3X2Q C;  4JEA A;  2Q9A A;  3ZWI A;  2OOC A;  1MMG A;  2HV6 A;  5L0H A;  2HJM A;  4G0H A;  3U8P A;  4MVS A;  2L6G A;  2WL8 A;  3AG4 C;  4AE4 A;  2XL8 A;  3U5S A;  1J8Y F;  2RD9 A;  4W8K A;  2J45 A;  3KMI A;  4BPM A;  2L6F A;  3ZSU A;  4E7Z A;  5L0J A;  4XPY A;  4G7O F;  2XLO A;  4PJJ A;  1E86 A;  1T5O A;  1YJG A;  3IPM O;  4U5H A;  2EIJ C;  3LS1 A;  2J9V A;  3T4R A;  1BBH A;  3LNR A;  1YVI A;  3SNH A;  4AL1 A;  3V7O A;  3S84 A;  2V3C C;  2YLI A;  4JTA B;  4E0I A;  5HSW A;  4I1O B;  1YLM A;  2HMZ A;  2Q9B A;  4LDR A;  2YQY A;  3GEH A;  1LIH A;  2EPN A;  4JIO A;  1S7Z A;  3IHU A;  3LEO A;  5JSL A;  4YT4 A;  3W8H A;  1QLE C;  5EK0 A;  3EGD A;  1M2O A;  3V5Z A;  3ABK C;  3UMI A;  4WGY A;  3RKO F;  1D0X A;  3C8G B;  3EJN A;  1PCX A;  4OD4 A;  5L3V A;  2CNW D;  5JUA A;  3NKE A;  4JW1 A;  2HV7 A;  4CIP A;  3AOU A;  4FWV A;  2R7V A;  3ZQY A;  4OIR F;  5BQH A;  3Q7G A;  1TFO B;  2LP4 A;  2VCA A;  2CNW A;  4E0H A;  3NG1 A;  4LER A;  1H9T A;  1OCC C;  3LJB A;  1TWG A;  3T6J A;  2R25 A;  2A0U A;  4Q5S F;  4JTD B;  3E70 C;  3IEE A;  2D4U A;  2LD6 A;  4EBK A;  2J8W A;  1RJ9 A;  1FR0 A;  1H9G A;  2OCC C;  1C02 A;  3ITF A;  1SMY F;  2J46 A;  3RF3 A;  2W4B A;  5DS6 A;  256B A;  2UUH A;  4R32 A;  4PFO A;  5F5F A;  3GOR A;  4EHP A;  3LUT B;  1J8M F;  2BE5 F;  4LLC A;  5B3I A;  1JRA A;  4MTO A;  3UMK A;  1OKK D;  1S05 A;  2R02 A;  1Q0D A;  1RCP A;  2OG2 A;  4M63 A;  3AGT A;  4PJM A;  1MMN A;  2HFI A;  1AVO B;  2Q00 A;  3X1O A;  2I8B A;  4AK9 A;  4I44 A;  4MS2 A;  5KYW A;  5TJ5 E;  1O5H A;  3T6B A;  1YAU O;  2KK1 A;  4NQF A;  4J32 B;  3EG9 A;  2HUJ A;  3RQG A;  1ZHT A;  1O3U A;  2A6H F;  1C03 A;  3AGU A;  3AJM A;  3JRM O;  4MND A;  4XTK A;  2NSF A;  5E33 A;  3JZ0 A;  3SEO A;  1JMW A;  2WVQ A;  5KYX A;  2L6H A;  4Z9I A;  1CPR A;  2XXA B;  1KNY A;  3DI5 A;  4JCZ A;  5EHH A;  3US6 A;  4JEB A;  1EQ1 A;  3KKB A;  4U9D A;  4BJT A;  1KTM A;  1G8X A;  2P6V A;  2X0C A;  2VCB A;  3RYL A;  5A69 A;  3POV A;  1F1M A;  4YT5 A;  4U5D E;  2PP4 A;  5AC5 A;  2NUP A;  1MND A;  3FOP A;  4DRJ B;  4A4A A;  1LS1 A;  2DYS C;  4BJ5 A;  4Z9H A;  3NMI A;  1A0B A;  2OJE D;  2P1A A;  4A2N B;  3LLK A;  2P61 A;  3RQE A;  1YZC A;  3TJ5 A;  1UFB A;  4PJL A;  2IM8 A;  3EHN A;  4CJG A;  2H7O A;  1D0Y A;  4O7G A;  2Y3B A;  4NCQ A;  4Z9J A;  1ZU4 A;  3U9M A;  1OR3 A;  3CZ6 A;  3DAF A;  1QSP A;  3C7J A;  1D1C A;  3RVY A;  5DQZ A;  3PHF 2;  1EKY A;  2O9X A;  1PD1 A;  3L34 A;  4H54 A;  2A0B A;  3ATP A;  2OEX A;  3BEH A;  1V55 C;  3AQC A;  1I5N A;  3GAN A;  4J30 B;  4DBR A;  5BQI A;  5COF A;  3SXK A;  4D4X A;  2GFH A;  4KNW A;  3ABM C;  1Q0M A;  2CW0 F;  2J9B A;  1ZVZ A;  3ZDL A;  3MYF A;  2KYH A;  2NSG A;  2YWA A;  3G4Z A;  5CI8 A;  1O87 A;  1ZZP A;  3ZG1 A;  1CPQ A;  3K6B A;  5D91 A;  2LSE A;  4FES A;  4G78 A;  1AUE A;  4IGG A;  2W45 A;  4YWQ A;  1VOM A;  3L1M A;  3DD7 A;  4OIQ F;  3TK0 A;  4I1M A;  2R05 A;  1G4U S;  2LQG A;  3ABL C;  5KYU B;  3FMS A;  1R4T A;  4JKV A;  3AG3 C;  4CSA A;  3N0T A;  4CDV A;  3Q6M A;  1W2W A;  2EPO A;  5JS5 A;  4PAC A;  1L7C A;  2D5R B;  2OQM A;  3LEV A;  1OR2 A;  1D1B A;  2HSQ A;  1LI7 A;  2G3V A;  3PMR A;  3SZR A;  2B0H A;  1CGN A;  1OQC A;  2KSF A;  2XS1 A;  3W2V A;  3U0C A;  4ULW A;  4QI2 A;  2A69 F;  3JSE O;  3M4C A;  5COM A;  1Z63 A;  3MYI A;  5D92 A;  3AQB A;  2IOQ A;  1OKK A;  1APC A;  1PD0 A;  1TWH A;  2VB6 A;  2YLG A;  3EH2 A;  4IRU A;  3KL4 A;  2Y3H A;  2W4M A;  4PK4 A;  3S29 A;  2FAP B;  3FOO A;  4P9T A;  3WAQ A;  2LFD A;  1C17 M;  2NUT B;  3T9O A;  3K1H A;  1OW6 A;  1WOL A;  2I15 A;  1M6T A;  3OA1 A;  5E3A A;  4C3B A;  1FNT c;  5JVE A;  4BEJ A;  5L0C A;  4XLN F;  4O6M A;  4LDQ A;  3S0X A;  3IQ5 A;  3DWW A;  1I4Y A;  4CSA C;  3ZC4 A;  1E84 A;  4K7B A;  2R7O A;  3B0U X;  2XRH A;  2A1D D;  3EZI A;  4YL3 A;  4OIO F;  3EFO B;  2P0N A;  4Q4Z F;  4DRI B;  4B6I A;  3LES A;  2KC3 A;  2KW3 C;  2OKU A;  5B1B C;  1GM5 A;  2WZF A;  1RMV A;  4FAP B;  4XEK A;  2KNH A;  4RDA A;  3MBG A;  3GEI A;  3QW1 A;  4K0D A;  2QLA A;  3CEX A;  2ZPA A;  4YN0 B;  4YK5 A;  4YL0 A;  2XM4 A;  2R7U A;  3IQT A;  3DZA A;  1FAP B;  4MVM A;  4L6R A;  3UMH A;  2PX0 A;  1YYJ A;  5DVW A;  2Y69 C;  3EZH A;  3WHN A;  2ZXR A;  3C63 A;  3UNG C;  3JSZ A;  1ZHW A;  4DOZ A;  4YT2 A;  2B0J A;  1ORJ A;  4CS7 A;  3LLI A;  3RVZ A;  3ASN C;  2WZL A;  3NYL A;  3KPH A;  4CX9 A;  3H65 A;  5COG A;  5FCL A;  1WN0 A;  1Q0F A;  3W2W A;  3I5P A;  3RIP A;  2J9U A;  2V26 A;  3SXZ A;  1NBB A;  4DBQ A;  1LS4 A;  4J7Y A;  2VCC A;  3ZQV A;  1BR1 A;  1ORS C;  1YYX A;  3HJC A;  3S90 A;  2JPU A;  2DYR C;  1FTS A;  4OIN F;  1E83 A;  4AE4 B;  4AL0 A;  1NZE A;  4KI2 A;  1U0B B;  4GEH A;  3HNJ A;  2ZXO A;  2HKV A;  2IXM A;  2XLD A;  3K66 A;  4JRZ A;  2J0X A;  4CS8 A;  3MFN A;  2H7V C;  2J0W A;  1HE1 A; 
#chains in the Genus database with same CATH homology
 3QTH A;  2P1A A;  2RD9 A;  2QE9 A;  5CIV A;  2OQM A;  2NSF A;  5COG A;  1RXQ A;  4N6C A;  3DI5 A;  2YQY A;  5COM A;  3DKA A;  5COF A;  2QNL A;  3GOR A;  3CEX A;  2F22 A;  2HKV A;  2OU6 A;  2NSG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...