2F22A

Crystal structure of a putative dna damage-inducable (dinb) protein (bh3987) from bacillus halodurans at 1.42 a resolution
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
142
structure length
142
Chain Sequence
b'GMDTNGVLYAANMTNALAKEIPESKWDIQLIPELGTLRKLFIHIVRVRDVYRDGLKTGSIKFPGRLASDEHRLLDELERSMEELVFEFKQTTFNSIKMGENYLSIMELLGTVIQHEGIHQGQYYVALKQSGINLPKQWVQDW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BH3987
publication title Crystal structure of BH3987 from Bacillus halodurans at 1.42 A resolution
rcsb
source organism Bacillus halodurans
molecule tags Metal binding protein
total genus 52
structure length 142
sequence length 142
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05163 DinB DinB family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.450 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) dinb family like domain 2f22A00
3QTHA 1RXQA 3GORA 2OQMA 5COGA 2RD9A 2OU6A 3DKAA 2NSFA 2HKVA 3CEXA 5CIVA 2P1AA 2QE9A 2YQYA 3DI5A 2NSGA 2QNLA 5COMA 5COFA 2F22A 4N6CA
chains in the Genus database with same CATH superfamily
1T6UA 4IGGA 3TD7A 4EBKA 4DJ9A 3HNLA 3O39A 4G7ZF 3M79A 4RDAA 1FR0A 3IQCA 2FGYA 2GA0A 3T6GB 2HSBA 4XEVA 1LIHA 4CDVA 5JT4A 3U3FA 2PP4A 1H6GA 2XM0A 2XS1A 4ZLDA 5E3CA 4MVOA 3LESA 3ZIBA 5JVEA 3I4UA 2FAPB 1U0BB 1MMAA 3EH2A 4NTFA 2VH3A 3HLZA 2YWAA 1C17M 2AWCA 4JC7A 2R02A 4DBRA 1NBBA 1Z7Qc 2YHSA 3EFOB 4MVMA 4A4AA 4CIPA 2J46A 5T3TA 3W4YA 4DVZA 1M2VB 1MNEA 2R05A 1UG7A 1QLEC 1Z3IX 2A1DD 2YKZA 3DE8A 3JSEO 3M4CA 3GEEA 4HFFB 3EGXB 1FAPB 4XEKA 5KYUB 1LKXA 2UUIA 3GORA 3H2VA 3L8JA 5L0CA 2R7RA 5K0IA 1I4ZA 4AL1A 3Q6MA 2R7QA 4PFPA 2VCCA 2X51A 3WAQA 2PNOA 3ZSUA 1S7ZA 1XZPA 1RCPA 1BDJB 2LQGA 1HW1A 5E3AA 3S28A 3T4RA 4MVSA 2WL8A 3SEOA 4C3EA 5KYXB 1MMGA 2XLDA 2EINC 1BZ4A 3WHNA 3SNHA 4ZLCA 4OIPF 1N1CA 2XRHA 5COMA 4CJOA 2CDQA 3GM3A 4YT5A 2R7OA 2XXAA 2O9XA 5BUOA 1LM3B 3FAJA 4G7OF 2WVQA 1E83A 4DXWA 3B0PA 3MLGA 1A7VA 4NY3A 3POVA 2EIJC 5F5FA 1JAFA 3KYJA 4YK5A 3V7OA 1CPRA 3C7JA 1RMVA 2IYLD 4XTKA 1YARO 1OKKD 4JEAA 3AGUA 3OWTA 5JP7A 4IB4A 4YT4A 5KYWA 1J8MF 3U0CA 4N6HA 3EQLF 3KKBA 3G50A 4PK4A 2WZGA 2KC3A 2L7AA 1OW8A 2HUJA 2OU6A 2XLOA 2QY9A 3WODF 4MVQA 1Z23A 3TJ6A 3TK0A 1AUEA 2D4UA 4WGZA 2KYHA 3VM6A 1A41A 3X2QC 3TULA 4YL0A 3SXKA 2Q9BA 1JRAA 4M63A 2DYSC 2J9BA 2YLGA 2Y3BA 1YDIA 1C02A 3EJNA 3RQFA 4MVUA 4X0RA 2LP4A 2Y69C 3NKDA 4XQ1A 3SXYA 4U5DE 2QLAA 3LEVA 2NG1A 4O6YA 1G5ZA 3U8PA 1QZXA 1IZMA 4Z9IA 4EBBA 4N6CA 1OR3A 4Q5SF 3B9QA 3U2MA 5A6KA 3QTHA 3C8ZA 5A6BD 3X1OA 5DS4A 3GEHA 2WVOA 2OKUA 1YLMA 1WWPA 3DE9A 2J0XA 3PMRA 4PJNA 2Q00A 1VLTA 3N24A 4IWBA 4LERA 2JD3A 4MQ9F 4PFOA 3SXZA 3RQEA 1CPQA 1WOLA 1NSGB 5EGYA 4Z9JA 4JJGA 2YL1A 1WN0A 4NTBA 4CS8A 3UR3C 3GANA 3IQ5A 4G78A 2CCYA 3S9OA 5DLJA 2P0NA 3EGDB 4E7ZA 2EPKX 3AG4C 3K33A 4A2NB 4NCQA 3VAYA 3SP1A 3S29A 3SZRA 2R9RB 1V74B 3EFOA 3U8VA 4OD4A 2XLHA 4C7OB 1M2VA 1WGWA 4U9DA 2R7VA 4U5BE 4XLPF 4EKWA 3R2PA 1RXQA 2L81A 3EGXA 1C03A 4AE4A 1Z63A 3C18A 4XPXA 5KYUA 3F46A 1G8XA 2YL0A 4J7YA 4NC3A 5A6AA 3ABKC 4JJFA 4RBNA 5A69A 1OKKA 1D0XA 2PF4E 1EA8A 4LLCA 1TWHA 1FFHA 1YA7O 3PCVA 4L6RA 3LUTB 2FFHA 2B0JA 4JVSA 4WJ0A 4DRHB 1BR2A 5CI9A 5KYXA 2IXOA 4P9TA 4FAPB 1OXBA 5COFA 5B1AC 2R7SA 2L9JA 5AC4A 3W2WA 2WZLA 2P61A 3HKKA 4IAQA 4QI2A 1QVXA 3FMSA 1EQ1A 1QPUA 4MTFA 1I5NA 1NU7D 3BEHA 3KH2A 4JCZA 2JX0A 4K7BA 4PJLA 1Y4CA 1QQ3A 2YVKA 3JZ0A 4MVRA 4P9FA 3K1HA 2CNWA 4JURI 1R5ID 5JUAA 3S90A 1NFNA 4ANJA 2OQMA 3ASOC 2OOCA 5T1DB 5EHHA 2LSEA 3FVYA 5A6BA 4U5FE 4AX2A 5B3SC 4OIQF 3NMJA 4BJ6A 1L3PA 2EIKC 3K66A 4K1OA 2WZFA 3CEXA 1XWJA 4P6IC 1ZHTA 2GFHA 2L6GA 3B29A 3HNKA 3LNRA 3M15A 3R7CA 5HV9A 4PACA 2A68F 2GAQA 2HV6A 3CZ6A 4FX5A 3AG3C 5AGFA 4D4XA 2F22A 1V4AA 3I5QA 3EPVA 3O10A 3ZQVA 1HMDA 2H7BA 2XL8A 1A0BA 3GODA 2AWYA 1PD1A 1PV3A 1ZHZA 2VB6A 1QSPA 2L6HA 3NG1A 1JOGA 4J7TA 2KQ9A 3HNJA 4U5HA 3AQCA 5L0FA 4HFKB 4XEFA 1E2XA 1M2OA 4G0HA 1R4TA 3ZWIA 1M57C 2YEVA 4JEBA 3C63A 3G4ZA 2KW3C 3ABMC 3NDBB 3JSZA 2I8BA 2IXMA 3KYIA 4GYTA 3DM9B 4BJ1A 4CS8C 3NKEA 4HE8D 4QI0A 1E86A 1Z5ZA 1LE2A 3PHF2 3DMDA 2R7XA 5L0DA 4JIOA 5L0IA 1VOMA 2DB4A 1KNYA 1WASA 2B0HA 2M4EA 5BQIA 1D1CA 2A6HF 2NSGA 3ZVRA 4RD9A 3B0UX 3J06A 3B71A 3QVYA 2VASA 3EGDA 3S27A 5A6JA 3UGOA 4CDAA 1HW2A 2EPOA 4KNWA 1YYXA 1EI7A 2D5RB 2W9YA 2AU5A 3K1IA 1OCCC 4FESA 3A9CA 5EK0A 5KYYB 2E87A 5D91A 3O6XA 1DOVA 1LS4A 2LD6A 1ZVZA 1ZU4A 2OEXA 2VC9A 2YL7A 4C7OA 1Q0MA 4U9EA 4OINF 2XM4A 2IXNA 2XLMA 4Z9HA 2Y39A 5B3IA 1U89A 2C03A 2GDCA 3O55A 5COGA 3S0XA 2HSQA 3U2LA 2J7PD 2NUTB 3DAFA 2KNHA 2NSFA 1HMOA 4C3DA 3FDQA 1ZW3A 2PFDA 4O6NA 3T9OA 1APCA 1DOWA 1O5HA 1OXKA 2OJQA 2YQYA 1ZHWA 2HV7A 3EZIA 3DI5A 3RQGA 3K7DA 4XLNF 4CS9A 4EUKB 1YA9A 3GWNA 3LEOA 1GM5A 2W45A 5BQGA 1H9TA 1YJGA 5L0JA 4CIHA 2OCCC 2LFFA 2XL6A 5FCLA 1I4YA 1ZHYA 2R25A 2EIMC 1BBHA 3FOOA 5JSLA 1Y6DA 5DVWA 1L7CA 4JRZA 3NMIA 4D4NA 1B68A 3MYIA 5DS5A 3VF0A 3AQBA 1K04A 4BJ6C 3W8IA 4KI2A 5T3WA 3M4BA 4CS7A 4BPMA 2KJGA 2Z15A 1NLXA 2QTVA 2W4MA 3DKAA 4E0IA 1TR2A 3EG9B 3LS1A 4XPWA 2HKVA 4BEJA 2AVKA 3LNMB 1LI5A 3OA1A 2QE9A 1WATA 1VK5A 2ZXPA 1NFOA 3DAGA 3GM1A 2NUPB 4XWJA 2PBEA 4E17A 3DZAA 3LLIA 1TFKB 4J30B 1FTSA 2J9WA 2KK1A 2IBFA 2EILC 3CAXA 1OQCA 3KMIA 2HMZA 3LLKA 4CSAC 1D0YA 1LS1A 1T5OA 4EWCA 1TWAA 4I44A 1O3UA 1TWCA 2H8AA 5D92A 2PX3A 2H7VC 1W2WA 2PX0A 3FXHA 5BQHA 1RJ9B 1E84A 3RYLA 1VLSA 4ONSA 1ZU5A 1LVKA 1O87A 2RSEB 3CQZA 4JW1A 1M6TA 4NQFA 4U5EE 3F47A 4JKVA 3DWWA 3HNIA 3DM5A 2P6VA 3T6BA 1QKRA 3U9MA 3RVYA 3QVZA 3ZTZA 1A7EA 3NYMA 3AG2C 4G7HF 4O7GA 3NYLA 1YZCA 3UNGC 4E18A 2Q4FA 1ZYRF 2MHRA 2P1AA 4ULVA 1YZAA 2YRFA 2IM8A 4CX9A 4CJGA 2NPUA 4I3MA 1KU2A 4LDRA 4DRJB 2J7PA 1FMWA 3K1IC 3EH1A 5JRAA 3RVZA 4AK9A 2Y3HA 4OIRF 1G4US 3AGTA 4PR9A 3LS0A 4I1MA 2C04A 3VRCA 2MWQA 4JCHA 2LK4A 4IAOA 4DVYP 1Z6AA 5KYYA 1CGNA 1ST6A 2BC5A 5F28E 1UFBA 3JRMO 3KPHA 5IY5C 2YZSA 1E85A 2EPNA 4JE9A 4MNDA 4BJ5A 2ICWG 4BEMJ 2LIGA 5L0GA 2G3VA 3GEIA 5FZTA 4JTCB 3JYYA 1NU9C 2NUTA 2X0CA 4CS9C 2GWWA 2QUPA 2M64A 1LI7A 3US6A 2V3CC 1IW7F 1SR2A 1D0ZA 4JTAB 3N0TA 4J32B 4BG0A 4FWVA 1NG1A 5JS5A 1OW7A 2YLIA 2AP3A 2YL3A 3I5PA 4DOZA 3C8GB 1OCZC 3ECSA 4Q7CA 1JR8A 4I1OB 1OR2A 4JZAA 2ASRA 3MYFA 1PCXA 2BL2A 1F1MA 1SF8A 2J0WA 1LE4A 3E70C 1RKEB 2Q3TA 3EHNA 4KBLA 5GPGB 4CSAA 3QW1A 3MBGA 1KTMA 3B0VC 4GQHA 1MMDA 5E33A 4ULWA 1LPEA 4N06A 3AOUA 2XLEA 3ZDLA 3L0IA 2J45A 4NTAA 3AJMA 3U3BA 3MFNA 3EG9A 3C8GD 2L6FA 2Q9AA 2ZXOA 2ZD9A 4LDQA 3CSKA 1CGME 2NUPA 1D1BA 2KSFA 4CDYA 2H7OA 1MQVA 2DYRC 2CGEA 1T01A 4F4BA 1K05A 4DBQA 1GS9A 1T9KA 1TFOB 2HJMA 3ABLC 3K6BA 4U5CE 4YJWA 5DQZA 3N2ZB 1V54C 4AL0A 3AG1C 2DGJA 1VYKA 1GGQA 1RJ9A 4AE4B 1K40A 1S05A 3LJBA 2VCAA 1OCOC 3W8HA 3Q6NA 4H54A 2V26A 1ORYA 2ZXRA 2RD9A 3FHDA 4LDKA 2P7VA 2WB7A 2Y3DA 2IOQA 3SXMA 4CBEA 2XSEA 4LACB 3DJNB 2OG2A 3E9VA 3IQ6A 3TOMA 3V5XA 3V5ZA 5L3VA 2R7UA 4IJJA 1TWGA 3NMKA 2CW0F 1NZEA 2UUHA 3TOLA 1ORJA 4JTDB 4B6IA 1HE9A 3Q7GA 3DJUB 1SYQA 3W2VA 2QNLA 3C62A 4MW8A 2LFDA 4GEHA 4KNVA 2R03A 1H7IA 1BR1A 2HFIA 1Q0FA 3UMKA 4MTGA 1YVIA 2I15A 4W8KA 1MNDA 5TJ5E 4R32A 256BA 3EZHA 3ZC4A 3IQTA 2OEVA 4BJ5C 5L0HA 4YT2A 4ER9A 2R7TA 1A7DA 2KGOA 3RH3A 1AVOB 3ZG1A 3SYNA 4YWQA 2XLVA 1J8YF 3H2UA 5DS6A 1T6IA 3IEEA 4N4WA 1VTMP 1JPJA 4PJMA 4W8PA 4HEAJ 4WABA 3JYHA 1V55C 3NRHA 2Q9CA 1U6HA 2WVNA 4LLEA 4U5GA 4H4KC 2HJ3A 1XZQA 4MS2A 1VB5A 5F5HA 4O6MA 2MYSA 1Q0KA 4QDLA 4Q4ZF 2HS5A 1H9GA 1SZIA 5DQTA 4DRIB 1ZW2A 1JPNA 1ZHXA 2CNWD 3C8GA 3FAPB 4YT8A 1D1AA 3A11A 3H65A 5HSWA 2IXPA 4MTOA 4XPYA 5AC5A 3T6JA 3UGPA 2TMVP 4EHPA 2EPMX 2G3KA 1TKNA 1BR4A 1Q0GA 2W4BA 2VCBA 3QZCA 1YAUO 3U9JA 1RKEA 2XS8A 1MMNA 1ORSC 3MX3A 3NYJA 3QW0A 4OD5A 3UMIA 3HJCA 4MVZA 3OEOA 3TQOA 2EPLX 2A0BA 3JT1A 2LCHA 1FNTc 1YYJA 5B1BC 1PD0A 1AEPA 2HMQA 3ATPA 1T6QA 1FFTC 4IARA 4WGYA 3L1MA 3JCUQ 2J9VA 3DD7A 3G4XA 5E2QA 3IHUA 5CI8A 2J8WA 3S84A 3RIPA 2XXAB 4YL3A 3V5YA 4EIYA 4MW3A 1SMYF 2ZPAA 3EHMA 1OCRC 3LAYA 2BE5F 3DXJF 3RF3A 1G4WR 2HZ8A 2ETSA 3ASNC 1TQGA 3RW0A 3BRJA 4OIOF 1VYIA 2A6EF 1FMVA 4YN0B 3L8IA 4E0HA 2A0UA 4E7SA 1VMAA 5KYWB 3JRTA 3ZTMA 3PDMP 2G62A 3IPMO 4KC9A 4K0DA 3WG7C 4BJTA 3ITFA 3HTKC 3JTLO 2YLDA 4IRUA 4O79A 3UMHA 5JLIA 4UDVA 1RKCA 2Y3GA 4C3BA 1JMWA 1HY5A 4PJJA 3VYWA 2R7WA 2A69F 5KYNA 3RKOF 5CIVA 1WTYA 1OW6A 1HE1A 3Q7LA 2OJED 4YL1A 4EBJA 2Q7RA 3FOPA 1Q0DA 3GM2A 1EKYA 3M1CB 2CYDA 1GQAA 2XL4A 2JPUA 2XLWA 2ZXWC 3ZQYA 1ZZPA 3GWLA 3KL4A 3RFYA 2J9UA 3TJ5A 1M56C 5L3QA 1CGOA 3U5SA 2DI3A 3QMKA 3L34A
chains in the Genus database with same CATH topology
3QTHA 1RXQA 3GORA 2OQMA 5COGA 2RD9A 2OU6A 3DKAA 2NSFA 2HKVA 3CEXA 5CIVA 2P1AA 2QE9A 2YQYA 3DI5A 2NSGA 2QNLA 5COMA 5COFA 2F22A 4N6CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QTH A;  1RXQ A;  3GOR A;  2OQM A;  5COG A;  2RD9 A;  2OU6 A;  3DKA A;  2NSF A;  2HKV A;  3CEX A;  5CIV A;  2P1A A;  2QE9 A;  2YQY A;  3DI5 A;  2NSG A;  2QNL A;  5COM A;  5COF A;  2F22 A;  4N6C A; 
#chains in the Genus database with same CATH topology
 1T6U A;  4IGG A;  3TD7 A;  4EBK A;  4DJ9 A;  3HNL A;  3O39 A;  4G7Z F;  3M79 A;  4RDA A;  1FR0 A;  3IQC A;  2FGY A;  2GA0 A;  3T6G B;  2HSB A;  4XEV A;  1LIH A;  4CDV A;  5JT4 A;  3U3F A;  2PP4 A;  1H6G A;  2XM0 A;  2XS1 A;  4ZLD A;  5E3C A;  4MVO A;  3LES A;  3ZIB A;  5JVE A;  3I4U A;  2FAP B;  1U0B B;  1MMA A;  3EH2 A;  4NTF A;  2VH3 A;  3HLZ A;  2YWA A;  1C17 M;  2AWC A;  4JC7 A;  2R02 A;  4DBR A;  1NBB A;  1Z7Q c;  2YHS A;  3EFO B;  4MVM A;  4A4A A;  4CIP A;  2J46 A;  5T3T A;  3W4Y A;  4DVZ A;  1M2V B;  1MNE A;  2R05 A;  1UG7 A;  1QLE C;  1Z3I X;  2A1D D;  2YKZ A;  3DE8 A;  3JSE O;  3M4C A;  3GEE A;  4HFF B;  3EGX B;  1FAP B;  4XEK A;  5KYU B;  1LKX A;  2UUI A;  3GOR A;  3H2V A;  3L8J A;  5L0C A;  2R7R A;  5K0I A;  1I4Z A;  4AL1 A;  3Q6M A;  2R7Q A;  4PFP A;  2VCC A;  2X51 A;  3WAQ A;  2PNO A;  3ZSU A;  1S7Z A;  1XZP A;  1RCP A;  1BDJ B;  2LQG A;  1HW1 A;  5E3A A;  3S28 A;  3T4R A;  4MVS A;  2WL8 A;  3SEO A;  4C3E A;  5KYX B;  1MMG A;  2XLD A;  2EIN C;  1BZ4 A;  3WHN A;  3SNH A;  4ZLC A;  4OIP F;  1N1C A;  2XRH A;  5COM A;  4CJO A;  2CDQ A;  3GM3 A;  4YT5 A;  2R7O A;  2XXA A;  2O9X A;  5BUO A;  1LM3 B;  3FAJ A;  4G7O F;  2WVQ A;  1E83 A;  4DXW A;  3B0P A;  3MLG A;  1A7V A;  4NY3 A;  3POV A;  2EIJ C;  5F5F A;  1JAF A;  3KYJ A;  4YK5 A;  3V7O A;  1CPR A;  3C7J A;  1RMV A;  2IYL D;  4XTK A;  1YAR O;  1OKK D;  4JEA A;  3AGU A;  3OWT A;  5JP7 A;  4IB4 A;  4YT4 A;  5KYW A;  1J8M F;  3U0C A;  4N6H A;  3EQL F;  3KKB A;  3G50 A;  4PK4 A;  2WZG A;  2KC3 A;  2L7A A;  1OW8 A;  2HUJ A;  2OU6 A;  2XLO A;  2QY9 A;  3WOD F;  4MVQ A;  1Z23 A;  3TJ6 A;  3TK0 A;  1AUE A;  2D4U A;  4WGZ A;  2KYH A;  3VM6 A;  1A41 A;  3X2Q C;  3TUL A;  4YL0 A;  3SXK A;  2Q9B A;  1JRA A;  4M63 A;  2DYS C;  2J9B A;  2YLG A;  2Y3B A;  1YDI A;  1C02 A;  3EJN A;  3RQF A;  4MVU A;  4X0R A;  2LP4 A;  2Y69 C;  3NKD A;  4XQ1 A;  3SXY A;  4U5D E;  2QLA A;  3LEV A;  2NG1 A;  4O6Y A;  1G5Z A;  3U8P A;  1QZX A;  1IZM A;  4Z9I A;  4EBB A;  4N6C A;  1OR3 A;  4Q5S F;  3B9Q A;  3U2M A;  5A6K A;  3QTH A;  3C8Z A;  5A6B D;  3X1O A;  5DS4 A;  3GEH A;  2WVO A;  2OKU A;  1YLM A;  1WWP A;  3DE9 A;  2J0X A;  3PMR A;  4PJN A;  2Q00 A;  1VLT A;  3N24 A;  4IWB A;  4LER A;  2JD3 A;  4MQ9 F;  4PFO A;  3SXZ A;  3RQE A;  1CPQ A;  1WOL A;  1NSG B;  5EGY A;  4Z9J A;  4JJG A;  2YL1 A;  1WN0 A;  4NTB A;  4CS8 A;  3UR3 C;  3GAN A;  3IQ5 A;  4G78 A;  2CCY A;  3S9O A;  5DLJ A;  2P0N A;  3EGD B;  4E7Z A;  2EPK X;  3AG4 C;  3K33 A;  4A2N B;  4NCQ A;  3VAY A;  3SP1 A;  3S29 A;  3SZR A;  2R9R B;  1V74 B;  3EFO A;  3U8V A;  4OD4 A;  2XLH A;  4C7O B;  1M2V A;  1WGW A;  4U9D A;  2R7V A;  4U5B E;  4XLP F;  4EKW A;  3R2P A;  1RXQ A;  2L81 A;  3EGX A;  1C03 A;  4AE4 A;  1Z63 A;  3C18 A;  4XPX A;  5KYU A;  3F46 A;  1G8X A;  2YL0 A;  4J7Y A;  4NC3 A;  5A6A A;  3ABK C;  4JJF A;  4RBN A;  5A69 A;  1OKK A;  1D0X A;  2PF4 E;  1EA8 A;  4LLC A;  1TWH A;  1FFH A;  1YA7 O;  3PCV A;  4L6R A;  3LUT B;  2FFH A;  2B0J A;  4JVS A;  4WJ0 A;  4DRH B;  1BR2 A;  5CI9 A;  5KYX A;  2IXO A;  4P9T A;  4FAP B;  1OXB A;  5COF A;  5B1A C;  2R7S A;  2L9J A;  5AC4 A;  3W2W A;  2WZL A;  2P61 A;  3HKK A;  4IAQ A;  4QI2 A;  1QVX A;  3FMS A;  1EQ1 A;  1QPU A;  4MTF A;  1I5N A;  1NU7 D;  3BEH A;  3KH2 A;  4JCZ A;  2JX0 A;  4K7B A;  4PJL A;  1Y4C A;  1QQ3 A;  2YVK A;  3JZ0 A;  4MVR A;  4P9F A;  3K1H A;  2CNW A;  4JUR I;  1R5I D;  5JUA A;  3S90 A;  1NFN A;  4ANJ A;  2OQM A;  3ASO C;  2OOC A;  5T1D B;  5EHH A;  2LSE A;  3FVY A;  5A6B A;  4U5F E;  4AX2 A;  5B3S C;  4OIQ F;  3NMJ A;  4BJ6 A;  1L3P A;  2EIK C;  3K66 A;  4K1O A;  2WZF A;  3CEX A;  1XWJ A;  4P6I C;  1ZHT A;  2GFH A;  2L6G A;  3B29 A;  3HNK A;  3LNR A;  3M15 A;  3R7C A;  5HV9 A;  4PAC A;  2A68 F;  2GAQ A;  2HV6 A;  3CZ6 A;  4FX5 A;  3AG3 C;  5AGF A;  4D4X A;  2F22 A;  1V4A A;  3I5Q A;  3EPV A;  3O10 A;  3ZQV A;  1HMD A;  2H7B A;  2XL8 A;  1A0B A;  3GOD A;  2AWY A;  1PD1 A;  1PV3 A;  1ZHZ A;  2VB6 A;  1QSP A;  2L6H A;  3NG1 A;  1JOG A;  4J7T A;  2KQ9 A;  3HNJ A;  4U5H A;  3AQC A;  5L0F A;  4HFK B;  4XEF A;  1E2X A;  1M2O A;  4G0H A;  1R4T A;  3ZWI A;  1M57 C;  2YEV A;  4JEB A;  3C63 A;  3G4Z A;  2KW3 C;  3ABM C;  3NDB B;  3JSZ A;  2I8B A;  2IXM A;  3KYI A;  4GYT A;  3DM9 B;  4BJ1 A;  4CS8 C;  3NKE A;  4HE8 D;  4QI0 A;  1E86 A;  1Z5Z A;  1LE2 A;  3PHF 2;  3DMD A;  2R7X A;  5L0D A;  4JIO A;  5L0I A;  1VOM A;  2DB4 A;  1KNY A;  1WAS A;  2B0H A;  2M4E A;  5BQI A;  1D1C A;  2A6H F;  2NSG A;  3ZVR A;  4RD9 A;  3B0U X;  3J06 A;  3B71 A;  3QVY A;  2VAS A;  3EGD A;  3S27 A;  5A6J A;  3UGO A;  4CDA A;  1HW2 A;  2EPO A;  4KNW A;  1YYX A;  1EI7 A;  2D5R B;  2W9Y A;  2AU5 A;  3K1I A;  1OCC C;  4FES A;  3A9C A;  5EK0 A;  5KYY B;  2E87 A;  5D91 A;  3O6X A;  1DOV A;  1LS4 A;  2LD6 A;  1ZVZ A;  1ZU4 A;  2OEX A;  2VC9 A;  2YL7 A;  4C7O A;  1Q0M A;  4U9E A;  4OIN F;  2XM4 A;  2IXN A;  2XLM A;  4Z9H A;  2Y39 A;  5B3I A;  1U89 A;  2C03 A;  2GDC A;  3O55 A;  5COG A;  3S0X A;  2HSQ A;  3U2L A;  2J7P D;  2NUT B;  3DAF A;  2KNH A;  2NSF A;  1HMO A;  4C3D A;  3FDQ A;  1ZW3 A;  2PFD A;  4O6N A;  3T9O A;  1APC A;  1DOW A;  1O5H A;  1OXK A;  2OJQ A;  2YQY A;  1ZHW A;  2HV7 A;  3EZI A;  3DI5 A;  3RQG A;  3K7D A;  4XLN F;  4CS9 A;  4EUK B;  1YA9 A;  3GWN A;  3LEO A;  1GM5 A;  2W45 A;  5BQG A;  1H9T A;  1YJG A;  5L0J A;  4CIH A;  2OCC C;  2LFF A;  2XL6 A;  5FCL A;  1I4Y A;  1ZHY A;  2R25 A;  2EIM C;  1BBH A;  3FOO A;  5JSL A;  1Y6D A;  5DVW A;  1L7C A;  4JRZ A;  3NMI A;  4D4N A;  1B68 A;  3MYI A;  5DS5 A;  3VF0 A;  3AQB A;  1K04 A;  4BJ6 C;  3W8I A;  4KI2 A;  5T3W A;  3M4B A;  4CS7 A;  4BPM A;  2KJG A;  2Z15 A;  1NLX A;  2QTV A;  2W4M A;  3DKA A;  4E0I A;  1TR2 A;  3EG9 B;  3LS1 A;  4XPW A;  2HKV A;  4BEJ A;  2AVK A;  3LNM B;  1LI5 A;  3OA1 A;  2QE9 A;  1WAT A;  1VK5 A;  2ZXP A;  1NFO A;  3DAG A;  3GM1 A;  2NUP B;  4XWJ A;  2PBE A;  4E17 A;  3DZA A;  3LLI A;  1TFK B;  4J30 B;  1FTS A;  2J9W A;  2KK1 A;  2IBF A;  2EIL C;  3CAX A;  1OQC A;  3KMI A;  2HMZ A;  3LLK A;  4CSA C;  1D0Y A;  1LS1 A;  1T5O A;  4EWC A;  1TWA A;  4I44 A;  1O3U A;  1TWC A;  2H8A A;  5D92 A;  2PX3 A;  2H7V C;  1W2W A;  2PX0 A;  3FXH A;  5BQH A;  1RJ9 B;  1E84 A;  3RYL A;  1VLS A;  4ONS A;  1ZU5 A;  1LVK A;  1O87 A;  2RSE B;  3CQZ A;  4JW1 A;  1M6T A;  4NQF A;  4U5E E;  3F47 A;  4JKV A;  3DWW A;  3HNI A;  3DM5 A;  2P6V A;  3T6B A;  1QKR A;  3U9M A;  3RVY A;  3QVZ A;  3ZTZ A;  1A7E A;  3NYM A;  3AG2 C;  4G7H F;  4O7G A;  3NYL A;  1YZC A;  3UNG C;  4E18 A;  2Q4F A;  1ZYR F;  2MHR A;  2P1A A;  4ULV A;  1YZA A;  2YRF A;  2IM8 A;  4CX9 A;  4CJG A;  2NPU A;  4I3M A;  1KU2 A;  4LDR A;  4DRJ B;  2J7P A;  1FMW A;  3K1I C;  3EH1 A;  5JRA A;  3RVZ A;  4AK9 A;  2Y3H A;  4OIR F;  1G4U S;  3AGT A;  4PR9 A;  3LS0 A;  4I1M A;  2C04 A;  3VRC A;  2MWQ A;  4JCH A;  2LK4 A;  4IAO A;  4DVY P;  1Z6A A;  5KYY A;  1CGN A;  1ST6 A;  2BC5 A;  5F28 E;  1UFB A;  3JRM O;  3KPH A;  5IY5 C;  2YZS A;  1E85 A;  2EPN A;  4JE9 A;  4MND A;  4BJ5 A;  2ICW G;  4BEM J;  2LIG A;  5L0G A;  2G3V A;  3GEI A;  5FZT A;  4JTC B;  3JYY A;  1NU9 C;  2NUT A;  2X0C A;  4CS9 C;  2GWW A;  2QUP A;  2M64 A;  1LI7 A;  3US6 A;  2V3C C;  1IW7 F;  1SR2 A;  1D0Z A;  4JTA B;  3N0T A;  4J32 B;  4BG0 A;  4FWV A;  1NG1 A;  5JS5 A;  1OW7 A;  2YLI A;  2AP3 A;  2YL3 A;  3I5P A;  4DOZ A;  3C8G B;  1OCZ C;  3ECS A;  4Q7C A;  1JR8 A;  4I1O B;  1OR2 A;  4JZA A;  2ASR A;  3MYF A;  1PCX A;  2BL2 A;  1F1M A;  1SF8 A;  2J0W A;  1LE4 A;  3E70 C;  1RKE B;  2Q3T A;  3EHN A;  4KBL A;  5GPG B;  4CSA A;  3QW1 A;  3MBG A;  1KTM A;  3B0V C;  4GQH A;  1MMD A;  5E33 A;  4ULW A;  1LPE A;  4N06 A;  3AOU A;  2XLE A;  3ZDL A;  3L0I A;  2J45 A;  4NTA A;  3AJM A;  3U3B A;  3MFN A;  3EG9 A;  3C8G D;  2L6F A;  2Q9A A;  2ZXO A;  2ZD9 A;  4LDQ A;  3CSK A;  1CGM E;  2NUP A;  1D1B A;  2KSF A;  4CDY A;  2H7O A;  1MQV A;  2DYR C;  2CGE A;  1T01 A;  4F4B A;  1K05 A;  4DBQ A;  1GS9 A;  1T9K A;  1TFO B;  2HJM A;  3ABL C;  3K6B A;  4U5C E;  4YJW A;  5DQZ A;  3N2Z B;  1V54 C;  4AL0 A;  3AG1 C;  2DGJ A;  1VYK A;  1GGQ A;  1RJ9 A;  4AE4 B;  1K40 A;  1S05 A;  3LJB A;  2VCA A;  1OCO C;  3W8H A;  3Q6N A;  4H54 A;  2V26 A;  1ORY A;  2ZXR A;  2RD9 A;  3FHD A;  4LDK A;  2P7V A;  2WB7 A;  2Y3D A;  2IOQ A;  3SXM A;  4CBE A;  2XSE A;  4LAC B;  3DJN B;  2OG2 A;  3E9V A;  3IQ6 A;  3TOM A;  3V5X A;  3V5Z A;  5L3V A;  2R7U A;  4IJJ A;  1TWG A;  3NMK A;  2CW0 F;  1NZE A;  2UUH A;  3TOL A;  1ORJ A;  4JTD B;  4B6I A;  1HE9 A;  3Q7G A;  3DJU B;  1SYQ A;  3W2V A;  2QNL A;  3C62 A;  4MW8 A;  2LFD A;  4GEH A;  4KNV A;  2R03 A;  1H7I A;  1BR1 A;  2HFI A;  1Q0F A;  3UMK A;  4MTG A;  1YVI A;  2I15 A;  4W8K A;  1MND A;  5TJ5 E;  4R32 A;  256B A;  3EZH A;  3ZC4 A;  3IQT A;  2OEV A;  4BJ5 C;  5L0H A;  4YT2 A;  4ER9 A;  2R7T A;  1A7D A;  2KGO A;  3RH3 A;  1AVO B;  3ZG1 A;  3SYN A;  4YWQ A;  2XLV A;  1J8Y F;  3H2U A;  5DS6 A;  1T6I A;  3IEE A;  4N4W A;  1VTM P;  1JPJ A;  4PJM A;  4W8P A;  4HEA J;  4WAB A;  3JYH A;  1V55 C;  3NRH A;  2Q9C A;  1U6H A;  2WVN A;  4LLE A;  4U5G A;  4H4K C;  2HJ3 A;  1XZQ A;  4MS2 A;  1VB5 A;  5F5H A;  4O6M A;  2MYS A;  1Q0K A;  4QDL A;  4Q4Z F;  2HS5 A;  1H9G A;  1SZI A;  5DQT A;  4DRI B;  1ZW2 A;  1JPN A;  1ZHX A;  2CNW D;  3C8G A;  3FAP B;  4YT8 A;  1D1A A;  3A11 A;  3H65 A;  5HSW A;  2IXP A;  4MTO A;  4XPY A;  5AC5 A;  3T6J A;  3UGP A;  2TMV P;  4EHP A;  2EPM X;  2G3K A;  1TKN A;  1BR4 A;  1Q0G A;  2W4B A;  2VCB A;  3QZC A;  1YAU O;  3U9J A;  1RKE A;  2XS8 A;  1MMN A;  1ORS C;  3MX3 A;  3NYJ A;  3QW0 A;  4OD5 A;  3UMI A;  3HJC A;  4MVZ A;  3OEO A;  3TQO A;  2EPL X;  2A0B A;  3JT1 A;  2LCH A;  1FNT c;  1YYJ A;  5B1B C;  1PD0 A;  1AEP A;  2HMQ A;  3ATP A;  1T6Q A;  1FFT C;  4IAR A;  4WGY A;  3L1M A;  3JCU Q;  2J9V A;  3DD7 A;  3G4X A;  5E2Q A;  3IHU A;  5CI8 A;  2J8W A;  3S84 A;  3RIP A;  2XXA B;  4YL3 A;  3V5Y A;  4EIY A;  4MW3 A;  1SMY F;  2ZPA A;  3EHM A;  1OCR C;  3LAY A;  2BE5 F;  3DXJ F;  3RF3 A;  1G4W R;  2HZ8 A;  2ETS A;  3ASN C;  1TQG A;  3RW0 A;  3BRJ A;  4OIO F;  1VYI A;  2A6E F;  1FMV A;  4YN0 B;  3L8I A;  4E0H A;  2A0U A;  4E7S A;  1VMA A;  5KYW B;  3JRT A;  3ZTM A;  3PDM P;  2G62 A;  3IPM O;  4KC9 A;  4K0D A;  3WG7 C;  4BJT A;  3ITF A;  3HTK C;  3JTL O;  2YLD A;  4IRU A;  4O79 A;  3UMH A;  5JLI A;  4UDV A;  1RKC A;  2Y3G A;  4C3B A;  1JMW A;  1HY5 A;  4PJJ A;  3VYW A;  2R7W A;  2A69 F;  5KYN A;  3RKO F;  5CIV A;  1WTY A;  1OW6 A;  1HE1 A;  3Q7L A;  2OJE D;  4YL1 A;  4EBJ A;  2Q7R A;  3FOP A;  1Q0D A;  3GM2 A;  1EKY A;  3M1C B;  2CYD A;  1GQA A;  2XL4 A;  2JPU A;  2XLW A;  2ZXW C;  3ZQY A;  1ZZP A;  3GWL A;  3KL4 A;  3RFY A;  2J9U A;  3TJ5 A;  1M56 C;  5L3Q A;  1CGO A;  3U5S A;  2DI3 A;  3QMK A;  3L34 A; 
#chains in the Genus database with same CATH homology
 3QTH A;  1RXQ A;  3GOR A;  2OQM A;  5COG A;  2RD9 A;  2OU6 A;  3DKA A;  2NSF A;  2HKV A;  3CEX A;  5CIV A;  2P1A A;  2QE9 A;  2YQY A;  3DI5 A;  2NSG A;  2QNL A;  5COM A;  5COF A;  2F22 A;  4N6C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...