5CI8A

Crystal structure of human tob in complex with inhibitor fragment 1
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
117
structure length
117
Chain Sequence
HHMQLEIQVALNFIISYLYNKLPRRRVNIFGEELERLLKKKYEGHWYPEKPYKGSGFRCIHIGEKVDPVIEQASKESGLDIDDVRGNLPQDLSVWIDPFEVSYQIGEKGPVKVLYVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/inhibitor
molecule keywords Protein Tob1
publication title Structural basis for inhibition of the Tob-CNOT7 interaction by a fragment screening approach
pubmed doi rcsb
source organism Homo sapiens
total genus 38
structure length 117
sequence length 117
ec nomenclature
pdb deposition date 2015-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07742 BTG BTG family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1120 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 5ci8A00
3DJNB 2D5RB 2Z15A 5CI8A 3DJUB 3E9VA 5CI9A
chains in the Genus database with same CATH superfamily
3DAGA 2J8WA 1NFNA 1U89A 1H9TA 3W4YA 4ULWA 2X51A 2P6VA 4O6MA 2HJMA 4G0HA 3WG7C 3MYFA 2DYRC 3DXJF 3FOPA 1DOWA 4C7OA 4OIPF 4MQ9F 4N06A 1FMWA 4U5GA 1BZ4A 4U5FE 5F5HA 2QNLA 3POVA 4JTDB 2M4EA 1N1CA 1ORSC 3ASOC 5COGA 1JPJA 1ZHXA 1H7IA 5KYXB 1O87A 4CS9C 2KC3A 4YL0A 3DI5A 3IQ6A 2XXAB 5JUAA 1FFTC 2HKVA 1RKEB 2EIMC 2R7VA 3AG4C 1D1CA 3A11A 1D0YA 4EBJA 2YLIA 1QLEC 3HTKC 2J0XA 4MW8A 3QVZA 5FCLA 2XL8A 2JX0A 2VB6A 3JRTA 3F47A 2NUPB 1NG1A 5E33A 2A6HF 1K40A 5L0FA 3FDQA 4U5EE 2KQ9A 1UFBA 4EHPA 2Y3DA 4CX9A 4JTCB 2FGYA 1TKNA 1XZPA 4CJOA 3Q6NA 4E17A 1FTSA 1JPNA 2J46A 3A9CA 5DS4A 3CQZA 3UMKA 5DS5A 3EZHA 3ZQYA 1GM5A 2WVQA 2ZXWC 2Q7RA 3S27A 3ZG1A 2XLDA 2LQGA 2PNOA 2VASA 2OU6A 2R05A 4GQHA 1ZHWA 2GA0A 2OEXA 3IQ5A 4HFFB 4O79A 2KSFA 2YEVA 3EGDB 3L8IA 1W2WA 1VYKA 2OKUA 4NCQA 3L1MA 4BJTA 3EPVA 4WGYA 2B0HA 3QW1A 4K1OA 4IAQA 1AEPA 2PX0A 1YJGA 4Z9HA 5JP7A 1E84A 1HMDA 1RKEA 1J8YF 4XEKA 3JRMO 2ZPAA 4KI2A 1PD0A 2AP3A 2YVKA 1ZHZA 3EH1A 5A69A 1WGWA 2QE9A 2UUIA 4U9EA 4XWJA 2NUPA 3U2LA 3FHDA 1CPQA 4MS2A 1SF8A 1YZAA 5DQTA 1BBHA 1I4YA 2RD9A 3RVZA 2XLHA 2LFDA 4JCHA 3F46A 4P9TA 1WASA 2IOQA 5JLIA 1ZZPA 4AL1A 1R4TA 3GM3A 1DOVA 3TJ5A 3AG2C 4YN0B 3GORA 1EI7A 2YKZA 4J7TA 3B0VC 5B1AC 2D4UA 3JTLO 3AGUA 2HSQA 1BDJB 2Q9CA 2ZXRA 3ZTMA 2OJED 1VLSA 4A4AA 1Z6AA 3ITFA 3W8IA 4KNWA 2LIGA 3ABMC 5L0CA 3K6BA 1SYQA 5AGFA 4G7ZF 1YDIA 3EGDA 1YYJA 4K0DA 5A6KA 1EKYA 4XLPF 5L0JA 1OXBA 3H2UA 1BR4A 1TFKB 4EBBA 4KBLA 3QTHA 3H2VA 2L9JA 2Y3BA 4HEAJ 1D1BA 4MVUA 4PJLA 4PR9A 3PHF2 2H7BA 1OKKA 3SXYA 1NBBA 3TD7A 3PMRA 2H7OA 4JCZA 1O5HA 3VYWA 3RQFA 3JT1A 3MBGA 2YL0A 3HNKA 4K7BA 3MFNA 4XPYA 1VTMP 3NKEA 4JRZA 1MMGA 3S28A 3T6BA 3DAFA 4FWVA 5COMA 1GGQA 3GM1A 4CS8C 1E85A 4IAOA 1LKXA 3LNRA 2HFIA 1T5OA 1NU7D 3JSZA 3AG3C 4G78A 1I4ZA 1NZEA 5E3AA 2CDQA 4B6IA 2KW3C 1AUEA 2KJGA 2Y69C 4FX5A 3M4BA 1HY5A 3NYJA 4DJ9A 4WJ0A 4IARA 3ZTZA 5FZTA 3LLKA 3PCVA 3JSEO 4JTAB 4DVYP 3DE8A 3M79A 5KYWB 4EWCA 3FAJA 2PFDA 1V74B 1WOLA 2DYSC 2XS8A 3AQCA 4BEJA 2J7PA 4BPMA 2MYSA 2F22A 1FMVA 1YAUO 5T3WA 4BJ5C 4C3BA 4E7ZA 4MW3A 4CJGA 2H8AA 2XM0A 3AOUA 2R7OA 3LS0A 4GEHA 3O39A 2VCBA 2R02A 1VYIA 1BR2A 3EJNA 1S05A 2HS5A 3DKAA 3QZCA 4CIPA 4E7SA 4DBQA 1RXQA 2AU5A 2J0WA 3NYLA 1V4AA 1YA7O 3UMHA 1ZHTA 2L7AA 4OD5A 4J32B 1Y6DA 4MVMA 5F28E 3TOLA 1LS4A 256BA 3ZSUA 1XZQA 4CS8A 3JYHA 2A0UA 4HE8D 3T6GB 2P0NA 1QPUA 2GAQA 2I15A 2ZXPA 2LFFA 4W8PA 1VOMA 3U8VA 1QKRA 5JT4A 2IM8A 4YT5A 4JKVA 5T3TA 2D5RB 2XL6A 2YL7A 4LDRA 4ULVA 2MWQA 4XQ1A 3T6JA 1G8XA 3V7OA 1WWPA 2J9UA 4PJNA 2R7XA 2CCYA 5CI9A 2DI3A 1VB5A 2KNHA 1L7CA 2BE5F 5KYWA 3C18A 3ZVRA 4ZLCA 1EQ1A 3HJCA 2EPNA 4NQFA 1VK5A 2OJQA 2XLOA 2B0JA 3C8GD 2OCCC 4BJ5A 3G4XA 4OIQF 1Q0GA 1SR2A 3C7JA 2XLMA 2YL1A 4RBNA 2R7TA 4ZLDA 1OW7A 4W8KA 2LCHA 4LLCA 3UR3C 1VLTA 2J9WA 4I1MA 4MVQA 1H9GA 2R03A 1RCPA 2WL8A 3SXMA 3U8PA 4YWQA 3QMKA 3RVYA 5CIVA 1R5ID 4DVZA 2C03A 3HKKA 3SNHA 3T4RA 2HUJA 1D1AA 1T01A 3GEEA 3S84A 3EFOB 4XLNF 1LPEA 1HE9A 2L6FA 2I8BA 5DLJA 4YT8A 2NG1A 2A6EF 2GDCA 3KKBA 5E2QA 5L0HA 3X2QC 4CDAA 3S9OA 2WZFA 3GANA 5A6BA 2HZ8A 1Q0FA 2YHSA 4NTAA 4JIOA 2CNWA 4CS9A 3R2PA 3V5XA 3NRHA 3HLZA 3L8JA 4E18A 3RIPA 1Y4CA 4YK5A 1TWCA 1WN0A 4IGGA 1VMAA 3RYLA 1L3PA 2WVNA 1GQAA 4RD9A 4D4NA 1M2VB 2JPUA 3GM2A 1Z63A 5COFA 4QI2A 3UMIA 3TJ6A 1G5ZA 4PJJA 1E83A 2R9RB 2ICWG 1TQGA 1ZYRF 3MLGA 3DJNB 1A41A 3L34A 3ABKC 3M4CA 1KU2A 4H4KC 3RKOF 3X1OA 3K7DA 5BQHA 3FOOA 3U3FA 3GODA 3WAQA 5EGYA 4KNVA 2V3CC 3RFYA 3RW0A 2ZD9A 1YVIA 3AJMA 1T9KA 1CGOA 1ORJA 2KGOA 4OD4A 3W8HA 3ATPA 1IZMA 2KK1A 3KMIA 3E9VA 5EK0A 3ZQVA 1SMYF 2YQYA 3QW0A 1TWAA 4D4XA 3EFOA 5L0DA 1M56C 2LD6A 4A2NB 2MHRA 4J30B 3RF3A 1M6TA 4JURI 3LESA 1Q0DA 2BC5A 3LLIA 4XEFA 5GPGB 4E0IA 4YT4A 1CGME 1V55C 1PCXA 3RH3A 4JC7A 1O3UA 2AWCA 3PDMP 1F1MA 2EPOA 1GS9A 3OEOA 4KC9A 1RJ9B 3SXZA 1Z23A 4Q5SF 1LI5A 3ZDLA 5F5FA 2XSEA 3NMIA 2IXOA 2H7VC 1OW8A 2QLAA 1PD1A 1TWGA 2W45A 5E3CA 2XRHA 5DVWA 1M2VA 2P61A 4F4BA 2ASRA 3ABLC 4JW1A 3B29A 2NSFA 4JJFA 2FAPB 4U5CE 3FAPB 4LLEA 3SEOA 4JZAA 1IW7F 1OCZC 4E0HA 3AG1C 4EKWA 2VC9A 3LAYA 2XLWA 1G4WR 4CSAC 5L0GA 2Q9AA 4PFPA 5HV9A 5JS5A 1HW2A 3GEHA 4X0RA 3B71A 5B3SC 2EPKX 2P7VA 2R7QA 3ECSA 3IPMO 1T6UA 4C3DA 1YLMA 2YLGA 4CDVA 4YT2A 4U5HA 4O7GA 2G3VA 1WATA 2HMQA 3G4ZA 1JAFA 3BEHA 3JZ0A 4JEAA 3WODF 4Q7CA 2YZSA 4IJJA 4H54A 1RMVA 3JCUQ 2P1AA 3OWTA 5L3VA 1LE4A 5BQGA 2QY9A 3LNMB 3O10A 3SZRA 1C17M 1D0ZA 1HW1A 2UUHA 2A1DD 1QSPA 3DM5A 4JEBA 4P6IC 3SP1A 3DJUB 4NTFA 4XTKA 2EPMX 2W9YA 3SYNA 1KTMA 3TK0A 1RJ9A 2W4MA 3VRCA 3IQTA 3EQLF 4CDYA 2WZGA 3CZ6A 3I5PA 3O55A 1E86A 4MTGA 1G4US 4AK9A 4UDVA 5L3QA 1JMWA 2LK4A 3DMDA 1U0BB 2Y3HA 4LACB 3RQEA 4YL3A 1FR0A 1MMNA 3EGXB 3B0UX 3KYJA 3I4UA 1TR2A 2QUPA 3VM6A 1LI7A 2PX3A 3FMSA 3HNIA 4C3EA 1ST6A 2YRFA 2OQMA 2HV7A 3RQGA 4L6RA 4ONSA 2Y39A 2VCAA 3M15A 1OKKD 1OR3A 2WZLA 4MTFA 5KYNA 3DE9A 2HV6A 3C8ZA 4G7OF 4AE4B 2L6HA 1AVOB 1LVKA 3ZIBA 2PBEA 2XLEA 1U6HA 4LDQA 3KL4A 5KYYA 1EA8A 2JD3A 3NKDA 1LIHA 1ZW2A 1OCRC 2IYLD 3EG9B 2A68F 3C62A 1QVXA 2AVKA 3S0XA 2HSBA 2KYHA 1C02A 2G3KA 4U5BE 2XM4A 4CIHA 2NSGA 3QVYA 2YLDA 5CI8A 2DGJA 1NU9C 2EIJC 3GWLA 4AL0A 1Q0KA 3CEXA 1SZIA 5JRAA 1I5NA 3S90A 4YL1A 1LM3B 3Q7LA 2J9BA 3K1IC 4I44A 2R7SA 1ZU4A 1XWJA 4QDLA 2R7RA 2R25A 1K04A 1PV3A 2LP4A 3E70C 1A7DA 5B3IA 1QQ3A 2EILC 4I3MA 4AX2A 1T6QA 1Q0MA 2EINC 3AGTA 4U9DA 3SXKA 2J7PD 1FNTc 2C04A 5HSWA 4PK4A 2YWAA 5D92A 2ETSA 3B0PA 3EGXA 5T1DB 1YA9A 4DXWA 4HFKB 4J7YA 1BR1A 4GYTA 1B68A 4O6NA 2NUTB 3W2WA 4EUKB 4MVZA 2IXMA 5JSLA 3U9MA 2HJ3A 4CBEA 4EBKA 5A6AA 2CW0F 2Z15A 1NLXA 1JRAA 2IXNA 4OIOF 2XS1A 4R32A 2YL3A 4DOZA 2FFHA 3EHNA 2VCCA 3EHMA 4PFOA 4AE4A 1RKCA 4I1OB 2Q00A 3DWWA 3IQCA 1Z7Qc 3KPHA 3DZAA 3GWNA 3U2MA 1JOGA 1JR8A 1YARO 1OR2A 3B9QA 3EG9A 3IHUA 3NMKA 1YZCA 2IBFA 1E2XA 3NYMA 1ZVZA 3Q7GA 4MVRA 2XLVA 4NTBA 4DRJB 5A6JA 1MMAA 2IXPA 4N6CA 4QI0A 3V5ZA 3WHNA 2WB7A 3OA1A 3ZC4A 2RSEB 1NFOA 4O6YA 4RDAA 1HE1A 1K05A 1TFOB 3K1IA 1ZW3A 1NSGB 3R7CA 1M57C 2GFHA 4NC3A 3NG1A 3S29A 5KYXA 2WVOA 3NMJA 1OW6A 3LEVA 3LJBA 4XPWA 2HMZA 3T9OA 2XXAA 1LS1A 3LUTB 4JE9A 3TOMA 2Q4FA 4NY3A 1MNEA 1C03A 3K1HA 4M63A 5KYUB 1MMDA 3N0TA 2QTVA 2NUTA 1OXKA 2E87A 1OCOC 4MTOA 3HNLA 4JVSA 2M64A 2BL2A 4PJMA 4FAPB 4Q4ZF 4OINF 1A7EA 3K33A 3HNJA 3C8GB 3IEEA 3Q6MA 4N4WA 2CGEA 3AQBA 3LS1A 3MX3A 1UG7A 4MNDA 3EZIA 1H6GA 1LE2A 1ZHYA 4OIRF 1KNYA 1MQVA 3FXHA 5AC4A 1FAPB 2EPLX 2NPUA 1APCA 1ZU5A 5L0IA 5JVEA 1V54C 3N2ZB 5DQZA 4LERA 3VF0A 4DBRA 5EHHA 2PP4A 5TJ5E 1CGNA 4BJ1A 4N6HA 4EIYA 2PF4E 3U5SA 5A6BD 3W2VA 2V26A 3CSKA 4ER9A 2R7WA 2CNWD 4MVOA 2O9XA 4P9FA 2J45A 4XPXA 2L6GA 4BG0A 3U0CA 2AWYA 3I5QA 3DM9B 3V5YA 3KH2A 4BJ6C 3UGOA 4MVSA 3GEIA 4IWBA 3O6XA 4WABA 1QZXA 2G62A 2GWWA 5KYYB 2A69F 1D0XA 1FFHA 3JYYA 5KYUA 4DRIB 1T6IA 1Z3IX 3J06A 2LSEA 2DB4A 2EIKC 1OQCA 3TQOA 4G7HF 2CYDA 1HMOA 3US6A 1Z5ZA 3FVYA 3ASNC 5DS6A 4JJGA 3BRJA 3C8GA 4C7OB 2Y3GA 4CS7A 3NDBB 3MYIA 1WTYA 2L81A 4XEVA 4ANJA 5BUOA 3U3BA 2OG2A 2ZXOA 1A0BA 3UNGC 3G50A 5IY5C 5BQIA 5B1BC 1YYXA 2X0CA 2VH3A 1J8MF 2Q3TA 1CPRA 4U5DE 3M1CB 1S7ZA 4YJWA 1ORYA 1OCCC 2OOCA 3KYIA 2Q9BA 4WGZA 2J9VA 5D91A 2TMVP 1A7VA 4BEMJ 3LEOA 3ZWIA 4DRHB 5K0IA 2R7UA 3VAYA 1M2OA 2XL4A 3EH2A 3N24A 4FESA 2A0BA 2W4BA 3H65A 1TWHA 3DD7A 3C63A 4PACA 5AC5A 3CAXA 4CSAA 1MNDA 4IB4A 4Z9IA 4BJ6A 4LDKA 3UGPA 3L0IA 4IRUA 3K66A 3TULA 4Z9JA 2OEVA 3U9JA
chains in the Genus database with same CATH topology
3DAGA 4ULWA 2X51A 2P6VA 4O6MA 4G0HA 3WG7C 2DYRC 3DXJF 4C7OA 4OIPF 4MQ9F 4N06A 1FMWA 4U5GA 4U5FE 5F5HA 3POVA 2M4EA 1N1CA 3ASOC 1JPJA 1ZHXA 5KYXB 1O87A 4CS9C 2XXAB 1FFTC 2EIMC 2R7VA 3AG4C 1D1CA 1D0YA 1QLEC 3HTKC 2J0XA 5FCLA 2VB6A 3JRTA 3F47A 2NUPB 1NG1A 5E33A 2A6HF 3FDQA 4U5EE 2KQ9A 2Y3DA 2FGYA 1TKNA 3Q6NA 1FTSA 1JPNA 2J46A 5DS4A 3CQZA 3UMKA 5DS5A 3EZHA 2WVQA 2ZXWC 3S27A 3ZG1A 2VASA 1ZHWA 4O79A 4HFFB 2YEVA 3EGDB 1W2WA 1VYKA 4BJTA 3EPVA 2PX0A 1J8YF 2ZPAA 4KI2A 1PD0A 1ZHZA 3EH1A 1WGWA 4XWJA 2NUPA 3FHDA 1SF8A 5DQTA 4JCHA 3F46A 2IOQA 3AG2C 4YN0B 3B0VC 5B1AC 2Q9CA 2ZXRA 1Z6AA 3ITFA 3W8IA 4KNWA 3ABMC 3K6BA 4G7ZF 3EGDA 4K0DA 4XLPF 1BR4A 4EBBA 4KBLA 2L9JA 2Y3BA 4HEAJ 1D1BA 4PJLA 3PHF2 2H7BA 1OKKA 3TD7A 3PMRA 2H7OA 1O5HA 3VYWA 3JT1A 4K7BA 3NKEA 1MMGA 3S28A 3T6BA 3DAFA 4FWVA 4CS8C 4IAOA 1LKXA 3LNRA 1NU7D 3JSZA 3AG3C 1NZEA 5E3AA 2CDQA 4B6IA 2KW3C 2KJGA 2Y69C 4FX5A 3NYJA 4WJ0A 3LLKA 4DVYP 5KYWB 4EWCA 3FAJA 2PFDA 2DYSC 4BEJA 3AQCA 2J7PA 2MYSA 5T3WA 1FMVA 4C3BA 4BJ5C 4E7ZA 2R7OA 3LS0A 4GEHA 3O39A 1VYIA 1BR2A 3EJNA 3QZCA 4E7SA 4DBQA 2J0WA 3NYLA 3UMHA 1ZHTA 4OD5A 4J32B 3ZSUA 4CS8A 3JYHA 4HE8D 2ZXPA 1VOMA 4YT5A 5T3TA 2D5RB 2MWQA 3T6JA 1G8XA 3V7OA 2J9UA 4PJNA 2R7XA 5CI9A 2KNHA 2BE5F 5KYWA 3ZVRA 4ZLCA 3HJCA 1VK5A 2B0JA 2OCCC 4BJ5A 4OIQF 4RBNA 2R7TA 4ZLDA 4W8KA 4LLCA 3UR3C 2J9WA 4I1MA 2WL8A 4YWQA 3QMKA 2C03A 3SNHA 3T4RA 1D1AA 3EFOB 4XLNF 2I8BA 5DLJA 4YT8A 2NG1A 2A6EF 3KKBA 5E2QA 3X2QC 2WZFA 3GANA 2YHSA 2CNWA 4CS9A 3NRHA 3HLZA 3RIPA 1TWCA 1VMAA 3RYLA 2WVNA 4RD9A 1Z63A 1M2VB 4QI2A 3UMIA 4PJJA 3MLGA 1ZYRF 3DJNB 3L34A 3ABKC 1KU2A 4H4KC 3RKOF 3X1OA 3K7DA 5EGYA 3GODA 4KNVA 3RFYA 2KGOA 4OD4A 3W8HA 1IZMA 3KMIA 3E9VA 1SMYF 1TWAA 3EFOA 1M56C 4A2NB 4J30B 4JURI 3LESA 3LLIA 4YT4A 1V55C 1PCXA 3RH3A 3OEOA 4KC9A 1RJ9B 5F5FA 1Z23A 4Q5SF 2XSEA 2IXOA 2H7VC 1PD1A 1TWGA 2W45A 5E3CA 2XRHA 5DVWA 1M2VA 4F4BA 3ABLC 4JW1A 4JJFA 4U5CE 4LLEA 3SEOA 4JZAA 1IW7F 1OCZC 3AG1C 3LAYA 4CSAC 2Q9AA 4PFPA 4X0RA 5B3SC 2P7VA 2R7QA 3ECSA 4C3DA 4YT2A 4U5HA 4O7GA 2G3VA 3WODF 4Q7CA 2YZSA 4IJJA 3JCUQ 3OWTA 5L3VA 2QY9A 2V3CC 5DQZA 3SZRA 1D0ZA 4P6IC 3DM5A 2A1DD 4DVZA 3SP1A 3DJUB 4XTKA 3SYNA 2W9YA 1RJ9A 2W4MA 3EQLF 2WZGA 3CZ6A 3I5PA 4AK9A 5L3QA 3DMDA 2Y3HA 4LACB 1MMNA 3EGXB 3B0UX 3I4UA 1TR2A 2PX3A 4C3EA 1ST6A 2HV7A 2Y39A 1OKKD 2WZLA 5KYNA 2HV6A 4G7OF 4AE4B 1LVKA 3ZIBA 5KYYA 3KL4A 2JD3A 3NKDA 2IYLD 1OCRC 3EG9B 2A68F 3S0XA 2G3KA 4U5BE 4CIHA 5CI8A 2DGJA 1NU9C 2EIJC 1SZIA 3Q7LA 2R7SA 3K1IC 4I44A 1ZU4A 2R7RA 4QDLA 3E70C 2EILC 4I3MA 4AX2A 2EINC 5HSWA 2J7PD 2C04A 4PK4A 5D92A 3EGXA 3B0PA 5T1DB 4HFKB 4O6NA 1BR1A 4GYTA 2NUTB 3W2WA 2IXMA 4CBEA 2CW0F 2Z15A 2IXNA 4OIOF 4DOZA 2FFHA 3EHNA 3EHMA 4PFOA 4AE4A 4I1OB 3DZAA 3EG9A 3B9QA 3NYMA 3Q7GA 1MMAA 2IXPA 4QI0A 2WB7A 3OA1A 3ZC4A 4O6YA 4RDAA 1M57C 2GFHA 3NG1A 3S29A 5KYXA 2WVOA 3LEVA 3LJBA 2XXAA 1LS1A 4NY3A 1MNEA 3K1HA 4M63A 5KYUB 1MMDA 3N0TA 2QTVA 2NUTA 2E87A 1OCOC 4JVSA 4PJMA 4Q4ZF 4OINF 3K33A 3IEEA 3Q6MA 2CGEA 3AQBA 3LS1A 3MX3A 4OIRF 4MNDA 3EZIA 1ZHYA 1ZU5A 1V54C 3N2ZB 4DBRA 4LERA 5EHHA 2PP4A 4BJ1A 2PF4E 3W2VA 2V26A 3CSKA 2R7WA 2CNWD 2O9XA 4BG0A 2J45A 3I5QA 3DM9B 3KH2A 4BJ6C 3UGOA 4IWBA 3O6XA 5KYYB 1QZXA 2G62A 2A69F 1D0XA 1FFHA 5KYUA 1Z3IX 2LSEA 2EIKC 4G7HF 1Z5ZA 3FVYA 3ASNC 5DS6A 4JJGA 4C7OB 2Y3GA 4CS7A 3NDBB 4ANJA 2L81A 5BUOA 2OG2A 2ZXOA 3UNGC 5IY5C 5B1BC 2VH3A 1J8MF 2Q3TA 4U5DE 3M1CB 1S7ZA 4YJWA 5D91A 1OCCC 2Q9BA 2J9VA 2R7UA 3VAYA 1M2OA 2XL4A 3EH2A 3N24A 4FESA 2W4BA 3H65A 1TWHA 3DD7A 4CSAA 1MNDA 4BJ6A 3UGPA 3L0IA 4IRUA 3K66A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DJN B;  2D5R B;  2Z15 A;  5CI8 A;  3DJU B;  3E9V A;  5CI9 A; 
#chains in the Genus database with same CATH topology
 3DAG A;  2J8W A;  1NFN A;  1U89 A;  1H9T A;  3W4Y A;  4ULW A;  2X51 A;  2P6V A;  4O6M A;  2HJM A;  4G0H A;  3WG7 C;  3MYF A;  2DYR C;  3DXJ F;  3FOP A;  1DOW A;  4C7O A;  4OIP F;  4MQ9 F;  4N06 A;  1FMW A;  4U5G A;  1BZ4 A;  4U5F E;  5F5H A;  2QNL A;  3POV A;  4JTD B;  2M4E A;  1N1C A;  1ORS C;  3ASO C;  5COG A;  1JPJ A;  1ZHX A;  1H7I A;  5KYX B;  1O87 A;  4CS9 C;  2KC3 A;  4YL0 A;  3DI5 A;  3IQ6 A;  2XXA B;  5JUA A;  1FFT C;  2HKV A;  1RKE B;  2EIM C;  2R7V A;  3AG4 C;  1D1C A;  3A11 A;  1D0Y A;  4EBJ A;  2YLI A;  1QLE C;  3HTK C;  2J0X A;  4MW8 A;  3QVZ A;  5FCL A;  2XL8 A;  2JX0 A;  2VB6 A;  3JRT A;  3F47 A;  2NUP B;  1NG1 A;  5E33 A;  2A6H F;  1K40 A;  5L0F A;  3FDQ A;  4U5E E;  2KQ9 A;  1UFB A;  4EHP A;  2Y3D A;  4CX9 A;  4JTC B;  2FGY A;  1TKN A;  1XZP A;  4CJO A;  3Q6N A;  4E17 A;  1FTS A;  1JPN A;  2J46 A;  3A9C A;  5DS4 A;  3CQZ A;  3UMK A;  5DS5 A;  3EZH A;  3ZQY A;  1GM5 A;  2WVQ A;  2ZXW C;  2Q7R A;  3S27 A;  3ZG1 A;  2XLD A;  2LQG A;  2PNO A;  2VAS A;  2OU6 A;  2R05 A;  4GQH A;  1ZHW A;  2GA0 A;  2OEX A;  3IQ5 A;  4HFF B;  4O79 A;  2KSF A;  2YEV A;  3EGD B;  3L8I A;  1W2W A;  1VYK A;  2OKU A;  4NCQ A;  3L1M A;  4BJT A;  3EPV A;  4WGY A;  2B0H A;  3QW1 A;  4K1O A;  4IAQ A;  1AEP A;  2PX0 A;  1YJG A;  4Z9H A;  5JP7 A;  1E84 A;  1HMD A;  1RKE A;  1J8Y F;  4XEK A;  3JRM O;  2ZPA A;  4KI2 A;  1PD0 A;  2AP3 A;  2YVK A;  1ZHZ A;  3EH1 A;  5A69 A;  1WGW A;  2QE9 A;  2UUI A;  4U9E A;  4XWJ A;  2NUP A;  3U2L A;  3FHD A;  1CPQ A;  4MS2 A;  1SF8 A;  1YZA A;  5DQT A;  1BBH A;  1I4Y A;  2RD9 A;  3RVZ A;  2XLH A;  2LFD A;  4JCH A;  3F46 A;  4P9T A;  1WAS A;  2IOQ A;  5JLI A;  1ZZP A;  4AL1 A;  1R4T A;  3GM3 A;  1DOV A;  3TJ5 A;  3AG2 C;  4YN0 B;  3GOR A;  1EI7 A;  2YKZ A;  4J7T A;  3B0V C;  5B1A C;  2D4U A;  3JTL O;  3AGU A;  2HSQ A;  1BDJ B;  2Q9C A;  2ZXR A;  3ZTM A;  2OJE D;  1VLS A;  4A4A A;  1Z6A A;  3ITF A;  3W8I A;  4KNW A;  2LIG A;  3ABM C;  5L0C A;  3K6B A;  1SYQ A;  5AGF A;  4G7Z F;  1YDI A;  3EGD A;  1YYJ A;  4K0D A;  5A6K A;  1EKY A;  4XLP F;  5L0J A;  1OXB A;  3H2U A;  1BR4 A;  1TFK B;  4EBB A;  4KBL A;  3QTH A;  3H2V A;  2L9J A;  2Y3B A;  4HEA J;  1D1B A;  4MVU A;  4PJL A;  4PR9 A;  3PHF 2;  2H7B A;  1OKK A;  3SXY A;  1NBB A;  3TD7 A;  3PMR A;  2H7O A;  4JCZ A;  1O5H A;  3VYW A;  3RQF A;  3JT1 A;  3MBG A;  2YL0 A;  3HNK A;  4K7B A;  3MFN A;  4XPY A;  1VTM P;  3NKE A;  4JRZ A;  1MMG A;  3S28 A;  3T6B A;  3DAF A;  4FWV A;  5COM A;  1GGQ A;  3GM1 A;  4CS8 C;  1E85 A;  4IAO A;  1LKX A;  3LNR A;  2HFI A;  1T5O A;  1NU7 D;  3JSZ A;  3AG3 C;  4G78 A;  1I4Z A;  1NZE A;  5E3A A;  2CDQ A;  4B6I A;  2KW3 C;  1AUE A;  2KJG A;  2Y69 C;  4FX5 A;  3M4B A;  1HY5 A;  3NYJ A;  4DJ9 A;  4WJ0 A;  4IAR A;  3ZTZ A;  5FZT A;  3LLK A;  3PCV A;  3JSE O;  4JTA B;  4DVY P;  3DE8 A;  3M79 A;  5KYW B;  4EWC A;  3FAJ A;  2PFD A;  1V74 B;  1WOL A;  2DYS C;  2XS8 A;  3AQC A;  4BEJ A;  2J7P A;  4BPM A;  2MYS A;  2F22 A;  1FMV A;  1YAU O;  5T3W A;  4BJ5 C;  4C3B A;  4E7Z A;  4MW3 A;  4CJG A;  2H8A A;  2XM0 A;  3AOU A;  2R7O A;  3LS0 A;  4GEH A;  3O39 A;  2VCB A;  2R02 A;  1VYI A;  1BR2 A;  3EJN A;  1S05 A;  2HS5 A;  3DKA A;  3QZC A;  4CIP A;  4E7S A;  4DBQ A;  1RXQ A;  2AU5 A;  2J0W A;  3NYL A;  1V4A A;  1YA7 O;  3UMH A;  1ZHT A;  2L7A A;  4OD5 A;  4J32 B;  1Y6D A;  4MVM A;  5F28 E;  3TOL A;  1LS4 A;  256B A;  3ZSU A;  1XZQ A;  4CS8 A;  3JYH A;  2A0U A;  4HE8 D;  3T6G B;  2P0N A;  1QPU A;  2GAQ A;  2I15 A;  2ZXP A;  2LFF A;  4W8P A;  1VOM A;  3U8V A;  1QKR A;  5JT4 A;  2IM8 A;  4YT5 A;  4JKV A;  5T3T A;  2D5R B;  2XL6 A;  2YL7 A;  4LDR A;  4ULV A;  2MWQ A;  4XQ1 A;  3T6J A;  1G8X A;  3V7O A;  1WWP A;  2J9U A;  4PJN A;  2R7X A;  2CCY A;  5CI9 A;  2DI3 A;  1VB5 A;  2KNH A;  1L7C A;  2BE5 F;  5KYW A;  3C18 A;  3ZVR A;  4ZLC A;  1EQ1 A;  3HJC A;  2EPN A;  4NQF A;  1VK5 A;  2OJQ A;  2XLO A;  2B0J A;  3C8G D;  2OCC C;  4BJ5 A;  3G4X A;  4OIQ F;  1Q0G A;  1SR2 A;  3C7J A;  2XLM A;  2YL1 A;  4RBN A;  2R7T A;  4ZLD A;  1OW7 A;  4W8K A;  2LCH A;  4LLC A;  3UR3 C;  1VLT A;  2J9W A;  4I1M A;  4MVQ A;  1H9G A;  2R03 A;  1RCP A;  2WL8 A;  3SXM A;  3U8P A;  4YWQ A;  3QMK A;  3RVY A;  5CIV A;  1R5I D;  4DVZ A;  2C03 A;  3HKK A;  3SNH A;  3T4R A;  2HUJ A;  1D1A A;  1T01 A;  3GEE A;  3S84 A;  3EFO B;  4XLN F;  1LPE A;  1HE9 A;  2L6F A;  2I8B A;  5DLJ A;  4YT8 A;  2NG1 A;  2A6E F;  2GDC A;  3KKB A;  5E2Q A;  5L0H A;  3X2Q C;  4CDA A;  3S9O A;  2WZF A;  3GAN A;  5A6B A;  2HZ8 A;  1Q0F A;  2YHS A;  4NTA A;  4JIO A;  2CNW A;  4CS9 A;  3R2P A;  3V5X A;  3NRH A;  3HLZ A;  3L8J A;  4E18 A;  3RIP A;  1Y4C A;  4YK5 A;  1TWC A;  1WN0 A;  4IGG A;  1VMA A;  3RYL A;  1L3P A;  2WVN A;  1GQA A;  4RD9 A;  4D4N A;  1M2V B;  2JPU A;  3GM2 A;  1Z63 A;  5COF A;  4QI2 A;  3UMI A;  3TJ6 A;  1G5Z A;  4PJJ A;  1E83 A;  2R9R B;  2ICW G;  1TQG A;  1ZYR F;  3MLG A;  3DJN B;  1A41 A;  3L34 A;  3ABK C;  3M4C A;  1KU2 A;  4H4K C;  3RKO F;  3X1O A;  3K7D A;  5BQH A;  3FOO A;  3U3F A;  3GOD A;  3WAQ A;  5EGY A;  4KNV A;  2V3C C;  3RFY A;  3RW0 A;  2ZD9 A;  1YVI A;  3AJM A;  1T9K A;  1CGO A;  1ORJ A;  2KGO A;  4OD4 A;  3W8H A;  3ATP A;  1IZM A;  2KK1 A;  3KMI A;  3E9V A;  5EK0 A;  3ZQV A;  1SMY F;  2YQY A;  3QW0 A;  1TWA A;  4D4X A;  3EFO A;  5L0D A;  1M56 C;  2LD6 A;  4A2N B;  2MHR A;  4J30 B;  3RF3 A;  1M6T A;  4JUR I;  3LES A;  1Q0D A;  2BC5 A;  3LLI A;  4XEF A;  5GPG B;  4E0I A;  4YT4 A;  1CGM E;  1V55 C;  1PCX A;  3RH3 A;  4JC7 A;  1O3U A;  2AWC A;  3PDM P;  1F1M A;  2EPO A;  1GS9 A;  3OEO A;  4KC9 A;  1RJ9 B;  3SXZ A;  1Z23 A;  4Q5S F;  1LI5 A;  3ZDL A;  5F5F A;  2XSE A;  3NMI A;  2IXO A;  2H7V C;  1OW8 A;  2QLA A;  1PD1 A;  1TWG A;  2W45 A;  5E3C A;  2XRH A;  5DVW A;  1M2V A;  2P61 A;  4F4B A;  2ASR A;  3ABL C;  4JW1 A;  3B29 A;  2NSF A;  4JJF A;  2FAP B;  4U5C E;  3FAP B;  4LLE A;  3SEO A;  4JZA A;  1IW7 F;  1OCZ C;  4E0H A;  3AG1 C;  4EKW A;  2VC9 A;  3LAY A;  2XLW A;  1G4W R;  4CSA C;  5L0G A;  2Q9A A;  4PFP A;  5HV9 A;  5JS5 A;  1HW2 A;  3GEH A;  4X0R A;  3B71 A;  5B3S C;  2EPK X;  2P7V A;  2R7Q A;  3ECS A;  3IPM O;  1T6U A;  4C3D A;  1YLM A;  2YLG A;  4CDV A;  4YT2 A;  4U5H A;  4O7G A;  2G3V A;  1WAT A;  2HMQ A;  3G4Z A;  1JAF A;  3BEH A;  3JZ0 A;  4JEA A;  3WOD F;  4Q7C A;  2YZS A;  4IJJ A;  4H54 A;  1RMV A;  3JCU Q;  2P1A A;  3OWT A;  5L3V A;  1LE4 A;  5BQG A;  2QY9 A;  3LNM B;  3O10 A;  3SZR A;  1C17 M;  1D0Z A;  1HW1 A;  2UUH A;  2A1D D;  1QSP A;  3DM5 A;  4JEB A;  4P6I C;  3SP1 A;  3DJU B;  4NTF A;  4XTK A;  2EPM X;  2W9Y A;  3SYN A;  1KTM A;  3TK0 A;  1RJ9 A;  2W4M A;  3VRC A;  3IQT A;  3EQL F;  4CDY A;  2WZG A;  3CZ6 A;  3I5P A;  3O55 A;  1E86 A;  4MTG A;  1G4U S;  4AK9 A;  4UDV A;  5L3Q A;  1JMW A;  2LK4 A;  3DMD A;  1U0B B;  2Y3H A;  4LAC B;  3RQE A;  4YL3 A;  1FR0 A;  1MMN A;  3EGX B;  3B0U X;  3KYJ A;  3I4U A;  1TR2 A;  2QUP A;  3VM6 A;  1LI7 A;  2PX3 A;  3FMS A;  3HNI A;  4C3E A;  1ST6 A;  2YRF A;  2OQM A;  2HV7 A;  3RQG A;  4L6R A;  4ONS A;  2Y39 A;  2VCA A;  3M15 A;  1OKK D;  1OR3 A;  2WZL A;  4MTF A;  5KYN A;  3DE9 A;  2HV6 A;  3C8Z A;  4G7O F;  4AE4 B;  2L6H A;  1AVO B;  1LVK A;  3ZIB A;  2PBE A;  2XLE A;  1U6H A;  4LDQ A;  3KL4 A;  5KYY A;  1EA8 A;  2JD3 A;  3NKD A;  1LIH A;  1ZW2 A;  1OCR C;  2IYL D;  3EG9 B;  2A68 F;  3C62 A;  1QVX A;  2AVK A;  3S0X A;  2HSB A;  2KYH A;  1C02 A;  2G3K A;  4U5B E;  2XM4 A;  4CIH A;  2NSG A;  3QVY A;  2YLD A;  5CI8 A;  2DGJ A;  1NU9 C;  2EIJ C;  3GWL A;  4AL0 A;  1Q0K A;  3CEX A;  1SZI A;  5JRA A;  1I5N A;  3S90 A;  4YL1 A;  1LM3 B;  3Q7L A;  2J9B A;  3K1I C;  4I44 A;  2R7S A;  1ZU4 A;  1XWJ A;  4QDL A;  2R7R A;  2R25 A;  1K04 A;  1PV3 A;  2LP4 A;  3E70 C;  1A7D A;  5B3I A;  1QQ3 A;  2EIL C;  4I3M A;  4AX2 A;  1T6Q A;  1Q0M A;  2EIN C;  3AGT A;  4U9D A;  3SXK A;  2J7P D;  1FNT c;  2C04 A;  5HSW A;  4PK4 A;  2YWA A;  5D92 A;  2ETS A;  3B0P A;  3EGX A;  5T1D B;  1YA9 A;  4DXW A;  4HFK B;  4J7Y A;  1BR1 A;  4GYT A;  1B68 A;  4O6N A;  2NUT B;  3W2W A;  4EUK B;  4MVZ A;  2IXM A;  5JSL A;  3U9M A;  2HJ3 A;  4CBE A;  4EBK A;  5A6A A;  2CW0 F;  2Z15 A;  1NLX A;  1JRA A;  2IXN A;  4OIO F;  2XS1 A;  4R32 A;  2YL3 A;  4DOZ A;  2FFH A;  3EHN A;  2VCC A;  3EHM A;  4PFO A;  4AE4 A;  1RKC A;  4I1O B;  2Q00 A;  3DWW A;  3IQC A;  1Z7Q c;  3KPH A;  3DZA A;  3GWN A;  3U2M A;  1JOG A;  1JR8 A;  1YAR O;  1OR2 A;  3B9Q A;  3EG9 A;  3IHU A;  3NMK A;  1YZC A;  2IBF A;  1E2X A;  3NYM A;  1ZVZ A;  3Q7G A;  4MVR A;  2XLV A;  4NTB A;  4DRJ B;  5A6J A;  1MMA A;  2IXP A;  4N6C A;  4QI0 A;  3V5Z A;  3WHN A;  2WB7 A;  3OA1 A;  3ZC4 A;  2RSE B;  1NFO A;  4O6Y A;  4RDA A;  1HE1 A;  1K05 A;  1TFO B;  3K1I A;  1ZW3 A;  1NSG B;  3R7C A;  1M57 C;  2GFH A;  4NC3 A;  3NG1 A;  3S29 A;  5KYX A;  2WVO A;  3NMJ A;  1OW6 A;  3LEV A;  3LJB A;  4XPW A;  2HMZ A;  3T9O A;  2XXA A;  1LS1 A;  3LUT B;  4JE9 A;  3TOM A;  2Q4F A;  4NY3 A;  1MNE A;  1C03 A;  3K1H A;  4M63 A;  5KYU B;  1MMD A;  3N0T A;  2QTV A;  2NUT A;  1OXK A;  2E87 A;  1OCO C;  4MTO A;  3HNL A;  4JVS A;  2M64 A;  2BL2 A;  4PJM A;  4FAP B;  4Q4Z F;  4OIN F;  1A7E A;  3K33 A;  3HNJ A;  3C8G B;  3IEE A;  3Q6M A;  4N4W A;  2CGE A;  3AQB A;  3LS1 A;  3MX3 A;  1UG7 A;  4MND A;  3EZI A;  1H6G A;  1LE2 A;  1ZHY A;  4OIR F;  1KNY A;  1MQV A;  3FXH A;  5AC4 A;  1FAP B;  2EPL X;  2NPU A;  1APC A;  1ZU5 A;  5L0I A;  5JVE A;  1V54 C;  3N2Z B;  5DQZ A;  4LER A;  3VF0 A;  4DBR A;  5EHH A;  2PP4 A;  5TJ5 E;  1CGN A;  4BJ1 A;  4N6H A;  4EIY A;  2PF4 E;  3U5S A;  5A6B D;  3W2V A;  2V26 A;  3CSK A;  4ER9 A;  2R7W A;  2CNW D;  4MVO A;  2O9X A;  4P9F A;  2J45 A;  4XPX A;  2L6G A;  4BG0 A;  3U0C A;  2AWY A;  3I5Q A;  3DM9 B;  3V5Y A;  3KH2 A;  4BJ6 C;  3UGO A;  4MVS A;  3GEI A;  4IWB A;  3O6X A;  4WAB A;  1QZX A;  2G62 A;  2GWW A;  5KYY B;  2A69 F;  1D0X A;  1FFH A;  3JYY A;  5KYU A;  4DRI B;  1T6I A;  1Z3I X;  3J06 A;  2LSE A;  2DB4 A;  2EIK C;  1OQC A;  3TQO A;  4G7H F;  2CYD A;  1HMO A;  3US6 A;  1Z5Z A;  3FVY A;  3ASN C;  5DS6 A;  4JJG A;  3BRJ A;  3C8G A;  4C7O B;  2Y3G A;  4CS7 A;  3NDB B;  3MYI A;  1WTY A;  2L81 A;  4XEV A;  4ANJ A;  5BUO A;  3U3B A;  2OG2 A;  2ZXO A;  1A0B A;  3UNG C;  3G50 A;  5IY5 C;  5BQI A;  5B1B C;  1YYX A;  2X0C A;  2VH3 A;  1J8M F;  2Q3T A;  1CPR A;  4U5D E;  3M1C B;  1S7Z A;  4YJW A;  1ORY A;  1OCC C;  2OOC A;  3KYI A;  2Q9B A;  4WGZ A;  2J9V A;  5D91 A;  2TMV P;  1A7V A;  4BEM J;  3LEO A;  3ZWI A;  4DRH B;  5K0I A;  2R7U A;  3VAY A;  1M2O A;  2XL4 A;  3EH2 A;  3N24 A;  4FES A;  2A0B A;  2W4B A;  3H65 A;  1TWH A;  3DD7 A;  3C63 A;  4PAC A;  5AC5 A;  3CAX A;  4CSA A;  1MND A;  4IB4 A;  4Z9I A;  4BJ6 A;  4LDK A;  3UGP A;  3L0I A;  4IRU A;  3K66 A;  3TUL A;  4Z9J A;  2OEV A;  3U9J A; 
#chains in the Genus database with same CATH homology
 3DAG A;  4ULW A;  2X51 A;  2P6V A;  4O6M A;  4G0H A;  3WG7 C;  2DYR C;  3DXJ F;  4C7O A;  4OIP F;  4MQ9 F;  4N06 A;  1FMW A;  4U5G A;  4U5F E;  5F5H A;  3POV A;  2M4E A;  1N1C A;  3ASO C;  1JPJ A;  1ZHX A;  5KYX B;  1O87 A;  4CS9 C;  2XXA B;  1FFT C;  2EIM C;  2R7V A;  3AG4 C;  1D1C A;  1D0Y A;  1QLE C;  3HTK C;  2J0X A;  5FCL A;  2VB6 A;  3JRT A;  3F47 A;  2NUP B;  1NG1 A;  5E33 A;  2A6H F;  3FDQ A;  4U5E E;  2KQ9 A;  2Y3D A;  2FGY A;  1TKN A;  3Q6N A;  1FTS A;  1JPN A;  2J46 A;  5DS4 A;  3CQZ A;  3UMK A;  5DS5 A;  3EZH A;  2WVQ A;  2ZXW C;  3S27 A;  3ZG1 A;  2VAS A;  1ZHW A;  4O79 A;  4HFF B;  2YEV A;  3EGD B;  1W2W A;  1VYK A;  4BJT A;  3EPV A;  2PX0 A;  1J8Y F;  2ZPA A;  4KI2 A;  1PD0 A;  1ZHZ A;  3EH1 A;  1WGW A;  4XWJ A;  2NUP A;  3FHD A;  1SF8 A;  5DQT A;  4JCH A;  3F46 A;  2IOQ A;  3AG2 C;  4YN0 B;  3B0V C;  5B1A C;  2Q9C A;  2ZXR A;  1Z6A A;  3ITF A;  3W8I A;  4KNW A;  3ABM C;  3K6B A;  4G7Z F;  3EGD A;  4K0D A;  4XLP F;  1BR4 A;  4EBB A;  4KBL A;  2L9J A;  2Y3B A;  4HEA J;  1D1B A;  4PJL A;  3PHF 2;  2H7B A;  1OKK A;  3TD7 A;  3PMR A;  2H7O A;  1O5H A;  3VYW A;  3JT1 A;  4K7B A;  3NKE A;  1MMG A;  3S28 A;  3T6B A;  3DAF A;  4FWV A;  4CS8 C;  4IAO A;  1LKX A;  3LNR A;  1NU7 D;  3JSZ A;  3AG3 C;  1NZE A;  5E3A A;  2CDQ A;  4B6I A;  2KW3 C;  2KJG A;  2Y69 C;  4FX5 A;  3NYJ A;  4WJ0 A;  3LLK A;  4DVY P;  5KYW B;  4EWC A;  3FAJ A;  2PFD A;  2DYS C;  4BEJ A;  3AQC A;  2J7P A;  2MYS A;  5T3W A;  1FMV A;  4C3B A;  4BJ5 C;  4E7Z A;  2R7O A;  3LS0 A;  4GEH A;  3O39 A;  1VYI A;  1BR2 A;  3EJN A;  3QZC A;  4E7S A;  4DBQ A;  2J0W A;  3NYL A;  3UMH A;  1ZHT A;  4OD5 A;  4J32 B;  3ZSU A;  4CS8 A;  3JYH A;  4HE8 D;  2ZXP A;  1VOM A;  4YT5 A;  5T3T A;  2D5R B;  2MWQ A;  3T6J A;  1G8X A;  3V7O A;  2J9U A;  4PJN A;  2R7X A;  5CI9 A;  2KNH A;  2BE5 F;  5KYW A;  3ZVR A;  4ZLC A;  3HJC A;  1VK5 A;  2B0J A;  2OCC C;  4BJ5 A;  4OIQ F;  4RBN A;  2R7T A;  4ZLD A;  4W8K A;  4LLC A;  3UR3 C;  2J9W A;  4I1M A;  2WL8 A;  4YWQ A;  3QMK A;  2C03 A;  3SNH A;  3T4R A;  1D1A A;  3EFO B;  4XLN F;  2I8B A;  5DLJ A;  4YT8 A;  2NG1 A;  2A6E F;  3KKB A;  5E2Q A;  3X2Q C;  2WZF A;  3GAN A;  2YHS A;  2CNW A;  4CS9 A;  3NRH A;  3HLZ A;  3RIP A;  1TWC A;  1VMA A;  3RYL A;  2WVN A;  4RD9 A;  1Z63 A;  1M2V B;  4QI2 A;  3UMI A;  4PJJ A;  3MLG A;  1ZYR F;  3DJN B;  3L34 A;  3ABK C;  1KU2 A;  4H4K C;  3RKO F;  3X1O A;  3K7D A;  5EGY A;  3GOD A;  4KNV A;  3RFY A;  2KGO A;  4OD4 A;  3W8H A;  1IZM A;  3KMI A;  3E9V A;  1SMY F;  1TWA A;  3EFO A;  1M56 C;  4A2N B;  4J30 B;  4JUR I;  3LES A;  3LLI A;  4YT4 A;  1V55 C;  1PCX A;  3RH3 A;  3OEO A;  4KC9 A;  1RJ9 B;  5F5F A;  1Z23 A;  4Q5S F;  2XSE A;  2IXO A;  2H7V C;  1PD1 A;  1TWG A;  2W45 A;  5E3C A;  2XRH A;  5DVW A;  1M2V A;  4F4B A;  3ABL C;  4JW1 A;  4JJF A;  4U5C E;  4LLE A;  3SEO A;  4JZA A;  1IW7 F;  1OCZ C;  3AG1 C;  3LAY A;  4CSA C;  2Q9A A;  4PFP A;  4X0R A;  5B3S C;  2P7V A;  2R7Q A;  3ECS A;  4C3D A;  4YT2 A;  4U5H A;  4O7G A;  2G3V A;  3WOD F;  4Q7C A;  2YZS A;  4IJJ A;  3JCU Q;  3OWT A;  5L3V A;  2QY9 A;  2V3C C;  5DQZ A;  3SZR A;  1D0Z A;  4P6I C;  3DM5 A;  2A1D D;  4DVZ A;  3SP1 A;  3DJU B;  4XTK A;  3SYN A;  2W9Y A;  1RJ9 A;  2W4M A;  3EQL F;  2WZG A;  3CZ6 A;  3I5P A;  4AK9 A;  5L3Q A;  3DMD A;  2Y3H A;  4LAC B;  1MMN A;  3EGX B;  3B0U X;  3I4U A;  1TR2 A;  2PX3 A;  4C3E A;  1ST6 A;  2HV7 A;  2Y39 A;  1OKK D;  2WZL A;  5KYN A;  2HV6 A;  4G7O F;  4AE4 B;  1LVK A;  3ZIB A;  5KYY A;  3KL4 A;  2JD3 A;  3NKD A;  2IYL D;  1OCR C;  3EG9 B;  2A68 F;  3S0X A;  2G3K A;  4U5B E;  4CIH A;  5CI8 A;  2DGJ A;  1NU9 C;  2EIJ C;  1SZI A;  3Q7L A;  2R7S A;  3K1I C;  4I44 A;  1ZU4 A;  2R7R A;  4QDL A;  3E70 C;  2EIL C;  4I3M A;  4AX2 A;  2EIN C;  5HSW A;  2J7P D;  2C04 A;  4PK4 A;  5D92 A;  3EGX A;  3B0P A;  5T1D B;  4HFK B;  4O6N A;  1BR1 A;  4GYT A;  2NUT B;  3W2W A;  2IXM A;  4CBE A;  2CW0 F;  2Z15 A;  2IXN A;  4OIO F;  4DOZ A;  2FFH A;  3EHN A;  3EHM A;  4PFO A;  4AE4 A;  4I1O B;  3DZA A;  3EG9 A;  3B9Q A;  3NYM A;  3Q7G A;  1MMA A;  2IXP A;  4QI0 A;  2WB7 A;  3OA1 A;  3ZC4 A;  4O6Y A;  4RDA A;  1M57 C;  2GFH A;  3NG1 A;  3S29 A;  5KYX A;  2WVO A;  3LEV A;  3LJB A;  2XXA A;  1LS1 A;  4NY3 A;  1MNE A;  3K1H A;  4M63 A;  5KYU B;  1MMD A;  3N0T A;  2QTV A;  2NUT A;  2E87 A;  1OCO C;  4JVS A;  4PJM A;  4Q4Z F;  4OIN F;  3K33 A;  3IEE A;  3Q6M A;  2CGE A;  3AQB A;  3LS1 A;  3MX3 A;  4OIR F;  4MND A;  3EZI A;  1ZHY A;  1ZU5 A;  1V54 C;  3N2Z B;  4DBR A;  4LER A;  5EHH A;  2PP4 A;  4BJ1 A;  2PF4 E;  3W2V A;  2V26 A;  3CSK A;  2R7W A;  2CNW D;  2O9X A;  4BG0 A;  2J45 A;  3I5Q A;  3DM9 B;  3KH2 A;  4BJ6 C;  3UGO A;  4IWB A;  3O6X A;  5KYY B;  1QZX A;  2G62 A;  2A69 F;  1D0X A;  1FFH A;  5KYU A;  1Z3I X;  2LSE A;  2EIK C;  4G7H F;  1Z5Z A;  3FVY A;  3ASN C;  5DS6 A;  4JJG A;  4C7O B;  2Y3G A;  4CS7 A;  3NDB B;  4ANJ A;  2L81 A;  5BUO A;  2OG2 A;  2ZXO A;  3UNG C;  5IY5 C;  5B1B C;  2VH3 A;  1J8M F;  2Q3T A;  4U5D E;  3M1C B;  1S7Z A;  4YJW A;  5D91 A;  1OCC C;  2Q9B A;  2J9V A;  2R7U A;  3VAY A;  1M2O A;  2XL4 A;  3EH2 A;  3N24 A;  4FES A;  2W4B A;  3H65 A;  1TWH A;  3DD7 A;  4CSA A;  1MND A;  4BJ6 A;  3UGP A;  3L0I A;  4IRU A;  3K66 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...