5CI8A

Crystal structure of human tob in complex with inhibitor fragment 1
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
117
structure length
117
Chain Sequence
HHMQLEIQVALNFIISYLYNKLPRRRVNIFGEELERLLKKKYEGHWYPEKPYKGSGFRCIHIGEKVDPVIEQASKESGLDIDDVRGNLPQDLSVWIDPFEVSYQIGEKGPVKVLYVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for inhibition of the Tob-CNOT7 interaction by a fragment screening approach
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/inhibitor
molecule keywords Protein Tob1
total genus 38
structure length 117
sequence length 117
ec nomenclature
pdb deposition date 2015-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07742 BTG BTG family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1120 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 5ci8A00
5CI8A 5CI9A 3DJUB 3E9VA 2Z15A 3DJNB 2D5RB
chains in the Genus database with same CATH superfamily
1TWHA 2W4MA 1Y6DA 2Q00A 3NYLA 2R05A 3ZDLA 4EBJA 5E3AA 2P6VA 1H9TA 5DS6A 2LFDA 3EZHA 4WGYA 4FAPB 2HKVA 2Q7RA 3SNHA 1WN0A 4KBLA 3SXZA 4EKWA 5KYNA 5L0HA 2LSEA 3G4ZA 3MYFA 3PDMP 4JE9A 5L0GA 4K7BA 3LUTB 1QVXA 1OR3A 1OQCA 3B0VC 3TOMA 3AG3C 3N24A 4XWJA 3UMKA 2MHRA 5DQTA 2IXNA 4FESA 1NG1A 5CI9A 1YZAA 3ZTZA 1SF8A 3O6XA 1PD0A 1CPRA 3TD7A 4JRZA 2L7AA 3JSEO 3M4CA 3OA1A 1MMGA 4IWBA 3U9JA 2UUIA 1VYIA 3H2UA 3ZC4A 5AC4A 4IAOA 4AE4A 4DBQA 2G3VA 4XLNF 4YWQA 4X0RA 1O5HA 1YDIA 3EHMA 1F1MA 3MFNA 3AQCA 3HNLA 2KQ9A 2OCCC 3DM9B 4WABA 2VCAA 4E7SA 4XEFA 4OIQF 1VTMP 4OIOF 4PK4A 4OD5A 2XS8A 4JZAA 1PCXA 2HFIA 2XXAB 1G4US 1D0YA 2XRHA 2L9JA 1QKRA 2DI3A 3E9VA 4H54A 1WGWA 4K0DA 2A0UA 1K40A 4PFOA 3T9OA 2M4EA 3C18A 2NSGA 1R5ID 1QQ3A 2X0CA 1G4WR 1KU2A 2NUTB 4MVUA 3ZVRA 1OW7A 2IOQA 2VB6A 3KMIA 3U2LA 1E85A 4E17A 2HJ3A 2CNWA 4YT5A 1LE4A 1GQAA 2JPUA 1Q0KA 3JRMO 3AOUA 4E0HA 1LI5A 1YZCA 3DAGA 4FX5A 4KNWA 3H65A 1TWCA 4HEAJ 4CIPA 1N1CA 1TKNA 1UFBA 2Y69C 3W8IA 2QLAA 3B9QA 1M2VB 1TWAA 1E84A 3ZTMA 3US6A 2YVKA 4BJ5C 3FMSA 1C17M 3M4BA 1OCZC 3GWNA 3K1IA 2FFHA 3LJBA 4IGGA 4LDQA 4OD4A 4RD9A 2XL4A 3A11A 256BA 3UMHA 2OKUA 3TOLA 5KYUB 3X1OA 5K0IA 3UGPA 1I4ZA 1BZ4A 3E70C 2LQGA 2IYLD 1MMDA 3DM5A 2D5RB 3ABMC 3ATPA 4MVQA 2Y3GA 2UUHA 1YYJA 2R03A 3GEHA 5EHHA 3W4YA 5F5HA 2V26A 2P61A 1APCA 1VOMA 2QUPA 4MTGA 4XPXA 2PBEA 1MNEA 2LK4A 1R4TA 1AEPA 1BR2A 1T6UA 1YJGA 3HNJA 1LVKA 2GWWA 3SYNA 3ASOC 1BDJB 3NMKA 2EILC 4AL1A 1ZHWA 2KC3A 2AVKA 3K1IC 3NG1A 1L7CA 1SMYF 2ZXPA 3V5YA 3NMJA 3JRTA 4KNVA 3KYJA 2CYDA 2J9WA 4HFFB 3U8VA 1JR8A 1OKKA 3U3FA 4N06A 5BUOA 1LIHA 2Y3BA 4GQHA 3B0UX 1ZW3A 2BL2A 3GEIA 3HJCA 4ULWA 1G8XA 4DRIB 1OKKD 4MVRA 4DXWA 4JCZA 4U5EE 2BE5F 1Z23A 2J9UA 3GM2A 4NC3A 1EQ1A 3IQCA 4CS7A 4JURI 1MQVA 1FTSA 2A68F 2B0HA 3EPVA 4JTDB 2J0XA 1HW1A 1VLSA 2DB4A 5JT4A 4QI0A 1K05A 2AU5A 4UDVA 1LS4A 1S05A 5E2QA 3UMIA 4D4NA 2OU6A 4J32B 1Z7Qc 3V5ZA 4B6IA 1YARO 2PFDA 3LNRA 3UR3C 3FDQA 1D1AA 3U8PA 1MNDA 4CBEA 2R9RB 3SXKA 3C62A 2CCYA 3O39A 3GORA 4PJMA 4LDKA 1FMVA 2FGYA 2Z15A 3C8GB 5E3CA 4AE4B 2HMZA 3KH2A 3WHNA 2XL6A 2IXOA 3ABKC 4U5FE 2H7OA 2VH3A 2XLWA 4N6CA 2L6FA 4DRHB 5A6AA 2HS5A 3VF0A 1RCPA 3OWTA 4FWVA 4JJGA 1V4AA 3U5SA 1D0ZA 4G7OF 1PV3A 2KK1A 2P7VA 3VM6A 5F5FA 2WB7A 3VYWA 2RSEB 1LPEA 1B68A 1RKEB 3RIPA 4DVZA 4YL0A 4DRJB 3NDBB 3DWWA 4O79A 4J30B 4O7GA 4C3DA 2IXMA 5COGA 5L3QA 2YLGA 5F28E 3FVYA 3DXJF 3S84A 4EBKA 4YT4A 3DJUB 4HFKB 3W2VA 5DS4A 2QNLA 5JP7A 2OEVA 4CDAA 2J45A 2R7TA 3S27A 4AL0A 1JAFA 3K66A 1H7IA 1A7VA 5T3TA 3UNGC 5DVWA 3QZCA 3CEXA 5CI8A 1TFKB 4PFPA 4ONSA 5T1DB 5L0CA 1U0BB 1MMNA 3TK0A 3FOPA 3RVZA 2NUTA 3K33A 2KNHA 4BPMA 5A6JA 1RXQA 3T6BA 3EHNA 1D1CA 2C04A 2X51A 1ZU4A 4WJ0A 3GEEA 3K1HA 3U3BA 4YT2A 2VC9A 3L0IA 4EBBA 3JYYA 1JPNA 3JT1A 3KPHA 1BBHA 2XS1A 5DS5A 4Z9IA 4DBRA 5A6BD 2YWAA 3CAXA 1A41A 4OIRF 2R7SA 1TQGA 2ZXRA 3EQLF 3MLGA 3GWLA 4CS9C 3TULA 4G7HF 4C3BA 3N0TA 1QLEC 2DGJA 3U2MA 3O55A 3EH1A 2IM8A 5CIVA 3ABLC 5GPGB 3HNKA 3K6BA 4R32A 2PF4E 4E0IA 1GM5A 2R7VA 2J0WA 3CSKA 4U5BE 2YL1A 3GANA 5D92A 5EGYA 3PHF2 3RVYA 1LM3B 2KYHA 4CJGA 4BJ6A 1OXKA 1BR1A 4GEHA 1LS1A 4U5GA 1NBBA 3V5XA 3EGXA 3W8HA 4MVSA 5HV9A 2R7WA 2GDCA 2YZSA 3RF3A 2XL8A 3RQGA 2XXAA 3QTHA 3SEOA 4U5CE 2H7VC 3TJ6A 4BJTA 4DOZA 1OCCC 1Q0DA 1E86A 1GGQA 3O10A 2XLDA 5D91A 3B0PA 1YAUO 2Q9BA 2J8WA 2AWYA 2Q9CA 3EJNA 3FXHA 4JEBA 2R25A 2R7OA 3EGDB 4JIOA 5E33A 1M57C 4O6NA 2CW0F 3G50A 3Q6NA 1T9KA 2VCBA 3DAFA 1J8MF 2EIKC 2QE9A 1XZQA 4U9EA 5T3WA 5KYWB 3PMRA 3T6GB 1SR2A 3DE9A 2XLEA 4DVYP 3M79A 4U5DE 2LD6A 4KC9A 3NYJA 2PX0A 3DJNB 2PX3A 1VB5A 4JTCB 1OXBA 3IQ5A 3IPMO 3F47A 2HSQA 4LLCA 2P1AA 1ZHZA 4LERA 2YRFA 4MVMA 5KYXA 1E2XA 2M64A 2VASA 2YEVA 2I15A 5EK0A 1UG7A 4L6RA 4BJ6C 5JS5A 4EUKB 3DD7A 2EPKX 3Q6MA 4D4XA 1QSPA 1I4YA 2YL3A 4BJ5A 5B1BC 2G3KA 5JSLA 2D4UA 2EPNA 1OW8A 2GFHA 3JTLO 4MTOA 4NTFA 1VMAA 4XTKA 3BEHA 1HE1A 2EPLX 3M15A 4C3EA 2QTVA 3C8ZA 3SXYA 1Z6AA 5FCLA 2A6EF 1NU9C 1AVOB 1WTYA 1AUEA 2HJMA 1RJ9B 3C8GD 1H6GA 5L0FA 2LIGA 1WWPA 2GAQA 2L6GA 2ETSA 1LE2A 4RBNA 2J9BA 3OEOA 2NUPB 3T6JA 1RMVA 3ASNC 3C63A 3JZ0A 3X2QC 3JSZA 1HY5A 1M6TA 2YLIA 4G78A 5BQGA 4RDAA 3W2WA 1OCRC 1CPQA 3EG9A 5IY5C 4MNDA 1VYKA 4M63A 4ER9A 4P9FA 3AG2C 1JOGA 3A9CA 2WVQA 3H2VA 4MTFA 3ZSUA 5JVEA 3WAQA 3S0XA 1A0BA 4NCQA 2OG2A 3EG9B 1Q0GA 2IBFA 4NY3A 4C7OA 3LS0A 1RKCA 3S9OA 3NKEA 4PJJA 3AG4C 4W8PA 2W45A 2MWQA 4JJFA 1Z63A 2CGEA 2E87A 2HMQA 2XLHA 2F22A 1WOLA 2JX0A 2WVOA 4JEAA 1HMDA 3V7OA 1Q0FA 1V74B 1WASA 3JCUQ 3T4RA 1ZHXA 4U5HA 1GS9A 1NU7D 4PR9A 4Q4ZF 4J7YA 2ZPAA 2HV7A 2XLMA 1YA7O 2DYSC 1DOWA 2L81A 2EINC 4O6MA 5KYYA 2H8AA 3ITFA 3QMKA 3PCVA 2JD3A 3JYHA 4XEVA 1JPJA 1FMWA 5AGFA 3NMIA 4LACB 1FFHA 4XLPF 3DZAA 1IZMA 1QZXA 2J7PA 3B71A 3L8JA 4CJOA 5A69A 1ORJA 3FAJA 4I1OB 1S7ZA 3CQZA 3KKBA 3QW1A 5DLJA 2V3CC 4CSAC 1RKEA 3WODF 4LLEA 3RH3A 2HSBA 5KYUA 5B3SC 5BQHA 2OOCA 2J7PD 5JUAA 2YHSA 3ZG1A 4YT8A 1O3UA 1DOVA 1LKXA 2L6HA 4K1OA 2B0JA 4MW8A 4NQFA 5L0IA 4W8KA 1NFOA 1M2OA 1XWJA 2EIMC 1C02A 4CX9A 3HNIA 2PP4A 1FFTC 3ECSA 3SZRA 2XM0A 4LDRA 3F46A 1ZVZA 5AC5A 2WL8A 2GA0A 4MVZA 1ZU5A 2MYSA 2ZXWC 1NLXA 2A6HF 3RQEA 4YJWA 3AG1C 4IRUA 4MS2A 3AQBA 2H7BA 4CS8A 1FR0A 4JTAB 2XLVA 1YVIA 3S29A 4QI2A 5HSWA 1U89A 4WGZA 4CS9A 3HLZA 1L3PA 1SZIA 2AWCA 1A7EA 1O87A 2Y3DA 1Y4CA 3GM1A 4ZLCA 3N2ZB 1EKYA 3NYMA 1C03A 4OIPF 1OW6A 1EA8A 1I5NA 2Y39A 3LLIA 3R2PA 3BRJA 4I3MA 4CDYA 3IQ6A 1Q0MA 3TJ5A 4Q7CA 2R7UA 5KYWA 2I8BA 3LAYA 5B3IA 2HV6A 2OJED 1OR2A 4AX2A 4PJNA 3U0CA 3SP1A 3ZQVA 3FAPB 3I5PA 4XQ1A 1J8YF 1VLTA 4DJ9A 4JVSA 3HKKA 1FAPB 2CDQA 2XM4A 2Q4FA 3LNMB 4A4AA 2EIJC 1VK5A 3MBGA 1EI7A 2XSEA 3RYLA 2CNWD 3LEVA 3MX3A 2EPMX 5COMA 4YK5A 3TQOA 1TWGA 2PNOA 4Q5SF 3I5QA 4J7TA 4MW3A 3ZWIA 4KI2A 1ORYA 5L0DA 1HE9A 1CGNA 3C8GA 4BG0A 2R02A 2DYRC 2QY9A 2ZXOA 2NUPA 3Q7LA 4P9TA 4Z9JA 1NZEA 3R7CA 4Z9HA 5JLIA 4PACA 3ZQYA 2XLOA 4H4KC 4E18A 3FHDA 2NPUA 5L0JA 3RQFA 1E83A 2OQMA 1JRAA 1T01A 3NRHA 2YL0A 4N4WA 2BC5A 3L1MA 1NSGB 2RD9A 4ULVA 4CSAA 4BEJA 4YL1A 1TFOB 4F4BA 1ORSC 3C7JA 4CIHA 4IJJA 1SYQA 1ZZPA 2WZLA 3EGXB 4MVOA 4OINF 3ZIBA 3VAYA 1U6HA 3EFOB 2ASRA 3QW0A 4QDLA 4EWCA 1CGME 4ZLDA 4AK9A 4XPWA 1QPUA 1ZW2A 2P0NA 2YL7A 3DE8A 1MMAA 5TJ5E 1JMWA 4BEMJ 2A69F 2W9YA 3G4XA 1OCOC 1D1BA 3I4UA 3IHUA 4N6HA 2W4BA 1Z5ZA 3QVYA 5BQIA 4G7ZF 4EIYA 2WVNA 2NG1A 2WZFA 2O9XA 1NFNA 2ICWG 4U9DA 5COFA 3M1CB 3RFYA 1PD1A 4IARA 2YQYA 4HE8D 4JCHA 2G62A 3MYIA 1T6IA 1BR4A 4JC7A 5L3VA 2OEXA 1YYXA 2AP3A 1ST6A 1M2VA 1V54C 5KYYB 2EPOA 3IQTA 1H9GA 3SXMA 2NSFA 2J46A 2A0BA 4NTBA 4I44A 4IB4A 4XPYA 2OJQA 1KNYA 2VCCA 4G0HA 1IW7F 4MQ9F 4NTAA 5KYXB 4IAQA 2C03A 3LS1A 1D0XA 4A2NB 4BJ1A 2YKZA 5FZTA 4YL3A 2IXPA 5A6KA 3U9MA 3AGUA 1ZYRF 1RJ9A 2Q3TA 2YLDA 3L34A 4YN0B 1W2WA 2J9VA 3UGOA 1WATA 3FOOA 1YA9A 3IEEA 3POVA 4I1MA 5DQZA 1A7DA 2KGOA 3LLKA 3KL4A 3KYIA 4JW1A 3EZIA 1T5OA 4EHPA 1G5ZA 2FAPB 1T6QA 2R7QA 5A6BA 2A1DD 2ZD9A 3WG7C 3EGDA 3S90A 4PJLA 3K7DA 1K04A 3VRCA 3DKAA 4ANJA 4E7ZA 3LESA 3NKDA 4CDVA 4CS8C 3DI5A 3GM3A 3AGTA 1YLMA 4XEKA 1ZHYA 2HZ8A 3LEOA 2KSFA 2WZGA 2Y3HA 3AJMA 4C7OB 2LFFA 3Q7GA 3B29A 1XZPA 1LI7A 3DMDA 3L8IA 5JRAA 2LCHA 4JKVA 1CGOA 3EFOA 3S28A 2R7RA 2HUJA 1ZHTA 2R7XA 2KW3C 3EH2A 3HTKC 2LP4A 1V55C 1M56C 3GODA 3RKOF 1KTMA 1TR2A 4GYTA 4P6IC 3RW0A 2TMVP 4O6YA 2KJGA 5B1AC 3J06A 1HMOA 3QVZA 2Q9AA 1FNTc 3CZ6A 1HW2A 1Z3IX
chains in the Genus database with same CATH topology
1TWHA 2W4MA 3NYLA 5E3AA 2P6VA 5DS6A 3EZHA 3SNHA 4KBLA 5KYNA 2LSEA 4K7BA 3B0VC 3AG3C 3N24A 4XWJA 3UMKA 5DQTA 2IXNA 4FESA 1NG1A 5CI9A 1SF8A 3O6XA 1PD0A 3TD7A 3OA1A 1MMGA 4IWBA 1VYIA 3ZC4A 4IAOA 4AE4A 4DBQA 2G3VA 4XLNF 4YWQA 4X0RA 1O5HA 3EHMA 3AQCA 2KQ9A 2OCCC 3DM9B 4E7SA 4OIOF 4OIQF 4PK4A 4OD5A 4JZAA 1PCXA 2XXAB 1D0YA 2XRHA 2L9JA 3E9VA 4K0DA 1WGWA 4PFOA 2M4EA 3ZVRA 2NUTB 1KU2A 2IOQA 2VB6A 3KMIA 2CNWA 4YT5A 3DAGA 4FX5A 4KNWA 3H65A 1TWCA 4HEAJ 1N1CA 1TKNA 2Y69C 3W8IA 3B9QA 1M2VB 1TWAA 4BJ5C 1OCZC 2FFHA 3LJBA 4OD4A 4RD9A 2XL4A 3UMHA 5KYUB 3X1OA 3UGPA 3E70C 2IYLD 1MMDA 3DM5A 2D5RB 3ABMC 2Y3GA 5EHHA 5F5HA 2V26A 1VOMA 1MNEA 1BR2A 1LVKA 3SYNA 3ASOC 2EILC 1ZHWA 3K1IC 3NG1A 1SMYF 2ZXPA 3JRTA 4KNVA 2J9WA 4HFFB 1OKKA 4N06A 5BUOA 2Y3BA 3B0UX 3HJCA 4ULWA 1G8XA 1OKKD 4U5EE 2BE5F 1Z23A 2J9UA 4CS7A 4JURI 1FTSA 2A68F 3EPVA 2J0XA 4QI0A 5E2QA 3UMIA 4J32B 4B6IA 3LNRA 2PFDA 3UR3C 3FDQA 1D1AA 1MNDA 4CBEA 3O39A 4PJMA 5E3CA 1FMVA 2Z15A 2FGYA 4AE4B 3KH2A 2IXOA 3ABKC 4U5FE 2H7OA 2VH3A 4FWVA 3OWTA 4JJGA 4G7OF 1D0ZA 2P7VA 5F5FA 2WB7A 3VYWA 3RIPA 4DVZA 3NDBB 4O79A 4J30B 4O7GA 4C3DA 2IXMA 5L3QA 3FVYA 3DXJF 4YT4A 3DJUB 4HFKB 3W2VA 5DS4A 2J45A 2R7TA 3S27A 3K66A 3UNGC 5T3TA 5DVWA 3QZCA 5CI8A 4PFPA 5T1DB 1MMNA 2NUTA 3K33A 2KNHA 3T6BA 3EHNA 1D1CA 2C04A 2X51A 1ZU4A 4WJ0A 3K1HA 4YT2A 3L0IA 4EBBA 1JPNA 3JT1A 5DS5A 4DBRA 4OIRF 2R7SA 2ZXRA 3EQLF 3MLGA 4CS9C 4G7HF 4C3BA 3N0TA 1QLEC 2DGJA 3EH1A 3ABLC 2R7VA 3K6BA 2PF4E 2J0WA 3CSKA 4U5BE 3PHF2 3GANA 5D92A 5EGYA 4BJ6A 1BR1A 4GEHA 1LS1A 4U5GA 3W8HA 3EGXA 2R7WA 2YZSA 2XXAA 3SEOA 4U5CE 2H7VC 4DOZA 4BJTA 1OCCC 5D91A 3B0PA 2Q9BA 2Q9CA 3EJNA 2R7OA 3EGDB 5E33A 1M57C 4O6NA 2CW0F 3Q6NA 3DAFA 1J8MF 2EIKC 5T3WA 5KYWB 3PMRA 4DVYP 4U5DE 4KC9A 3NYJA 2PX0A 3DJNB 2PX3A 3F47A 4LLCA 5KYXA 1ZHZA 4LERA 4OIPF 2YEVA 2VASA 4BJ6C 3DD7A 3Q6MA 4BJ5A 5B1BC 2G3KA 2GFHA 1VMAA 4XTKA 4C3EA 2QTVA 5FCLA 1Z6AA 2A6EF 1NU9C 1RJ9B 4RBNA 3OEOA 2NUPB 3T6JA 3ASNC 3X2QC 3JSZA 4RDAA 3W2WA 1OCRC 3EG9A 5IY5C 4MNDA 1VYKA 4M63A 3AG2C 2WVQA 3ZSUA 3S0XA 2OG2A 3EG9B 4NY3A 4C7OA 3LS0A 3NKEA 4PJJA 3AG4C 2W45A 2MWQA 4JJFA 1Z63A 2CGEA 2E87A 2WVOA 3V7OA 3JCUQ 3T4RA 1ZHXA 4U5HA 1NU7D 4Q4ZF 2ZPAA 2HV7A 2DYSC 2L81A 4O6MA 2EINC 5KYYA 3ITFA 3QMKA 2JD3A 3JYHA 1JPJA 1FMWA 4LACB 1FFHA 4XLPF 3DZAA 1IZMA 1QZXA 2J7PA 3FAJA 4I1OB 1S7ZA 3CQZA 3KKBA 5DLJA 2V3CC 4CSAC 3WODF 4LLEA 3RH3A 5KYUA 5B3SC 2J7PD 2YHSA 3ZG1A 4YT8A 1LKXA 2B0JA 4W8KA 1M2OA 2EIMC 2PP4A 1FFTC 3ECSA 3SZRA 3F46A 2WL8A 1ZU5A 2MYSA 2ZXWC 2A6HF 4YJWA 4IRUA 3AG1C 3AQBA 2H7BA 4CS8A 3S29A 4QI2A 5HSWA 4CS9A 3HLZA 1SZIA 2Y3DA 1O87A 4ZLCA 3N2ZB 3NYMA 2Y39A 3LLIA 4I3MA 2R7UA 4Q7CA 5KYWA 2I8BA 3LAYA 2HV6A 4AX2A 4PJNA 3SP1A 3I5PA 1J8YF 4JVSA 2CDQA 2EIJC 1VK5A 2XSEA 3RYLA 2CNWD 3LEVA 3MX3A 1TWGA 4Q5SF 3I5QA 4KI2A 4BG0A 2DYRC 2QY9A 2ZXOA 2NUPA 3Q7LA 1NZEA 4H4KC 3FHDA 3NRHA 4CSAA 4BEJA 4F4BA 4CIHA 4IJJA 2WZLA 3EGXB 4OINF 3ZIBA 3VAYA 4EWCA 3EFOB 4QDLA 4ZLDA 4AK9A 1MMAA 2A69F 2W9YA 1OCOC 1D1BA 3I4UA 2W4BA 1Z5ZA 4G7ZF 2WVNA 2NG1A 2WZFA 2O9XA 3RFYA 3M1CB 1PD1A 4HE8D 4JCHA 2G62A 5L3VA 1BR4A 1ST6A 1M2VA 1V54C 5KYYB 2J46A 4I44A 4G0HA 4MQ9F 1IW7F 5KYXB 2C03A 3LS1A 1D0XA 4A2NB 4BJ1A 2IXPA 4YN0B 1ZYRF 1RJ9A 2Q3TA 3L34A 1W2WA 2J9VA 3UGOA 3POVA 3IEEA 4I1MA 5DQZA 2KGOA 3LLKA 3KL4A 4JW1A 3EZIA 2R7QA 2A1DD 3WG7C 3EGDA 4PJLA 3K7DA 4ANJA 4E7ZA 3LESA 3NKDA 4CS8C 1ZHYA 2Y3HA 2WZGA 4C7OB 3Q7GA 3DMDA 3S28A 3EFOA 2R7RA 1ZHTA 2R7XA 2KW3C 3EH2A 3HTKC 1V55C 1M56C 3GODA 3RKOF 1TR2A 4GYTA 4P6IC 4O6YA 2KJGA 5B1AC 2Q9AA 3CZ6A 1Z3IX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CI8 A;  5CI9 A;  3DJU B;  3E9V A;  2Z15 A;  3DJN B;  2D5R B; 
#chains in the Genus database with same CATH topology
 1TWH A;  2W4M A;  1Y6D A;  2Q00 A;  3NYL A;  2R05 A;  3ZDL A;  4EBJ A;  5E3A A;  2P6V A;  1H9T A;  5DS6 A;  2LFD A;  3EZH A;  4WGY A;  4FAP B;  2HKV A;  2Q7R A;  3SNH A;  1WN0 A;  4KBL A;  3SXZ A;  4EKW A;  5KYN A;  5L0H A;  2LSE A;  3G4Z A;  3MYF A;  3PDM P;  4JE9 A;  5L0G A;  4K7B A;  3LUT B;  1QVX A;  1OR3 A;  1OQC A;  3B0V C;  3TOM A;  3AG3 C;  3N24 A;  4XWJ A;  3UMK A;  2MHR A;  5DQT A;  2IXN A;  4FES A;  1NG1 A;  5CI9 A;  1YZA A;  3ZTZ A;  1SF8 A;  3O6X A;  1PD0 A;  1CPR A;  3TD7 A;  4JRZ A;  2L7A A;  3JSE O;  3M4C A;  3OA1 A;  1MMG A;  4IWB A;  3U9J A;  2UUI A;  1VYI A;  3H2U A;  3ZC4 A;  5AC4 A;  4IAO A;  4AE4 A;  4DBQ A;  2G3V A;  4XLN F;  4YWQ A;  4X0R A;  1O5H A;  1YDI A;  3EHM A;  1F1M A;  3MFN A;  3AQC A;  3HNL A;  2KQ9 A;  2OCC C;  3DM9 B;  4WAB A;  2VCA A;  4E7S A;  4XEF A;  4OIQ F;  1VTM P;  4OIO F;  4PK4 A;  4OD5 A;  2XS8 A;  4JZA A;  1PCX A;  2HFI A;  2XXA B;  1G4U S;  1D0Y A;  2XRH A;  2L9J A;  1QKR A;  2DI3 A;  3E9V A;  4H54 A;  1WGW A;  4K0D A;  2A0U A;  1K40 A;  4PFO A;  3T9O A;  2M4E A;  3C18 A;  2NSG A;  1R5I D;  1QQ3 A;  2X0C A;  1G4W R;  1KU2 A;  2NUT B;  4MVU A;  3ZVR A;  1OW7 A;  2IOQ A;  2VB6 A;  3KMI A;  3U2L A;  1E85 A;  4E17 A;  2HJ3 A;  2CNW A;  4YT5 A;  1LE4 A;  1GQA A;  2JPU A;  1Q0K A;  3JRM O;  3AOU A;  4E0H A;  1LI5 A;  1YZC A;  3DAG A;  4FX5 A;  4KNW A;  3H65 A;  1TWC A;  4HEA J;  4CIP A;  1N1C A;  1TKN A;  1UFB A;  2Y69 C;  3W8I A;  2QLA A;  3B9Q A;  1M2V B;  1TWA A;  1E84 A;  3ZTM A;  3US6 A;  2YVK A;  4BJ5 C;  3FMS A;  1C17 M;  3M4B A;  1OCZ C;  3GWN A;  3K1I A;  2FFH A;  3LJB A;  4IGG A;  4LDQ A;  4OD4 A;  4RD9 A;  2XL4 A;  3A11 A;  256B A;  3UMH A;  2OKU A;  3TOL A;  5KYU B;  3X1O A;  5K0I A;  3UGP A;  1I4Z A;  1BZ4 A;  3E70 C;  2LQG A;  2IYL D;  1MMD A;  3DM5 A;  2D5R B;  3ABM C;  3ATP A;  4MVQ A;  2Y3G A;  2UUH A;  1YYJ A;  2R03 A;  3GEH A;  5EHH A;  3W4Y A;  5F5H A;  2V26 A;  2P61 A;  1APC A;  1VOM A;  2QUP A;  4MTG A;  4XPX A;  2PBE A;  1MNE A;  2LK4 A;  1R4T A;  1AEP A;  1BR2 A;  1T6U A;  1YJG A;  3HNJ A;  1LVK A;  2GWW A;  3SYN A;  3ASO C;  1BDJ B;  3NMK A;  2EIL C;  4AL1 A;  1ZHW A;  2KC3 A;  2AVK A;  3K1I C;  3NG1 A;  1L7C A;  1SMY F;  2ZXP A;  3V5Y A;  3NMJ A;  3JRT A;  4KNV A;  3KYJ A;  2CYD A;  2J9W A;  4HFF B;  3U8V A;  1JR8 A;  1OKK A;  3U3F A;  4N06 A;  5BUO A;  1LIH A;  2Y3B A;  4GQH A;  3B0U X;  1ZW3 A;  2BL2 A;  3GEI A;  3HJC A;  4ULW A;  1G8X A;  4DRI B;  1OKK D;  4MVR A;  4DXW A;  4JCZ A;  4U5E E;  2BE5 F;  1Z23 A;  2J9U A;  3GM2 A;  4NC3 A;  1EQ1 A;  3IQC A;  4CS7 A;  4JUR I;  1MQV A;  1FTS A;  2A68 F;  2B0H A;  3EPV A;  4JTD B;  2J0X A;  1HW1 A;  1VLS A;  2DB4 A;  5JT4 A;  4QI0 A;  1K05 A;  2AU5 A;  4UDV A;  1LS4 A;  1S05 A;  5E2Q A;  3UMI A;  4D4N A;  2OU6 A;  4J32 B;  1Z7Q c;  3V5Z A;  4B6I A;  1YAR O;  2PFD A;  3LNR A;  3UR3 C;  3FDQ A;  1D1A A;  3U8P A;  1MND A;  4CBE A;  2R9R B;  3SXK A;  3C62 A;  2CCY A;  3O39 A;  3GOR A;  4PJM A;  4LDK A;  1FMV A;  2FGY A;  2Z15 A;  3C8G B;  5E3C A;  4AE4 B;  2HMZ A;  3KH2 A;  3WHN A;  2XL6 A;  2IXO A;  3ABK C;  4U5F E;  2H7O A;  2VH3 A;  2XLW A;  4N6C A;  2L6F A;  4DRH B;  5A6A A;  2HS5 A;  3VF0 A;  1RCP A;  3OWT A;  4FWV A;  4JJG A;  1V4A A;  3U5S A;  1D0Z A;  4G7O F;  1PV3 A;  2KK1 A;  2P7V A;  3VM6 A;  5F5F A;  2WB7 A;  3VYW A;  2RSE B;  1LPE A;  1B68 A;  1RKE B;  3RIP A;  4DVZ A;  4YL0 A;  4DRJ B;  3NDB B;  3DWW A;  4O79 A;  4J30 B;  4O7G A;  4C3D A;  2IXM A;  5COG A;  5L3Q A;  2YLG A;  5F28 E;  3FVY A;  3DXJ F;  3S84 A;  4EBK A;  4YT4 A;  3DJU B;  4HFK B;  3W2V A;  5DS4 A;  2QNL A;  5JP7 A;  2OEV A;  4CDA A;  2J45 A;  2R7T A;  3S27 A;  4AL0 A;  1JAF A;  3K66 A;  1H7I A;  1A7V A;  5T3T A;  3UNG C;  5DVW A;  3QZC A;  3CEX A;  5CI8 A;  1TFK B;  4PFP A;  4ONS A;  5T1D B;  5L0C A;  1U0B B;  1MMN A;  3TK0 A;  3FOP A;  3RVZ A;  2NUT A;  3K33 A;  2KNH A;  4BPM A;  5A6J A;  1RXQ A;  3T6B A;  3EHN A;  1D1C A;  2C04 A;  2X51 A;  1ZU4 A;  4WJ0 A;  3GEE A;  3K1H A;  3U3B A;  4YT2 A;  2VC9 A;  3L0I A;  4EBB A;  3JYY A;  1JPN A;  3JT1 A;  3KPH A;  1BBH A;  2XS1 A;  5DS5 A;  4Z9I A;  4DBR A;  5A6B D;  2YWA A;  3CAX A;  1A41 A;  4OIR F;  2R7S A;  1TQG A;  2ZXR A;  3EQL F;  3MLG A;  3GWL A;  4CS9 C;  3TUL A;  4G7H F;  4C3B A;  3N0T A;  1QLE C;  2DGJ A;  3U2M A;  3O55 A;  3EH1 A;  2IM8 A;  5CIV A;  3ABL C;  5GPG B;  3HNK A;  3K6B A;  4R32 A;  2PF4 E;  4E0I A;  1GM5 A;  2R7V A;  2J0W A;  3CSK A;  4U5B E;  2YL1 A;  3GAN A;  5D92 A;  5EGY A;  3PHF 2;  3RVY A;  1LM3 B;  2KYH A;  4CJG A;  4BJ6 A;  1OXK A;  1BR1 A;  4GEH A;  1LS1 A;  4U5G A;  1NBB A;  3V5X A;  3EGX A;  3W8H A;  4MVS A;  5HV9 A;  2R7W A;  2GDC A;  2YZS A;  3RF3 A;  2XL8 A;  3RQG A;  2XXA A;  3QTH A;  3SEO A;  4U5C E;  2H7V C;  3TJ6 A;  4BJT A;  4DOZ A;  1OCC C;  1Q0D A;  1E86 A;  1GGQ A;  3O10 A;  2XLD A;  5D91 A;  3B0P A;  1YAU O;  2Q9B A;  2J8W A;  2AWY A;  2Q9C A;  3EJN A;  3FXH A;  4JEB A;  2R25 A;  2R7O A;  3EGD B;  4JIO A;  5E33 A;  1M57 C;  4O6N A;  2CW0 F;  3G50 A;  3Q6N A;  1T9K A;  2VCB A;  3DAF A;  1J8M F;  2EIK C;  2QE9 A;  1XZQ A;  4U9E A;  5T3W A;  5KYW B;  3PMR A;  3T6G B;  1SR2 A;  3DE9 A;  2XLE A;  4DVY P;  3M79 A;  4U5D E;  2LD6 A;  4KC9 A;  3NYJ A;  2PX0 A;  3DJN B;  2PX3 A;  1VB5 A;  4JTC B;  1OXB A;  3IQ5 A;  3IPM O;  3F47 A;  2HSQ A;  4LLC A;  2P1A A;  1ZHZ A;  4LER A;  2YRF A;  4MVM A;  5KYX A;  1E2X A;  2M64 A;  2VAS A;  2YEV A;  2I15 A;  5EK0 A;  1UG7 A;  4L6R A;  4BJ6 C;  5JS5 A;  4EUK B;  3DD7 A;  2EPK X;  3Q6M A;  4D4X A;  1QSP A;  1I4Y A;  2YL3 A;  4BJ5 A;  5B1B C;  2G3K A;  5JSL A;  2D4U A;  2EPN A;  1OW8 A;  2GFH A;  3JTL O;  4MTO A;  4NTF A;  1VMA A;  4XTK A;  3BEH A;  1HE1 A;  2EPL X;  3M15 A;  4C3E A;  2QTV A;  3C8Z A;  3SXY A;  1Z6A A;  5FCL A;  2A6E F;  1NU9 C;  1AVO B;  1WTY A;  1AUE A;  2HJM A;  1RJ9 B;  3C8G D;  1H6G A;  5L0F A;  2LIG A;  1WWP A;  2GAQ A;  2L6G A;  2ETS A;  1LE2 A;  4RBN A;  2J9B A;  3OEO A;  2NUP B;  3T6J A;  1RMV A;  3ASN C;  3C63 A;  3JZ0 A;  3X2Q C;  3JSZ A;  1HY5 A;  1M6T A;  2YLI A;  4G78 A;  5BQG A;  4RDA A;  3W2W A;  1OCR C;  1CPQ A;  3EG9 A;  5IY5 C;  4MND A;  1VYK A;  4M63 A;  4ER9 A;  4P9F A;  3AG2 C;  1JOG A;  3A9C A;  2WVQ A;  3H2V A;  4MTF A;  3ZSU A;  5JVE A;  3WAQ A;  3S0X A;  1A0B A;  4NCQ A;  2OG2 A;  3EG9 B;  1Q0G A;  2IBF A;  4NY3 A;  4C7O A;  3LS0 A;  1RKC A;  3S9O A;  3NKE A;  4PJJ A;  3AG4 C;  4W8P A;  2W45 A;  2MWQ A;  4JJF A;  1Z63 A;  2CGE A;  2E87 A;  2HMQ A;  2XLH A;  2F22 A;  1WOL A;  2JX0 A;  2WVO A;  4JEA A;  1HMD A;  3V7O A;  1Q0F A;  1V74 B;  1WAS A;  3JCU Q;  3T4R A;  1ZHX A;  4U5H A;  1GS9 A;  1NU7 D;  4PR9 A;  4Q4Z F;  4J7Y A;  2ZPA A;  2HV7 A;  2XLM A;  1YA7 O;  2DYS C;  1DOW A;  2L81 A;  2EIN C;  4O6M A;  5KYY A;  2H8A A;  3ITF A;  3QMK A;  3PCV A;  2JD3 A;  3JYH A;  4XEV A;  1JPJ A;  1FMW A;  5AGF A;  3NMI A;  4LAC B;  1FFH A;  4XLP F;  3DZA A;  1IZM A;  1QZX A;  2J7P A;  3B71 A;  3L8J A;  4CJO A;  5A69 A;  1ORJ A;  3FAJ A;  4I1O B;  1S7Z A;  3CQZ A;  3KKB A;  3QW1 A;  5DLJ A;  2V3C C;  4CSA C;  1RKE A;  3WOD F;  4LLE A;  3RH3 A;  2HSB A;  5KYU A;  5B3S C;  5BQH A;  2OOC A;  2J7P D;  5JUA A;  2YHS A;  3ZG1 A;  4YT8 A;  1O3U A;  1DOV A;  1LKX A;  2L6H A;  4K1O A;  2B0J A;  4MW8 A;  4NQF A;  5L0I A;  4W8K A;  1NFO A;  1M2O A;  1XWJ A;  2EIM C;  1C02 A;  4CX9 A;  3HNI A;  2PP4 A;  1FFT C;  3ECS A;  3SZR A;  2XM0 A;  4LDR A;  3F46 A;  1ZVZ A;  5AC5 A;  2WL8 A;  2GA0 A;  4MVZ A;  1ZU5 A;  2MYS A;  2ZXW C;  1NLX A;  2A6H F;  3RQE A;  4YJW A;  3AG1 C;  4IRU A;  4MS2 A;  3AQB A;  2H7B A;  4CS8 A;  1FR0 A;  4JTA B;  2XLV A;  1YVI A;  3S29 A;  4QI2 A;  5HSW A;  1U89 A;  4WGZ A;  4CS9 A;  3HLZ A;  1L3P A;  1SZI A;  2AWC A;  1A7E A;  1O87 A;  2Y3D A;  1Y4C A;  3GM1 A;  4ZLC A;  3N2Z B;  1EKY A;  3NYM A;  1C03 A;  4OIP F;  1OW6 A;  1EA8 A;  1I5N A;  2Y39 A;  3LLI A;  3R2P A;  3BRJ A;  4I3M A;  4CDY A;  3IQ6 A;  1Q0M A;  3TJ5 A;  4Q7C A;  2R7U A;  5KYW A;  2I8B A;  3LAY A;  5B3I A;  2HV6 A;  2OJE D;  1OR2 A;  4AX2 A;  4PJN A;  3U0C A;  3SP1 A;  3ZQV A;  3FAP B;  3I5P A;  4XQ1 A;  1J8Y F;  1VLT A;  4DJ9 A;  4JVS A;  3HKK A;  1FAP B;  2CDQ A;  2XM4 A;  2Q4F A;  3LNM B;  4A4A A;  2EIJ C;  1VK5 A;  3MBG A;  1EI7 A;  2XSE A;  3RYL A;  2CNW D;  3LEV A;  3MX3 A;  2EPM X;  5COM A;  4YK5 A;  3TQO A;  1TWG A;  2PNO A;  4Q5S F;  3I5Q A;  4J7T A;  4MW3 A;  3ZWI A;  4KI2 A;  1ORY A;  5L0D A;  1HE9 A;  1CGN A;  3C8G A;  4BG0 A;  2R02 A;  2DYR C;  2QY9 A;  2ZXO A;  2NUP A;  3Q7L A;  4P9T A;  4Z9J A;  1NZE A;  3R7C A;  4Z9H A;  5JLI A;  4PAC A;  3ZQY A;  2XLO A;  4H4K C;  4E18 A;  3FHD A;  2NPU A;  5L0J A;  3RQF A;  1E83 A;  2OQM A;  1JRA A;  1T01 A;  3NRH A;  2YL0 A;  4N4W A;  2BC5 A;  3L1M A;  1NSG B;  2RD9 A;  4ULV A;  4CSA A;  4BEJ A;  4YL1 A;  1TFO B;  4F4B A;  1ORS C;  3C7J A;  4CIH A;  4IJJ A;  1SYQ A;  1ZZP A;  2WZL A;  3EGX B;  4MVO A;  4OIN F;  3ZIB A;  3VAY A;  1U6H A;  3EFO B;  2ASR A;  3QW0 A;  4QDL A;  4EWC A;  1CGM E;  4ZLD A;  4AK9 A;  4XPW A;  1QPU A;  1ZW2 A;  2P0N A;  2YL7 A;  3DE8 A;  1MMA A;  5TJ5 E;  1JMW A;  4BEM J;  2A69 F;  2W9Y A;  3G4X A;  1OCO C;  1D1B A;  3I4U A;  3IHU A;  4N6H A;  2W4B A;  1Z5Z A;  3QVY A;  5BQI A;  4G7Z F;  4EIY A;  2WVN A;  2NG1 A;  2WZF A;  2O9X A;  1NFN A;  2ICW G;  4U9D A;  5COF A;  3M1C B;  3RFY A;  1PD1 A;  4IAR A;  2YQY A;  4HE8 D;  4JCH A;  2G62 A;  3MYI A;  1T6I A;  1BR4 A;  4JC7 A;  5L3V A;  2OEX A;  1YYX A;  2AP3 A;  1ST6 A;  1M2V A;  1V54 C;  5KYY B;  2EPO A;  3IQT A;  1H9G A;  3SXM A;  2NSF A;  2J46 A;  2A0B A;  4NTB A;  4I44 A;  4IB4 A;  4XPY A;  2OJQ A;  1KNY A;  2VCC A;  4G0H A;  1IW7 F;  4MQ9 F;  4NTA A;  5KYX B;  4IAQ A;  2C03 A;  3LS1 A;  1D0X A;  4A2N B;  4BJ1 A;  2YKZ A;  5FZT A;  4YL3 A;  2IXP A;  5A6K A;  3U9M A;  3AGU A;  1ZYR F;  1RJ9 A;  2Q3T A;  2YLD A;  3L34 A;  4YN0 B;  1W2W A;  2J9V A;  3UGO A;  1WAT A;  3FOO A;  1YA9 A;  3IEE A;  3POV A;  4I1M A;  5DQZ A;  1A7D A;  2KGO A;  3LLK A;  3KL4 A;  3KYI A;  4JW1 A;  3EZI A;  1T5O A;  4EHP A;  1G5Z A;  2FAP B;  1T6Q A;  2R7Q A;  5A6B A;  2A1D D;  2ZD9 A;  3WG7 C;  3EGD A;  3S90 A;  4PJL A;  3K7D A;  1K04 A;  3VRC A;  3DKA A;  4ANJ A;  4E7Z A;  3LES A;  3NKD A;  4CDV A;  4CS8 C;  3DI5 A;  3GM3 A;  3AGT A;  1YLM A;  4XEK A;  1ZHY A;  2HZ8 A;  3LEO A;  2KSF A;  2WZG A;  2Y3H A;  3AJM A;  4C7O B;  2LFF A;  3Q7G A;  3B29 A;  1XZP A;  1LI7 A;  3DMD A;  3L8I A;  5JRA A;  2LCH A;  4JKV A;  1CGO A;  3EFO A;  3S28 A;  2R7R A;  2HUJ A;  1ZHT A;  2R7X A;  2KW3 C;  3EH2 A;  3HTK C;  2LP4 A;  1V55 C;  1M56 C;  3GOD A;  3RKO F;  1KTM A;  1TR2 A;  4GYT A;  4P6I C;  3RW0 A;  2TMV P;  4O6Y A;  2KJG A;  5B1A C;  3J06 A;  1HMO A;  3QVZ A;  2Q9A A;  1FNT c;  3CZ6 A;  1HW2 A;  1Z3I X; 
#chains in the Genus database with same CATH homology
 1TWH A;  2W4M A;  3NYL A;  5E3A A;  2P6V A;  5DS6 A;  3EZH A;  3SNH A;  4KBL A;  5KYN A;  2LSE A;  4K7B A;  3B0V C;  3AG3 C;  3N24 A;  4XWJ A;  3UMK A;  5DQT A;  2IXN A;  4FES A;  1NG1 A;  5CI9 A;  1SF8 A;  3O6X A;  1PD0 A;  3TD7 A;  3OA1 A;  1MMG A;  4IWB A;  1VYI A;  3ZC4 A;  4IAO A;  4AE4 A;  4DBQ A;  2G3V A;  4XLN F;  4YWQ A;  4X0R A;  1O5H A;  3EHM A;  3AQC A;  2KQ9 A;  2OCC C;  3DM9 B;  4E7S A;  4OIO F;  4OIQ F;  4PK4 A;  4OD5 A;  4JZA A;  1PCX A;  2XXA B;  1D0Y A;  2XRH A;  2L9J A;  3E9V A;  4K0D A;  1WGW A;  4PFO A;  2M4E A;  3ZVR A;  2NUT B;  1KU2 A;  2IOQ A;  2VB6 A;  3KMI A;  2CNW A;  4YT5 A;  3DAG A;  4FX5 A;  4KNW A;  3H65 A;  1TWC A;  4HEA J;  1N1C A;  1TKN A;  2Y69 C;  3W8I A;  3B9Q A;  1M2V B;  1TWA A;  4BJ5 C;  1OCZ C;  2FFH A;  3LJB A;  4OD4 A;  4RD9 A;  2XL4 A;  3UMH A;  5KYU B;  3X1O A;  3UGP A;  3E70 C;  2IYL D;  1MMD A;  3DM5 A;  2D5R B;  3ABM C;  2Y3G A;  5EHH A;  5F5H A;  2V26 A;  1VOM A;  1MNE A;  1BR2 A;  1LVK A;  3SYN A;  3ASO C;  2EIL C;  1ZHW A;  3K1I C;  3NG1 A;  1SMY F;  2ZXP A;  3JRT A;  4KNV A;  2J9W A;  4HFF B;  1OKK A;  4N06 A;  5BUO A;  2Y3B A;  3B0U X;  3HJC A;  4ULW A;  1G8X A;  1OKK D;  4U5E E;  2BE5 F;  1Z23 A;  2J9U A;  4CS7 A;  4JUR I;  1FTS A;  2A68 F;  3EPV A;  2J0X A;  4QI0 A;  5E2Q A;  3UMI A;  4J32 B;  4B6I A;  3LNR A;  2PFD A;  3UR3 C;  3FDQ A;  1D1A A;  1MND A;  4CBE A;  3O39 A;  4PJM A;  5E3C A;  1FMV A;  2Z15 A;  2FGY A;  4AE4 B;  3KH2 A;  2IXO A;  3ABK C;  4U5F E;  2H7O A;  2VH3 A;  4FWV A;  3OWT A;  4JJG A;  4G7O F;  1D0Z A;  2P7V A;  5F5F A;  2WB7 A;  3VYW A;  3RIP A;  4DVZ A;  3NDB B;  4O79 A;  4J30 B;  4O7G A;  4C3D A;  2IXM A;  5L3Q A;  3FVY A;  3DXJ F;  4YT4 A;  3DJU B;  4HFK B;  3W2V A;  5DS4 A;  2J45 A;  2R7T A;  3S27 A;  3K66 A;  3UNG C;  5T3T A;  5DVW A;  3QZC A;  5CI8 A;  4PFP A;  5T1D B;  1MMN A;  2NUT A;  3K33 A;  2KNH A;  3T6B A;  3EHN A;  1D1C A;  2C04 A;  2X51 A;  1ZU4 A;  4WJ0 A;  3K1H A;  4YT2 A;  3L0I A;  4EBB A;  1JPN A;  3JT1 A;  5DS5 A;  4DBR A;  4OIR F;  2R7S A;  2ZXR A;  3EQL F;  3MLG A;  4CS9 C;  4G7H F;  4C3B A;  3N0T A;  1QLE C;  2DGJ A;  3EH1 A;  3ABL C;  2R7V A;  3K6B A;  2PF4 E;  2J0W A;  3CSK A;  4U5B E;  3PHF 2;  3GAN A;  5D92 A;  5EGY A;  4BJ6 A;  1BR1 A;  4GEH A;  1LS1 A;  4U5G A;  3W8H A;  3EGX A;  2R7W A;  2YZS A;  2XXA A;  3SEO A;  4U5C E;  2H7V C;  4DOZ A;  4BJT A;  1OCC C;  5D91 A;  3B0P A;  2Q9B A;  2Q9C A;  3EJN A;  2R7O A;  3EGD B;  5E33 A;  1M57 C;  4O6N A;  2CW0 F;  3Q6N A;  3DAF A;  1J8M F;  2EIK C;  5T3W A;  5KYW B;  3PMR A;  4DVY P;  4U5D E;  4KC9 A;  3NYJ A;  2PX0 A;  3DJN B;  2PX3 A;  3F47 A;  4LLC A;  5KYX A;  1ZHZ A;  4LER A;  4OIP F;  2YEV A;  2VAS A;  4BJ6 C;  3DD7 A;  3Q6M A;  4BJ5 A;  5B1B C;  2G3K A;  2GFH A;  1VMA A;  4XTK A;  4C3E A;  2QTV A;  5FCL A;  1Z6A A;  2A6E F;  1NU9 C;  1RJ9 B;  4RBN A;  3OEO A;  2NUP B;  3T6J A;  3ASN C;  3X2Q C;  3JSZ A;  4RDA A;  3W2W A;  1OCR C;  3EG9 A;  5IY5 C;  4MND A;  1VYK A;  4M63 A;  3AG2 C;  2WVQ A;  3ZSU A;  3S0X A;  2OG2 A;  3EG9 B;  4NY3 A;  4C7O A;  3LS0 A;  3NKE A;  4PJJ A;  3AG4 C;  2W45 A;  2MWQ A;  4JJF A;  1Z63 A;  2CGE A;  2E87 A;  2WVO A;  3V7O A;  3JCU Q;  3T4R A;  1ZHX A;  4U5H A;  1NU7 D;  4Q4Z F;  2ZPA A;  2HV7 A;  2DYS C;  2L81 A;  4O6M A;  2EIN C;  5KYY A;  3ITF A;  3QMK A;  2JD3 A;  3JYH A;  1JPJ A;  1FMW A;  4LAC B;  1FFH A;  4XLP F;  3DZA A;  1IZM A;  1QZX A;  2J7P A;  3FAJ A;  4I1O B;  1S7Z A;  3CQZ A;  3KKB A;  5DLJ A;  2V3C C;  4CSA C;  3WOD F;  4LLE A;  3RH3 A;  5KYU A;  5B3S C;  2J7P D;  2YHS A;  3ZG1 A;  4YT8 A;  1LKX A;  2B0J A;  4W8K A;  1M2O A;  2EIM C;  2PP4 A;  1FFT C;  3ECS A;  3SZR A;  3F46 A;  2WL8 A;  1ZU5 A;  2MYS A;  2ZXW C;  2A6H F;  4YJW A;  4IRU A;  3AG1 C;  3AQB A;  2H7B A;  4CS8 A;  3S29 A;  4QI2 A;  5HSW A;  4CS9 A;  3HLZ A;  1SZI A;  2Y3D A;  1O87 A;  4ZLC A;  3N2Z B;  3NYM A;  2Y39 A;  3LLI A;  4I3M A;  2R7U A;  4Q7C A;  5KYW A;  2I8B A;  3LAY A;  2HV6 A;  4AX2 A;  4PJN A;  3SP1 A;  3I5P A;  1J8Y F;  4JVS A;  2CDQ A;  2EIJ C;  1VK5 A;  2XSE A;  3RYL A;  2CNW D;  3LEV A;  3MX3 A;  1TWG A;  4Q5S F;  3I5Q A;  4KI2 A;  4BG0 A;  2DYR C;  2QY9 A;  2ZXO A;  2NUP A;  3Q7L A;  1NZE A;  4H4K C;  3FHD A;  3NRH A;  4CSA A;  4BEJ A;  4F4B A;  4CIH A;  4IJJ A;  2WZL A;  3EGX B;  4OIN F;  3ZIB A;  3VAY A;  4EWC A;  3EFO B;  4QDL A;  4ZLD A;  4AK9 A;  1MMA A;  2A69 F;  2W9Y A;  1OCO C;  1D1B A;  3I4U A;  2W4B A;  1Z5Z A;  4G7Z F;  2WVN A;  2NG1 A;  2WZF A;  2O9X A;  3RFY A;  3M1C B;  1PD1 A;  4HE8 D;  4JCH A;  2G62 A;  5L3V A;  1BR4 A;  1ST6 A;  1M2V A;  1V54 C;  5KYY B;  2J46 A;  4I44 A;  4G0H A;  4MQ9 F;  1IW7 F;  5KYX B;  2C03 A;  3LS1 A;  1D0X A;  4A2N B;  4BJ1 A;  2IXP A;  4YN0 B;  1ZYR F;  1RJ9 A;  2Q3T A;  3L34 A;  1W2W A;  2J9V A;  3UGO A;  3POV A;  3IEE A;  4I1M A;  5DQZ A;  2KGO A;  3LLK A;  3KL4 A;  4JW1 A;  3EZI A;  2R7Q A;  2A1D D;  3WG7 C;  3EGD A;  4PJL A;  3K7D A;  4ANJ A;  4E7Z A;  3LES A;  3NKD A;  4CS8 C;  1ZHY A;  2Y3H A;  2WZG A;  4C7O B;  3Q7G A;  3DMD A;  3S28 A;  3EFO A;  2R7R A;  1ZHT A;  2R7X A;  2KW3 C;  3EH2 A;  3HTK C;  1V55 C;  1M56 C;  3GOD A;  3RKO F;  1TR2 A;  4GYT A;  4P6I C;  4O6Y A;  2KJG A;  5B1A C;  2Q9A A;  3CZ6 A;  1Z3I X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...