4QI0A

X-ray structure of the roq domain from murine roquin-1
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
153
structure length
153
Chain Sequence
QNPQQLSSNLWAAVRARGCQFLGPAMQEEALKLVLLALEDGSALSRKVLVLFVVQRLEPRFPQASKTSIGHVVQLLYRASCFKVTKRDEDSSLMQLKEEFRTYEALRREHDSQIVQIAMEAGLRIAPDQWSSLLYGDQSHKSHMQSIIDKLQT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Rna binding protein
molecule keywords Roquin-1
publication title Structural basis for RNA recognition in roquin-mediated post-transcriptional gene regulation.
pubmed doi rcsb
source organism Mus musculus
total genus 56
structure length 153
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2014-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18386 ROQ_II Roquin II domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1790 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4qi0A00
5F5HA 4QI2A 4ULWA 3X1OA 5F5FA 4ZLDA 4YWQA 4QI0A 4ZLCA
chains in the Genus database with same CATH superfamily
3U2LA 2OU6A 3EJNA 1S05A 1OCCC 3TULA 2R7XA 3KYIA 1PV3A 1K40A 1QVXA 2EIKC 3J06A 3L8JA 5HSWA 4LERA 3ZDLA 2GWWA 1LI7A 2NPUA 3ATPA 3EZHA 3ZC4A 1OCOC 3KL4A 1O3UA 1E85A 2HFIA 2AWYA 3HNJA 2LD6A 4Z9JA 1C17M 4MVZA 4G7ZF 4HEAJ 2OKUA 4WABA 1HMOA 3H65A 2AVKA 2QE9A 3BEHA 1ZHYA 2HZ8A 2M4EA 3EPVA 4PJNA 2AP3A 4CS8C 2WVQA 4BEMJ 1L3PA 2ZXRA 3GM1A 4KNVA 4JTAB 4N6HA 1Z6AA 2LP4A 1Z23A 4PR9A 4PFPA 2LIGA 2Y3BA 4MS2A 4NC3A 3A9CA 4RBNA 4X0RA 5JUAA 3WG7C 3X2QC 1A41A 1IW7F 3S0XA 3PCVA 4DRJB 1LM3B 4I3MA 4XPYA 2L6GA 1CGNA 4IGGA 3VYWA 2R02A 1TQGA 2WVNA 2HMQA 3C18A 2B0JA 5KYWA 4IRUA 1TWCA 2A69F 2XL8A 2IXPA 1J8MF 3CZ6A 4GEHA 3AG2C 3RW0A 3HNIA 3WHNA 2OG2A 4U5GA 2A1DD 1VYIA 4G7OF 2ZPAA 3AG3C 1CGME 1NZEA 4E0IA 2XLDA 2ICWG 3EHMA 1V54C 3TQOA 3V5ZA 1R4TA 3NMKA 3X1OA 4M63A 4XWJA 3GEIA 4PK4A 3EGXA 1YYJA 1VLSA 1K05A 5L0JA 1QPUA 1TKNA 1YA7O 4CDVA 2YWAA 4MVRA 4PJLA 2EINC 5DS5A 2J0XA 2WL8A 4YJWA 2P6VA 5DQTA 3LNRA 5E3AA 1Q0DA 3DMDA 3I4UA 1HW1A 1DOWA 2AU5A 2IXMA 2LQGA 3FXHA 3JZ0A 1BR4A 2OCCC 3RIPA 2VCCA 2A0UA 1YZAA 2NSGA 5K0IA 1MMNA 3L34A 3I5QA 1QKRA 1M56C 3U9JA 1YAUO 3RQGA 3HNKA 2OJED 4K0DA 1U89A 1LS4A 4IB4A 2J46A 2A6HF 2NSFA 3ABLC 3Q7LA 3DM5A 1XZQA 3US6A 1CGOA 1TFKB 4JCZA 4JJGA 5TJ5E 5A69A 4U5FE 2IM8A 1OQCA 2HKVA 1SMYF 1FNTc 5D92A 2VH3A 4JKVA 4MVUA 1ZU4A 1ZU5A 2KGOA 3GEHA 3M4CA 1I4YA 1FAPB 1NU9C 5T3TA 3LAYA 4HE8D 2HV6A 3RH3A 4C7OA 4XLNF 2XLOA 3S84A 1Z5ZA 5COGA 2V26A 4PFOA 3RVYA 2IXOA 4EBKA 3DJUB 4RDAA 1WWPA 2YL0A 3MYFA 4N4WA 3M15A 1G4US 2FFHA 2E87A 5JP7A 3WAQA 3GM3A 3K7DA 3PDMP 1D0ZA 2A68F 4I1OB 4IAOA 1ZHZA 2M64A 1D1BA 3Q7GA 2EPNA 2VC9A 5BQIA 4FX5A 3GODA 3IQ5A 2R03A 4RD9A 2YEVA 2FGYA 1U6HA 1FMWA 1QLEC 1VB5A 1LE4A 1M6TA 1ZHXA 5JRAA 1ORJA 1GGQA 2IOQA 5JS5A 5JVEA 3O55A 2MWQA 3DZAA 4OIPF 4DJ9A 4MVOA 3FOOA 1NFNA 2XLMA 2H7OA 3LLIA 4EWCA 5L0HA 3EG9B 3EQLF 1Q0KA 3K66A 3ZVRA 3A11A 4XQ1A 1G8XA 3U8PA 2R7OA 2EPKX 3HLZA 4NTAA 2G3VA 3MX3A 2NUTB 2R7VA 3ZTZA 3SXMA 4DRHB 1OKKA 3SEOA 2ZXPA 4J7YA 2D5RB 1NU7D 4JURI 3T4RA 3B0PA 3ZG1A 3CSKA 4O6NA 1MMGA 3SZRA 4BJ5A 2C03A 1LKXA 3JTLO 3KH2A 1UFBA 2J9VA 3S29A 5KYNA 3B29A 4CX9A 1SR2A 5DVWA 3LLKA 4W8PA 2LFFA 2J45A 3IQ6A 4EBJA 5A6BA 5JLIA 5B3SC 5F5FA 3NKDA 2LFDA 1FR0A 3VF0A 1YLMA 1ZW3A 1O5HA 5A6JA 2XL4A 4E0HA 3DE9A 4W8KA 5JT4A 2R7TA 1UG7A 3QW0A 4LDKA 2KJGA 3JT1A 3O6XA 3W4YA 3ZSUA 4R32A 1Y6DA 4MQ9F 4AL0A 1S7ZA 4XPXA 4DVYP 3ECSA 1T5OA 2FAPB 2OEVA 1TR2A 3GM2A 2UUHA 3UGPA 3L0IA 5A6KA 1A0BA 3JCUQ 1MNDA 2H8AA 4QDLA 4OIRF 3S28A 1GM5A 5A6AA 2RSEB 1MQVA 4E7ZA 4KI2A 3E9VA 2YHSA 3EH1A 1A7EA 2WZLA 3DI5A 3JRTA 4C7OB 4J7TA 2YRFA 4IWBA 1OCZC 2RD9A 1CPQA 4I1MA 2YL1A 4JIOA 4XPWA 1E86A 2P61A 3FAJA 4F4BA 1RMVA 4PACA 1FTSA 2HSBA 1H9GA 5L0GA 4G0HA 2OJQA 2EPMX 2XLEA 1ZVZA 1BZ4A 1T6IA 2Q9BA 4H4KC 3C8ZA 2R05A 2WB7A 4PJJA 1M57C 4N6CA 3F46A 3C8GB 3ITFA 4EHPA 2LCHA 5BQHA 3MFNA 3T6JA 2C04A 2XM4A 2Y3GA 3OEOA 2KYHA 2KQ9A 3IPMO 2QTVA 2Z15A 1APCA 1C03A 3EG9A 4LDQA 5E33A 5JSLA 4JVSA 2W4BA 3T6GB 2W9YA 4G78A 2L81A 3CEXA 2PX3A 4AE4B 1Z3IX 2R9RB 4ZLCA 4Q4ZF 2OQMA 1ZZPA 4CIHA 3K33A 1RKEA 3CQZA 3G50A 1Q0FA 2CW0F 3IHUA 3IQCA 4DVZA 2NUTA 3ABMC 2XSEA 1L7CA 4L6RA 5B1AC 3SXZA 5BUOA 1WATA 3POVA 1E84A 4CSAA 4P9FA 2KW3C 2XRHA 1ZYRF 3NKEA 2XM0A 4KC9A 5B1BC 4BJ5C 4KNWA 3DAGA 4YT4A 5KYYA 1ST6A 2QY9A 4A2NB 4D4XA 3FDQA 3UR3C 5FCLA 3OA1A 2XXAB 2BL2A 3G4ZA 3B9QA 3AOUA 2IYLD 3V5XA 2ZXOA 2Q9CA 4E17A 4MTOA 4OIQF 2UUIA 4U5BE 1LPEA 1MNEA 3W2WA 4J32B 1Z63A 1ZW2A 1RKCA 3WODF 2PX0A 3U0CA 1AUEA 1EKYA 2AWCA 4CJOA 3NYLA 2QLAA 1T6QA 1JMWA 2D4UA 2KNHA 3EFOB 3JSEO 2ETSA 5EHHA 3AJMA 3BRJA 1I4ZA 3N24A 4Z9IA 4DBQA 3HJCA 1A7VA 3M4BA 3R2PA 1V4AA 1MMAA 4U5CE 2X0CA 2XLHA 2CNWA 2GAQA 2R25A 2R7QA 2WVOA 3K1IA 1BR1A 4LLCA 1J8YF 4O6MA 3KKBA 4ULVA 2Q7RA 3HTKC 3ZQYA 3LS1A 3RVZA 4C3DA 5AC4A 1G4WR 2EILC 3DKAA 4CIPA 1GQAA 1FFTC 3RKOF 4B6IA 1E83A 3Q6MA 1JRAA 2CCYA 2DYRC 1XWJA 3M1CB 4MTFA 3U2MA 1PD0A 3LESA 3U3BA 2YL3A 3V7OA 4DOZA 4OD4A 4JEAA 2GA0A 1YA9A 2YZSA 3DWWA 2IBFA 2YL7A 4Q5SF 3UNGC 2YLDA 5L0DA 4FWVA 2B0HA 2J7PA 2JPUA 3C8GA 2CDQA 4XEFA 3S9OA 3ASNC 5L3QA 2R7RA 1Z7Qc 1HW2A 1AVOB 1EQ1A 2H7VC 3TJ6A 1EI7A 3DE8A 2G62A 3L1MA 4Z9HA 2X51A 2Y3HA 4NQFA 2J9BA 4JE9A 3QW1A 3EGDB 3K1HA 4MNDA 1M2VB 3C7JA 3G4XA 5DLJA 1T6UA 4ER9A 4AE4A 1KTMA 3QVYA 2PP4A 4DXWA 1B68A 2HSQA 3GANA 3SXYA 3R7CA 1VOMA 4WJ0A 3UMIA 4JJFA 1RCPA 1QZXA 2G3KA 4JC7A 1HY5A 3U9MA 4A4AA 4EIYA 1WTYA 4DBRA 4CSAC 2LK4A 3PHF2 5T1DB 4YWQA 1RKEB 2ASRA 3TOMA 3JYHA 3M79A 1QSPA 4J30B 4JEBA 4YT8A 2XXAA 1OKKD 4EKWA 4JZAA 4MVQA 4WGZA 5KYYB 3S90A 4BG0A 1LS1A 2EPOA 1WASA 4LLEA 5E2QA 3FHDA 2WZFA 2Y3DA 4UDVA 2JD3A 5A6BD 3AQCA 1KNYA 1IZMA 4OIOF 1HE1A 3DD7A 4BJ6A 3UMHA 3FAPB 2XL6A 3JYYA 1PCXA 3ZIBA 2R7WA 1HMDA 2TMVP 2VCBA 5DS6A 3EFOA 1Y4CA 1ZHWA 3AQBA 2DYSC 2GFHA 3ZWIA 3U3FA 1WGWA 2GDCA 4LACB 1YZCA 4YL0A 256BA 4NCQA 4XEKA 5COFA 1R5ID 1MMDA 1LE2A 5CI8A 1VTMP 4P9TA 5KYXB 3K1IC 3TJ5A 4FAPB 3NMIA 4FESA 2QNLA 2PF4E 4XLPF 3GWNA 4U9DA 2XLVA 1H6GA 4C3BA 1TFOB 1VK5A 4MW3A 1KU2A 3GEEA 3AG1C 3UMKA 2Q9AA 5GPGB 1AEPA 2CYDA 2VCAA 1TWHA 3NG1A 1U0BB 3F47A 3NRHA 1ZHTA 2A6EF 3AGUA 4CDYA 2KC3A 3DM9B 3W8HA 2CGEA 2DGJA 1VYKA 2J9WA 2J9UA 4ONSA 4JRZA 2L9JA 2J0WA 1K04A 4IARA 2EIJC 2P1AA 2KK1A 1SF8A 4ULWA 5F28E 4QI2A 3VM6A 2HV7A 1C02A 1HE9A 5B3IA 1JPJA 2XS1A 3ABKC 4XEVA 3EGDA 4YT5A 4HFKB 1M2VA 3KYJA 4JW1A 4XTKA 3RYLA 3SYNA 1WOLA 4CDAA 2VB6A 2PBEA 1N1CA 1GS9A 2Q3TA 3EZIA 3FMSA 1TWAA 3NMJA 4YT2A 2HJ3A 4CS7A 1T01A 3RQEA 3LEVA 1JAFA 2MHRA 1V55C 3O10A 4WGYA 2H7BA 2F22A 1TWGA 5T3WA 3DXJF 3GWLA 5FZTA 3ZTMA 3KMIA 3JRMO 4JTDB 3RF3A 4BJTA 2W45A 3AG4C 1NFOA 3DAFA 1NBBA 1O87A 2NG1A 3NYMA 3K6BA 4E18A 3SXKA 5L0IA 3W2VA 5IY5C 1W2WA 2I8BA 2VASA 1NG1A 3QZCA 2WZGA 4OD5A 5L3VA 3VAYA 1SZIA 1F1MA 1OXBA 2BE5F 3CAXA 1BR2A 4BJ6C 1D1CA 1FMVA 1WN0A 4GYTA 4O79A 2R7SA 4CS9A 2I15A 1CPRA 2YQYA 3FOPA 4GQHA 3QVZA 4YL1A 4CJGA 4U5DE 1YDIA 3IEEA 1BBHA 4O6YA 1RJ9B 4P6IC 3VRCA 3GORA 1OCRC 2Y39A 3OWTA 2NUPB 3PMRA 4HFFB 1JR8A 4JCHA 3UGOA 4ZLDA 1G5ZA 1SYQA 5DQZA 3TOLA 5KYXA 4I44A 4BJ1A 3B71A 4PJMA 4AK9A 4YN0B 1YVIA 4N06A 2CNWD 3T9OA 4E7SA 5EGYA 2HJMA 5EK0A 5AGFA 4NY3A 1YARO 3ASOC 5CIVA 2Q00A 2OEXA 3EHNA 1T9KA 3C62A 2HS5A 4MW8A 3HNLA 2MYSA 3RFYA 3LNMB 1JOGA 3LUTB 1A7DA 2YKZA 1OW6A 2BC5A 4MTGA 3T6BA 5KYUB 4G7HF 5BQGA 2YLIA 1OW7A 4NTBA 4CBEA 5HV9A 4K7BA 4Q7CA 4U5HA 4DRIB 4OINF 2DB4A 2OOCA 4NTFA 1Q0GA 4JTCB 4EBBA 1OR3A 2J7PD 1YJGA 3EH2A 3C8GD 1Q0MA 4K1OA 4D4NA 1DOVA 1H7IA 4O7GA 3U5SA 1OW8A 2P0NA 3SP1A 2XLWA 1ORYA 3IQTA 3Q6NA 1D1AA 2J8WA 2HUJA 1OR2A 2O9XA 4U9EA 2PNOA 5E3CA 4CS8A 1M2OA 2YVKA 1QQ3A 3B0UX 5KYUA 2P7VA 1PD1A 3C63A 3V5YA 1NLXA 3AGTA 3MBGA 2L7AA 5L0FA 1D0YA 2QUPA 2LSEA 2V3CC 3S27A 1V74B 4BPMA 2R7UA 5COMA 1YYXA 1ORSC 3TK0A 3L8IA 2PFDA 1I5NA 3TD7A 2XS8A 5D91A 3LJBA 4YK5A 3N0TA 4YL3A 5AC5A 1NSGB 2Q4FA 1D0XA 4MVMA 2ZD9A 3I5PA 1RXQA 2EPLX 3E70C 4H54A 2JX0A 3DJNB 4EUKB 5L0CA 1LIHA 2EIMC 3SNHA 1XZPA 5KYWB 4CS9C 5DS4A 1H9TA 1VLTA 3U8VA 2Y69C 2ZXWC 4IJJA 3RQFA 4ANJA 3ZQVA 1RJ9A 4C3EA 3B0VC 4IAQA 1LI5A 4BEJA 2NUPA 3FVYA 2L6FA 1E2XA 1LVKA 1FFHA 2W4MA 4MVSA 1OXKA 4AL1A 2KSFA 4QI0A 2YLGA 3MYIA 2A0BA 5F5HA 3EGXB 3HKKA 4U5EE 3N2ZB 1EA8A 3W8IA 3NDBB 4LDRA 3O39A 3QTHA 3LEOA 3H2UA 1VMAA 3QMKA 2L6HA 1JPNA 3MLGA 2DI3A 3JSZA 3NYJA 5CI9A 4AX2A 3KPHA 2HMZA 2IXNA 1BDJB 4KBLA 3LS0A 3H2VA
chains in the Genus database with same CATH topology
3EJNA 2R7XA 1OCCC 2EIKC 5HSWA 4LERA 3EZHA 3ZC4A 1OCOC 3KL4A 4G7ZF 4HEAJ 3H65A 1ZHYA 2M4EA 3EPVA 4PJNA 4CS8C 2WVQA 2ZXRA 4KNVA 1Z6AA 1Z23A 4PFPA 2Y3BA 4RBNA 4X0RA 3WG7C 3X2QC 1IW7F 3S0XA 4I3MA 3VYWA 2WVNA 2B0JA 5KYWA 4IRUA 1TWCA 2A69F 2IXPA 1J8MF 3CZ6A 4GEHA 3AG2C 2OG2A 4U5GA 2A1DD 1VYIA 4G7OF 2ZPAA 3AG3C 1NZEA 3EHMA 1V54C 3X1OA 4M63A 4XWJA 4PK4A 3EGXA 1TKNA 4PJLA 2EINC 5DS5A 2J0XA 2WL8A 4YJWA 2P6VA 5DQTA 3LNRA 5E3AA 3DMDA 3I4UA 2IXMA 1BR4A 2OCCC 3RIPA 1MMNA 3L34A 3I5QA 1M56C 4K0DA 2J46A 2A6HF 3ABLC 3Q7LA 3DM5A 4JJGA 4U5FE 1SMYF 5D92A 2VH3A 1ZU4A 1ZU5A 2KGOA 5T3TA 1NU9C 3LAYA 4HE8D 2HV6A 3RH3A 4C7OA 4XLNF 1Z5ZA 2V26A 4PFOA 2IXOA 3DJUB 4RDAA 2FFHA 2E87A 3K7DA 1D0ZA 2A68F 4I1OB 4IAOA 1ZHZA 1D1BA 3Q7GA 4FX5A 3GODA 4RD9A 2YEVA 2FGYA 1FMWA 1QLEC 1ZHXA 2IOQA 2MWQA 3DZAA 4OIPF 4EWCA 2H7OA 3LLIA 3EG9B 3EQLF 3K66A 3ZVRA 1G8XA 2R7OA 3HLZA 2G3VA 3MX3A 2NUTB 2R7VA 1OKKA 3SEOA 2ZXPA 4JURI 2D5RB 1NU7D 3ZG1A 3T4RA 3B0PA 4BJ5A 3CSKA 4O6NA 1MMGA 3SZRA 2C03A 1LKXA 3KH2A 5KYNA 2J9VA 3S29A 5DVWA 3LLKA 2J45A 5B3SC 5F5FA 3NKDA 1O5HA 2XL4A 4W8KA 2R7TA 2KJGA 3JT1A 3O6XA 3ZSUA 4MQ9F 1S7ZA 4DVYP 3ECSA 1TR2A 3UGPA 3L0IA 4OIRF 3JCUQ 1MNDA 4QDLA 3S28A 4KI2A 4E7ZA 3E9VA 2YHSA 3EH1A 2WZLA 3JRTA 4C7OB 1OCZC 4I1MA 4F4BA 3FAJA 1FTSA 4G0HA 4H4KC 2Q9BA 2WB7A 4PJJA 1M57C 3F46A 3ITFA 3T6JA 2C04A 2Y3GA 3OEOA 2KQ9A 2QTVA 2Z15A 3EG9A 5E33A 4JVSA 2W4BA 2W9YA 2L81A 2PX3A 4AE4B 1Z3IX 4Q4ZF 4ZLCA 4CIHA 3K33A 3CQZA 2CW0F 4DVZA 2NUTA 3ABMC 2XSEA 5B1AC 5BUOA 3POVA 4CSAA 2KW3C 2XRHA 1ZYRF 3NKEA 4KC9A 5B1BC 4BJ5C 4YT4A 4KNWA 3DAGA 5KYYA 3FDQA 1ST6A 2QY9A 4A2NB 2XXAB 3UR3C 5FCLA 3OA1A 3B9QA 2IYLD 2ZXOA 2Q9CA 4OIQF 4U5BE 1MNEA 3W2WA 4J32B 1Z63A 3WODF 2PX0A 3NYLA 2KNHA 3EFOB 5EHHA 3N24A 4DBQA 3HJCA 4U5CE 1MMAA 2CNWA 2R7QA 2WVOA 4LLCA 1BR1A 1J8YF 4O6MA 3KKBA 3HTKC 3LS1A 4C3DA 2EILC 4B6IA 1FFTC 3RKOF 3Q6MA 2DYRC 3M1CB 1PD0A 3LESA 3V7OA 4DOZA 4OD4A 2YZSA 4Q5SF 3UNGC 4FWVA 2J7PA 2CDQA 5L3QA 3ASNC 2R7RA 2H7VC 2G62A 2X51A 2Y3HA 4MNDA 3EGDB 3K1HA 1M2VB 5DLJA 4AE4A 2PP4A 3GANA 1VOMA 4WJ0A 3UMIA 4JJFA 2G3KA 1QZXA 4DBRA 4CSAC 3PHF2 5T1DB 4YWQA 3JYHA 4J30B 4YT8A 2XXAA 1OKKD 4JZAA 5KYYB 4BG0A 1LS1A 4LLEA 5E2QA 3FHDA 2WZFA 2Y3DA 2JD3A 3AQCA 1IZMA 4OIOF 3DD7A 4BJ6A 3UMHA 3ZIBA 2R7WA 1PCXA 5DS6A 3EFOA 1ZHWA 3AQBA 2DYSC 2GFHA 1WGWA 4LACB 1MMDA 5CI8A 5KYXB 3K1IC 4FESA 4XLPF 2PF4E 4C3BA 1VK5A 1KU2A 3UMKA 3AG1C 2Q9AA 1TWHA 3NG1A 3F47A 3NRHA 1ZHTA 2A6EF 3DM9B 3W8HA 2CGEA 2DGJA 1VYKA 2J9WA 2J9UA 2L9JA 2J0WA 2EIJC 1SF8A 4ULWA 4QI2A 2HV7A 1JPJA 3ABKC 3RYLA 3EGDA 4YT5A 4HFKB 1M2VA 4JW1A 4XTKA 3SYNA 2VB6A 1N1CA 3EZIA 2Q3TA 1TWAA 4YT2A 4CS7A 3LEVA 1V55C 2H7BA 1TWGA 5T3WA 3DXJF 3KMIA 4BJTA 2W45A 3AG4C 3DAFA 1O87A 3NYMA 2NG1A 3K6BA 3W2VA 5IY5C 1W2WA 2I8BA 2VASA 1NG1A 3QZCA 2WZGA 4OD5A 5L3VA 3VAYA 1SZIA 2BE5F 1BR2A 4BJ6C 1D1CA 1FMVA 4GYTA 2R7SA 4O79A 4CS9A 4U5DE 3IEEA 4O6YA 1RJ9B 4P6IC 1OCRC 2Y39A 3OWTA 2NUPB 3PMRA 4HFFB 4JCHA 3UGOA 4ZLDA 5DQZA 5KYXA 4I44A 4BJ1A 4PJMA 4AK9A 4YN0B 4N06A 2CNWD 5EGYA 4E7SA 4NY3A 3ASOC 3EHNA 2MYSA 3RFYA 5KYUB 3T6BA 4G7HF 4CBEA 4K7BA 4Q7CA 4U5HA 4OINF 4EBBA 2J7PD 3EH2A 4O7GA 3SP1A 3Q6NA 1D1AA 2O9XA 5E3CA 4CS8A 1M2OA 3B0UX 5KYUA 2P7VA 1PD1A 1D0YA 2LSEA 2V3CC 3S27A 2R7UA 2PFDA 3TD7A 5D91A 3LJBA 3N0TA 1D0XA 3I5PA 3E70C 3DJNB 2EIMC 3SNHA 5KYWB 4CS9C 5DS4A 2Y69C 2ZXWC 4IJJA 4ANJA 4C3EA 3B0VC 1RJ9A 4BEJA 2NUPA 3FVYA 1LVKA 1FFHA 2W4MA 4QI0A 5F5HA 3EGXB 4U5EE 3W8IA 3N2ZB 3NDBB 3O39A 1VMAA 3QMKA 1JPNA 3MLGA 3JSZA 3NYJA 5CI9A 4AX2A 2IXNA 4IWBA 4KBLA 3LS0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5F5H A;  4QI2 A;  4ULW A;  3X1O A;  5F5F A;  4ZLD A;  4YWQ A;  4QI0 A;  4ZLC A; 
#chains in the Genus database with same CATH topology
 3U2L A;  2OU6 A;  3EJN A;  1S05 A;  1OCC C;  3TUL A;  2R7X A;  3KYI A;  1PV3 A;  1K40 A;  1QVX A;  2EIK C;  3J06 A;  3L8J A;  5HSW A;  4LER A;  3ZDL A;  2GWW A;  1LI7 A;  2NPU A;  3ATP A;  3EZH A;  3ZC4 A;  1OCO C;  3KL4 A;  1O3U A;  1E85 A;  2HFI A;  2AWY A;  3HNJ A;  2LD6 A;  4Z9J A;  1C17 M;  4MVZ A;  4G7Z F;  4HEA J;  2OKU A;  4WAB A;  1HMO A;  3H65 A;  2AVK A;  2QE9 A;  3BEH A;  1ZHY A;  2HZ8 A;  2M4E A;  3EPV A;  4PJN A;  2AP3 A;  4CS8 C;  2WVQ A;  4BEM J;  1L3P A;  2ZXR A;  3GM1 A;  4KNV A;  4JTA B;  4N6H A;  1Z6A A;  2LP4 A;  1Z23 A;  4PR9 A;  4PFP A;  2LIG A;  2Y3B A;  4MS2 A;  4NC3 A;  3A9C A;  4RBN A;  4X0R A;  5JUA A;  3WG7 C;  3X2Q C;  1A41 A;  1IW7 F;  3S0X A;  3PCV A;  4DRJ B;  1LM3 B;  4I3M A;  4XPY A;  2L6G A;  1CGN A;  4IGG A;  3VYW A;  2R02 A;  1TQG A;  2WVN A;  2HMQ A;  3C18 A;  2B0J A;  5KYW A;  4IRU A;  1TWC A;  2A69 F;  2XL8 A;  2IXP A;  1J8M F;  3CZ6 A;  4GEH A;  3AG2 C;  3RW0 A;  3HNI A;  3WHN A;  2OG2 A;  4U5G A;  2A1D D;  1VYI A;  4G7O F;  2ZPA A;  3AG3 C;  1CGM E;  1NZE A;  4E0I A;  2XLD A;  2ICW G;  3EHM A;  1V54 C;  3TQO A;  3V5Z A;  1R4T A;  3NMK A;  3X1O A;  4M63 A;  4XWJ A;  3GEI A;  4PK4 A;  3EGX A;  1YYJ A;  1VLS A;  1K05 A;  5L0J A;  1QPU A;  1TKN A;  1YA7 O;  4CDV A;  2YWA A;  4MVR A;  4PJL A;  2EIN C;  5DS5 A;  2J0X A;  2WL8 A;  4YJW A;  2P6V A;  5DQT A;  3LNR A;  5E3A A;  1Q0D A;  3DMD A;  3I4U A;  1HW1 A;  1DOW A;  2AU5 A;  2IXM A;  2LQG A;  3FXH A;  3JZ0 A;  1BR4 A;  2OCC C;  3RIP A;  2VCC A;  2A0U A;  1YZA A;  2NSG A;  5K0I A;  1MMN A;  3L34 A;  3I5Q A;  1QKR A;  1M56 C;  3U9J A;  1YAU O;  3RQG A;  3HNK A;  2OJE D;  4K0D A;  1U89 A;  1LS4 A;  4IB4 A;  2J46 A;  2A6H F;  2NSF A;  3ABL C;  3Q7L A;  3DM5 A;  1XZQ A;  3US6 A;  1CGO A;  1TFK B;  4JCZ A;  4JJG A;  5TJ5 E;  5A69 A;  4U5F E;  2IM8 A;  1OQC A;  2HKV A;  1SMY F;  1FNT c;  5D92 A;  2VH3 A;  4JKV A;  4MVU A;  1ZU4 A;  1ZU5 A;  2KGO A;  3GEH A;  3M4C A;  1I4Y A;  1FAP B;  1NU9 C;  5T3T A;  3LAY A;  4HE8 D;  2HV6 A;  3RH3 A;  4C7O A;  4XLN F;  2XLO A;  3S84 A;  1Z5Z A;  5COG A;  2V26 A;  4PFO A;  3RVY A;  2IXO A;  4EBK A;  3DJU B;  4RDA A;  1WWP A;  2YL0 A;  3MYF A;  4N4W A;  3M15 A;  1G4U S;  2FFH A;  2E87 A;  5JP7 A;  3WAQ A;  3GM3 A;  3K7D A;  3PDM P;  1D0Z A;  2A68 F;  4I1O B;  4IAO A;  1ZHZ A;  2M64 A;  1D1B A;  3Q7G A;  2EPN A;  2VC9 A;  5BQI A;  4FX5 A;  3GOD A;  3IQ5 A;  2R03 A;  4RD9 A;  2YEV A;  2FGY A;  1U6H A;  1FMW A;  1QLE C;  1VB5 A;  1LE4 A;  1M6T A;  1ZHX A;  5JRA A;  1ORJ A;  1GGQ A;  2IOQ A;  5JS5 A;  5JVE A;  3O55 A;  2MWQ A;  3DZA A;  4OIP F;  4DJ9 A;  4MVO A;  3FOO A;  1NFN A;  2XLM A;  2H7O A;  3LLI A;  4EWC A;  5L0H A;  3EG9 B;  3EQL F;  1Q0K A;  3K66 A;  3ZVR A;  3A11 A;  4XQ1 A;  1G8X A;  3U8P A;  2R7O A;  2EPK X;  3HLZ A;  4NTA A;  2G3V A;  3MX3 A;  2NUT B;  2R7V A;  3ZTZ A;  3SXM A;  4DRH B;  1OKK A;  3SEO A;  2ZXP A;  4J7Y A;  2D5R B;  1NU7 D;  4JUR I;  3T4R A;  3B0P A;  3ZG1 A;  3CSK A;  4O6N A;  1MMG A;  3SZR A;  4BJ5 A;  2C03 A;  1LKX A;  3JTL O;  3KH2 A;  1UFB A;  2J9V A;  3S29 A;  5KYN A;  3B29 A;  4CX9 A;  1SR2 A;  5DVW A;  3LLK A;  4W8P A;  2LFF A;  2J45 A;  3IQ6 A;  4EBJ A;  5A6B A;  5JLI A;  5B3S C;  5F5F A;  3NKD A;  2LFD A;  1FR0 A;  3VF0 A;  1YLM A;  1ZW3 A;  1O5H A;  5A6J A;  2XL4 A;  4E0H A;  3DE9 A;  4W8K A;  5JT4 A;  2R7T A;  1UG7 A;  3QW0 A;  4LDK A;  2KJG A;  3JT1 A;  3O6X A;  3W4Y A;  3ZSU A;  4R32 A;  1Y6D A;  4MQ9 F;  4AL0 A;  1S7Z A;  4XPX A;  4DVY P;  3ECS A;  1T5O A;  2FAP B;  2OEV A;  1TR2 A;  3GM2 A;  2UUH A;  3UGP A;  3L0I A;  5A6K A;  1A0B A;  3JCU Q;  1MND A;  2H8A A;  4QDL A;  4OIR F;  3S28 A;  1GM5 A;  5A6A A;  2RSE B;  1MQV A;  4E7Z A;  4KI2 A;  3E9V A;  2YHS A;  3EH1 A;  1A7E A;  2WZL A;  3DI5 A;  3JRT A;  4C7O B;  4J7T A;  2YRF A;  4IWB A;  1OCZ C;  2RD9 A;  1CPQ A;  4I1M A;  2YL1 A;  4JIO A;  4XPW A;  1E86 A;  2P61 A;  3FAJ A;  4F4B A;  1RMV A;  4PAC A;  1FTS A;  2HSB A;  1H9G A;  5L0G A;  4G0H A;  2OJQ A;  2EPM X;  2XLE A;  1ZVZ A;  1BZ4 A;  1T6I A;  2Q9B A;  4H4K C;  3C8Z A;  2R05 A;  2WB7 A;  4PJJ A;  1M57 C;  4N6C A;  3F46 A;  3C8G B;  3ITF A;  4EHP A;  2LCH A;  5BQH A;  3MFN A;  3T6J A;  2C04 A;  2XM4 A;  2Y3G A;  3OEO A;  2KYH A;  2KQ9 A;  3IPM O;  2QTV A;  2Z15 A;  1APC A;  1C03 A;  3EG9 A;  4LDQ A;  5E33 A;  5JSL A;  4JVS A;  2W4B A;  3T6G B;  2W9Y A;  4G78 A;  2L81 A;  3CEX A;  2PX3 A;  4AE4 B;  1Z3I X;  2R9R B;  4ZLC A;  4Q4Z F;  2OQM A;  1ZZP A;  4CIH A;  3K33 A;  1RKE A;  3CQZ A;  3G50 A;  1Q0F A;  2CW0 F;  3IHU A;  3IQC A;  4DVZ A;  2NUT A;  3ABM C;  2XSE A;  1L7C A;  4L6R A;  5B1A C;  3SXZ A;  5BUO A;  1WAT A;  3POV A;  1E84 A;  4CSA A;  4P9F A;  2KW3 C;  2XRH A;  1ZYR F;  3NKE A;  2XM0 A;  4KC9 A;  5B1B C;  4BJ5 C;  4KNW A;  3DAG A;  4YT4 A;  5KYY A;  1ST6 A;  2QY9 A;  4A2N B;  4D4X A;  3FDQ A;  3UR3 C;  5FCL A;  3OA1 A;  2XXA B;  2BL2 A;  3G4Z A;  3B9Q A;  3AOU A;  2IYL D;  3V5X A;  2ZXO A;  2Q9C A;  4E17 A;  4MTO A;  4OIQ F;  2UUI A;  4U5B E;  1LPE A;  1MNE A;  3W2W A;  4J32 B;  1Z63 A;  1ZW2 A;  1RKC A;  3WOD F;  2PX0 A;  3U0C A;  1AUE A;  1EKY A;  2AWC A;  4CJO A;  3NYL A;  2QLA A;  1T6Q A;  1JMW A;  2D4U A;  2KNH A;  3EFO B;  3JSE O;  2ETS A;  5EHH A;  3AJM A;  3BRJ A;  1I4Z A;  3N24 A;  4Z9I A;  4DBQ A;  3HJC A;  1A7V A;  3M4B A;  3R2P A;  1V4A A;  1MMA A;  4U5C E;  2X0C A;  2XLH A;  2CNW A;  2GAQ A;  2R25 A;  2R7Q A;  2WVO A;  3K1I A;  1BR1 A;  4LLC A;  1J8Y F;  4O6M A;  3KKB A;  4ULV A;  2Q7R A;  3HTK C;  3ZQY A;  3LS1 A;  3RVZ A;  4C3D A;  5AC4 A;  1G4W R;  2EIL C;  3DKA A;  4CIP A;  1GQA A;  1FFT C;  3RKO F;  4B6I A;  1E83 A;  3Q6M A;  1JRA A;  2CCY A;  2DYR C;  1XWJ A;  3M1C B;  4MTF A;  3U2M A;  1PD0 A;  3LES A;  3U3B A;  2YL3 A;  3V7O A;  4DOZ A;  4OD4 A;  4JEA A;  2GA0 A;  1YA9 A;  2YZS A;  3DWW A;  2IBF A;  2YL7 A;  4Q5S F;  3UNG C;  2YLD A;  5L0D A;  4FWV A;  2B0H A;  2J7P A;  2JPU A;  3C8G A;  2CDQ A;  4XEF A;  3S9O A;  3ASN C;  5L3Q A;  2R7R A;  1Z7Q c;  1HW2 A;  1AVO B;  1EQ1 A;  2H7V C;  3TJ6 A;  1EI7 A;  3DE8 A;  2G62 A;  3L1M A;  4Z9H A;  2X51 A;  2Y3H A;  4NQF A;  2J9B A;  4JE9 A;  3QW1 A;  3EGD B;  3K1H A;  4MND A;  1M2V B;  3C7J A;  3G4X A;  5DLJ A;  1T6U A;  4ER9 A;  4AE4 A;  1KTM A;  3QVY A;  2PP4 A;  4DXW A;  1B68 A;  2HSQ A;  3GAN A;  3SXY A;  3R7C A;  1VOM A;  4WJ0 A;  3UMI A;  4JJF A;  1RCP A;  1QZX A;  2G3K A;  4JC7 A;  1HY5 A;  3U9M A;  4A4A A;  4EIY A;  1WTY A;  4DBR A;  4CSA C;  2LK4 A;  3PHF 2;  5T1D B;  4YWQ A;  1RKE B;  2ASR A;  3TOM A;  3JYH A;  3M79 A;  1QSP A;  4J30 B;  4JEB A;  4YT8 A;  2XXA A;  1OKK D;  4EKW A;  4JZA A;  4MVQ A;  4WGZ A;  5KYY B;  3S90 A;  4BG0 A;  1LS1 A;  2EPO A;  1WAS A;  4LLE A;  5E2Q A;  3FHD A;  2WZF A;  2Y3D A;  4UDV A;  2JD3 A;  5A6B D;  3AQC A;  1KNY A;  1IZM A;  4OIO F;  1HE1 A;  3DD7 A;  4BJ6 A;  3UMH A;  3FAP B;  2XL6 A;  3JYY A;  1PCX A;  3ZIB A;  2R7W A;  1HMD A;  2TMV P;  2VCB A;  5DS6 A;  3EFO A;  1Y4C A;  1ZHW A;  3AQB A;  2DYS C;  2GFH A;  3ZWI A;  3U3F A;  1WGW A;  2GDC A;  4LAC B;  1YZC A;  4YL0 A;  256B A;  4NCQ A;  4XEK A;  5COF A;  1R5I D;  1MMD A;  1LE2 A;  5CI8 A;  1VTM P;  4P9T A;  5KYX B;  3K1I C;  3TJ5 A;  4FAP B;  3NMI A;  4FES A;  2QNL A;  2PF4 E;  4XLP F;  3GWN A;  4U9D A;  2XLV A;  1H6G A;  4C3B A;  1TFO B;  1VK5 A;  4MW3 A;  1KU2 A;  3GEE A;  3AG1 C;  3UMK A;  2Q9A A;  5GPG B;  1AEP A;  2CYD A;  2VCA A;  1TWH A;  3NG1 A;  1U0B B;  3F47 A;  3NRH A;  1ZHT A;  2A6E F;  3AGU A;  4CDY A;  2KC3 A;  3DM9 B;  3W8H A;  2CGE A;  2DGJ A;  1VYK A;  2J9W A;  2J9U A;  4ONS A;  4JRZ A;  2L9J A;  2J0W A;  1K04 A;  4IAR A;  2EIJ C;  2P1A A;  2KK1 A;  1SF8 A;  4ULW A;  5F28 E;  4QI2 A;  3VM6 A;  2HV7 A;  1C02 A;  1HE9 A;  5B3I A;  1JPJ A;  2XS1 A;  3ABK C;  4XEV A;  3EGD A;  4YT5 A;  4HFK B;  1M2V A;  3KYJ A;  4JW1 A;  4XTK A;  3RYL A;  3SYN A;  1WOL A;  4CDA A;  2VB6 A;  2PBE A;  1N1C A;  1GS9 A;  2Q3T A;  3EZI A;  3FMS A;  1TWA A;  3NMJ A;  4YT2 A;  2HJ3 A;  4CS7 A;  1T01 A;  3RQE A;  3LEV A;  1JAF A;  2MHR A;  1V55 C;  3O10 A;  4WGY A;  2H7B A;  2F22 A;  1TWG A;  5T3W A;  3DXJ F;  3GWL A;  5FZT A;  3ZTM A;  3KMI A;  3JRM O;  4JTD B;  3RF3 A;  4BJT A;  2W45 A;  3AG4 C;  1NFO A;  3DAF A;  1NBB A;  1O87 A;  2NG1 A;  3NYM A;  3K6B A;  4E18 A;  3SXK A;  5L0I A;  3W2V A;  5IY5 C;  1W2W A;  2I8B A;  2VAS A;  1NG1 A;  3QZC A;  2WZG A;  4OD5 A;  5L3V A;  3VAY A;  1SZI A;  1F1M A;  1OXB A;  2BE5 F;  3CAX A;  1BR2 A;  4BJ6 C;  1D1C A;  1FMV A;  1WN0 A;  4GYT A;  4O79 A;  2R7S A;  4CS9 A;  2I15 A;  1CPR A;  2YQY A;  3FOP A;  4GQH A;  3QVZ A;  4YL1 A;  4CJG A;  4U5D E;  1YDI A;  3IEE A;  1BBH A;  4O6Y A;  1RJ9 B;  4P6I C;  3VRC A;  3GOR A;  1OCR C;  2Y39 A;  3OWT A;  2NUP B;  3PMR A;  4HFF B;  1JR8 A;  4JCH A;  3UGO A;  4ZLD A;  1G5Z A;  1SYQ A;  5DQZ A;  3TOL A;  5KYX A;  4I44 A;  4BJ1 A;  3B71 A;  4PJM A;  4AK9 A;  4YN0 B;  1YVI A;  4N06 A;  2CNW D;  3T9O A;  4E7S A;  5EGY A;  2HJM A;  5EK0 A;  5AGF A;  4NY3 A;  1YAR O;  3ASO C;  5CIV A;  2Q00 A;  2OEX A;  3EHN A;  1T9K A;  3C62 A;  2HS5 A;  4MW8 A;  3HNL A;  2MYS A;  3RFY A;  3LNM B;  1JOG A;  3LUT B;  1A7D A;  2YKZ A;  1OW6 A;  2BC5 A;  4MTG A;  3T6B A;  5KYU B;  4G7H F;  5BQG A;  2YLI A;  1OW7 A;  4NTB A;  4CBE A;  5HV9 A;  4K7B A;  4Q7C A;  4U5H A;  4DRI B;  4OIN F;  2DB4 A;  2OOC A;  4NTF A;  1Q0G A;  4JTC B;  4EBB A;  1OR3 A;  2J7P D;  1YJG A;  3EH2 A;  3C8G D;  1Q0M A;  4K1O A;  4D4N A;  1DOV A;  1H7I A;  4O7G A;  3U5S A;  1OW8 A;  2P0N A;  3SP1 A;  2XLW A;  1ORY A;  3IQT A;  3Q6N A;  1D1A A;  2J8W A;  2HUJ A;  1OR2 A;  2O9X A;  4U9E A;  2PNO A;  5E3C A;  4CS8 A;  1M2O A;  2YVK A;  1QQ3 A;  3B0U X;  5KYU A;  2P7V A;  1PD1 A;  3C63 A;  3V5Y A;  1NLX A;  3AGT A;  3MBG A;  2L7A A;  5L0F A;  1D0Y A;  2QUP A;  2LSE A;  2V3C C;  3S27 A;  1V74 B;  4BPM A;  2R7U A;  5COM A;  1YYX A;  1ORS C;  3TK0 A;  3L8I A;  2PFD A;  1I5N A;  3TD7 A;  2XS8 A;  5D91 A;  3LJB A;  4YK5 A;  3N0T A;  4YL3 A;  5AC5 A;  1NSG B;  2Q4F A;  1D0X A;  4MVM A;  2ZD9 A;  3I5P A;  1RXQ A;  2EPL X;  3E70 C;  4H54 A;  2JX0 A;  3DJN B;  4EUK B;  5L0C A;  1LIH A;  2EIM C;  3SNH A;  1XZP A;  5KYW B;  4CS9 C;  5DS4 A;  1H9T A;  1VLT A;  3U8V A;  2Y69 C;  2ZXW C;  4IJJ A;  3RQF A;  4ANJ A;  3ZQV A;  1RJ9 A;  4C3E A;  3B0V C;  4IAQ A;  1LI5 A;  4BEJ A;  2NUP A;  3FVY A;  2L6F A;  1E2X A;  1LVK A;  1FFH A;  2W4M A;  4MVS A;  1OXK A;  4AL1 A;  2KSF A;  4QI0 A;  2YLG A;  3MYI A;  2A0B A;  5F5H A;  3EGX B;  3HKK A;  4U5E E;  3N2Z B;  1EA8 A;  3W8I A;  3NDB B;  4LDR A;  3O39 A;  3QTH A;  3LEO A;  3H2U A;  1VMA A;  3QMK A;  2L6H A;  1JPN A;  3MLG A;  2DI3 A;  3JSZ A;  3NYJ A;  5CI9 A;  4AX2 A;  3KPH A;  2HMZ A;  2IXN A;  1BDJ B;  4KBL A;  3LS0 A;  3H2V A; 
#chains in the Genus database with same CATH homology
 3EJN A;  2R7X A;  1OCC C;  2EIK C;  5HSW A;  4LER A;  3EZH A;  3ZC4 A;  1OCO C;  3KL4 A;  4G7Z F;  4HEA J;  3H65 A;  1ZHY A;  2M4E A;  3EPV A;  4PJN A;  4CS8 C;  2WVQ A;  2ZXR A;  4KNV A;  1Z6A A;  1Z23 A;  4PFP A;  2Y3B A;  4RBN A;  4X0R A;  3WG7 C;  3X2Q C;  1IW7 F;  3S0X A;  4I3M A;  3VYW A;  2WVN A;  2B0J A;  5KYW A;  4IRU A;  1TWC A;  2A69 F;  2IXP A;  1J8M F;  3CZ6 A;  4GEH A;  3AG2 C;  2OG2 A;  4U5G A;  2A1D D;  1VYI A;  4G7O F;  2ZPA A;  3AG3 C;  1NZE A;  3EHM A;  1V54 C;  3X1O A;  4M63 A;  4XWJ A;  4PK4 A;  3EGX A;  1TKN A;  4PJL A;  2EIN C;  5DS5 A;  2J0X A;  2WL8 A;  4YJW A;  2P6V A;  5DQT A;  3LNR A;  5E3A A;  3DMD A;  3I4U A;  2IXM A;  1BR4 A;  2OCC C;  3RIP A;  1MMN A;  3L34 A;  3I5Q A;  1M56 C;  4K0D A;  2J46 A;  2A6H F;  3ABL C;  3Q7L A;  3DM5 A;  4JJG A;  4U5F E;  1SMY F;  5D92 A;  2VH3 A;  1ZU4 A;  1ZU5 A;  2KGO A;  5T3T A;  1NU9 C;  3LAY A;  4HE8 D;  2HV6 A;  3RH3 A;  4C7O A;  4XLN F;  1Z5Z A;  2V26 A;  4PFO A;  2IXO A;  3DJU B;  4RDA A;  2FFH A;  2E87 A;  3K7D A;  1D0Z A;  2A68 F;  4I1O B;  4IAO A;  1ZHZ A;  1D1B A;  3Q7G A;  4FX5 A;  3GOD A;  4RD9 A;  2YEV A;  2FGY A;  1FMW A;  1QLE C;  1ZHX A;  2IOQ A;  2MWQ A;  3DZA A;  4OIP F;  4EWC A;  2H7O A;  3LLI A;  3EG9 B;  3EQL F;  3K66 A;  3ZVR A;  1G8X A;  2R7O A;  3HLZ A;  2G3V A;  3MX3 A;  2NUT B;  2R7V A;  1OKK A;  3SEO A;  2ZXP A;  4JUR I;  2D5R B;  1NU7 D;  3ZG1 A;  3T4R A;  3B0P A;  4BJ5 A;  3CSK A;  4O6N A;  1MMG A;  3SZR A;  2C03 A;  1LKX A;  3KH2 A;  5KYN A;  2J9V A;  3S29 A;  5DVW A;  3LLK A;  2J45 A;  5B3S C;  5F5F A;  3NKD A;  1O5H A;  2XL4 A;  4W8K A;  2R7T A;  2KJG A;  3JT1 A;  3O6X A;  3ZSU A;  4MQ9 F;  1S7Z A;  4DVY P;  3ECS A;  1TR2 A;  3UGP A;  3L0I A;  4OIR F;  3JCU Q;  1MND A;  4QDL A;  3S28 A;  4KI2 A;  4E7Z A;  3E9V A;  2YHS A;  3EH1 A;  2WZL A;  3JRT A;  4C7O B;  1OCZ C;  4I1M A;  4F4B A;  3FAJ A;  1FTS A;  4G0H A;  4H4K C;  2Q9B A;  2WB7 A;  4PJJ A;  1M57 C;  3F46 A;  3ITF A;  3T6J A;  2C04 A;  2Y3G A;  3OEO A;  2KQ9 A;  2QTV A;  2Z15 A;  3EG9 A;  5E33 A;  4JVS A;  2W4B A;  2W9Y A;  2L81 A;  2PX3 A;  4AE4 B;  1Z3I X;  4Q4Z F;  4ZLC A;  4CIH A;  3K33 A;  3CQZ A;  2CW0 F;  4DVZ A;  2NUT A;  3ABM C;  2XSE A;  5B1A C;  5BUO A;  3POV A;  4CSA A;  2KW3 C;  2XRH A;  1ZYR F;  3NKE A;  4KC9 A;  5B1B C;  4BJ5 C;  4YT4 A;  4KNW A;  3DAG A;  5KYY A;  3FDQ A;  1ST6 A;  2QY9 A;  4A2N B;  2XXA B;  3UR3 C;  5FCL A;  3OA1 A;  3B9Q A;  2IYL D;  2ZXO A;  2Q9C A;  4OIQ F;  4U5B E;  1MNE A;  3W2W A;  4J32 B;  1Z63 A;  3WOD F;  2PX0 A;  3NYL A;  2KNH A;  3EFO B;  5EHH A;  3N24 A;  4DBQ A;  3HJC A;  4U5C E;  1MMA A;  2CNW A;  2R7Q A;  2WVO A;  4LLC A;  1BR1 A;  1J8Y F;  4O6M A;  3KKB A;  3HTK C;  3LS1 A;  4C3D A;  2EIL C;  4B6I A;  1FFT C;  3RKO F;  3Q6M A;  2DYR C;  3M1C B;  1PD0 A;  3LES A;  3V7O A;  4DOZ A;  4OD4 A;  2YZS A;  4Q5S F;  3UNG C;  4FWV A;  2J7P A;  2CDQ A;  5L3Q A;  3ASN C;  2R7R A;  2H7V C;  2G62 A;  2X51 A;  2Y3H A;  4MND A;  3EGD B;  3K1H A;  1M2V B;  5DLJ A;  4AE4 A;  2PP4 A;  3GAN A;  1VOM A;  4WJ0 A;  3UMI A;  4JJF A;  2G3K A;  1QZX A;  4DBR A;  4CSA C;  3PHF 2;  5T1D B;  4YWQ A;  3JYH A;  4J30 B;  4YT8 A;  2XXA A;  1OKK D;  4JZA A;  5KYY B;  4BG0 A;  1LS1 A;  4LLE A;  5E2Q A;  3FHD A;  2WZF A;  2Y3D A;  2JD3 A;  3AQC A;  1IZM A;  4OIO F;  3DD7 A;  4BJ6 A;  3UMH A;  3ZIB A;  2R7W A;  1PCX A;  5DS6 A;  3EFO A;  1ZHW A;  3AQB A;  2DYS C;  2GFH A;  1WGW A;  4LAC B;  1MMD A;  5CI8 A;  5KYX B;  3K1I C;  4FES A;  4XLP F;  2PF4 E;  4C3B A;  1VK5 A;  1KU2 A;  3UMK A;  3AG1 C;  2Q9A A;  1TWH A;  3NG1 A;  3F47 A;  3NRH A;  1ZHT A;  2A6E F;  3DM9 B;  3W8H A;  2CGE A;  2DGJ A;  1VYK A;  2J9W A;  2J9U A;  2L9J A;  2J0W A;  2EIJ C;  1SF8 A;  4ULW A;  4QI2 A;  2HV7 A;  1JPJ A;  3ABK C;  3RYL A;  3EGD A;  4YT5 A;  4HFK B;  1M2V A;  4JW1 A;  4XTK A;  3SYN A;  2VB6 A;  1N1C A;  3EZI A;  2Q3T A;  1TWA A;  4YT2 A;  4CS7 A;  3LEV A;  1V55 C;  2H7B A;  1TWG A;  5T3W A;  3DXJ F;  3KMI A;  4BJT A;  2W45 A;  3AG4 C;  3DAF A;  1O87 A;  3NYM A;  2NG1 A;  3K6B A;  3W2V A;  5IY5 C;  1W2W A;  2I8B A;  2VAS A;  1NG1 A;  3QZC A;  2WZG A;  4OD5 A;  5L3V A;  3VAY A;  1SZI A;  2BE5 F;  1BR2 A;  4BJ6 C;  1D1C A;  1FMV A;  4GYT A;  2R7S A;  4O79 A;  4CS9 A;  4U5D E;  3IEE A;  4O6Y A;  1RJ9 B;  4P6I C;  1OCR C;  2Y39 A;  3OWT A;  2NUP B;  3PMR A;  4HFF B;  4JCH A;  3UGO A;  4ZLD A;  5DQZ A;  5KYX A;  4I44 A;  4BJ1 A;  4PJM A;  4AK9 A;  4YN0 B;  4N06 A;  2CNW D;  5EGY A;  4E7S A;  4NY3 A;  3ASO C;  3EHN A;  2MYS A;  3RFY A;  5KYU B;  3T6B A;  4G7H F;  4CBE A;  4K7B A;  4Q7C A;  4U5H A;  4OIN F;  4EBB A;  2J7P D;  3EH2 A;  4O7G A;  3SP1 A;  3Q6N A;  1D1A A;  2O9X A;  5E3C A;  4CS8 A;  1M2O A;  3B0U X;  5KYU A;  2P7V A;  1PD1 A;  1D0Y A;  2LSE A;  2V3C C;  3S27 A;  2R7U A;  2PFD A;  3TD7 A;  5D91 A;  3LJB A;  3N0T A;  1D0X A;  3I5P A;  3E70 C;  3DJN B;  2EIM C;  3SNH A;  5KYW B;  4CS9 C;  5DS4 A;  2Y69 C;  2ZXW C;  4IJJ A;  4ANJ A;  4C3E A;  3B0V C;  1RJ9 A;  4BEJ A;  2NUP A;  3FVY A;  1LVK A;  1FFH A;  2W4M A;  4QI0 A;  5F5H A;  3EGX B;  4U5E E;  3W8I A;  3N2Z B;  3NDB B;  3O39 A;  1VMA A;  3QMK A;  1JPN A;  3MLG A;  3JSZ A;  3NYJ A;  5CI9 A;  4AX2 A;  2IXN A;  4IWB A;  4KBL A;  3LS0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...