4QI0A

X-ray structure of the roq domain from murine roquin-1
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
153
structure length
153
Chain Sequence
QNPQQLSSNLWAAVRARGCQFLGPAMQEEALKLVLLALEDGSALSRKVLVLFVVQRLEPRFPQASKTSIGHVVQLLYRASCFKVTKRDEDSSLMQLKEEFRTYEALRREHDSQIVQIAMEAGLRIAPDQWSSLLYGDQSHKSHMQSIIDKLQT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis for RNA recognition in roquin-mediated post-transcriptional gene regulation.
pubmed doi rcsb
source organism Mus musculus
molecule tags Rna binding protein
molecule keywords Roquin-1
total genus 56
structure length 153
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2014-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18386 ROQ_II Roquin II domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1790 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4qi0A00
5F5FA 4QI0A 4QI2A 4ZLDA 4YWQA 4ULWA 3X1OA 5F5HA 4ZLCA
chains in the Genus database with same CATH superfamily
1SZIA 3DAGA 1T6UA 3Q7LA 4H54A 5L3QA 3IHUA 3NMJA 3Q6MA 1L7CA 3TOMA 1U0BB 2ASRA 1YA9A 2JD3A 3LUTB 1OR2A 1ZU5A 2Y39A 4W8KA 3H2UA 4XPWA 3SEOA 4WJ0A 3SXZA 5L0HA 1V54C 3ATPA 2M64A 2XLHA 3WHNA 1C03A 2NPUA 2R7QA 4PR9A 3L8IA 3AG3C 4HFKB 4MVRA 5B1AC 3RQGA 3T6GB 3ZC4A 5BQHA 1VTMP 3NKEA 2W45A 1M56C 2R7TA 1LM3B 2J9VA 2OU6A 2R03A 3SXMA 2IXPA 4CS8A 2WVOA 2EIJC 2HV6A 2KC3A 3GEEA 2A6EF 2H7BA 1NFOA 3GEIA 3KYJA 3W4YA 2XS1A 1DOVA 4MVOA 5T3WA 3RH3A 2QNLA 1YYJA 3QZCA 4ER9A 2A0UA 4PFOA 1A7EA 5AC4A 1JPNA 2XLDA 5AGFA 1NFNA 3TD7A 2JX0A 1WASA 1ZW3A 3ITFA 1QVXA 2IYLD 3K6BA 4E0IA 3UMKA 4AL0A 2J7PD 2F22A 2L9JA 4EUKB 5F5FA 4E0HA 4YT4A 1RJ9B 5KYUB 1YZAA 2ZXPA 3VM6A 4LLCA 3UMIA 2Q3TA 4DOZA 3POVA 2HJMA 1FFHA 5CI8A 1U89A 2AU5A 4NTBA 1JAFA 4JCHA 2Q9CA 2MYSA 3S9OA 2CW0F 2LK4A 3LLKA 2YRFA 4LACB 3MYIA 2H8AA 2X51A 4D4NA 1M57C 2GDCA 3EH1A 3QVZA 4WABA 3CZ6A 2MHRA 4JTDB 4N06A 3U8PA 3DE8A 4AE4B 4CS8C 3L8JA 2YLDA 1VK5A 2CYDA 1G8XA 4CDVA 2R7RA 2NUPB 2DYSC 2J7PA 4CIPA 4G7OF 5A6BD 3M4CA 2KJGA 1JMWA 3KH2A 2R25A 4PJLA 3IPMO 4U5FE 4NCQA 1ZHXA 3LS0A 3UGOA 1UG7A 2EPNA 4KBLA 3W8IA 1MQVA 4IGGA 4G78A 3U9MA 4AK9A 1PV3A 3EZIA 4JKVA 4NTAA 4CIHA 5A69A 2R7WA 2XLOA 3IQCA 4C3DA 1EQ1A 3VYWA 3HLZA 4E7ZA 4MVMA 3Q7GA 4AE4A 1Z5ZA 3AQBA 5DS5A 4N6CA 3SXYA 2EINC 2VCCA 1FMWA 3C8GD 1S7ZA 1V55C 2OJQA 2WB7A 3NYLA 2P6VA 4JVSA 5JSLA 1SMYF 1LI5A 3F46A 3VF0A 1NSGB 3GWNA 4MTFA 3DWWA 2XS8A 2B0JA 3EPVA 4DBQA 1LPEA 1RJ9A 3B71A 4E17A 2V3CC 2J45A 3W2WA 4BJ6C 4QDLA 4I3MA 3JZ0A 4CDYA 3DAFA 1Q0DA 4JJFA 3L34A 4O6NA 3GM2A 1OCRC 2NSFA 2Y3DA 2J0XA 1NLXA 1VMAA 3FVYA 1EA8A 4XQ1A 4Z9JA 3DD7A 4MW8A 4JC7A 4BEMJ 4CX9A 1Q0KA 5KYWB 1B68A 1PD1A 2XLWA 1M6TA 2LP4A 1BR1A 3I5PA 1QSPA 1FTSA 4G0HA 4MVUA 3TJ5A 3TK0A 5JLIA 4U5DE 2L7AA 2PX0A 4Q7CA 3TJ6A 1O3UA 5DS6A 3U0CA 5T3TA 3M15A 1ZHWA 1AUEA 2Y3HA 3AOUA 2GAQA 4BEJA 1M2OA 1TWCA 4JEAA 2XL6A 3CSKA 2WL8A 4AL1A 1K04A 4JEBA 1U6HA 2RSEB 2LFDA 3B9QA 3VRCA 2XL4A 3NMKA 2QLAA 3JCUQ 1RCPA 2XLVA 5JS5A 3PCVA 5EGYA 2Y3BA 2EPLX 2J8WA 4U5CE 2LIGA 3GODA 3A11A 4DJ9A 1JPJA 3KYIA 4I1MA 4BJ5A 4D4XA 1UFBA 3FHDA 2EIMC 1D0ZA 1PCXA 4BJ1A 3JTLO 4EIYA 1ZHZA 4DVYP 3K7DA 2PBEA 4NTFA 4LDQA 4O6YA 1HMOA 3GWLA 4CJGA 1M2VB 2P0NA 4KC9A 3C8GB 4CJOA 5B1BC 3DZAA 4OIOF 1OW7A 4RD9A 2WVNA 2W4MA 3DM5A 4ANJA 4IAOA 3IQTA 1Y4CA 1SF8A 2ZXOA 3E70C 3JT1A 2YLIA 2Y3GA 3O6XA 1G5ZA 4FX5A 2YVKA 5FZTA 1Z7Qc 1OW6A 1WN0A 3N0TA 4K0DA 5DVWA 2R7XA 1S05A 4J32B 1A41A 3DJUB 3EFOB 1QZXA 3LJBA 4HFFB 3LS1A 3RKOF 4U5BE 5F28E 3BEHA 2W9YA 3O10A 1E83A 4I44A 1D1BA 1VYIA 2RD9A 3C8GA 3DI5A 3FXHA 4HEAJ 4OINF 2OEVA 1WATA 3B0PA 2BL2A 2G3KA 2IXOA 1EKYA 2Q00A 4BG0A 4YL0A 4YT8A 4G7HF 4JZAA 1Q0FA 1RKEB 1M2VA 2FGYA 2X0CA 3DE9A 256BA 3FDQA 4NQFA 3O39A 3OA1A 5EK0A 3RF3A 5E3CA 1OQCA 2HMQA 2YL3A 4YL1A 3K1IC 1T9KA 3HNIA 3KL4A 4Q5SF 3ZVRA 3I5QA 2H7OA 1L3PA 5B3IA 1J8YF 5HSWA 1T01A 2OOCA 3M79A 4X0RA 5BUOA 1VB5A 1N1CA 2KYHA 4JTCB 3S0XA 2HV7A 2PFDA 1VYKA 1OR3A 1SYQA 3EZHA 4CBEA 3T4RA 3JRMO 1DOWA 3L0IA 1FNTc 4ZLCA 4N6HA 2LCHA 3IQ5A 4PACA 2OEXA 1OKKD 2OG2A 3PHF2 4PJMA 1ORYA 3L1MA 4NY3A 5L0CA 3DM9B 3K66A 4JIOA 1QLEC 4OIRF 1YYXA 5BQGA 3DKAA 2YL0A 5GPGB 3W2VA 1FFTC 2ICWG 2CDQA 3LNMB 4C3EA 1WOLA 1H9TA 2Q7RA 2GA0A 1WGWA 1ZZPA 2BC5A 3US6A 2Q4FA 4H4KC 3QMKA 5E2QA 2C03A 2A6HF 2KQ9A 3AG4C 1OCZC 1TFOB 4GQHA 2KW3C 3GEHA 2AWYA 2EPMX 1YA7O 5JRAA 3TULA 4Z9IA 1CPQA 4C3BA 4EBBA 1E85A 3BRJA 5FCLA 5L0FA 2W4BA 3AJMA 2DB4A 1OXBA 2J9WA 3ASNC 3KPHA 3ZTMA 3H2VA 4P6IC 5L0GA 3NDBB 2KSFA 2IBFA 2ZPAA 3R2PA 4BJ5C 4ULWA 1E2XA 1SR2A 3G50A 3LAYA 5IY5C 3ASOC 2OKUA 3NYJA 4PFPA 3RIPA 4MS2A 1I4YA 4UDVA 2G3VA 3GM1A 4BJ6A 4JE9A 3T6JA 1TKNA 2HFIA 2XL8A 2L6FA 2XM4A 2YEVA 4JW1A 1Q0GA 2XM0A 1KU2A 3E9VA 3LEVA 4DXWA 2FAPB 1CGNA 4MVSA 2XXAB 2A69F 3FOOA 2Q9AA 4IWBA 4ONSA 4EBJA 5DS4A 2YKZA 1TWAA 2DYRC 3NMIA 4MQ9F 3SXKA 3WAQA 4EKWA 1E84A 4YL3A 2KK1A 4J7TA 4XPXA 3HNKA 1YDIA 2IXNA 4RBNA 4XPYA 3B0UX 2OQMA 3K1HA 5DQZA 2CNWD 4BPMA 5E33A 4MVQA 1TFKB 3ABMC 3QW1A 4JJGA 3NG1A 1LE2A 1O5HA 3MBGA 2NUPA 1V74B 1CGOA 2YWAA 1GM5A 1AEPA 4EWCA 1K05A 3WG7C 2LFFA 2VCBA 1TQGA 5A6KA 2HKVA 4FESA 1MNEA 3FAPB 3PMRA 5A6BA 4XLNF 1BDJB 1K40A 4U5GA 4CS9A 2HJ3A 5KYUA 1HMDA 1HY5A 4QI2A 2YL1A 3SNHA 5D92A 3K1IA 4CS9C 2XLEA 3S29A 4U5HA 2VC9A 1NG1A 1BR4A 1YLMA 4OD5A 2MWQA 4GYTA 1XZQA 2JPUA 2D4UA 3CQZA 2G62A 5E3AA 3JYYA 2YQYA 1ZHTA 4J7YA 1HE1A 1HW2A 3V5ZA 1NU9C 3RQFA 1NU7D 4E7SA 4A2NB 4E18A 4F4BA 1Z3IX 3ZDLA 4A4AA 4PJJA 4XWJA 2Q9BA 2IXMA 4ZLDA 2LD6A 2GWWA 2FFHA 2A68F 4G7ZF 3NKDA 4DRJB 2C04A 2OJED 1FMVA 2NG1A 4J30B 3U5SA 1BR2A 1I5NA 4XEVA 1D1CA 5JP7A 1ZYRF 4JTAB 1KTMA 3I4UA 2WZLA 5L3VA 3C63A 1APCA 3EH2A 4ULVA 1FAPB 3SP1A 3EGDA 4I1OB 3OEOA 5F5HA 1LI7A 3SYNA 3U9JA 3UMHA 3AG1C 5KYXA 2D5RB 1HW1A 1TR2A 1T6QA 2LQGA 1H6GA 3EGDB 3ZQYA 2L81A 2O9XA 1JRAA 2GFHA 5DLJA 2ZXWC 3RQEA 3JRTA 1ORJA 3LNRA 3UGPA 1MMGA 2Z15A 5BQIA 3MLGA 1E86A 3K33A 5COGA 3ZIBA 5CIVA 3HNJA 2CNWA 1TWGA 3MX3A 1LS1A 4P9FA 1Z63A 1ORSC 4IJJA 1GGQA 4L6RA 4LERA 1JOGA 1HE9A 1WWPA 3FOPA 3ZG1A 2ZD9A 4AX2A 3X1OA 3EGXA 3NYMA 4YJWA 4DRIB 3S84A 4OIQF 5JUAA 3EJNA 3H65A 4WGYA 2J0WA 1O87A 1ST6A 1ZU4A 2VH3A 3KMIA 2L6HA 2VASA 4YK5A 3U3FA 3CEXA 2PP4A 1QPUA 2NSGA 1YVIA 4CS7A 4LLEA 1ZHYA 3ZWIA 2PNOA 2XRHA 3F47A 4GEHA 3U2MA 1MMDA 1WTYA 3UNGC 5JVEA 1LIHA 1CGME 3MFNA 2YHSA 1LKXA 4IAQA 1VLTA 2R7SA 3O55A 3T9OA 4Z9HA 2R7UA 1AVOB 3RW0A 5K0IA 1ZVZA 1IW7F 4NC3A 3G4XA 4HE8D 1Q0MA 3W8HA 4CSAA 1LVKA 2CGEA 3AGUA 3B29A 1XZPA 3RVZA 5CI9A 4PK4A 4LDRA 3S28A 3HNLA 1C17M 3IEEA 3RYLA 5KYNA 4U5EE 1FR0A 3DMDA 1VLSA 2ZXRA 3C8ZA 3GM3A 1ZW2A 3G4ZA 1OCOC 3QW0A 4PJNA 5AC5A 1NZEA 1T6IA 2XXAA 1IZMA 4YT5A 4BJTA 3EG9B 4P9TA 2XSEA 1RKCA 2EPKX 5KYYB 4O7GA 4XEKA 3U8VA 4JRZA 2YL7A 3U2LA 1JR8A 3AQCA 3V7OA 1A7DA 4R32A 4IRUA 4EHPA 4YWQA 5L0IA 4KI2A 2UUIA 4B6IA 2QY9A 4C7OB 1Z23A 1F1MA 3EHNA 2M4EA 2J46A 1H7IA 2WZFA 3X2QC 4QI0A 3GANA 1BZ4A 2VCAA 5HV9A 4DRHB 2NUTB 1QKRA 4KNWA 2B0HA 3V5YA 3RVYA 3ECSA 3DJNB 2BE5F 2L6GA 3VAYA 2R7VA 2Y69C 3LESA 3MYFA 5T1DB 2R05A 5A6JA 5D91A 1OW8A 4CSAC 2HSQA 2H7VC 5KYWA 1YJGA 2AP3A 3ZTZA 1D1AA 1G4WR 3NRHA 1MNDA 1T5OA 3N2ZB 2A0BA 5EHHA 2YLGA 4Q4ZF 3AGTA 2PF4E 3LEOA 3SZRA 1TWHA 1LE4A 1GQAA 5L0DA 2QUPA 3CAXA 3TOLA 3J06A 4OD4A 3N24A 4M63A 4MTOA 1Y6DA 1A7VA 2I15A 1H9GA 4EBKA 4DVZA 2DGJA 1GS9A 2EILC 3A9CA 3GORA 2NUTA 2HUJA 3ABKC 4MVZA 2A1DD 1MMNA 3EQLF 4WGZA 3DXJF 2HSBA 4XEFA 4CDAA 2VB6A 4IARA 2EPOA 4FAPB 3S27A 4MTGA 2R02A 1R5ID 1W2WA 4C7OA 2HS5A 4JURI 3EHMA 3JSEO 2P1AA 2CCYA 2I8BA 3Q6NA 2PX3A 1D0XA 4FWVA 3WODF 2KNHA 4K1OA 5KYYA 5COFA 4YN0B 1QQ3A 2YZSA 1OCCC 2LSEA 3U3BA 1PD0A 1I4ZA 2HMZA 3EG9A 4MW3A 1VOMA 4YT2A 2AWCA 3HKKA 1A0BA 1YAUO 3C62A 3FMSA 4OIPF 2HZ8A 5B3SC 3C18A 4XTKA 3R7CA 4N4WA 1J8MF 1LS4A 2J9UA 1MMAA 4LDKA 2DI3A 2QE9A 3AG2C 5TJ5E 1RKEA 4O79A 2R7OA 5DQTA 4RDAA 2J9BA 2P61A 4KNVA 1YZCA 4IB4A 1G4US 2QTVA 3OWTA 3S90A 3KKBA 5JT4A 5COMA 5L0JA 4O6MA 3PDMP 2TMVP 1BBHA 1RXQA 3V5XA 2EIKC 2V26A 1C02A 2E87A 2XLMA 1D0YA 2IOQA 2KGOA 1CPRA 2AVKA 1R4TA 2WVQA 1XWJA 3EFOA 3FAJA 3JYHA 3M4BA 3QTHA 1YARO 3UR3C 3IQ6A 1RMVA 1KNYA 3JSZA 3ZSUA 4K7BA 3ABLC 3C7JA 4U9DA 4MNDA 2ETSA 1V4AA 3ZQVA 4U9EA 3QVYA 1OKKA 3HJCA 2IM8A 1OXKA 2WZGA 5KYXB 1Z6AA 3M1CB 3RFYA 3B0VC 4XLPF 1EI7A 2OCCC 4JCZA 3TQOA 4DBRA 3EGXB 2UUHA 2R9RB 3LLIA 1NBBA 4W8PA 5A6AA 3T6BA 3HTKC 2P7VA
chains in the Genus database with same CATH topology
1SZIA 3DAGA 3Q7LA 5L3QA 3Q6MA 2JD3A 1ZU5A 2Y39A 4W8KA 3SEOA 4WJ0A 1V54C 5B1AC 2R7QA 3AG3C 4HFKB 3NKEA 2W45A 1M56C 2R7TA 2J9VA 2IXPA 4CS8A 2WVOA 2EIJC 2HV6A 2A6EF 2H7BA 5T3WA 3RH3A 3QZCA 4PFOA 1JPNA 3TD7A 5KYXA 3ITFA 2IYLD 3K6BA 3UMKA 2J7PD 2L9JA 5F5FA 4YT4A 1RJ9B 5KYUB 2ZXPA 4LLCA 3UMIA 2Q3TA 4DOZA 3POVA 1FFHA 5CI8A 4JCHA 2Q9CA 2MYSA 2CW0F 3LLKA 4LACB 2X51A 1M57C 3EH1A 3CZ6A 4N06A 4AE4B 4CS8C 1VK5A 1G8XA 2R7RA 2NUPB 2DYSC 2J7PA 4G7OF 2KJGA 3KH2A 4PJLA 4U5FE 1ZHXA 3LS0A 3UGOA 4KBLA 3W8IA 4AK9A 3EZIA 4CIHA 2R7WA 4C3DA 3VYWA 3HLZA 4E7ZA 3Q7GA 4AE4A 1Z5ZA 3AQBA 2EINC 1FMWA 1S7ZA 1V55C 2WB7A 3NYLA 2P6VA 4JVSA 1SMYF 3F46A 2B0JA 3EPVA 4DBQA 1RJ9A 2V3CC 2J45A 3W2WA 4BJ6C 4QDLA 4I3MA 3DAFA 4JJFA 4O6NA 3L34A 1OCRC 3FVYA 2Y3DA 2J0XA 1VMAA 5KYWB 3DD7A 1PD1A 1BR1A 3I5PA 1FTSA 4G0HA 4U5DE 2PX0A 4Q7CA 5DS6A 5T3TA 1ZHWA 2Y3HA 4BEJA 1M2OA 1TWCA 3CSKA 2WL8A 3B9QA 2XL4A 3JCUQ 5EGYA 2Y3BA 4U5CE 3GODA 1JPJA 4I1MA 4BJ5A 3FHDA 2EIMC 1D0ZA 1PCXA 4BJ1A 1ZHZA 4DVYP 3K7DA 4O6YA 1M2VB 4KC9A 5B1BC 3DZAA 4OIOF 4RD9A 2WVNA 2W4MA 3DM5A 4ANJA 4IAOA 1SF8A 2ZXOA 3E70C 3JT1A 2Y3GA 3O6XA 4FX5A 3N0TA 4K0DA 5DVWA 2R7XA 4J32B 3DJUB 3EFOB 1QZXA 3LJBA 4HFFB 3LS1A 3RKOF 4U5BE 2W9YA 4I44A 1D1BA 1VYIA 4OINF 4HEAJ 3B0PA 2G3KA 2IXOA 4BG0A 4YT8A 4G7HF 4JZAA 1M2VA 2FGYA 3FDQA 3O39A 3OA1A 5E3CA 3K1IC 3KL4A 4Q5SF 3ZVRA 3I5QA 2H7OA 5HSWA 1J8YF 4X0RA 5BUOA 1N1CA 3S0XA 2HV7A 2PFDA 1VYKA 3EZHA 4CBEA 3T4RA 3L0IA 4ZLCA 1OKKD 2OG2A 3PHF2 4PJMA 4NY3A 3DM9B 3K66A 1QLEC 4OIRF 3W2VA 1FFTC 2CDQA 4C3EA 1WGWA 4H4KC 3QMKA 5E2QA 2C03A 2A6HF 2KQ9A 3AG4C 1OCZC 2KW3C 4EBBA 4C3BA 5FCLA 2W4BA 2J9WA 3ASNC 4P6IC 3NDBB 2ZPAA 4BJ5C 4ULWA 3LAYA 5IY5C 3ASOC 3NYJA 4PFPA 3RIPA 2G3VA 4BJ6A 3T6JA 1TKNA 3ZC4A 2YEVA 4JW1A 3LEVA 1KU2A 3E9VA 2XXAB 2A69F 4IWBA 2Q9AA 5DS4A 4MQ9F 1TWAA 2DYRC 2IXNA 4RBNA 3B0UX 5DQZA 3K1HA 2CNWD 5E33A 3ABMC 4JJGA 3NG1A 1O5HA 2NUPA 4EWCA 3WG7C 4FESA 1MNEA 3PMRA 4XLNF 4U5GA 4CS9A 5KYUA 4QI2A 3SNHA 5D92A 4CS9C 3S29A 4U5HA 1NG1A 1BR4A 4OD5A 2MWQA 4GYTA 3CQZA 2G62A 5E3AA 1ZHTA 1NU9C 1NU7D 4E7SA 4A2NB 4F4BA 1Z3IX 4PJJA 4XWJA 2Q9BA 2IXMA 4ZLDA 2FFHA 2A68F 4G7ZF 3NKDA 2C04A 1FMVA 2NG1A 4J30B 1BR2A 1D1CA 1ZYRF 3I4UA 2WZLA 5L3VA 3EH2A 3SP1A 5F5HA 3EGDA 4I1OB 3OEOA 3UMHA 3SYNA 3AG1C 2D5RB 1TR2A 3EGDB 2L81A 2O9XA 2GFHA 5DLJA 2ZXWC 3JRTA 3LNRA 3UGPA 1MMGA 2Z15A 3MLGA 3K33A 3ZIBA 3MX3A 2CNWA 1TWGA 1LS1A 1Z63A 4IJJA 4LERA 5DS5A 3ZG1A 4AX2A 3X1OA 3EGXA 3NYMA 4YJWA 4OIQF 3EJNA 3H65A 1O87A 1ST6A 1ZU4A 2J0WA 2VH3A 3KMIA 2VASA 2PP4A 4CS7A 4LLEA 1ZHYA 4GEHA 2XRHA 3F47A 1MMDA 3UNGC 2YHSA 1LKXA 2R7SA 2R7UA 1IW7F 4HE8D 3W8HA 4CSAA 1LVKA 2CGEA 5CI9A 4PK4A 3S28A 3IEEA 3RYLA 5KYNA 4U5EE 3DMDA 2ZXRA 1OCOC 4PJNA 1NZEA 2XXAA 1IZMA 4YT5A 4BJTA 3EG9B 2XSEA 5KYYB 4O7GA 3AQCA 3V7OA 4KI2A 4IRUA 4YWQA 4B6IA 2QY9A 4C7OB 1Z23A 3EHNA 2M4EA 2J46A 3X2QC 2WZFA 4QI0A 3GANA 2NUTB 4KNWA 3ECSA 3DJNB 2BE5F 3VAYA 2R7VA 2Y69C 3LESA 5T1DB 5D91A 4CSAC 2H7VC 5KYWA 1D1AA 3NRHA 1MNDA 3N2ZB 5EHHA 4Q4ZF 2PF4E 3SZRA 1TWHA 4OD4A 3N24A 4M63A 4DVZA 2DGJA 2NUTA 2EILC 3ABKC 2A1DD 1MMNA 3EQLF 3DXJF 2VB6A 3S27A 1W2WA 4C7OA 4JURI 3EHMA 4FWVA 3Q6NA 2I8BA 2PX3A 1D0XA 3WODF 5KYYA 2KNHA 4YN0B 2YZSA 1OCCC 2LSEA 1PD0A 3EG9A 4YT2A 1VOMA 4OIPF 5B3SC 4XTKA 1J8MF 2J9UA 1MMAA 3AG2C 4O79A 2R7OA 5DQTA 4RDAA 4KNVA 2QTVA 3OWTA 3KKBA 4O6MA 2EIKC 2V26A 2E87A 3EFOA 3JYHA 1D0YA 2IOQA 2KGOA 2WVQA 3FAJA 3UR3C 3JSZA 3ZSUA 4K7BA 3ABLC 4MNDA 1OKKA 3HJCA 2WZGA 5KYXB 1Z6AA 3M1CB 3RFYA 3B0VC 4XLPF 2OCCC 4DBRA 3EGXB 3LLIA 3T6BA 3HTKC 2P7VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5F5F A;  4QI0 A;  4QI2 A;  4ZLD A;  4YWQ A;  4ULW A;  3X1O A;  5F5H A;  4ZLC A; 
#chains in the Genus database with same CATH topology
 1SZI A;  3DAG A;  1T6U A;  3Q7L A;  4H54 A;  5L3Q A;  3IHU A;  3NMJ A;  3Q6M A;  1L7C A;  3TOM A;  1U0B B;  2ASR A;  1YA9 A;  2JD3 A;  3LUT B;  1OR2 A;  1ZU5 A;  2Y39 A;  4W8K A;  3H2U A;  4XPW A;  3SEO A;  4WJ0 A;  3SXZ A;  5L0H A;  1V54 C;  3ATP A;  2M64 A;  2XLH A;  3WHN A;  1C03 A;  2NPU A;  2R7Q A;  4PR9 A;  3L8I A;  3AG3 C;  4HFK B;  4MVR A;  5B1A C;  3RQG A;  3T6G B;  3ZC4 A;  5BQH A;  1VTM P;  3NKE A;  2W45 A;  1M56 C;  2R7T A;  1LM3 B;  2J9V A;  2OU6 A;  2R03 A;  3SXM A;  2IXP A;  4CS8 A;  2WVO A;  2EIJ C;  2HV6 A;  2KC3 A;  3GEE A;  2A6E F;  2H7B A;  1NFO A;  3GEI A;  3KYJ A;  3W4Y A;  2XS1 A;  1DOV A;  4MVO A;  5T3W A;  3RH3 A;  2QNL A;  1YYJ A;  3QZC A;  4ER9 A;  2A0U A;  4PFO A;  1A7E A;  5AC4 A;  1JPN A;  2XLD A;  5AGF A;  1NFN A;  3TD7 A;  2JX0 A;  1WAS A;  1ZW3 A;  3ITF A;  1QVX A;  2IYL D;  3K6B A;  4E0I A;  3UMK A;  4AL0 A;  2J7P D;  2F22 A;  2L9J A;  4EUK B;  5F5F A;  4E0H A;  4YT4 A;  1RJ9 B;  5KYU B;  1YZA A;  2ZXP A;  3VM6 A;  4LLC A;  3UMI A;  2Q3T A;  4DOZ A;  3POV A;  2HJM A;  1FFH A;  5CI8 A;  1U89 A;  2AU5 A;  4NTB A;  1JAF A;  4JCH A;  2Q9C A;  2MYS A;  3S9O A;  2CW0 F;  2LK4 A;  3LLK A;  2YRF A;  4LAC B;  3MYI A;  2H8A A;  2X51 A;  4D4N A;  1M57 C;  2GDC A;  3EH1 A;  3QVZ A;  4WAB A;  3CZ6 A;  2MHR A;  4JTD B;  4N06 A;  3U8P A;  3DE8 A;  4AE4 B;  4CS8 C;  3L8J A;  2YLD A;  1VK5 A;  2CYD A;  1G8X A;  4CDV A;  2R7R A;  2NUP B;  2DYS C;  2J7P A;  4CIP A;  4G7O F;  5A6B D;  3M4C A;  2KJG A;  1JMW A;  3KH2 A;  2R25 A;  4PJL A;  3IPM O;  4U5F E;  4NCQ A;  1ZHX A;  3LS0 A;  3UGO A;  1UG7 A;  2EPN A;  4KBL A;  3W8I A;  1MQV A;  4IGG A;  4G78 A;  3U9M A;  4AK9 A;  1PV3 A;  3EZI A;  4JKV A;  4NTA A;  4CIH A;  5A69 A;  2R7W A;  2XLO A;  3IQC A;  4C3D A;  1EQ1 A;  3VYW A;  3HLZ A;  4E7Z A;  4MVM A;  3Q7G A;  4AE4 A;  1Z5Z A;  3AQB A;  5DS5 A;  4N6C A;  3SXY A;  2EIN C;  2VCC A;  1FMW A;  3C8G D;  1S7Z A;  1V55 C;  2OJQ A;  2WB7 A;  3NYL A;  2P6V A;  4JVS A;  5JSL A;  1SMY F;  1LI5 A;  3F46 A;  3VF0 A;  1NSG B;  3GWN A;  4MTF A;  3DWW A;  2XS8 A;  2B0J A;  3EPV A;  4DBQ A;  1LPE A;  1RJ9 A;  3B71 A;  4E17 A;  2V3C C;  2J45 A;  3W2W A;  4BJ6 C;  4QDL A;  4I3M A;  3JZ0 A;  4CDY A;  3DAF A;  1Q0D A;  4JJF A;  3L34 A;  4O6N A;  3GM2 A;  1OCR C;  2NSF A;  2Y3D A;  2J0X A;  1NLX A;  1VMA A;  3FVY A;  1EA8 A;  4XQ1 A;  4Z9J A;  3DD7 A;  4MW8 A;  4JC7 A;  4BEM J;  4CX9 A;  1Q0K A;  5KYW B;  1B68 A;  1PD1 A;  2XLW A;  1M6T A;  2LP4 A;  1BR1 A;  3I5P A;  1QSP A;  1FTS A;  4G0H A;  4MVU A;  3TJ5 A;  3TK0 A;  5JLI A;  4U5D E;  2L7A A;  2PX0 A;  4Q7C A;  3TJ6 A;  1O3U A;  5DS6 A;  3U0C A;  5T3T A;  3M15 A;  1ZHW A;  1AUE A;  2Y3H A;  3AOU A;  2GAQ A;  4BEJ A;  1M2O A;  1TWC A;  4JEA A;  2XL6 A;  3CSK A;  2WL8 A;  4AL1 A;  1K04 A;  4JEB A;  1U6H A;  2RSE B;  2LFD A;  3B9Q A;  3VRC A;  2XL4 A;  3NMK A;  2QLA A;  3JCU Q;  1RCP A;  2XLV A;  5JS5 A;  3PCV A;  5EGY A;  2Y3B A;  2EPL X;  2J8W A;  4U5C E;  2LIG A;  3GOD A;  3A11 A;  4DJ9 A;  1JPJ A;  3KYI A;  4I1M A;  4BJ5 A;  4D4X A;  1UFB A;  3FHD A;  2EIM C;  1D0Z A;  1PCX A;  4BJ1 A;  3JTL O;  4EIY A;  1ZHZ A;  4DVY P;  3K7D A;  2PBE A;  4NTF A;  4LDQ A;  4O6Y A;  1HMO A;  3GWL A;  4CJG A;  1M2V B;  2P0N A;  4KC9 A;  3C8G B;  4CJO A;  5B1B C;  3DZA A;  4OIO F;  1OW7 A;  4RD9 A;  2WVN A;  2W4M A;  3DM5 A;  4ANJ A;  4IAO A;  3IQT A;  1Y4C A;  1SF8 A;  2ZXO A;  3E70 C;  3JT1 A;  2YLI A;  2Y3G A;  3O6X A;  1G5Z A;  4FX5 A;  2YVK A;  5FZT A;  1Z7Q c;  1OW6 A;  1WN0 A;  3N0T A;  4K0D A;  5DVW A;  2R7X A;  1S05 A;  4J32 B;  1A41 A;  3DJU B;  3EFO B;  1QZX A;  3LJB A;  4HFF B;  3LS1 A;  3RKO F;  4U5B E;  5F28 E;  3BEH A;  2W9Y A;  3O10 A;  1E83 A;  4I44 A;  1D1B A;  1VYI A;  2RD9 A;  3C8G A;  3DI5 A;  3FXH A;  4HEA J;  4OIN F;  2OEV A;  1WAT A;  3B0P A;  2BL2 A;  2G3K A;  2IXO A;  1EKY A;  2Q00 A;  4BG0 A;  4YL0 A;  4YT8 A;  4G7H F;  4JZA A;  1Q0F A;  1RKE B;  1M2V A;  2FGY A;  2X0C A;  3DE9 A;  256B A;  3FDQ A;  4NQF A;  3O39 A;  3OA1 A;  5EK0 A;  3RF3 A;  5E3C A;  1OQC A;  2HMQ A;  2YL3 A;  4YL1 A;  3K1I C;  1T9K A;  3HNI A;  3KL4 A;  4Q5S F;  3ZVR A;  3I5Q A;  2H7O A;  1L3P A;  5B3I A;  1J8Y F;  5HSW A;  1T01 A;  2OOC A;  3M79 A;  4X0R A;  5BUO A;  1VB5 A;  1N1C A;  2KYH A;  4JTC B;  3S0X A;  2HV7 A;  2PFD A;  1VYK A;  1OR3 A;  1SYQ A;  3EZH A;  4CBE A;  3T4R A;  3JRM O;  1DOW A;  3L0I A;  1FNT c;  4ZLC A;  4N6H A;  2LCH A;  3IQ5 A;  4PAC A;  2OEX A;  1OKK D;  2OG2 A;  3PHF 2;  4PJM A;  1ORY A;  3L1M A;  4NY3 A;  5L0C A;  3DM9 B;  3K66 A;  4JIO A;  1QLE C;  4OIR F;  1YYX A;  5BQG A;  3DKA A;  2YL0 A;  5GPG B;  3W2V A;  1FFT C;  2ICW G;  2CDQ A;  3LNM B;  4C3E A;  1WOL A;  1H9T A;  2Q7R A;  2GA0 A;  1WGW A;  1ZZP A;  2BC5 A;  3US6 A;  2Q4F A;  4H4K C;  3QMK A;  5E2Q A;  2C03 A;  2A6H F;  2KQ9 A;  3AG4 C;  1OCZ C;  1TFO B;  4GQH A;  2KW3 C;  3GEH A;  2AWY A;  2EPM X;  1YA7 O;  5JRA A;  3TUL A;  4Z9I A;  1CPQ A;  4C3B A;  4EBB A;  1E85 A;  3BRJ A;  5FCL A;  5L0F A;  2W4B A;  3AJM A;  2DB4 A;  1OXB A;  2J9W A;  3ASN C;  3KPH A;  3ZTM A;  3H2V A;  4P6I C;  5L0G A;  3NDB B;  2KSF A;  2IBF A;  2ZPA A;  3R2P A;  4BJ5 C;  4ULW A;  1E2X A;  1SR2 A;  3G50 A;  3LAY A;  5IY5 C;  3ASO C;  2OKU A;  3NYJ A;  4PFP A;  3RIP A;  4MS2 A;  1I4Y A;  4UDV A;  2G3V A;  3GM1 A;  4BJ6 A;  4JE9 A;  3T6J A;  1TKN A;  2HFI A;  2XL8 A;  2L6F A;  2XM4 A;  2YEV A;  4JW1 A;  1Q0G A;  2XM0 A;  1KU2 A;  3E9V A;  3LEV A;  4DXW A;  2FAP B;  1CGN A;  4MVS A;  2XXA B;  2A69 F;  3FOO A;  2Q9A A;  4IWB A;  4ONS A;  4EBJ A;  5DS4 A;  2YKZ A;  1TWA A;  2DYR C;  3NMI A;  4MQ9 F;  3SXK A;  3WAQ A;  4EKW A;  1E84 A;  4YL3 A;  2KK1 A;  4J7T A;  4XPX A;  3HNK A;  1YDI A;  2IXN A;  4RBN A;  4XPY A;  3B0U X;  2OQM A;  3K1H A;  5DQZ A;  2CNW D;  4BPM A;  5E33 A;  4MVQ A;  1TFK B;  3ABM C;  3QW1 A;  4JJG A;  3NG1 A;  1LE2 A;  1O5H A;  3MBG A;  2NUP A;  1V74 B;  1CGO A;  2YWA A;  1GM5 A;  1AEP A;  4EWC A;  1K05 A;  3WG7 C;  2LFF A;  2VCB A;  1TQG A;  5A6K A;  2HKV A;  4FES A;  1MNE A;  3FAP B;  3PMR A;  5A6B A;  4XLN F;  1BDJ B;  1K40 A;  4U5G A;  4CS9 A;  2HJ3 A;  5KYU A;  1HMD A;  1HY5 A;  4QI2 A;  2YL1 A;  3SNH A;  5D92 A;  3K1I A;  4CS9 C;  2XLE A;  3S29 A;  4U5H A;  2VC9 A;  1NG1 A;  1BR4 A;  1YLM A;  4OD5 A;  2MWQ A;  4GYT A;  1XZQ A;  2JPU A;  2D4U A;  3CQZ A;  2G62 A;  5E3A A;  3JYY A;  2YQY A;  1ZHT A;  4J7Y A;  1HE1 A;  1HW2 A;  3V5Z A;  1NU9 C;  3RQF A;  1NU7 D;  4E7S A;  4A2N B;  4E18 A;  4F4B A;  1Z3I X;  3ZDL A;  4A4A A;  4PJJ A;  4XWJ A;  2Q9B A;  2IXM A;  4ZLD A;  2LD6 A;  2GWW A;  2FFH A;  2A68 F;  4G7Z F;  3NKD A;  4DRJ B;  2C04 A;  2OJE D;  1FMV A;  2NG1 A;  4J30 B;  3U5S A;  1BR2 A;  1I5N A;  4XEV A;  1D1C A;  5JP7 A;  1ZYR F;  4JTA B;  1KTM A;  3I4U A;  2WZL A;  5L3V A;  3C63 A;  1APC A;  3EH2 A;  4ULV A;  1FAP B;  3SP1 A;  3EGD A;  4I1O B;  3OEO A;  5F5H A;  1LI7 A;  3SYN A;  3U9J A;  3UMH A;  3AG1 C;  5KYX A;  2D5R B;  1HW1 A;  1TR2 A;  1T6Q A;  2LQG A;  1H6G A;  3EGD B;  3ZQY A;  2L81 A;  2O9X A;  1JRA A;  2GFH A;  5DLJ A;  2ZXW C;  3RQE A;  3JRT A;  1ORJ A;  3LNR A;  3UGP A;  1MMG A;  2Z15 A;  5BQI A;  3MLG A;  1E86 A;  3K33 A;  5COG A;  3ZIB A;  5CIV A;  3HNJ A;  2CNW A;  1TWG A;  3MX3 A;  1LS1 A;  4P9F A;  1Z63 A;  1ORS C;  4IJJ A;  1GGQ A;  4L6R A;  4LER A;  1JOG A;  1HE9 A;  1WWP A;  3FOP A;  3ZG1 A;  2ZD9 A;  4AX2 A;  3X1O A;  3EGX A;  3NYM A;  4YJW A;  4DRI B;  3S84 A;  4OIQ F;  5JUA A;  3EJN A;  3H65 A;  4WGY A;  2J0W A;  1O87 A;  1ST6 A;  1ZU4 A;  2VH3 A;  3KMI A;  2L6H A;  2VAS A;  4YK5 A;  3U3F A;  3CEX A;  2PP4 A;  1QPU A;  2NSG A;  1YVI A;  4CS7 A;  4LLE A;  1ZHY A;  3ZWI A;  2PNO A;  2XRH A;  3F47 A;  4GEH A;  3U2M A;  1MMD A;  1WTY A;  3UNG C;  5JVE A;  1LIH A;  1CGM E;  3MFN A;  2YHS A;  1LKX A;  4IAQ A;  1VLT A;  2R7S A;  3O55 A;  3T9O A;  4Z9H A;  2R7U A;  1AVO B;  3RW0 A;  5K0I A;  1ZVZ A;  1IW7 F;  4NC3 A;  3G4X A;  4HE8 D;  1Q0M A;  3W8H A;  4CSA A;  1LVK A;  2CGE A;  3AGU A;  3B29 A;  1XZP A;  3RVZ A;  5CI9 A;  4PK4 A;  4LDR A;  3S28 A;  3HNL A;  1C17 M;  3IEE A;  3RYL A;  5KYN A;  4U5E E;  1FR0 A;  3DMD A;  1VLS A;  2ZXR A;  3C8Z A;  3GM3 A;  1ZW2 A;  3G4Z A;  1OCO C;  3QW0 A;  4PJN A;  5AC5 A;  1NZE A;  1T6I A;  2XXA A;  1IZM A;  4YT5 A;  4BJT A;  3EG9 B;  4P9T A;  2XSE A;  1RKC A;  2EPK X;  5KYY B;  4O7G A;  4XEK A;  3U8V A;  4JRZ A;  2YL7 A;  3U2L A;  1JR8 A;  3AQC A;  3V7O A;  1A7D A;  4R32 A;  4IRU A;  4EHP A;  4YWQ A;  5L0I A;  4KI2 A;  2UUI A;  4B6I A;  2QY9 A;  4C7O B;  1Z23 A;  1F1M A;  3EHN A;  2M4E A;  2J46 A;  1H7I A;  2WZF A;  3X2Q C;  4QI0 A;  3GAN A;  1BZ4 A;  2VCA A;  5HV9 A;  4DRH B;  2NUT B;  1QKR A;  4KNW A;  2B0H A;  3V5Y A;  3RVY A;  3ECS A;  3DJN B;  2BE5 F;  2L6G A;  3VAY A;  2R7V A;  2Y69 C;  3LES A;  3MYF A;  5T1D B;  2R05 A;  5A6J A;  5D91 A;  1OW8 A;  4CSA C;  2HSQ A;  2H7V C;  5KYW A;  1YJG A;  2AP3 A;  3ZTZ A;  1D1A A;  1G4W R;  3NRH A;  1MND A;  1T5O A;  3N2Z B;  2A0B A;  5EHH A;  2YLG A;  4Q4Z F;  3AGT A;  2PF4 E;  3LEO A;  3SZR A;  1TWH A;  1LE4 A;  1GQA A;  5L0D A;  2QUP A;  3CAX A;  3TOL A;  3J06 A;  4OD4 A;  3N24 A;  4M63 A;  4MTO A;  1Y6D A;  1A7V A;  2I15 A;  1H9G A;  4EBK A;  4DVZ A;  2DGJ A;  1GS9 A;  2EIL C;  3A9C A;  3GOR A;  2NUT A;  2HUJ A;  3ABK C;  4MVZ A;  2A1D D;  1MMN A;  3EQL F;  4WGZ A;  3DXJ F;  2HSB A;  4XEF A;  4CDA A;  2VB6 A;  4IAR A;  2EPO A;  4FAP B;  3S27 A;  4MTG A;  2R02 A;  1R5I D;  1W2W A;  4C7O A;  2HS5 A;  4JUR I;  3EHM A;  3JSE O;  2P1A A;  2CCY A;  2I8B A;  3Q6N A;  2PX3 A;  1D0X A;  4FWV A;  3WOD F;  2KNH A;  4K1O A;  5KYY A;  5COF A;  4YN0 B;  1QQ3 A;  2YZS A;  1OCC C;  2LSE A;  3U3B A;  1PD0 A;  1I4Z A;  2HMZ A;  3EG9 A;  4MW3 A;  1VOM A;  4YT2 A;  2AWC A;  3HKK A;  1A0B A;  1YAU O;  3C62 A;  3FMS A;  4OIP F;  2HZ8 A;  5B3S C;  3C18 A;  4XTK A;  3R7C A;  4N4W A;  1J8M F;  1LS4 A;  2J9U A;  1MMA A;  4LDK A;  2DI3 A;  2QE9 A;  3AG2 C;  5TJ5 E;  1RKE A;  4O79 A;  2R7O A;  5DQT A;  4RDA A;  2J9B A;  2P61 A;  4KNV A;  1YZC A;  4IB4 A;  1G4U S;  2QTV A;  3OWT A;  3S90 A;  3KKB A;  5JT4 A;  5COM A;  5L0J A;  4O6M A;  3PDM P;  2TMV P;  1BBH A;  1RXQ A;  3V5X A;  2EIK C;  2V26 A;  1C02 A;  2E87 A;  2XLM A;  1D0Y A;  2IOQ A;  2KGO A;  1CPR A;  2AVK A;  1R4T A;  2WVQ A;  1XWJ A;  3EFO A;  3FAJ A;  3JYH A;  3M4B A;  3QTH A;  1YAR O;  3UR3 C;  3IQ6 A;  1RMV A;  1KNY A;  3JSZ A;  3ZSU A;  4K7B A;  3ABL C;  3C7J A;  4U9D A;  4MND A;  2ETS A;  1V4A A;  3ZQV A;  4U9E A;  3QVY A;  1OKK A;  3HJC A;  2IM8 A;  1OXK A;  2WZG A;  5KYX B;  1Z6A A;  3M1C B;  3RFY A;  3B0V C;  4XLP F;  1EI7 A;  2OCC C;  4JCZ A;  3TQO A;  4DBR A;  3EGX B;  2UUH A;  2R9R B;  3LLI A;  1NBB A;  4W8P A;  5A6A A;  3T6B A;  3HTK C;  2P7V A; 
#chains in the Genus database with same CATH homology
 1SZI A;  3DAG A;  3Q7L A;  5L3Q A;  3Q6M A;  2JD3 A;  1ZU5 A;  2Y39 A;  4W8K A;  3SEO A;  4WJ0 A;  1V54 C;  5B1A C;  2R7Q A;  3AG3 C;  4HFK B;  3NKE A;  2W45 A;  1M56 C;  2R7T A;  2J9V A;  2IXP A;  4CS8 A;  2WVO A;  2EIJ C;  2HV6 A;  2A6E F;  2H7B A;  5T3W A;  3RH3 A;  3QZC A;  4PFO A;  1JPN A;  3TD7 A;  5KYX A;  3ITF A;  2IYL D;  3K6B A;  3UMK A;  2J7P D;  2L9J A;  5F5F A;  4YT4 A;  1RJ9 B;  5KYU B;  2ZXP A;  4LLC A;  3UMI A;  2Q3T A;  4DOZ A;  3POV A;  1FFH A;  5CI8 A;  4JCH A;  2Q9C A;  2MYS A;  2CW0 F;  3LLK A;  4LAC B;  2X51 A;  1M57 C;  3EH1 A;  3CZ6 A;  4N06 A;  4AE4 B;  4CS8 C;  1VK5 A;  1G8X A;  2R7R A;  2NUP B;  2DYS C;  2J7P A;  4G7O F;  2KJG A;  3KH2 A;  4PJL A;  4U5F E;  1ZHX A;  3LS0 A;  3UGO A;  4KBL A;  3W8I A;  4AK9 A;  3EZI A;  4CIH A;  2R7W A;  4C3D A;  3VYW A;  3HLZ A;  4E7Z A;  3Q7G A;  4AE4 A;  1Z5Z A;  3AQB A;  2EIN C;  1FMW A;  1S7Z A;  1V55 C;  2WB7 A;  3NYL A;  2P6V A;  4JVS A;  1SMY F;  3F46 A;  2B0J A;  3EPV A;  4DBQ A;  1RJ9 A;  2V3C C;  2J45 A;  3W2W A;  4BJ6 C;  4QDL A;  4I3M A;  3DAF A;  4JJF A;  4O6N A;  3L34 A;  1OCR C;  3FVY A;  2Y3D A;  2J0X A;  1VMA A;  5KYW B;  3DD7 A;  1PD1 A;  1BR1 A;  3I5P A;  1FTS A;  4G0H A;  4U5D E;  2PX0 A;  4Q7C A;  5DS6 A;  5T3T A;  1ZHW A;  2Y3H A;  4BEJ A;  1M2O A;  1TWC A;  3CSK A;  2WL8 A;  3B9Q A;  2XL4 A;  3JCU Q;  5EGY A;  2Y3B A;  4U5C E;  3GOD A;  1JPJ A;  4I1M A;  4BJ5 A;  3FHD A;  2EIM C;  1D0Z A;  1PCX A;  4BJ1 A;  1ZHZ A;  4DVY P;  3K7D A;  4O6Y A;  1M2V B;  4KC9 A;  5B1B C;  3DZA A;  4OIO F;  4RD9 A;  2WVN A;  2W4M A;  3DM5 A;  4ANJ A;  4IAO A;  1SF8 A;  2ZXO A;  3E70 C;  3JT1 A;  2Y3G A;  3O6X A;  4FX5 A;  3N0T A;  4K0D A;  5DVW A;  2R7X A;  4J32 B;  3DJU B;  3EFO B;  1QZX A;  3LJB A;  4HFF B;  3LS1 A;  3RKO F;  4U5B E;  2W9Y A;  4I44 A;  1D1B A;  1VYI A;  4OIN F;  4HEA J;  3B0P A;  2G3K A;  2IXO A;  4BG0 A;  4YT8 A;  4G7H F;  4JZA A;  1M2V A;  2FGY A;  3FDQ A;  3O39 A;  3OA1 A;  5E3C A;  3K1I C;  3KL4 A;  4Q5S F;  3ZVR A;  3I5Q A;  2H7O A;  5HSW A;  1J8Y F;  4X0R A;  5BUO A;  1N1C A;  3S0X A;  2HV7 A;  2PFD A;  1VYK A;  3EZH A;  4CBE A;  3T4R A;  3L0I A;  4ZLC A;  1OKK D;  2OG2 A;  3PHF 2;  4PJM A;  4NY3 A;  3DM9 B;  3K66 A;  1QLE C;  4OIR F;  3W2V A;  1FFT C;  2CDQ A;  4C3E A;  1WGW A;  4H4K C;  3QMK A;  5E2Q A;  2C03 A;  2A6H F;  2KQ9 A;  3AG4 C;  1OCZ C;  2KW3 C;  4EBB A;  4C3B A;  5FCL A;  2W4B A;  2J9W A;  3ASN C;  4P6I C;  3NDB B;  2ZPA A;  4BJ5 C;  4ULW A;  3LAY A;  5IY5 C;  3ASO C;  3NYJ A;  4PFP A;  3RIP A;  2G3V A;  4BJ6 A;  3T6J A;  1TKN A;  3ZC4 A;  2YEV A;  4JW1 A;  3LEV A;  1KU2 A;  3E9V A;  2XXA B;  2A69 F;  4IWB A;  2Q9A A;  5DS4 A;  4MQ9 F;  1TWA A;  2DYR C;  2IXN A;  4RBN A;  3B0U X;  5DQZ A;  3K1H A;  2CNW D;  5E33 A;  3ABM C;  4JJG A;  3NG1 A;  1O5H A;  2NUP A;  4EWC A;  3WG7 C;  4FES A;  1MNE A;  3PMR A;  4XLN F;  4U5G A;  4CS9 A;  5KYU A;  4QI2 A;  3SNH A;  5D92 A;  4CS9 C;  3S29 A;  4U5H A;  1NG1 A;  1BR4 A;  4OD5 A;  2MWQ A;  4GYT A;  3CQZ A;  2G62 A;  5E3A A;  1ZHT A;  1NU9 C;  1NU7 D;  4E7S A;  4A2N B;  4F4B A;  1Z3I X;  4PJJ A;  4XWJ A;  2Q9B A;  2IXM A;  4ZLD A;  2FFH A;  2A68 F;  4G7Z F;  3NKD A;  2C04 A;  1FMV A;  2NG1 A;  4J30 B;  1BR2 A;  1D1C A;  1ZYR F;  3I4U A;  2WZL A;  5L3V A;  3EH2 A;  3SP1 A;  5F5H A;  3EGD A;  4I1O B;  3OEO A;  3UMH A;  3SYN A;  3AG1 C;  2D5R B;  1TR2 A;  3EGD B;  2L81 A;  2O9X A;  2GFH A;  5DLJ A;  2ZXW C;  3JRT A;  3LNR A;  3UGP A;  1MMG A;  2Z15 A;  3MLG A;  3K33 A;  3ZIB A;  3MX3 A;  2CNW A;  1TWG A;  1LS1 A;  1Z63 A;  4IJJ A;  4LER A;  5DS5 A;  3ZG1 A;  4AX2 A;  3X1O A;  3EGX A;  3NYM A;  4YJW A;  4OIQ F;  3EJN A;  3H65 A;  1O87 A;  1ST6 A;  1ZU4 A;  2J0W A;  2VH3 A;  3KMI A;  2VAS A;  2PP4 A;  4CS7 A;  4LLE A;  1ZHY A;  4GEH A;  2XRH A;  3F47 A;  1MMD A;  3UNG C;  2YHS A;  1LKX A;  2R7S A;  2R7U A;  1IW7 F;  4HE8 D;  3W8H A;  4CSA A;  1LVK A;  2CGE A;  5CI9 A;  4PK4 A;  3S28 A;  3IEE A;  3RYL A;  5KYN A;  4U5E E;  3DMD A;  2ZXR A;  1OCO C;  4PJN A;  1NZE A;  2XXA A;  1IZM A;  4YT5 A;  4BJT A;  3EG9 B;  2XSE A;  5KYY B;  4O7G A;  3AQC A;  3V7O A;  4KI2 A;  4IRU A;  4YWQ A;  4B6I A;  2QY9 A;  4C7O B;  1Z23 A;  3EHN A;  2M4E A;  2J46 A;  3X2Q C;  2WZF A;  4QI0 A;  3GAN A;  2NUT B;  4KNW A;  3ECS A;  3DJN B;  2BE5 F;  3VAY A;  2R7V A;  2Y69 C;  3LES A;  5T1D B;  5D91 A;  4CSA C;  2H7V C;  5KYW A;  1D1A A;  3NRH A;  1MND A;  3N2Z B;  5EHH A;  4Q4Z F;  2PF4 E;  3SZR A;  1TWH A;  4OD4 A;  3N24 A;  4M63 A;  4DVZ A;  2DGJ A;  2NUT A;  2EIL C;  3ABK C;  2A1D D;  1MMN A;  3EQL F;  3DXJ F;  2VB6 A;  3S27 A;  1W2W A;  4C7O A;  4JUR I;  3EHM A;  4FWV A;  3Q6N A;  2I8B A;  2PX3 A;  1D0X A;  3WOD F;  5KYY A;  2KNH A;  4YN0 B;  2YZS A;  1OCC C;  2LSE A;  1PD0 A;  3EG9 A;  4YT2 A;  1VOM A;  4OIP F;  5B3S C;  4XTK A;  1J8M F;  2J9U A;  1MMA A;  3AG2 C;  4O79 A;  2R7O A;  5DQT A;  4RDA A;  4KNV A;  2QTV A;  3OWT A;  3KKB A;  4O6M A;  2EIK C;  2V26 A;  2E87 A;  3EFO A;  3JYH A;  1D0Y A;  2IOQ A;  2KGO A;  2WVQ A;  3FAJ A;  3UR3 C;  3JSZ A;  3ZSU A;  4K7B A;  3ABL C;  4MND A;  1OKK A;  3HJC A;  2WZG A;  5KYX B;  1Z6A A;  3M1C B;  3RFY A;  3B0V C;  4XLP F;  2OCC C;  4DBR A;  3EGX B;  3LLI A;  3T6B A;  3HTK C;  2P7V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...