2HUJA

Crystal structure of a protein of uknown function (np_471338.1) from listeria innocua at 1.74 a resolution
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
125
structure length
125
Chain Sequence
LYFQGMELLIRTEQLLLQNEKNWELYLSNREEEKPFDFYKDMKPFVDEAKRCADDFLELAIPWVNTERPPYLGELQLRQACDNVQMTAVSAFNGRSFYKHFLDHYQSTKYTLTRVRDFLKRKEES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lin2004 protein
publication title Crystal structures of MW1337R and lin2004: representatives of a novel protein family that adopt a four-helical bundle fold.
pubmed doi rcsb
source organism Listeria innocua
molecule tags Structural genomics, unknown function
total genus 56
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2006-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08807 DUF1798 Bacterial domain of unknown function (DUF1798)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.440 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) YppE-like 2hujA00
2IM8A 2HFIA 2HUJA 2ETSA
chains in the Genus database with same CATH superfamily
3S28A 2OEVA 3HNIA 4OD4A 4EBBA 2NUPA 3C8GD 2AVKA 5E3CA 3SXMA 1SF8A 5JUAA 1D1CA 2WB7A 3RFYA 1HW1A 4DXWA 1TKNA 3V7OA 2CCYA 5L3QA 2XS8A 4MTOA 3FOPA 1VYKA 3K1IA 4Z9IA 4D4NA 3L34A 3GODA 3I5QA 4OINF 3S90A 2R7UA 3HNLA 4JE9A 2L9JA 1EKYA 5COGA 4G7ZF 3VAYA 3ZQVA 4C3BA 1V54C 3LNRA 2E87A 2MYSA 1D1BA 1TWCA 1T5OA 1V55C 2YL1A 2IXOA 2DB4A 1E84A 2HV7A 1C17M 2YL7A 4KI2A 1D0XA 5L0CA 1L7CA 3E9VA 3KMIA 2PFDA 1ZHYA 1Q0KA 3Q7GA 5L0JA 3C7JA 3FMSA 2ZXRA 3FAJA 4NCQA 5DLJA 3X1OA 2F22A 3KL4A 3ZVRA 3TJ5A 1WASA 4WGYA 2OKUA 2GA0A 1RKEA 2B0HA 4AL1A 1WTYA 4I1MA 3C8ZA 1FFHA 1N1CA 4DVZA 2HMZA 4EBKA 3QW0A 3AG3C 1VYIA 4NY3A 2YL3A 1WN0A 3SYNA 1EQ1A 1LE2A 1ZHTA 4MW3A 1FTSA 3LEOA 1YZCA 2DGJA 2HUJA 1OCZC 1A0BA 2R7RA 3VYWA 4HE8D 1LVKA 1ZW3A 5F5FA 4G78A 4J7YA 3TK0A 2AU5A 4E7SA 3OA1A 5DS6A 2A0UA 2YZSA 1TFKB 2G3KA 3N0TA 4D4XA 3U2MA 4U5EE 3TULA 2YL0A 4XEKA 4CS9C 2PP4A 2LCHA 4I3MA 4JCZA 4BEJA 3V5YA 1E83A 3UMKA 1XZPA 3W2WA 3C8GB 3ZG1A 1LI5A 5JSLA 3WAQA 2A68F 3B9QA 3EHMA 2FAPB 3RW0A 3O10A 4JZAA 3AG4C 2EPNA 3SXKA 4B6IA 1E2XA 1JOGA 4DOZA 4JJGA 3DE8A 5DQTA 2HZ8A 3GM3A 3HKKA 3J06A 2WL8A 1VK5A 2EINC 3ASNC 4YT8A 2QY9A 3L0IA 2XL6A 4E17A 1WOLA 4C7OA 4PR9A 1ZYRF 4JRZA 1I4YA 1S05A 2J46A 4CJGA 3ATPA 5BQIA 1OQCA 2H8AA 2H7BA 4IAOA 4PFOA 4JEBA 4XQ1A 4ER9A 5L0IA 2Z15A 3UGOA 2OJQA 2IXPA 2KJGA 1BR1A 1BR2A 4NTFA 2HJMA 1TWGA 3HJCA 5L0HA 5COFA 3KH2A 2L81A 2NG1A 3IQCA 3T9OA 4IGGA 3B71A 1I4ZA 3KKBA 4WJ0A 2OCCC 1D0ZA 2ETSA 3DMDA 4K7BA 3RQFA 3EFOB 2L6GA 3FOOA 4XWJA 3UNGC 4K0DA 4ANJA 4MVOA 1G8XA 4JTDB 1E85A 3KYJA 2X0CA 4G7OF 2NUTA 4U9EA 1YYJA 5KYXB 3K6BA 2O9XA 3M79A 2Q7RA 3S27A 4CX9A 4WGZA 1Z5ZA 1IW7F 2KNHA 3A11A 5KYWA 2VCCA 1IZMA 3LLIA 2CGEA 3ASOC 4Z9JA 3T6BA 2XLDA 3LNMB 4NTBA 3NRHA 1JPJA 1U89A 1KNYA 1T9KA 3PDMP 2ZPAA 2NUPB 4MW8A 4CS8A 4E7ZA 3HTKC 1BR4A 1LS4A 2A6HF 3X2QC 3CAXA 4H4KC 1L3PA 1YVIA 2R7WA 1OR3A 3C62A 1LM3B 2XLWA 3L1MA 3O39A 4FX5A 3TJ6A 4JCHA 3ZTMA 3DKAA 1H7IA 2YRFA 1VMAA 4EKWA 2IXNA 3HNJA 3IPMO 3RYLA 1WATA 2AWYA 3GEHA 4ULWA 1NFOA 3SXYA 2EILC 2Y3HA 4AE4A 4BJ1A 3WG7C 3GEIA 2HFIA 3AG1C 3FXHA 3PMRA 5EK0A 2Q00A 3IHUA 2R7SA 1U6HA 1G5ZA 3OWTA 1RJ9A 4U5CE 1UFBA 3S9OA 3ZIBA 4P6IC 1GGQA 4AX2A 4C3EA 4JW1A 3S0XA 2Q9CA 4LLCA 3M15A 3U5SA 2EPOA 1J8MF 2IYLD 3NG1A 1TFOB 4YL3A 3WODF 3K1IC 1QLEC 2P61A 1LPEA 2KK1A 1ZU5A 3TOLA 2VH3A 1APCA 3EZHA 1YDIA 4XEVA 3QMKA 1ZU4A 1RKEB 2GDCA 4JIOA 2GAQA 2XL4A 3H2VA 3SEOA 4YT2A 3E70C 3JYHA 2WZGA 3KYIA 4G0HA 2LFDA 2XLEA 3ECSA 3RVZA 1EA8A 3V5ZA 3IQ6A 3HNKA 4I1OB 2OQMA 1PD0A 3QZCA 3QVYA 5KYNA 2WZLA 3JRTA 4HFFB 1B68A 4BJTA 2I8BA 2I15A 4IRUA 4LERA 3DAGA 3K66A 2UUHA 1CPQA 3I5PA 3VF0A 3DM9B 2PX3A 1MNDA 3H2UA 3ITFA 5JS5A 1OW7A 2LP4A 3NYLA 4P9TA 1ZZPA 5K0IA 3JTLO 2XRHA 5GPGB 2R7XA 2WVOA 3AQCA 3ZWIA 4CS7A 3MFNA 4MVUA 3S84A 2WZFA 1K40A 1M56C 1XZQA 1PCXA 1V74B 4DVYP 3DE9A 1D1AA 4YT5A 2FGYA 2Y69C 3F46A 1JR8A 5COMA 2D4UA 1MMNA 4XPYA 5D91A 1ORJA 4O79A 4PJMA 2YKZA 1ZHXA 2UUIA 1WWPA 2DYSC 4HEAJ 2EPLX 3C63A 4C7OB 2ICWG 2OEXA 5AGFA 4PFPA 5A6BA 1BZ4A 3UMHA 1SMYF 5HSWA 3U8VA 1H9TA 4QI2A 1GS9A 1NZEA 2Q9BA 4O7GA 1ST6A 2AWCA 2YEVA 3MLGA 4LDKA 4N6HA 2PBEA 3U2LA 5KYYA 1G4WR 4LDRA 1Q0DA 2PX0A 1Q0MA 5DS4A 3JZ0A 3JSZA 1XWJA 2X51A 3NKEA 3N2ZB 4RD9A 4W8KA 5B1BC 3O55A 4PJNA 5FCLA 2R7TA 3FDQA 3RH3A 2LFFA 4P9FA 3W2VA 3BEHA 2Q9AA 5EHHA 1ZVZA 2DYRC 2NUTB 4X0RA 1OCCC 3CEXA 3F47A 1M2VA 3JCUQ 4YJWA 3RQEA 2ZXOA 5T1DB 1OCOC 5L3VA 1RMVA 1S7ZA 1TWAA 1UG7A 3MX3A 2EIMC 2YHSA 4XEFA 5DS5A 3RF3A 1FMVA 4BJ6C 2GFHA 3MYIA 4PJJA 2BC5A 5CI9A 2PNOA 4J30B 3R7CA 3EGXA 4E0HA 1Z23A 1MMAA 3NMJA 5CIVA 3MYFA 2W4BA 1FAPB 2QE9A 1Z7Qc 2KSFA 5KYUB 4BJ6A 4N4WA 1YZAA 3QW1A 2ZXWC 1C02A 4MVMA 2XLVA 3EH1A 3W8HA 3EPVA 3RQGA 1M57C 4EHPA 1AEPA 2CW0F 2YWAA 4N06A 1Z63A 3OEOA 3SNHA 3B29A 1VB5A 3DJUB 4OD5A 3GORA 5F5HA 5A6BD 4KNWA 5A6JA 4ONSA 2XLMA 2XSEA 1NLXA 4R32A 3VRCA 5TJ5E 2J0XA 4YN0B 3KPHA 1R5ID 3WHNA 5E2QA 2M64A 1M2OA 4JURI 1RJ9B 1LS1A 1YA9A 3W8IA 4CS8C 4OIRF 3EGDA 2R25A 4QI0A 4O6NA 1HE1A 4U5HA 2XXAA 2OJED 1QSPA 2OOCA 3FAPB 2ZXPA 2XLHA 4AL0A 2VB6A 2XM4A 5JVEA 2IBFA 1OKKA 2LQGA 3LS1A 4MVQA 5E3AA 5BQGA 2QUPA 5E33A 4EWCA 4MVSA 1OCRC 1HMOA 1Z3IX 3RVYA 1VLSA 4MNDA 4BPMA 2J9UA 3M4BA 2H7VC 4O6YA 2RD9A 5FZTA 3GEEA 1YAUO 2J9BA 3JYYA 4O6MA 1AUEA 5AC4A 2ZD9A 1SR2A 1I5NA 3U9MA 1LE4A 3C18A 2HJ3A 3EZIA 4DRHB 2Y3DA 1G4US 5JP7A 3TOMA 1ZW2A 1QQ3A 2W9YA 4CDYA 1WGWA 4MS2A 3US6A 3AGTA 2YLGA 1ORYA 4JJFA 3EHNA 3ZTZA 4C3DA 3CQZA 3TD7A 4CIPA 2NSGA 1Q0FA 4L6RA 1A7VA 3JSEO 4OIOF 4XPWA 4E0IA 2W4MA 2YLIA 2HS5A 1JPNA 3ZC4A 2HSQA 2PF4E 2DI3A 2HV6A 1QVXA 2HKVA 3EG9A 3UMIA 3ZSUA 1YYXA 3DI5A 3LEVA 256BA 3ZQYA 4YT4A 3DD7A 3LUTB 2CYDA 3LLKA 1YA7O 2C03A 4U5FE 3U3FA 4DJ9A 1GM5A 4LDQA 4U9DA 4F4BA 1LIHA 1TQGA 3EFOA 4ULVA 1HE9A 2V26A 1PD1A 4N6CA 3QTHA 4J7TA 3NMIA 1A41A 3NYMA 4AK9A 2B0JA 2J9VA 3EQLF 3G4XA 3M4CA 3Q6MA 4NC3A 3S29A 4CDAA 3U0CA 3NKDA 4CSAA 4EUKB 5KYXA 3B0UX 1D0YA 5DVWA 4LLEA 2R02A 2V3CC 5D92A 1Y6DA 5A6KA 2BL2A 1OKKD 2QLAA 4Q7CA 3DJNB 3CSKA 1MNEA 3FHDA 4BJ5C 1AVOB 1C03A 2KQ9A 3JRMO 5B3SC 1NU7D 5L0DA 1BBHA 5KYYB 1EI7A 1F1MA 1NBBA 1RXQA 1SZIA 3W4YA 5BUOA 1OW6A 4U5BE 3K33A 3JT1A 4GEHA 2J7PA 1QZXA 4BJ5A 1NFNA 3IQ5A 3BRJA 1CGOA 4MTGA 3GANA 4XPXA 3UGPA 1V4AA 2YVKA 3L8JA 3K1HA 4PACA 3UR3C 3NYJA 2R05A 4FESA 4FAPB 3LJBA 3Q6NA 5A6AA 1MMGA 1KU2A 4YL0A 1M2VB 3NMKA 4NQFA 1E86A 4NTAA 1DOVA 1MMDA 2M4EA 2XS1A 2VCAA 4E18A 2Y3GA 3H65A 1K05A 3AGUA 3DWWA 5AC5A 4A2NB 1FNTc 4KC9A 1T6QA 1VOMA 1LI7A 4GQHA 3V5XA 4RDAA 4JEAA 4YK5A 5BQHA 4UDVA 3B0VC 3EJNA 2Y39A 3IQTA 1NSGB 3G4ZA 4YWQA 2XM0A 2A69F 3EGXB 2P0NA 5JRAA 1HW2A 3R2PA 4I44A 4DBRA 1JRAA 4FWVA 4KNVA 1OW8A 4MVRA 1QPUA 4Z9HA 4Q4ZF 4EIYA 2A0BA 3T4RA 1MQVA 1TR2A 4IAQA 4LACB 2R7OA 2LSEA 2Q3TA 1A7DA 3U9JA 2BE5F 3ZDLA 3SP1A 3POVA 3FVYA 2RSEB 4PJLA 4U5GA 4DRIB 4BEMJ 2EPMX 2YQYA 3RIPA 4IB4A 3IEEA 2H7OA 4MQ9F 5L0GA 2D5RB 3PHF2 1KTMA 3TQOA 1OXKA 4DBQA 3DM5A 2FFHA 2R7QA 2G62A 5B3IA 5KYWB 1YARO 3EGDB 3GM1A 1W2WA 4MVZA 5DQZA 1O87A 2XXAB 2P7VA 1ZHWA 2VCBA 2EIKC 2J7PD 2KYHA 1H6GA 2WVNA 1VLTA 3DAFA 1Y4CA 3LESA 2Q4FA 1LKXA 2YLDA 3EH2A 3AJMA 2NSFA 1Z6AA 3NDBB 2ASRA 2J8WA 2JD3A 1Q0GA 3DXJF 4CDVA 2KGOA 2OG2A 4KBLA 3T6JA 5B1AC 4XLNF 2Y3BA 4CS9A 1FFTC 3ABLC 5IY5C 4MTFA 1JMWA 4OIPF 2CNWA 4RBNA 3M1CB 2JX0A 2A1DD 1OR2A 2QNLA 2JPUA 3I4UA 4IWBA 1SYQA 4AE4B 3GM2A 5A69A 2R7VA 3SXZA 1YJGA 1R4TA 2L7AA 4U5DE 3B0PA 4Q5SF 1T6UA 1TWHA 2J45A 2NPUA 5T3TA 4HFKB 1A7EA 3ABMC 4CJOA 3CZ6A 1GQAA 3VM6A 4XLPF 5L0FA 1DOWA 1CGME 4EBJA 5JLIA 1QKRA 2VC9A 3ABKC 3EG9B 5HV9A 1RKCA 2WVQA 3N24A 3LAYA 2P1AA 2W45A 3C8GA 3GWLA 4JC7A 1HMDA 4XTKA 1CGNA 3U3BA 4ZLCA 2IM8A 2LD6A 2P6VA 3Q7LA 2XL8A 1VTMP 4W8PA 4CIHA 4IJJA 4IARA 4OIQF 3AQBA 1ORSC 2XLOA 2GWWA 1K04A 4K1OA 4JKVA 3G50A 3DZAA 2TMVP 3AOUA 2J9WA 4YL1A 2A6EF 1RCPA 3AG2C 4CBEA 2QTVA 3SZRA 1CPRA 2R9RB 1NG1A 4GYTA 4JTCB 5JT4A 1OXBA 2OU6A 2J0WA 3A9CA 3L8IA 4H54A 1T01A 2L6HA 4J32B 4DRJB 2MWQA 5CI8A 2MHRA 3RKOF 2IOQA 2LIGA 3HLZA 2CDQA 2KW3C 2VASA 1FMWA 1T6IA 5KYUA 5T3WA 4CSAC 1JAFA 1ZHZA 2AP3A 2CNWD 4WABA 1HY5A 3U8PA 4G7HF 1J8YF 1U0BB 4JTAB 1NU9C 1M6TA 1PV3A 2KC3A 3LS0A 2LK4A 3T6GB 2G3VA 1O3UA 2C04A 3QVZA 2IXMA 5EGYA 1BDJB 4JVSA 1O5HA 1YLMA 3O6XA 2R03A 3K7DA 4PK4A 5F28E 2HMQA 4QDLA 4A4AA 1FR0A 2HSBA 2L6FA 3PCVA 3GWNA 2EIJC 4M63A 4BG0A 1H9GA 2EPKX 4ZLDA 3MBGA
chains in the Genus database with same CATH topology
2IM8A 2HFIA 2HUJA 2ETSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IM8 A;  2HFI A;  2HUJ A;  2ETS A; 
#chains in the Genus database with same CATH topology
 3S28 A;  2OEV A;  3HNI A;  4OD4 A;  4EBB A;  2NUP A;  3C8G D;  2AVK A;  5E3C A;  3SXM A;  1SF8 A;  5JUA A;  1D1C A;  2WB7 A;  3RFY A;  1HW1 A;  4DXW A;  1TKN A;  3V7O A;  2CCY A;  5L3Q A;  2XS8 A;  4MTO A;  3FOP A;  1VYK A;  3K1I A;  4Z9I A;  4D4N A;  3L34 A;  3GOD A;  3I5Q A;  4OIN F;  3S90 A;  2R7U A;  3HNL A;  4JE9 A;  2L9J A;  1EKY A;  5COG A;  4G7Z F;  3VAY A;  3ZQV A;  4C3B A;  1V54 C;  3LNR A;  2E87 A;  2MYS A;  1D1B A;  1TWC A;  1T5O A;  1V55 C;  2YL1 A;  2IXO A;  2DB4 A;  1E84 A;  2HV7 A;  1C17 M;  2YL7 A;  4KI2 A;  1D0X A;  5L0C A;  1L7C A;  3E9V A;  3KMI A;  2PFD A;  1ZHY A;  1Q0K A;  3Q7G A;  5L0J A;  3C7J A;  3FMS A;  2ZXR A;  3FAJ A;  4NCQ A;  5DLJ A;  3X1O A;  2F22 A;  3KL4 A;  3ZVR A;  3TJ5 A;  1WAS A;  4WGY A;  2OKU A;  2GA0 A;  1RKE A;  2B0H A;  4AL1 A;  1WTY A;  4I1M A;  3C8Z A;  1FFH A;  1N1C A;  4DVZ A;  2HMZ A;  4EBK A;  3QW0 A;  3AG3 C;  1VYI A;  4NY3 A;  2YL3 A;  1WN0 A;  3SYN A;  1EQ1 A;  1LE2 A;  1ZHT A;  4MW3 A;  1FTS A;  3LEO A;  1YZC A;  2DGJ A;  2HUJ A;  1OCZ C;  1A0B A;  2R7R A;  3VYW A;  4HE8 D;  1LVK A;  1ZW3 A;  5F5F A;  4G78 A;  4J7Y A;  3TK0 A;  2AU5 A;  4E7S A;  3OA1 A;  5DS6 A;  2A0U A;  2YZS A;  1TFK B;  2G3K A;  3N0T A;  4D4X A;  3U2M A;  4U5E E;  3TUL A;  2YL0 A;  4XEK A;  4CS9 C;  2PP4 A;  2LCH A;  4I3M A;  4JCZ A;  4BEJ A;  3V5Y A;  1E83 A;  3UMK A;  1XZP A;  3W2W A;  3C8G B;  3ZG1 A;  1LI5 A;  5JSL A;  3WAQ A;  2A68 F;  3B9Q A;  3EHM A;  2FAP B;  3RW0 A;  3O10 A;  4JZA A;  3AG4 C;  2EPN A;  3SXK A;  4B6I A;  1E2X A;  1JOG A;  4DOZ A;  4JJG A;  3DE8 A;  5DQT A;  2HZ8 A;  3GM3 A;  3HKK A;  3J06 A;  2WL8 A;  1VK5 A;  2EIN C;  3ASN C;  4YT8 A;  2QY9 A;  3L0I A;  2XL6 A;  4E17 A;  1WOL A;  4C7O A;  4PR9 A;  1ZYR F;  4JRZ A;  1I4Y A;  1S05 A;  2J46 A;  4CJG A;  3ATP A;  5BQI A;  1OQC A;  2H8A A;  2H7B A;  4IAO A;  4PFO A;  4JEB A;  4XQ1 A;  4ER9 A;  5L0I A;  2Z15 A;  3UGO A;  2OJQ A;  2IXP A;  2KJG A;  1BR1 A;  1BR2 A;  4NTF A;  2HJM A;  1TWG A;  3HJC A;  5L0H A;  5COF A;  3KH2 A;  2L81 A;  2NG1 A;  3IQC A;  3T9O A;  4IGG A;  3B71 A;  1I4Z A;  3KKB A;  4WJ0 A;  2OCC C;  1D0Z A;  2ETS A;  3DMD A;  4K7B A;  3RQF A;  3EFO B;  2L6G A;  3FOO A;  4XWJ A;  3UNG C;  4K0D A;  4ANJ A;  4MVO A;  1G8X A;  4JTD B;  1E85 A;  3KYJ A;  2X0C A;  4G7O F;  2NUT A;  4U9E A;  1YYJ A;  5KYX B;  3K6B A;  2O9X A;  3M79 A;  2Q7R A;  3S27 A;  4CX9 A;  4WGZ A;  1Z5Z A;  1IW7 F;  2KNH A;  3A11 A;  5KYW A;  2VCC A;  1IZM A;  3LLI A;  2CGE A;  3ASO C;  4Z9J A;  3T6B A;  2XLD A;  3LNM B;  4NTB A;  3NRH A;  1JPJ A;  1U89 A;  1KNY A;  1T9K A;  3PDM P;  2ZPA A;  2NUP B;  4MW8 A;  4CS8 A;  4E7Z A;  3HTK C;  1BR4 A;  1LS4 A;  2A6H F;  3X2Q C;  3CAX A;  4H4K C;  1L3P A;  1YVI A;  2R7W A;  1OR3 A;  3C62 A;  1LM3 B;  2XLW A;  3L1M A;  3O39 A;  4FX5 A;  3TJ6 A;  4JCH A;  3ZTM A;  3DKA A;  1H7I A;  2YRF A;  1VMA A;  4EKW A;  2IXN A;  3HNJ A;  3IPM O;  3RYL A;  1WAT A;  2AWY A;  3GEH A;  4ULW A;  1NFO A;  3SXY A;  2EIL C;  2Y3H A;  4AE4 A;  4BJ1 A;  3WG7 C;  3GEI A;  2HFI A;  3AG1 C;  3FXH A;  3PMR A;  5EK0 A;  2Q00 A;  3IHU A;  2R7S A;  1U6H A;  1G5Z A;  3OWT A;  1RJ9 A;  4U5C E;  1UFB A;  3S9O A;  3ZIB A;  4P6I C;  1GGQ A;  4AX2 A;  4C3E A;  4JW1 A;  3S0X A;  2Q9C A;  4LLC A;  3M15 A;  3U5S A;  2EPO A;  1J8M F;  2IYL D;  3NG1 A;  1TFO B;  4YL3 A;  3WOD F;  3K1I C;  1QLE C;  2P61 A;  1LPE A;  2KK1 A;  1ZU5 A;  3TOL A;  2VH3 A;  1APC A;  3EZH A;  1YDI A;  4XEV A;  3QMK A;  1ZU4 A;  1RKE B;  2GDC A;  4JIO A;  2GAQ A;  2XL4 A;  3H2V A;  3SEO A;  4YT2 A;  3E70 C;  3JYH A;  2WZG A;  3KYI A;  4G0H A;  2LFD A;  2XLE A;  3ECS A;  3RVZ A;  1EA8 A;  3V5Z A;  3IQ6 A;  3HNK A;  4I1O B;  2OQM A;  1PD0 A;  3QZC A;  3QVY A;  5KYN A;  2WZL A;  3JRT A;  4HFF B;  1B68 A;  4BJT A;  2I8B A;  2I15 A;  4IRU A;  4LER A;  3DAG A;  3K66 A;  2UUH A;  1CPQ A;  3I5P A;  3VF0 A;  3DM9 B;  2PX3 A;  1MND A;  3H2U A;  3ITF A;  5JS5 A;  1OW7 A;  2LP4 A;  3NYL A;  4P9T A;  1ZZP A;  5K0I A;  3JTL O;  2XRH A;  5GPG B;  2R7X A;  2WVO A;  3AQC A;  3ZWI A;  4CS7 A;  3MFN A;  4MVU A;  3S84 A;  2WZF A;  1K40 A;  1M56 C;  1XZQ A;  1PCX A;  1V74 B;  4DVY P;  3DE9 A;  1D1A A;  4YT5 A;  2FGY A;  2Y69 C;  3F46 A;  1JR8 A;  5COM A;  2D4U A;  1MMN A;  4XPY A;  5D91 A;  1ORJ A;  4O79 A;  4PJM A;  2YKZ A;  1ZHX A;  2UUI A;  1WWP A;  2DYS C;  4HEA J;  2EPL X;  3C63 A;  4C7O B;  2ICW G;  2OEX A;  5AGF A;  4PFP A;  5A6B A;  1BZ4 A;  3UMH A;  1SMY F;  5HSW A;  3U8V A;  1H9T A;  4QI2 A;  1GS9 A;  1NZE A;  2Q9B A;  4O7G A;  1ST6 A;  2AWC A;  2YEV A;  3MLG A;  4LDK A;  4N6H A;  2PBE A;  3U2L A;  5KYY A;  1G4W R;  4LDR A;  1Q0D A;  2PX0 A;  1Q0M A;  5DS4 A;  3JZ0 A;  3JSZ A;  1XWJ A;  2X51 A;  3NKE A;  3N2Z B;  4RD9 A;  4W8K A;  5B1B C;  3O55 A;  4PJN A;  5FCL A;  2R7T A;  3FDQ A;  3RH3 A;  2LFF A;  4P9F A;  3W2V A;  3BEH A;  2Q9A A;  5EHH A;  1ZVZ A;  2DYR C;  2NUT B;  4X0R A;  1OCC C;  3CEX A;  3F47 A;  1M2V A;  3JCU Q;  4YJW A;  3RQE A;  2ZXO A;  5T1D B;  1OCO C;  5L3V A;  1RMV A;  1S7Z A;  1TWA A;  1UG7 A;  3MX3 A;  2EIM C;  2YHS A;  4XEF A;  5DS5 A;  3RF3 A;  1FMV A;  4BJ6 C;  2GFH A;  3MYI A;  4PJJ A;  2BC5 A;  5CI9 A;  2PNO A;  4J30 B;  3R7C A;  3EGX A;  4E0H A;  1Z23 A;  1MMA A;  3NMJ A;  5CIV A;  3MYF A;  2W4B A;  1FAP B;  2QE9 A;  1Z7Q c;  2KSF A;  5KYU B;  4BJ6 A;  4N4W A;  1YZA A;  3QW1 A;  2ZXW C;  1C02 A;  4MVM A;  2XLV A;  3EH1 A;  3W8H A;  3EPV A;  3RQG A;  1M57 C;  4EHP A;  1AEP A;  2CW0 F;  2YWA A;  4N06 A;  1Z63 A;  3OEO A;  3SNH A;  3B29 A;  1VB5 A;  3DJU B;  4OD5 A;  3GOR A;  5F5H A;  5A6B D;  4KNW A;  5A6J A;  4ONS A;  2XLM A;  2XSE A;  1NLX A;  4R32 A;  3VRC A;  5TJ5 E;  2J0X A;  4YN0 B;  3KPH A;  1R5I D;  3WHN A;  5E2Q A;  2M64 A;  1M2O A;  4JUR I;  1RJ9 B;  1LS1 A;  1YA9 A;  3W8I A;  4CS8 C;  4OIR F;  3EGD A;  2R25 A;  4QI0 A;  4O6N A;  1HE1 A;  4U5H A;  2XXA A;  2OJE D;  1QSP A;  2OOC A;  3FAP B;  2ZXP A;  2XLH A;  4AL0 A;  2VB6 A;  2XM4 A;  5JVE A;  2IBF A;  1OKK A;  2LQG A;  3LS1 A;  4MVQ A;  5E3A A;  5BQG A;  2QUP A;  5E33 A;  4EWC A;  4MVS A;  1OCR C;  1HMO A;  1Z3I X;  3RVY A;  1VLS A;  4MND A;  4BPM A;  2J9U A;  3M4B A;  2H7V C;  4O6Y A;  2RD9 A;  5FZT A;  3GEE A;  1YAU O;  2J9B A;  3JYY A;  4O6M A;  1AUE A;  5AC4 A;  2ZD9 A;  1SR2 A;  1I5N A;  3U9M A;  1LE4 A;  3C18 A;  2HJ3 A;  3EZI A;  4DRH B;  2Y3D A;  1G4U S;  5JP7 A;  3TOM A;  1ZW2 A;  1QQ3 A;  2W9Y A;  4CDY A;  1WGW A;  4MS2 A;  3US6 A;  3AGT A;  2YLG A;  1ORY A;  4JJF A;  3EHN A;  3ZTZ A;  4C3D A;  3CQZ A;  3TD7 A;  4CIP A;  2NSG A;  1Q0F A;  4L6R A;  1A7V A;  3JSE O;  4OIO F;  4XPW A;  4E0I A;  2W4M A;  2YLI A;  2HS5 A;  1JPN A;  3ZC4 A;  2HSQ A;  2PF4 E;  2DI3 A;  2HV6 A;  1QVX A;  2HKV A;  3EG9 A;  3UMI A;  3ZSU A;  1YYX A;  3DI5 A;  3LEV A;  256B A;  3ZQY A;  4YT4 A;  3DD7 A;  3LUT B;  2CYD A;  3LLK A;  1YA7 O;  2C03 A;  4U5F E;  3U3F A;  4DJ9 A;  1GM5 A;  4LDQ A;  4U9D A;  4F4B A;  1LIH A;  1TQG A;  3EFO A;  4ULV A;  1HE9 A;  2V26 A;  1PD1 A;  4N6C A;  3QTH A;  4J7T A;  3NMI A;  1A41 A;  3NYM A;  4AK9 A;  2B0J A;  2J9V A;  3EQL F;  3G4X A;  3M4C A;  3Q6M A;  4NC3 A;  3S29 A;  4CDA A;  3U0C A;  3NKD A;  4CSA A;  4EUK B;  5KYX A;  3B0U X;  1D0Y A;  5DVW A;  4LLE A;  2R02 A;  2V3C C;  5D92 A;  1Y6D A;  5A6K A;  2BL2 A;  1OKK D;  2QLA A;  4Q7C A;  3DJN B;  3CSK A;  1MNE A;  3FHD A;  4BJ5 C;  1AVO B;  1C03 A;  2KQ9 A;  3JRM O;  5B3S C;  1NU7 D;  5L0D A;  1BBH A;  5KYY B;  1EI7 A;  1F1M A;  1NBB A;  1RXQ A;  1SZI A;  3W4Y A;  5BUO A;  1OW6 A;  4U5B E;  3K33 A;  3JT1 A;  4GEH A;  2J7P A;  1QZX A;  4BJ5 A;  1NFN A;  3IQ5 A;  3BRJ A;  1CGO A;  4MTG A;  3GAN A;  4XPX A;  3UGP A;  1V4A A;  2YVK A;  3L8J A;  3K1H A;  4PAC A;  3UR3 C;  3NYJ A;  2R05 A;  4FES A;  4FAP B;  3LJB A;  3Q6N A;  5A6A A;  1MMG A;  1KU2 A;  4YL0 A;  1M2V B;  3NMK A;  4NQF A;  1E86 A;  4NTA A;  1DOV A;  1MMD A;  2M4E A;  2XS1 A;  2VCA A;  4E18 A;  2Y3G A;  3H65 A;  1K05 A;  3AGU A;  3DWW A;  5AC5 A;  4A2N B;  1FNT c;  4KC9 A;  1T6Q A;  1VOM A;  1LI7 A;  4GQH A;  3V5X A;  4RDA A;  4JEA A;  4YK5 A;  5BQH A;  4UDV A;  3B0V C;  3EJN A;  2Y39 A;  3IQT A;  1NSG B;  3G4Z A;  4YWQ A;  2XM0 A;  2A69 F;  3EGX B;  2P0N A;  5JRA A;  1HW2 A;  3R2P A;  4I44 A;  4DBR A;  1JRA A;  4FWV A;  4KNV A;  1OW8 A;  4MVR A;  1QPU A;  4Z9H A;  4Q4Z F;  4EIY A;  2A0B A;  3T4R A;  1MQV A;  1TR2 A;  4IAQ A;  4LAC B;  2R7O A;  2LSE A;  2Q3T A;  1A7D A;  3U9J A;  2BE5 F;  3ZDL A;  3SP1 A;  3POV A;  3FVY A;  2RSE B;  4PJL A;  4U5G A;  4DRI B;  4BEM J;  2EPM X;  2YQY A;  3RIP A;  4IB4 A;  3IEE A;  2H7O A;  4MQ9 F;  5L0G A;  2D5R B;  3PHF 2;  1KTM A;  3TQO A;  1OXK A;  4DBQ A;  3DM5 A;  2FFH A;  2R7Q A;  2G62 A;  5B3I A;  5KYW B;  1YAR O;  3EGD B;  3GM1 A;  1W2W A;  4MVZ A;  5DQZ A;  1O87 A;  2XXA B;  2P7V A;  1ZHW A;  2VCB A;  2EIK C;  2J7P D;  2KYH A;  1H6G A;  2WVN A;  1VLT A;  3DAF A;  1Y4C A;  3LES A;  2Q4F A;  1LKX A;  2YLD A;  3EH2 A;  3AJM A;  2NSF A;  1Z6A A;  3NDB B;  2ASR A;  2J8W A;  2JD3 A;  1Q0G A;  3DXJ F;  4CDV A;  2KGO A;  2OG2 A;  4KBL A;  3T6J A;  5B1A C;  4XLN F;  2Y3B A;  4CS9 A;  1FFT C;  3ABL C;  5IY5 C;  4MTF A;  1JMW A;  4OIP F;  2CNW A;  4RBN A;  3M1C B;  2JX0 A;  2A1D D;  1OR2 A;  2QNL A;  2JPU A;  3I4U A;  4IWB A;  1SYQ A;  4AE4 B;  3GM2 A;  5A69 A;  2R7V A;  3SXZ A;  1YJG A;  1R4T A;  2L7A A;  4U5D E;  3B0P A;  4Q5S F;  1T6U A;  1TWH A;  2J45 A;  2NPU A;  5T3T A;  4HFK B;  1A7E A;  3ABM C;  4CJO A;  3CZ6 A;  1GQA A;  3VM6 A;  4XLP F;  5L0F A;  1DOW A;  1CGM E;  4EBJ A;  5JLI A;  1QKR A;  2VC9 A;  3ABK C;  3EG9 B;  5HV9 A;  1RKC A;  2WVQ A;  3N24 A;  3LAY A;  2P1A A;  2W45 A;  3C8G A;  3GWL A;  4JC7 A;  1HMD A;  4XTK A;  1CGN A;  3U3B A;  4ZLC A;  2IM8 A;  2LD6 A;  2P6V A;  3Q7L A;  2XL8 A;  1VTM P;  4W8P A;  4CIH A;  4IJJ A;  4IAR A;  4OIQ F;  3AQB A;  1ORS C;  2XLO A;  2GWW A;  1K04 A;  4K1O A;  4JKV A;  3G50 A;  3DZA A;  2TMV P;  3AOU A;  2J9W A;  4YL1 A;  2A6E F;  1RCP A;  3AG2 C;  4CBE A;  2QTV A;  3SZR A;  1CPR A;  2R9R B;  1NG1 A;  4GYT A;  4JTC B;  5JT4 A;  1OXB A;  2OU6 A;  2J0W A;  3A9C A;  3L8I A;  4H54 A;  1T01 A;  2L6H A;  4J32 B;  4DRJ B;  2MWQ A;  5CI8 A;  2MHR A;  3RKO F;  2IOQ A;  2LIG A;  3HLZ A;  2CDQ A;  2KW3 C;  2VAS A;  1FMW A;  1T6I A;  5KYU A;  5T3W A;  4CSA C;  1JAF A;  1ZHZ A;  2AP3 A;  2CNW D;  4WAB A;  1HY5 A;  3U8P A;  4G7H F;  1J8Y F;  1U0B B;  4JTA B;  1NU9 C;  1M6T A;  1PV3 A;  2KC3 A;  3LS0 A;  2LK4 A;  3T6G B;  2G3V A;  1O3U A;  2C04 A;  3QVZ A;  2IXM A;  5EGY A;  1BDJ B;  4JVS A;  1O5H A;  1YLM A;  3O6X A;  2R03 A;  3K7D A;  4PK4 A;  5F28 E;  2HMQ A;  4QDL A;  4A4A A;  1FR0 A;  2HSB A;  2L6F A;  3PCV A;  3GWN A;  2EIJ C;  4M63 A;  4BG0 A;  1H9G A;  2EPK X;  4ZLD A;  3MBG A; 
#chains in the Genus database with same CATH homology
 2IM8 A;  2HFI A;  2HUJ A;  2ETS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...