3AQBA

M. luteus b-p 26 heterodimeric hexaprenyl diphosphate synthase in complex with magnesium
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
135
structure length
135
Chain Sequence
MMRYLHKIELELNRLTSRYPFFKKIAFDAEIIKLVDDLNVDENVKCAIVAIDTSMRMQDFINEDNKDSFVLSTDVLSALFYKYLSQPFYQHDFLVLTDCVSRINELKSIRATITDEIALHNINKQIHYMFIQPYM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Component A of hexaprenyl diphosphate synthase
publication title Crystal structure of heterodimeric hexaprenyl diphosphate synthase from Micrococcus luteus B-P 26 reveals that the small subunit is directly involved in the product chain length regulation.
pubmed doi rcsb
source organism Micrococcus luteus
molecule tags Transferase
total genus 58
structure length 135
sequence length 135
chains with identical sequence C
ec nomenclature ec 2.5.1.83: Hexaprenyl-diphosphate synthase ((2E,6E)-farnesyl-diphosphate specific).
pdb deposition date 2010-10-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1450 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3aqbA00
3AQBA 3AQCA
chains in the Genus database with same CATH superfamily
3DJNB 3IQTA 4ONSA 5JP7A 3TJ6A 3KH2A 3DD7A 3B29A 4YL1A 3IHUA 3LEVA 2C04A 2KW3C 5JSLA 4RBNA 3H65A 3EZIA 4AL0A 3UMIA 3QVZA 2H7VC 1OXKA 3ZWIA 4E0IA 2QTVA 3DXJF 3AQCA 1M2OA 2ASRA 5DS4A 2YZSA 2R7VA 5EHHA 3HNKA 4NTBA 4G7ZF 5DS5A 2JD3A 3JSZA 1QPUA 3ABKC 3OEOA 5A6BD 2AVKA 2TMVP 1S7ZA 3S27A 2GFHA 4BG0A 3DZAA 3UNGC 4QDLA 2AWCA 2XL6A 1RKCA 2A69F 4JC7A 3TD7A 4CBEA 1OQCA 2ICWG 1FNTc 2Y3HA 3TJ5A 2J9WA 4KI2A 2WL8A 3LUTB 3ZIBA 3W2VA 2E87A 4A4AA 1BR2A 3LNRA 4DBRA 2XLHA 2YVKA 5A6AA 1NBBA 2EPMX 3JSEO 3EGDB 1JAFA 2MWQA 3W8IA 1Q0MA 3C8GB 4PFOA 3VF0A 4MQ9F 4J32B 4U5BE 2R03A 4CDYA 4DVZA 2R9RB 3EFOA 3TULA 1MNDA 3W2WA 5DS6A 1VTMP 3GEHA 2CNWA 5COMA 4G7HF 1SF8A 3PMRA 3ABMC 2DI3A 1TFOB 4PJMA 1KU2A 2NUTB 3FMSA 1ZHZA 3C8GA 1WTYA 1BDJB 1YVIA 3IQ6A 1XZQA 2VCBA 1FMVA 2WZGA 3KMIA 1O3UA 4YJWA 5COGA 4Z9HA 3R2PA 4MNDA 5BQHA 2HV6A 5KYYA 1K04A 2XM0A 2LIGA 3LS0A 5COFA 3U3BA 1Z6AA 2W4MA 3ZC4A 2LFFA 3ZDLA 2XLEA 2AP3A 1I4ZA 2DB4A 3Q6NA 2X51A 5B1BC 3A11A 4ZLDA 4J7YA 2OOCA 3U3FA 3Q7GA 1BZ4A 1UG7A 1YJGA 3EH1A 2HUJA 5B3IA 4Q4ZF 2P7VA 1A7DA 1G4WR 3BEHA 1TQGA 3DM5A 4P9TA 2J8WA 3V5XA 1O87A 3RF3A 1E86A 5DQZA 3S84A 4CS8C 2L7AA 1T01A 3B71A 1WASA 3F47A 3SNHA 4N6CA 3E9VA 1T5OA 2IXMA 3S28A 2KYHA 1CGNA 2OJED 4G0HA 1TWHA 3PDMP 5E33A 1BBHA 2FGYA 3A9CA 4PJLA 4AE4B 1YARO 5FZTA 3EH2A 4CIHA 1YZAA 4LDQA 4EBBA 1V74B 4DVYP 4XPYA 5A6BA 2OG2A 2YL0A 2XLOA 5CI8A 1CGOA 1Q0DA 2PP4A 3FAPB 3O6XA 4M63A 3X2QC 2B0JA 3JRMO 1FR0A 5BQIA 5A69A 3MFNA 1LE2A 1OXBA 3HJCA 2Q3TA 4LLEA 4WJ0A 3RIPA 5KYUB 1LIHA 2ZXRA 3ASOC 4NCQA 3RQEA 1A7EA 3SXMA 1M56C 2NG1A 2JX0A 1TKNA 1NFOA 3LLKA 3N2ZB 4MW8A 4CS9C 4CIPA 4CSAC 1JR8A 1HMDA 2X0CA 3TOLA 1UFBA 4NQFA 4HFFB 2G3KA 5E3AA 1HE9A 3Q6MA 1ZHWA 3EGXB 2P6VA 4JCZA 5KYUA 2B0HA 3W8HA 1HW1A 3J06A 3AOUA 1LI5A 1SR2A 3TQOA 1J8MF 5JUAA 1S05A 2HSQA 1ORJA 2R02A 4DRIB 2LD6A 3G4ZA 5AC5A 1FFTC 1QVXA 2MHRA 2MYSA 4P9FA 4EBKA 2EIJC 4CS7A 3DAFA 3PCVA 3T4RA 3EQLF 1FMWA 2NSFA 4E7SA 3EHMA 2XXAB 1A41A 2CCYA 3GANA 3UMHA 1TWAA 3C62A 4L6RA 4W8PA 4AX2A 3M4BA 1JRAA 5L3QA 3GODA 2ZD9A 1VYKA 2LCHA 1MMDA 5E3CA 1E84A 3AG4C 2LP4A 5JS5A 3HLZA 4JTAB 1VMAA 1D0YA 2CW0F 3RVZA 3AG3C 4FWVA 3C18A 5IY5C 3DKAA 2XXAA 4P6IC 3VAYA 1ZZPA 3NRHA 2Y39A 1WGWA 2QNLA 2L9JA 2PFDA 4IAOA 3EHNA 2KNHA 4QI0A 2R05A 3M15A 4IARA 1ZU5A 3LNMB 5T3WA 2XL8A 1Z23A 2IXOA 4ER9A 1K05A 4C7OA 3FOPA 4KC9A 5D92A 4YK5A 1LS1A 4MW3A 5T1DB 4DXWA 1EKYA 2QY9A 4EKWA 2Q9BA 3X1OA 3ZQYA 1BR1A 4O6YA 1VYIA 4LACB 5JT4A 3CQZA 5FCLA 4LLCA 2H7OA 5F5HA 5A6JA 2OEVA 3RH3A 2GA0A 2VASA 3DAGA 5CIVA 1RKEB 4WABA 1SMYF 3V7OA 1D0ZA 4C3DA 1SYQA 2WB7A 3UGOA 4FX5A 3RW0A 1C02A 5JLIA 1FFHA 1G4US 3Q7LA 1RMVA 1O5HA 3OA1A 2LSEA 2A6HF 2YL3A 2R25A 2YLIA 2JPUA 2A0UA 3U0CA 1RKEA 5GPGB 2HMZA 2QE9A 4DOZA 3T9OA 3EFOB 5T3TA 5HV9A 3K1IC 4U5FE 2J7PD 4YT5A 1D0XA 1QSPA 1YYXA 4HE8D 4HFKB 2GWWA 3TOMA 2Q9CA 2EPNA 4C3EA 4KNVA 2P1AA 4IAQA 4XPXA 3GORA 3US6A 4I3MA 2XM4A 5CI9A 5JVEA 3KKBA 1D1CA 1MNEA 1ZHXA 4N06A 4U5GA 5KYYB 1IZMA 1T9KA 1U6HA 4X0RA 2O9XA 4CX9A 2UUHA 3K33A 4Z9JA 3KYIA 4AK9A 3LESA 2Y3BA 3NKDA 2XL4A 5BQGA 4E18A 1CPRA 1M57C 1VLTA 3DE8A 4H4KC 1LVKA 4JE9A 4O7GA 1FAPB 1YDIA 3IQ5A 4N4WA 2OJQA 2WVQA 3S9OA 4W8KA 5L0IA 2XRHA 2NSGA 4OD4A 2EIKC 4G78A 2R7RA 4JURI 1LM3B 1WOLA 4NY3A 2YL7A 3HNJA 3I4UA 3S29A 2YEVA 1G5ZA 3PHF2 4IRUA 1EA8A 3NMJA 3RQGA 1RJ9A 4GQHA 2I15A 1NG1A 3NYLA 2Q9AA 3JTLO 4BJ6C 2R7UA 4BJ5C 4CS8A 3ECSA 1L7CA 4K7BA 3QW0A 3LJBA 3DM9B 3EZHA 1VOMA 2UUIA 4U5HA 3AQBA 3KPHA 3S0XA 3GEEA 4OIQF 2J45A 2OU6A 5TJ5E 4Q5SF 1NFNA 1TFKB 1HMOA 1F1MA 4YT4A 1LI7A 2XLDA 2KSFA 5HSWA 2LK4A 2VH3A 5L0JA 1WWPA 1FTSA 2I8BA 3U9MA 3QZCA 2XS1A 1C17M 4JEBA 2P61A 2R7TA 1M6TA 1U89A 2EPKX 3SXZA 2XLWA 4NTFA 1ZHYA 4CS9A 1PCXA 1Y4CA 1Q0FA 2EPLX 3GM3A 2Y3DA 4KBLA 1GS9A 3LLIA 1ZW2A 4K0DA 3IEEA 2L6HA 3C63A 4OINF 3FXHA 1A7VA 4O79A 2J7PA 2VCCA 1PD1A 4PJNA 1ORYA 2EIMC 3GEIA 4XEVA 4BPMA 1XWJA 3FOOA 4E7ZA 1YA9A 2VB6A 2W45A 3G4XA 3MYFA 3U5SA 1T6UA 4MVMA 3L8JA 3H2UA 3FHDA 3ITFA 4MTOA 4OD5A 3SP1A 3ZTZA 1OR2A 3RYLA 2BE5F 3MLGA 4PACA 1ST6A 4O6NA 5L0GA 1Z63A 3EG9A 3RQFA 5L0CA 1NU7D 1NU9C 2PF4E 2ZPAA 3G50A 1OW7A 2H8AA 3IPMO 3O55A 3NMKA 3ABLC 3ZG1A 3NKEA 5AGFA 4KNWA 1VK5A 5E2QA 3U8VA 4GEHA 1E83A 1EI7A 3AG2C 1ZYRF 1VLSA 5DLJA 5KYNA 3I5PA 4ULVA 2IXPA 1EQ1A 5DVWA 1BR4A 3T6GB 2OQMA 3QVYA 4JRZA 4GYTA 4C3BA 2HZ8A 4EIYA 4EUKB 4BJ1A 4C7OB 3H2VA 1JPJA 4JZAA 1MMNA 3B9QA 2KK1A 2HJ3A 3GM2A 2OKUA 3O10A 4IJJA 4I1OB 1ORSC 2HSBA 2ETSA 3VRCA 3UR3C 3WHNA 2Q00A 1HE1A 2YL1A 3K1HA 4MVUA 1OCCC 1JOGA 1OW6A 2J9VA 2VCAA 2WVNA 2XSEA 3HNLA 4YL0A 1Q0KA 1Z7Qc 3AJMA 3NYMA 4DBQA 4XLPF 2YRFA 3M1CB 3DJUB 1JPNA 2Z15A 4IB4A 2C03A 2G3VA 4BEJA 3W4YA 2QUPA 1WN0A 3NG1A 1HW2A 1Q0GA 3SXKA 1T6IA 4XEFA 5EK0A 1R5ID 3UMKA 1GM5A 1HY5A 1NSGB 4UDVA 1A0BA 1TWCA 4LDKA 2PX0A 4JTCB 1H9GA 3DMDA 4U5EE 2XS8A 3TK0A 3U8PA 3EPVA 3N0TA 3V5YA 4YN0B 2J9UA 1ZU4A 4XTKA 3T6JA 4BEMJ 3AGUA 4CDAA 2W4BA 4PR9A 1W2WA 4EHPA 4FAPB 1QZXA 3CAXA 3K1IA 2WZFA 1Y6DA 2EILC 3MYIA 4Q7CA 2Q7RA 1YLMA 3IQCA 2CYDA 2IBFA 3N24A 3QW1A 1V55C 3OWTA 4MTFA 4NTAA 3U2MA 3U2LA 5L0DA 2M64A 2PBEA 1OCOC 3HNIA 3RVYA 3L1MA 4MS2A 2LQGA 4OIOF 2CDQA 3DE9A 3WG7C 1T6QA 2PX3A 3QTHA 3ZSUA 4G7OF 1AUEA 1PV3A 4EBJA 4IWBA 4ZLCA 1LPEA 1OCZC 4XWJA 3CSKA 1Z3IX 4OIRF 3NYJA 2WZLA 3AGTA 3C8ZA 2VC9A 3POVA 2M4EA 4WGZA 4D4XA 4U9EA 5AC4A 1DOVA 4JJGA 2YWAA 4H54A 4JTDB 2A68F 1IW7F 3CZ6A 1RXQA 3C7JA 1RJ9B 1SZIA 3LEOA 4O6MA 4J30B 1D1BA 1V54C 3E70C 4F4BA 2HV7A 4OIPF 1ZHTA 1QLEC 1TWGA 2Q4FA 1C03A 3LS1A 4U9DA 3CEXA 3QMKA 3SZRA 3L8IA 3VYWA 1K40A 1MMAA 4RD9A 5A6KA 4MTGA 4BJ6A 3FVYA 4BJ5A 1APCA 3ATPA 5B3SC 3O39A 1YZCA 4WGYA 4YT2A 3K6BA 3LAYA 4E0HA 4JW1A 2YLDA 5L3VA 3WODF 1VB5A 4LERA 1GGQA 4K1OA 4JCHA 4ULWA 4EWCA 1H9TA 4NC3A 2V26A 3K7DA 1DOWA 4MVZA 2BL2A 2R7QA 4PJJA 4XPWA 1WATA 3U9JA 4FESA 4AE4A 1OKKA 2PNOA 1OW8A 2OCCC 4CDVA 2AU5A 3M79A 4YT8A 1N1CA 3EGDA 4ANJA 5JRAA 2CGEA 1J8YF 3MX3A 2YHSA 4I44A 3GWNA 3JYYA 5D91A 4JIOA 3R7CA 5BUOA 2OEXA 5F28E 1I4YA 1KNYA 2DYSC 2GDCA 3KYJA 256BA 3HKKA 1AVOB 4E17A 2P0NA 2R7SA 3GM1A 2D5RB 1H7IA 2J0WA 2ZXOA 4R32A 2KQ9A 1PD0A 1YAUO 4J7TA 2NUTA 4XLNF 1ZW3A 2H7BA 2RSEB 2XLMA 2YQYA 3EJNA 4CJOA 2FAPB 3EG9B 5KYXB 1LS4A 2IXNA 5F5FA 1G8XA 1OCRC 1D1AA 3NMIA 2HFIA 3FDQA 2YLGA 1MQVA 3ZTMA 1JMWA 3VM6A 2A1DD 4U5DE 5EGYA 3SYNA 5B1AC 1AEPA 3SEOA 2R7XA 2HMQA 4JEAA 3DI5A 1OR3A 2EINC 2HKVA 5K0IA 5KYXA 2V3CC 1KTMA 3KL4A 2KGOA 1B68A 3JCUQ 4DRHB 4I1MA 3B0VC 3V5ZA 1M2VB 2L6FA 1V4AA 4BJTA 2NPUA 2R7OA 4MVOA 1ZVZA 4AL1A 3SXYA 3GWLA 2QLAA 1LE4A 4MVSA 3RKOF 3ZQVA 3B0PA 5L0HA 4JJFA 4CJGA 3L0IA 3K66A 2F22A 1H6GA 3ASNC 2L6GA 1LKXA 2KC3A 2Y69C 1U0BB 2KJGA 2WVOA 3FAJA 3WAQA 1M2VA 3ZVRA 1NLXA 2R7WA 2GAQA 4A2NB 1E85A 1XZPA 2RD9A 4DJ9A 2HS5A 1QKRA 3I5QA 4D4NA 4YWQA 2EPOA 1Z5ZA 4JVSA 2BC5A 1GQAA 1CGME 4B6IA 4MVRA 3RFYA 4QI2A 1RCPA 2AWYA 2IOQA 2NUPB 3AG1C 3DWWA 1E2XA 2XLVA 5L0FA 2Y3GA 2L81A 1YYJA 3MBGA 4Z9IA 1NZEA 1I5NA 4N6HA 3EGXA 4XQ1A 4CSAA 2DGJA 1QQ3A 3BRJA 3NDBB 3M4CA 1MMGA 2J0XA 1L3PA 3JT1A 4MVQA 2IM8A 1R4TA 4PK4A 2FFHA 3T6BA 1CPQA 1TR2A 4DRJB 5KYWB 3L34A 2NUPA 2YKZA 2J46A 2CNWD 2W9YA 3JYHA 2J9BA 4PFPA 1OKKD 2A0BA 4HEAJ 4XEKA 3UGPA 2ZXPA 3JRTA 3B0UX 3S90A 3C8GD 4LDRA 2D4UA 2HJMA 3F46A 2A6EF 4U5CE 5DQTA 4RDAA 2G62A 3JZ0A 2LFDA 2ZXWC 4YL3A 5KYWA 3HTKC 4JKVA 1YA7O 2DYRC 2IYLD 4IGGA
chains in the Genus database with same CATH topology
3DJNB 3KH2A 3DD7A 3LEVA 2C04A 2KW3C 4RBNA 3H65A 3EZIA 3UMIA 2H7VC 2QTVA 3DXJF 3AQCA 1M2OA 5DS4A 2YZSA 2R7VA 5EHHA 4G7ZF 5DS5A 2JD3A 3JSZA 3ABKC 3OEOA 1S7ZA 3S27A 2GFHA 4BG0A 3DZAA 3UNGC 4QDLA 4CBEA 2A69F 3TD7A 2Y3HA 2J9WA 4KI2A 2WL8A 3ZIBA 3W2VA 2E87A 1BR2A 3LNRA 4DBRA 3EGDB 2MWQA 3W8IA 4PFOA 4MQ9F 4J32B 4U5BE 4DVZA 3EFOA 1MNDA 3W2WA 5DS6A 2CNWA 4G7HF 1SF8A 3PMRA 3ABMC 4PJMA 1KU2A 2NUTB 1ZHZA 4LACB 3KMIA 4YJWA 1FMVA 2WZGA 4MNDA 5KYYA 2HV6A 3LS0A 1Z6AA 2W4MA 3ZC4A 3Q6NA 2X51A 5B1BC 4ZLDA 3Q7GA 3EH1A 4Q4ZF 2P7VA 3DM5A 1O87A 5DQZA 4CS8C 3F47A 3SNHA 3E9VA 2IXMA 3S28A 4G0HA 1TWHA 5E33A 2FGYA 4PJLA 4AE4B 3EH2A 4CIHA 4EBBA 4DVYP 2OG2A 5CI8A 2PP4A 3O6XA 4M63A 3X2QC 2B0JA 3HJCA 2Q3TA 4LLEA 4WJ0A 3RIPA 5KYUB 2ZXRA 3ASOC 4AE4A 1M56C 2NG1A 3N2ZB 1TKNA 3LLKA 4CS9C 4CSAC 4HFFB 2G3KA 5E3AA 3Q6MA 1ZHWA 3EGXB 2P6VA 5KYUA 3W8HA 1J8MF 1FFTC 2MYSA 2EIJC 4CS7A 3DAFA 3T4RA 3EQLF 1FMWA 4E7SA 3EHMA 2XXAB 3GANA 3UMHA 1TWAA 4AX2A 5L3QA 3GODA 1VYKA 5E3CA 1MMDA 3AG4C 3HLZA 1VMAA 1D0YA 2CW0F 3AG3C 4FWVA 5IY5C 2XXAA 4P6IC 3VAYA 3NRHA 2Y39A 1WGWA 2L9JA 2PFDA 4IAOA 3EHNA 2KNHA 4QI0A 1ZU5A 5T3WA 1Z23A 2IXOA 4C7OA 4KC9A 5D92A 1LS1A 5T1DB 2QY9A 2Q9BA 3X1OA 1BR1A 4O6YA 1VYIA 3CQZA 5FCLA 4LLCA 2H7OA 5F5HA 3RH3A 2VASA 3DAGA 1SMYF 3V7OA 1D0ZA 4C3DA 2WB7A 3UGOA 4FX5A 1FFHA 3Q7LA 1O5HA 3OA1A 2LSEA 2A6HF 4DOZA 3EFOB 5T3TA 3K1IC 4U5FE 2J7PD 4YT5A 1D0XA 4HE8D 4HFKB 2Q9CA 4C3EA 4KNVA 4I3MA 5CI9A 3KKBA 1D1CA 1MNEA 1ZHXA 4N06A 4U5GA 5KYYB 1IZMA 4X0RA 2O9XA 3K33A 4AK9A 3LESA 2Y3BA 3NKDA 2XL4A 1M57C 4H4KC 1LVKA 4O7GA 2WVQA 4W8KA 2XRHA 4OD4A 2EIKC 2R7RA 4JURI 4NY3A 3I4UA 3S29A 2YEVA 3PHF2 4IRUA 1RJ9A 1NG1A 3NYLA 2Q9AA 4BJ6C 2R7UA 4BJ5C 4CS8A 3ECSA 4K7BA 3LJBA 3DM9B 3EZHA 1VOMA 4U5HA 3AQBA 3S0XA 4OIQF 2J45A 4Q5SF 4YT4A 5HSWA 2VH3A 1FTSA 2I8BA 3QZCA 2R7TA 1ZHYA 4CS9A 1PCXA 4CSAA 4KBLA 2Y3DA 4K0DA 3LLIA 3IEEA 4OINF 4O79A 2J7PA 1PD1A 4PJNA 2EIMC 4E7ZA 2W45A 2VB6A 4OD5A 3FHDA 3ITFA 3SP1A 3RYLA 2BE5F 3MLGA 1ST6A 4O6NA 1Z63A 3EG9A 1NU7D 1NU9C 2PF4E 2ZPAA 3ABLC 3ZG1A 3NKEA 4KNWA 1VK5A 5E2QA 4GEHA 3AG2C 1ZYRF 5DLJA 5KYNA 3I5PA 2IXPA 5DVWA 1BR4A 4GYTA 4C3BA 4BJ1A 4C7OB 1JPJA 4JZAA 1MMNA 3B9QA 4IJJA 4I1OB 3UR3C 3K1HA 1OCCC 2J9VA 2XSEA 2WVNA 4DBQA 3NYMA 4XLPF 3M1CB 3DJUB 1JPNA 2Z15A 2C03A 2G3VA 4BEJA 3NG1A 3UMKA 1TWCA 2PX0A 3DMDA 4U5EE 3EPVA 3N0TA 4YN0B 2J9UA 1ZU4A 4XTKA 3T6JA 2W4BA 1W2WA 1QZXA 2WZFA 4Q7CA 2EILC 4ANJA 3N24A 1V55C 3OWTA 1OCOC 4OIOF 2CDQA 3WG7C 2PX3A 3ZSUA 4G7OF 4IWBA 4ZLCA 1OCZC 4XWJA 3CSKA 1Z3IX 4OIRF 3NYJA 2WZLA 3POVA 2M4EA 4JJGA 2A68F 1IW7F 3CZ6A 1RJ9B 1SZIA 4O6MA 4J30B 3E70C 1D1BA 1V54C 4F4BA 2HV7A 4OIPF 1ZHTA 1QLEC 1TWGA 3LS1A 3SZRA 5B3SC 3QMKA 3VYWA 1MMAA 4RD9A 4BJ6A 3FVYA 4BJ5A 3O39A 4YT2A 5L3VA 3K6BA 3LAYA 4JW1A 3WODF 4LERA 4JCHA 4ULWA 4EWCA 2V26A 3K7DA 4PJJA 2R7QA 4FESA 1OKKA 2OCCC 4YT8A 1N1CA 3EGDA 2CGEA 1J8YF 3MX3A 2YHSA 4I44A 5BUOA 5D91A 2DYSC 2R7SA 2D5RB 2J0WA 2ZXOA 2KQ9A 1PD0A 2NUTA 4XLNF 2H7BA 3EJNA 3EG9B 5KYXB 2IXNA 5F5FA 1G8XA 1OCRC 1D1AA 3FDQA 2A1DD 4U5DE 5EGYA 3SYNA 5B1AC 3SEOA 2R7XA 2EINC 5KYXA 2V3CC 3KL4A 2KGOA 3JCUQ 4I1MA 3B0VC 1M2VB 4BJTA 2R7OA 3RKOF 3B0PA 4JJFA 3L0IA 3K66A 3ASNC 1LKXA 2Y69C 2KJGA 2WVOA 3FAJA 1M2VA 3ZVRA 2R7WA 4A2NB 4YWQA 3I5QA 1Z5ZA 4JVSA 4B6IA 3RFYA 4QI2A 2IOQA 2NUPB 3AG1C 2Y3GA 2L81A 1NZEA 3EGXA 2DGJA 3NDBB 1MMGA 2J0XA 3JT1A 4PK4A 2FFHA 3T6BA 1TR2A 5KYWB 3L34A 2NUPA 2J46A 2CNWD 2W9YA 3JYHA 4PFPA 1OKKD 4HEAJ 3UGPA 2ZXPA 3JRTA 3B0UX 3F46A 2A6EF 4U5CE 5DQTA 4RDAA 2G62A 2ZXWC 5KYWA 3HTKC 2DYRC 2IYLD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AQB A;  3AQC A; 
#chains in the Genus database with same CATH topology
 3DJN B;  3IQT A;  4ONS A;  5JP7 A;  3TJ6 A;  3KH2 A;  3DD7 A;  3B29 A;  4YL1 A;  3IHU A;  3LEV A;  2C04 A;  2KW3 C;  5JSL A;  4RBN A;  3H65 A;  3EZI A;  4AL0 A;  3UMI A;  3QVZ A;  2H7V C;  1OXK A;  3ZWI A;  4E0I A;  2QTV A;  3DXJ F;  3AQC A;  1M2O A;  2ASR A;  5DS4 A;  2YZS A;  2R7V A;  5EHH A;  3HNK A;  4NTB A;  4G7Z F;  5DS5 A;  2JD3 A;  3JSZ A;  1QPU A;  3ABK C;  3OEO A;  5A6B D;  2AVK A;  2TMV P;  1S7Z A;  3S27 A;  2GFH A;  4BG0 A;  3DZA A;  3UNG C;  4QDL A;  2AWC A;  2XL6 A;  1RKC A;  2A69 F;  4JC7 A;  3TD7 A;  4CBE A;  1OQC A;  2ICW G;  1FNT c;  2Y3H A;  3TJ5 A;  2J9W A;  4KI2 A;  2WL8 A;  3LUT B;  3ZIB A;  3W2V A;  2E87 A;  4A4A A;  1BR2 A;  3LNR A;  4DBR A;  2XLH A;  2YVK A;  5A6A A;  1NBB A;  2EPM X;  3JSE O;  3EGD B;  1JAF A;  2MWQ A;  3W8I A;  1Q0M A;  3C8G B;  4PFO A;  3VF0 A;  4MQ9 F;  4J32 B;  4U5B E;  2R03 A;  4CDY A;  4DVZ A;  2R9R B;  3EFO A;  3TUL A;  1MND A;  3W2W A;  5DS6 A;  1VTM P;  3GEH A;  2CNW A;  5COM A;  4G7H F;  1SF8 A;  3PMR A;  3ABM C;  2DI3 A;  1TFO B;  4PJM A;  1KU2 A;  2NUT B;  3FMS A;  1ZHZ A;  3C8G A;  1WTY A;  1BDJ B;  1YVI A;  3IQ6 A;  1XZQ A;  2VCB A;  1FMV A;  2WZG A;  3KMI A;  1O3U A;  4YJW A;  5COG A;  4Z9H A;  3R2P A;  4MND A;  5BQH A;  2HV6 A;  5KYY A;  1K04 A;  2XM0 A;  2LIG A;  3LS0 A;  5COF A;  3U3B A;  1Z6A A;  2W4M A;  3ZC4 A;  2LFF A;  3ZDL A;  2XLE A;  2AP3 A;  1I4Z A;  2DB4 A;  3Q6N A;  2X51 A;  5B1B C;  3A11 A;  4ZLD A;  4J7Y A;  2OOC A;  3U3F A;  3Q7G A;  1BZ4 A;  1UG7 A;  1YJG A;  3EH1 A;  2HUJ A;  5B3I A;  4Q4Z F;  2P7V A;  1A7D A;  1G4W R;  3BEH A;  1TQG A;  3DM5 A;  4P9T A;  2J8W A;  3V5X A;  1O87 A;  3RF3 A;  1E86 A;  5DQZ A;  3S84 A;  4CS8 C;  2L7A A;  1T01 A;  3B71 A;  1WAS A;  3F47 A;  3SNH A;  4N6C A;  3E9V A;  1T5O A;  2IXM A;  3S28 A;  2KYH A;  1CGN A;  2OJE D;  4G0H A;  1TWH A;  3PDM P;  5E33 A;  1BBH A;  2FGY A;  3A9C A;  4PJL A;  4AE4 B;  1YAR O;  5FZT A;  3EH2 A;  4CIH A;  1YZA A;  4LDQ A;  4EBB A;  1V74 B;  4DVY P;  4XPY A;  5A6B A;  2OG2 A;  2YL0 A;  2XLO A;  5CI8 A;  1CGO A;  1Q0D A;  2PP4 A;  3FAP B;  3O6X A;  4M63 A;  3X2Q C;  2B0J A;  3JRM O;  1FR0 A;  5BQI A;  5A69 A;  3MFN A;  1LE2 A;  1OXB A;  3HJC A;  2Q3T A;  4LLE A;  4WJ0 A;  3RIP A;  5KYU B;  1LIH A;  2ZXR A;  3ASO C;  4NCQ A;  3RQE A;  1A7E A;  3SXM A;  1M56 C;  2NG1 A;  2JX0 A;  1TKN A;  1NFO A;  3LLK A;  3N2Z B;  4MW8 A;  4CS9 C;  4CIP A;  4CSA C;  1JR8 A;  1HMD A;  2X0C A;  3TOL A;  1UFB A;  4NQF A;  4HFF B;  2G3K A;  5E3A A;  1HE9 A;  3Q6M A;  1ZHW A;  3EGX B;  2P6V A;  4JCZ A;  5KYU A;  2B0H A;  3W8H A;  1HW1 A;  3J06 A;  3AOU A;  1LI5 A;  1SR2 A;  3TQO A;  1J8M F;  5JUA A;  1S05 A;  2HSQ A;  1ORJ A;  2R02 A;  4DRI B;  2LD6 A;  3G4Z A;  5AC5 A;  1FFT C;  1QVX A;  2MHR A;  2MYS A;  4P9F A;  4EBK A;  2EIJ C;  4CS7 A;  3DAF A;  3PCV A;  3T4R A;  3EQL F;  1FMW A;  2NSF A;  4E7S A;  3EHM A;  2XXA B;  1A41 A;  2CCY A;  3GAN A;  3UMH A;  1TWA A;  3C62 A;  4L6R A;  4W8P A;  4AX2 A;  3M4B A;  1JRA A;  5L3Q A;  3GOD A;  2ZD9 A;  1VYK A;  2LCH A;  1MMD A;  5E3C A;  1E84 A;  3AG4 C;  2LP4 A;  5JS5 A;  3HLZ A;  4JTA B;  1VMA A;  1D0Y A;  2CW0 F;  3RVZ A;  3AG3 C;  4FWV A;  3C18 A;  5IY5 C;  3DKA A;  2XXA A;  4P6I C;  3VAY A;  1ZZP A;  3NRH A;  2Y39 A;  1WGW A;  2QNL A;  2L9J A;  2PFD A;  4IAO A;  3EHN A;  2KNH A;  4QI0 A;  2R05 A;  3M15 A;  4IAR A;  1ZU5 A;  3LNM B;  5T3W A;  2XL8 A;  1Z23 A;  2IXO A;  4ER9 A;  1K05 A;  4C7O A;  3FOP A;  4KC9 A;  5D92 A;  4YK5 A;  1LS1 A;  4MW3 A;  5T1D B;  4DXW A;  1EKY A;  2QY9 A;  4EKW A;  2Q9B A;  3X1O A;  3ZQY A;  1BR1 A;  4O6Y A;  1VYI A;  4LAC B;  5JT4 A;  3CQZ A;  5FCL A;  4LLC A;  2H7O A;  5F5H A;  5A6J A;  2OEV A;  3RH3 A;  2GA0 A;  2VAS A;  3DAG A;  5CIV A;  1RKE B;  4WAB A;  1SMY F;  3V7O A;  1D0Z A;  4C3D A;  1SYQ A;  2WB7 A;  3UGO A;  4FX5 A;  3RW0 A;  1C02 A;  5JLI A;  1FFH A;  1G4U S;  3Q7L A;  1RMV A;  1O5H A;  3OA1 A;  2LSE A;  2A6H F;  2YL3 A;  2R25 A;  2YLI A;  2JPU A;  2A0U A;  3U0C A;  1RKE A;  5GPG B;  2HMZ A;  2QE9 A;  4DOZ A;  3T9O A;  3EFO B;  5T3T A;  5HV9 A;  3K1I C;  4U5F E;  2J7P D;  4YT5 A;  1D0X A;  1QSP A;  1YYX A;  4HE8 D;  4HFK B;  2GWW A;  3TOM A;  2Q9C A;  2EPN A;  4C3E A;  4KNV A;  2P1A A;  4IAQ A;  4XPX A;  3GOR A;  3US6 A;  4I3M A;  2XM4 A;  5CI9 A;  5JVE A;  3KKB A;  1D1C A;  1MNE A;  1ZHX A;  4N06 A;  4U5G A;  5KYY B;  1IZM A;  1T9K A;  1U6H A;  4X0R A;  2O9X A;  4CX9 A;  2UUH A;  3K33 A;  4Z9J A;  3KYI A;  4AK9 A;  3LES A;  2Y3B A;  3NKD A;  2XL4 A;  5BQG A;  4E18 A;  1CPR A;  1M57 C;  1VLT A;  3DE8 A;  4H4K C;  1LVK A;  4JE9 A;  4O7G A;  1FAP B;  1YDI A;  3IQ5 A;  4N4W A;  2OJQ A;  2WVQ A;  3S9O A;  4W8K A;  5L0I A;  2XRH A;  2NSG A;  4OD4 A;  2EIK C;  4G78 A;  2R7R A;  4JUR I;  1LM3 B;  1WOL A;  4NY3 A;  2YL7 A;  3HNJ A;  3I4U A;  3S29 A;  2YEV A;  1G5Z A;  3PHF 2;  4IRU A;  1EA8 A;  3NMJ A;  3RQG A;  1RJ9 A;  4GQH A;  2I15 A;  1NG1 A;  3NYL A;  2Q9A A;  3JTL O;  4BJ6 C;  2R7U A;  4BJ5 C;  4CS8 A;  3ECS A;  1L7C A;  4K7B A;  3QW0 A;  3LJB A;  3DM9 B;  3EZH A;  1VOM A;  2UUI A;  4U5H A;  3AQB A;  3KPH A;  3S0X A;  3GEE A;  4OIQ F;  2J45 A;  2OU6 A;  5TJ5 E;  4Q5S F;  1NFN A;  1TFK B;  1HMO A;  1F1M A;  4YT4 A;  1LI7 A;  2XLD A;  2KSF A;  5HSW A;  2LK4 A;  2VH3 A;  5L0J A;  1WWP A;  1FTS A;  2I8B A;  3U9M A;  3QZC A;  2XS1 A;  1C17 M;  4JEB A;  2P61 A;  2R7T A;  1M6T A;  1U89 A;  2EPK X;  3SXZ A;  2XLW A;  4NTF A;  1ZHY A;  4CS9 A;  1PCX A;  1Y4C A;  1Q0F A;  2EPL X;  3GM3 A;  2Y3D A;  4KBL A;  1GS9 A;  3LLI A;  1ZW2 A;  4K0D A;  3IEE A;  2L6H A;  3C63 A;  4OIN F;  3FXH A;  1A7V A;  4O79 A;  2J7P A;  2VCC A;  1PD1 A;  4PJN A;  1ORY A;  2EIM C;  3GEI A;  4XEV A;  4BPM A;  1XWJ A;  3FOO A;  4E7Z A;  1YA9 A;  2VB6 A;  2W45 A;  3G4X A;  3MYF A;  3U5S A;  1T6U A;  4MVM A;  3L8J A;  3H2U A;  3FHD A;  3ITF A;  4MTO A;  4OD5 A;  3SP1 A;  3ZTZ A;  1OR2 A;  3RYL A;  2BE5 F;  3MLG A;  4PAC A;  1ST6 A;  4O6N A;  5L0G A;  1Z63 A;  3EG9 A;  3RQF A;  5L0C A;  1NU7 D;  1NU9 C;  2PF4 E;  2ZPA A;  3G50 A;  1OW7 A;  2H8A A;  3IPM O;  3O55 A;  3NMK A;  3ABL C;  3ZG1 A;  3NKE A;  5AGF A;  4KNW A;  1VK5 A;  5E2Q A;  3U8V A;  4GEH A;  1E83 A;  1EI7 A;  3AG2 C;  1ZYR F;  1VLS A;  5DLJ A;  5KYN A;  3I5P A;  4ULV A;  2IXP A;  1EQ1 A;  5DVW A;  1BR4 A;  3T6G B;  2OQM A;  3QVY A;  4JRZ A;  4GYT A;  4C3B A;  2HZ8 A;  4EIY A;  4EUK B;  4BJ1 A;  4C7O B;  3H2V A;  1JPJ A;  4JZA A;  1MMN A;  3B9Q A;  2KK1 A;  2HJ3 A;  3GM2 A;  2OKU A;  3O10 A;  4IJJ A;  4I1O B;  1ORS C;  2HSB A;  2ETS A;  3VRC A;  3UR3 C;  3WHN A;  2Q00 A;  1HE1 A;  2YL1 A;  3K1H A;  4MVU A;  1OCC C;  1JOG A;  1OW6 A;  2J9V A;  2VCA A;  2WVN A;  2XSE A;  3HNL A;  4YL0 A;  1Q0K A;  1Z7Q c;  3AJM A;  3NYM A;  4DBQ A;  4XLP F;  2YRF A;  3M1C B;  3DJU B;  1JPN A;  2Z15 A;  4IB4 A;  2C03 A;  2G3V A;  4BEJ A;  3W4Y A;  2QUP A;  1WN0 A;  3NG1 A;  1HW2 A;  1Q0G A;  3SXK A;  1T6I A;  4XEF A;  5EK0 A;  1R5I D;  3UMK A;  1GM5 A;  1HY5 A;  1NSG B;  4UDV A;  1A0B A;  1TWC A;  4LDK A;  2PX0 A;  4JTC B;  1H9G A;  3DMD A;  4U5E E;  2XS8 A;  3TK0 A;  3U8P A;  3EPV A;  3N0T A;  3V5Y A;  4YN0 B;  2J9U A;  1ZU4 A;  4XTK A;  3T6J A;  4BEM J;  3AGU A;  4CDA A;  2W4B A;  4PR9 A;  1W2W A;  4EHP A;  4FAP B;  1QZX A;  3CAX A;  3K1I A;  2WZF A;  1Y6D A;  2EIL C;  3MYI A;  4Q7C A;  2Q7R A;  1YLM A;  3IQC A;  2CYD A;  2IBF A;  3N24 A;  3QW1 A;  1V55 C;  3OWT A;  4MTF A;  4NTA A;  3U2M A;  3U2L A;  5L0D A;  2M64 A;  2PBE A;  1OCO C;  3HNI A;  3RVY A;  3L1M A;  4MS2 A;  2LQG A;  4OIO F;  2CDQ A;  3DE9 A;  3WG7 C;  1T6Q A;  2PX3 A;  3QTH A;  3ZSU A;  4G7O F;  1AUE A;  1PV3 A;  4EBJ A;  4IWB A;  4ZLC A;  1LPE A;  1OCZ C;  4XWJ A;  3CSK A;  1Z3I X;  4OIR F;  3NYJ A;  2WZL A;  3AGT A;  3C8Z A;  2VC9 A;  3POV A;  2M4E A;  4WGZ A;  4D4X A;  4U9E A;  5AC4 A;  1DOV A;  4JJG A;  2YWA A;  4H54 A;  4JTD B;  2A68 F;  1IW7 F;  3CZ6 A;  1RXQ A;  3C7J A;  1RJ9 B;  1SZI A;  3LEO A;  4O6M A;  4J30 B;  1D1B A;  1V54 C;  3E70 C;  4F4B A;  2HV7 A;  4OIP F;  1ZHT A;  1QLE C;  1TWG A;  2Q4F A;  1C03 A;  3LS1 A;  4U9D A;  3CEX A;  3QMK A;  3SZR A;  3L8I A;  3VYW A;  1K40 A;  1MMA A;  4RD9 A;  5A6K A;  4MTG A;  4BJ6 A;  3FVY A;  4BJ5 A;  1APC A;  3ATP A;  5B3S C;  3O39 A;  1YZC A;  4WGY A;  4YT2 A;  3K6B A;  3LAY A;  4E0H A;  4JW1 A;  2YLD A;  5L3V A;  3WOD F;  1VB5 A;  4LER A;  1GGQ A;  4K1O A;  4JCH A;  4ULW A;  4EWC A;  1H9T A;  4NC3 A;  2V26 A;  3K7D A;  1DOW A;  4MVZ A;  2BL2 A;  2R7Q A;  4PJJ A;  4XPW A;  1WAT A;  3U9J A;  4FES A;  4AE4 A;  1OKK A;  2PNO A;  1OW8 A;  2OCC C;  4CDV A;  2AU5 A;  3M79 A;  4YT8 A;  1N1C A;  3EGD A;  4ANJ A;  5JRA A;  2CGE A;  1J8Y F;  3MX3 A;  2YHS A;  4I44 A;  3GWN A;  3JYY A;  5D91 A;  4JIO A;  3R7C A;  5BUO A;  2OEX A;  5F28 E;  1I4Y A;  1KNY A;  2DYS C;  2GDC A;  3KYJ A;  256B A;  3HKK A;  1AVO B;  4E17 A;  2P0N A;  2R7S A;  3GM1 A;  2D5R B;  1H7I A;  2J0W A;  2ZXO A;  4R32 A;  2KQ9 A;  1PD0 A;  1YAU O;  4J7T A;  2NUT A;  4XLN F;  1ZW3 A;  2H7B A;  2RSE B;  2XLM A;  2YQY A;  3EJN A;  4CJO A;  2FAP B;  3EG9 B;  5KYX B;  1LS4 A;  2IXN A;  5F5F A;  1G8X A;  1OCR C;  1D1A A;  3NMI A;  2HFI A;  3FDQ A;  2YLG A;  1MQV A;  3ZTM A;  1JMW A;  3VM6 A;  2A1D D;  4U5D E;  5EGY A;  3SYN A;  5B1A C;  1AEP A;  3SEO A;  2R7X A;  2HMQ A;  4JEA A;  3DI5 A;  1OR3 A;  2EIN C;  2HKV A;  5K0I A;  5KYX A;  2V3C C;  1KTM A;  3KL4 A;  2KGO A;  1B68 A;  3JCU Q;  4DRH B;  4I1M A;  3B0V C;  3V5Z A;  1M2V B;  2L6F A;  1V4A A;  4BJT A;  2NPU A;  2R7O A;  4MVO A;  1ZVZ A;  4AL1 A;  3SXY A;  3GWL A;  2QLA A;  1LE4 A;  4MVS A;  3RKO F;  3ZQV A;  3B0P A;  5L0H A;  4JJF A;  4CJG A;  3L0I A;  3K66 A;  2F22 A;  1H6G A;  3ASN C;  2L6G A;  1LKX A;  2KC3 A;  2Y69 C;  1U0B B;  2KJG A;  2WVO A;  3FAJ A;  3WAQ A;  1M2V A;  3ZVR A;  1NLX A;  2R7W A;  2GAQ A;  4A2N B;  1E85 A;  1XZP A;  2RD9 A;  4DJ9 A;  2HS5 A;  1QKR A;  3I5Q A;  4D4N A;  4YWQ A;  2EPO A;  1Z5Z A;  4JVS A;  2BC5 A;  1GQA A;  1CGM E;  4B6I A;  4MVR A;  3RFY A;  4QI2 A;  1RCP A;  2AWY A;  2IOQ A;  2NUP B;  3AG1 C;  3DWW A;  1E2X A;  2XLV A;  5L0F A;  2Y3G A;  2L81 A;  1YYJ A;  3MBG A;  4Z9I A;  1NZE A;  1I5N A;  4N6H A;  3EGX A;  4XQ1 A;  4CSA A;  2DGJ A;  1QQ3 A;  3BRJ A;  3NDB B;  3M4C A;  1MMG A;  2J0X A;  1L3P A;  3JT1 A;  4MVQ A;  2IM8 A;  1R4T A;  4PK4 A;  2FFH A;  3T6B A;  1CPQ A;  1TR2 A;  4DRJ B;  5KYW B;  3L34 A;  2NUP A;  2YKZ A;  2J46 A;  2CNW D;  2W9Y A;  3JYH A;  2J9B A;  4PFP A;  1OKK D;  2A0B A;  4HEA J;  4XEK A;  3UGP A;  2ZXP A;  3JRT A;  3B0U X;  3S90 A;  3C8G D;  4LDR A;  2D4U A;  2HJM A;  3F46 A;  2A6E F;  4U5C E;  5DQT A;  4RDA A;  2G62 A;  3JZ0 A;  2LFD A;  2ZXW C;  4YL3 A;  5KYW A;  3HTK C;  4JKV A;  1YA7 O;  2DYR C;  2IYL D;  4IGG A; 
#chains in the Genus database with same CATH homology
 3DJN B;  3KH2 A;  3DD7 A;  3LEV A;  2C04 A;  2KW3 C;  4RBN A;  3H65 A;  3EZI A;  3UMI A;  2H7V C;  2QTV A;  3DXJ F;  3AQC A;  1M2O A;  5DS4 A;  2YZS A;  2R7V A;  5EHH A;  4G7Z F;  5DS5 A;  2JD3 A;  3JSZ A;  3ABK C;  3OEO A;  1S7Z A;  3S27 A;  2GFH A;  4BG0 A;  3DZA A;  3UNG C;  4QDL A;  4CBE A;  2A69 F;  3TD7 A;  2Y3H A;  2J9W A;  4KI2 A;  2WL8 A;  3ZIB A;  3W2V A;  2E87 A;  1BR2 A;  3LNR A;  4DBR A;  3EGD B;  2MWQ A;  3W8I A;  4PFO A;  4MQ9 F;  4J32 B;  4U5B E;  4DVZ A;  3EFO A;  1MND A;  3W2W A;  5DS6 A;  2CNW A;  4G7H F;  1SF8 A;  3PMR A;  3ABM C;  4PJM A;  1KU2 A;  2NUT B;  1ZHZ A;  4LAC B;  3KMI A;  4YJW A;  1FMV A;  2WZG A;  4MND A;  5KYY A;  2HV6 A;  3LS0 A;  1Z6A A;  2W4M A;  3ZC4 A;  3Q6N A;  2X51 A;  5B1B C;  4ZLD A;  3Q7G A;  3EH1 A;  4Q4Z F;  2P7V A;  3DM5 A;  1O87 A;  5DQZ A;  4CS8 C;  3F47 A;  3SNH A;  3E9V A;  2IXM A;  3S28 A;  4G0H A;  1TWH A;  5E33 A;  2FGY A;  4PJL A;  4AE4 B;  3EH2 A;  4CIH A;  4EBB A;  4DVY P;  2OG2 A;  5CI8 A;  2PP4 A;  3O6X A;  4M63 A;  3X2Q C;  2B0J A;  3HJC A;  2Q3T A;  4LLE A;  4WJ0 A;  3RIP A;  5KYU B;  2ZXR A;  3ASO C;  4AE4 A;  1M56 C;  2NG1 A;  3N2Z B;  1TKN A;  3LLK A;  4CS9 C;  4CSA C;  4HFF B;  2G3K A;  5E3A A;  3Q6M A;  1ZHW A;  3EGX B;  2P6V A;  5KYU A;  3W8H A;  1J8M F;  1FFT C;  2MYS A;  2EIJ C;  4CS7 A;  3DAF A;  3T4R A;  3EQL F;  1FMW A;  4E7S A;  3EHM A;  2XXA B;  3GAN A;  3UMH A;  1TWA A;  4AX2 A;  5L3Q A;  3GOD A;  1VYK A;  5E3C A;  1MMD A;  3AG4 C;  3HLZ A;  1VMA A;  1D0Y A;  2CW0 F;  3AG3 C;  4FWV A;  5IY5 C;  2XXA A;  4P6I C;  3VAY A;  3NRH A;  2Y39 A;  1WGW A;  2L9J A;  2PFD A;  4IAO A;  3EHN A;  2KNH A;  4QI0 A;  1ZU5 A;  5T3W A;  1Z23 A;  2IXO A;  4C7O A;  4KC9 A;  5D92 A;  1LS1 A;  5T1D B;  2QY9 A;  2Q9B A;  3X1O A;  1BR1 A;  4O6Y A;  1VYI A;  3CQZ A;  5FCL A;  4LLC A;  2H7O A;  5F5H A;  3RH3 A;  2VAS A;  3DAG A;  1SMY F;  3V7O A;  1D0Z A;  4C3D A;  2WB7 A;  3UGO A;  4FX5 A;  1FFH A;  3Q7L A;  1O5H A;  3OA1 A;  2LSE A;  2A6H F;  4DOZ A;  3EFO B;  5T3T A;  3K1I C;  4U5F E;  2J7P D;  4YT5 A;  1D0X A;  4HE8 D;  4HFK B;  2Q9C A;  4C3E A;  4KNV A;  4I3M A;  5CI9 A;  3KKB A;  1D1C A;  1MNE A;  1ZHX A;  4N06 A;  4U5G A;  5KYY B;  1IZM A;  4X0R A;  2O9X A;  3K33 A;  4AK9 A;  3LES A;  2Y3B A;  3NKD A;  2XL4 A;  1M57 C;  4H4K C;  1LVK A;  4O7G A;  2WVQ A;  4W8K A;  2XRH A;  4OD4 A;  2EIK C;  2R7R A;  4JUR I;  4NY3 A;  3I4U A;  3S29 A;  2YEV A;  3PHF 2;  4IRU A;  1RJ9 A;  1NG1 A;  3NYL A;  2Q9A A;  4BJ6 C;  2R7U A;  4BJ5 C;  4CS8 A;  3ECS A;  4K7B A;  3LJB A;  3DM9 B;  3EZH A;  1VOM A;  4U5H A;  3AQB A;  3S0X A;  4OIQ F;  2J45 A;  4Q5S F;  4YT4 A;  5HSW A;  2VH3 A;  1FTS A;  2I8B A;  3QZC A;  2R7T A;  1ZHY A;  4CS9 A;  1PCX A;  4CSA A;  4KBL A;  2Y3D A;  4K0D A;  3LLI A;  3IEE A;  4OIN F;  4O79 A;  2J7P A;  1PD1 A;  4PJN A;  2EIM C;  4E7Z A;  2W45 A;  2VB6 A;  4OD5 A;  3FHD A;  3ITF A;  3SP1 A;  3RYL A;  2BE5 F;  3MLG A;  1ST6 A;  4O6N A;  1Z63 A;  3EG9 A;  1NU7 D;  1NU9 C;  2PF4 E;  2ZPA A;  3ABL C;  3ZG1 A;  3NKE A;  4KNW A;  1VK5 A;  5E2Q A;  4GEH A;  3AG2 C;  1ZYR F;  5DLJ A;  5KYN A;  3I5P A;  2IXP A;  5DVW A;  1BR4 A;  4GYT A;  4C3B A;  4BJ1 A;  4C7O B;  1JPJ A;  4JZA A;  1MMN A;  3B9Q A;  4IJJ A;  4I1O B;  3UR3 C;  3K1H A;  1OCC C;  2J9V A;  2XSE A;  2WVN A;  4DBQ A;  3NYM A;  4XLP F;  3M1C B;  3DJU B;  1JPN A;  2Z15 A;  2C03 A;  2G3V A;  4BEJ A;  3NG1 A;  3UMK A;  1TWC A;  2PX0 A;  3DMD A;  4U5E E;  3EPV A;  3N0T A;  4YN0 B;  2J9U A;  1ZU4 A;  4XTK A;  3T6J A;  2W4B A;  1W2W A;  1QZX A;  2WZF A;  4Q7C A;  2EIL C;  4ANJ A;  3N24 A;  1V55 C;  3OWT A;  1OCO C;  4OIO F;  2CDQ A;  3WG7 C;  2PX3 A;  3ZSU A;  4G7O F;  4IWB A;  4ZLC A;  1OCZ C;  4XWJ A;  3CSK A;  1Z3I X;  4OIR F;  3NYJ A;  2WZL A;  3POV A;  2M4E A;  4JJG A;  2A68 F;  1IW7 F;  3CZ6 A;  1RJ9 B;  1SZI A;  4O6M A;  4J30 B;  3E70 C;  1D1B A;  1V54 C;  4F4B A;  2HV7 A;  4OIP F;  1ZHT A;  1QLE C;  1TWG A;  3LS1 A;  3SZR A;  5B3S C;  3QMK A;  3VYW A;  1MMA A;  4RD9 A;  4BJ6 A;  3FVY A;  4BJ5 A;  3O39 A;  4YT2 A;  5L3V A;  3K6B A;  3LAY A;  4JW1 A;  3WOD F;  4LER A;  4JCH A;  4ULW A;  4EWC A;  2V26 A;  3K7D A;  4PJJ A;  2R7Q A;  4FES A;  1OKK A;  2OCC C;  4YT8 A;  1N1C A;  3EGD A;  2CGE A;  1J8Y F;  3MX3 A;  2YHS A;  4I44 A;  5BUO A;  5D91 A;  2DYS C;  2R7S A;  2D5R B;  2J0W A;  2ZXO A;  2KQ9 A;  1PD0 A;  2NUT A;  4XLN F;  2H7B A;  3EJN A;  3EG9 B;  5KYX B;  2IXN A;  5F5F A;  1G8X A;  1OCR C;  1D1A A;  3FDQ A;  2A1D D;  4U5D E;  5EGY A;  3SYN A;  5B1A C;  3SEO A;  2R7X A;  2EIN C;  5KYX A;  2V3C C;  3KL4 A;  2KGO A;  3JCU Q;  4I1M A;  3B0V C;  1M2V B;  4BJT A;  2R7O A;  3RKO F;  3B0P A;  4JJF A;  3L0I A;  3K66 A;  3ASN C;  1LKX A;  2Y69 C;  2KJG A;  2WVO A;  3FAJ A;  1M2V A;  3ZVR A;  2R7W A;  4A2N B;  4YWQ A;  3I5Q A;  1Z5Z A;  4JVS A;  4B6I A;  3RFY A;  4QI2 A;  2IOQ A;  2NUP B;  3AG1 C;  2Y3G A;  2L81 A;  1NZE A;  3EGX A;  2DGJ A;  3NDB B;  1MMG A;  2J0X A;  3JT1 A;  4PK4 A;  2FFH A;  3T6B A;  1TR2 A;  5KYW B;  3L34 A;  2NUP A;  2J46 A;  2CNW D;  2W9Y A;  3JYH A;  4PFP A;  1OKK D;  4HEA J;  3UGP A;  2ZXP A;  3JRT A;  3B0U X;  3F46 A;  2A6E F;  4U5C E;  5DQT A;  4RDA A;  2G62 A;  2ZXW C;  5KYW A;  3HTK C;  2DYR C;  2IYL D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...