3AQBA

M. luteus b-p 26 heterodimeric hexaprenyl diphosphate synthase in complex with magnesium
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
135
structure length
135
Chain Sequence
MMRYLHKIELELNRLTSRYPFFKKIAFDAEIIKLVDDLNVDENVKCAIVAIDTSMRMQDFINEDNKDSFVLSTDVLSALFYKYLSQPFYQHDFLVLTDCVSRINELKSIRATITDEIALHNINKQIHYMFIQPYM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Component A of hexaprenyl diphosphate synthase
publication title Crystal structure of heterodimeric hexaprenyl diphosphate synthase from Micrococcus luteus B-P 26 reveals that the small subunit is directly involved in the product chain length regulation.
pubmed doi rcsb
source organism Micrococcus luteus
molecule tags Transferase
total genus 58
structure length 135
sequence length 135
chains with identical sequence C
ec nomenclature ec 2.5.1.83: Hexaprenyl-diphosphate synthase ((2E,6E)-farnesyl-diphosphate specific).
pdb deposition date 2010-10-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1450 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3aqbA00
3AQCA 3AQBA
chains in the Genus database with same CATH superfamily
3JSEO 2UUHA 3T6JA 3S0XA 2KNHA 4U5BE 4E7SA 2L81A 4AL1A 1WASA 4DVYP 1B68A 3FMSA 2NSGA 2YEVA 4EWCA 5A6AA 1BBHA 1NBBA 1L7CA 1VYKA 2KGOA 3AG3C 4XPXA 5FZTA 4CSAA 2GWWA 5T1DB 2EPMX 4JTAB 3ZDLA 1OR3A 1CGNA 3VRCA 4JVSA 3TK0A 4XPWA 2EILC 1PD0A 1WWPA 2XXAA 1YARO 4U5DE 4AL0A 2GFHA 4ONSA 1LKXA 2IXPA 5F5FA 5KYNA 3C63A 1AEPA 1FTSA 1TFKB 2PP4A 2HKVA 3LLIA 3ZTZA 1FMVA 2J45A 4LDKA 1QPUA 4C7OB 2Y3HA 2XLHA 2GAQA 3EH1A 3KPHA 3O39A 1SYQA 3QW1A 1VMAA 1OCOC 3K1HA 1S05A 3JZ0A 3LESA 3TOMA 2J7PD 5EHHA 1TR2A 1YZAA 1VLSA 2AWYA 2QTVA 1LPEA 1H9TA 3V7OA 3I5PA 3SNHA 5HSWA 4CDYA 2IM8A 4PACA 3Q6MA 4JCZA 1V4AA 1FMWA 1SZIA 4W8KA 4N6HA 1GGQA 2HMZA 1E83A 2LFFA 3R2PA 2R9RB 5JVEA 2XL8A 2XS1A 1D1BA 3L0IA 2G3KA 2GA0A 2HV7A 2Q9AA 3L34A 2EIMC 2NUTA 4KI2A 3B0UX 5A6JA 3K66A 2W9YA 4K0DA 4O6NA 4ULWA 3IHUA 3AQBA 5JP7A 4OIRF 1SR2A 2Q00A 1T6UA 1UG7A 3EGDA 2IXNA 3X1OA 3EZIA 1QZXA 5GPGB 2JPUA 4MVRA 3RKOF 1CPRA 1XZPA 4NQFA 3U2LA 1MMDA 2YVKA 3FAJA 5KYYA 1RKEA 2XL6A 2DB4A 4GQHA 3L1MA 3HLZA 3DE8A 3C8GA 5A6BA 4IAOA 3MLGA 5BQGA 2YLDA 3HKKA 1DOWA 3V5ZA 5B1AC 3W8HA 2VCCA 3M1CB 2D5RB 3IQ5A 4NCQA 3FXHA 3JRTA 3C8GD 3EG9B 3LS1A 1GM5A 2YLIA 2FAPB 2VC9A 3MFNA 3K7DA 4EBKA 1VB5A 2G3VA 2EPOA 3TD7A 4JCHA 3CSKA 3HJCA 3VAYA 1PD1A 3UGPA 4YL1A 3HNJA 2WB7A 4LLEA 1TWAA 2L7AA 3LS0A 4MVUA 4BJ6A 5L0DA 3QVZA 2ZXOA 3EQLF 3GWNA 4MTOA 3X2QC 4YL3A 4AE4B 3ZC4A 2AU5A 1C02A 1S7ZA 3RYLA 2RSEB 2R7TA 2ZD9A 2NUPA 2V26A 3GM1A 3M15A 3RVZA 4YWQA 4HFKB 1VYIA 3F47A 3US6A 2DI3A 3ZQYA 3AGTA 3M79A 5L0IA 1JPJA 2CCYA 3IEEA 3EHNA 4I3MA 4JW1A 1FFHA 3CZ6A 4XEKA 2LQGA 4A2NB 1BDJB 4JE9A 3JCUQ 2R7XA 4G7OF 3H65A 3DWWA 4CJOA 4LDRA 3ZIBA 1A7DA 3CEXA 2Q7RA 5KYWB 4XQ1A 4JURI 2CYDA 5HV9A 2HSBA 2KW3C 2J9VA 1T6QA 4I1OB 4JJGA 1RJ9B 3LEVA 5K0IA 4BPMA 4IB4A 1A0BA 1BR1A 2J9BA 1WATA 2AVKA 5L0GA 1VTMP 4O7GA 4PJNA 1E85A 4U5CE 5KYUB 3FDQA 4OIPF 2BL2A 4DBRA 4ZLCA 2G62A 2IYLD 2Y3DA 3Q7LA 4FWVA 4M63A 4MNDA 3LNRA 4MVQA 4OD4A 3TOLA 2XXAB 4IAQA 4BJ5A 2WL8A 1JPNA 2HSQA 2A69F 4D4XA 1NG1A 4LERA 2IOQA 4K1OA 4RD9A 1YDIA 1JRAA 2H7BA 3IPMO 3BEHA 5AC4A 3E9VA 2J8WA 3KMIA 4I1MA 4DOZA 4G7ZF 1KU2A 1BR4A 2Y3BA 3ITFA 4MVZA 3SP1A 2C03A 3UR3C 4YN0B 1ZHZA 2DGJA 1RKCA 1O5HA 3BRJA 4J7TA 4CJGA 3MYIA 4PR9A 1O3UA 1R5ID 4N6CA 3RFYA 5L0FA 2R7RA 1EQ1A 3UGOA 3EHMA 4N4WA 4PFPA 4EKWA 1YJGA 4LDQA 3WODF 5BUOA 2JX0A 4DVZA 3VYWA 2NUTB 3V5YA 3QTHA 4LLCA 5CI8A 3RQGA 3TULA 1CGME 2WVQA 2YWAA 3JRMO 3DM5A 1MMAA 5KYXA 1VOMA 2EPKX 3DE9A 3LJBA 4BJ1A 4PK4A 4C3BA 2R7WA 3GORA 4BEJA 5KYYB 2NSFA 4UDVA 2NPUA 2JD3A 1G4US 1RKEB 2VCBA 3LLKA 4JRZA 4FAPB 5E33A 5B3IA 4E0HA 4NY3A 3T6BA 3O55A 1U89A 3JTLO 1D1CA 4HE8D 1Z7Qc 2J7PA 4BG0A 2OEVA 4U9DA 2KK1A 4E0IA 2LIGA 3T4RA 2OJQA 2CNWD 2B0JA 3SEOA 3DZAA 1CPQA 2LD6A 2MHRA 2M64A 4KNWA 1ZHXA 2HMQA 3FHDA 3ZSUA 4D4NA 4CIHA 2LFDA 3LUTB 2A0UA 2XLOA 4XLPF 2HJMA 3N2ZB 3NMIA 4MVOA 2L9JA 4CS9A 3LEOA 3G4XA 3S9OA 3EGXA 2PF4E 4H4KC 3RVYA 4ZLDA 4MW3A 3MX3A 5FCLA 2J46A 1ZVZA 1ZW2A 2KYHA 2PX0A 2OG2A 3K33A 2O9XA 4MQ9F 4EBJA 3S90A 3NMKA 3VF0A 2VH3A 3IQ6A 4I44A 5DQZA 2R05A 4PFOA 1OCRC 1H6GA 3UNGC 4E7ZA 2NUPB 4J7YA 4DRJB 1T01A 4CDVA 1FNTc 5B1BC 2Y69C 3C7JA 2P6VA 2X51A 2IBFA 2Z15A 3PHF2 3CQZA 1C17M 4CS8A 5A69A 2KSFA 2A6EF 3G4ZA 3MBGA 3SXMA 3U0CA 3WG7C 1GS9A 1NU7D 4WJ0A 3DJUB 4HFFB 2BC5A 2R7OA 5D92A 4YT2A 1A7EA 1ZZPA 3JT1A 4N06A 1Y6DA 4NTAA 4XLNF 3RQEA 2PBEA 2OQMA 2I8BA 1M2OA 2Q3TA 2W45A 4RDAA 5B3SC 2CGEA 3K1IC 4KC9A 4IJJA 2CW0F 3E70C 3T6GB 4E18A 1NFNA 2WZFA 3RIPA 3ZWIA 3KL4A 3WAQA 1MQVA 2A68F 4XWJA 4P9TA 5D91A 3HNLA 5KYXB 1LI7A 4GEHA 1Z23A 1C03A 3GEEA 1LE2A 3TJ5A 5BQIA 3PDMP 4CSAC 2VCAA 2W4BA 3W4YA 4BEMJ 1LS1A 4KNVA 1UFBA 2F22A 4G78A 1LIHA 2YHSA 2L6HA 1E84A 2P1AA 3WHNA 5JLIA 2V3CC 3W8IA 1O87A 3NYLA 1M6TA 2WZGA 3H2VA 3QVYA 1PV3A 4ER9A 1W2WA 3KYIA 5JT4A 3U3FA 4PJJA 4YT5A 4YJWA 3EJNA 2ZXWC 5L0CA 2FGYA 1JAFA 4IGGA 3UMKA 1APCA 5AGFA 4A4AA 4DXWA 1YVIA 3F46A 1OW8A 4IRUA 4YL0A 3S29A 2LK4A 1YAUO 1KTMA 1RXQA 4BJTA 4DBQA 3ATPA 1M2VA 2XLDA 4FX5A 5BQHA 3PMRA 2ZXPA 4KBLA 4C3DA 2A6HF 5E3CA 2Y39A 3N0TA 3NYJA 1ZHTA 4NC3A 5AC5A 1OXKA 3S28A 1FFTC 1JOGA 3KKBA 4NTBA 1TFOB 4CS7A 2OEXA 3B9QA 1OW6A 3W2VA 4U5GA 1FAPB 1V74B 3U8VA 3ABLC 4B6IA 5L0JA 3I4UA 4K7BA 3EFOA 3C62A 4F4BA 2PX3A 3POVA 5EK0A 4YT4A 1Q0GA 2XL4A 3ZTMA 1Q0KA 4JEAA 3DI5A 3GWLA 4O6YA 5A6KA 5JSLA 2A0BA 3ASNC 1ORSC 4CDAA 3FAPB 2ICWG 3C18A 5JRAA 1Z6AA 2Y3GA 2MWQA 3GEHA 4MTGA 2I15A 4OD5A 1TQGA 3FOPA 4IWBA 2QNLA 3A9CA 1T6IA 1H7IA 3DAGA 5DQTA 1V54C 2LP4A 3O6XA 2R03A 2WVOA 2XRHA 4C3EA 4EHPA 2YRFA 2C04A 2EPLX 1YYXA 4Z9JA 1TWCA 2DYSC 2OOCA 1TKNA 1TWGA 1AUEA 1ZU5A 1ZW3A 3ABKC 4JTDB 1D1AA 2HV6A 3EGXB 4XEFA 5CI9A 5DS5A 1L3PA 2L6GA 4NTFA 2X0CA 3SXZA 1EKYA 2J9WA 1MNEA 3DJNB 5L3QA 4AE4A 4XTKA 5E3AA 3CAXA 4BJ6C 3EPVA 4JZAA 1NFOA 4JIOA 1OCCC 4JJFA 4L6RA 4YT8A 2R7UA 5COGA 4OIQF 1LE4A 3EGDB 2QY9A 4MW8A 2XLWA 1K40A 4DRIB 3RH3A 3QW0A 2CNWA 4W8PA 1Q0FA 1E86A 2YL0A 2XLEA 3GODA 2HZ8A 3U9JA 3DM9B 3GM2A 3C8GB 4HEAJ 3ZG1A 2PFDA 3JYHA 3FOOA 3UMHA 4EIYA 3GM3A 3NKDA 1DOVA 2YL1A 4MVMA 1TWHA 2XLMA 3QMKA 1MMGA 1YZCA 2R7QA 1YA7O 1RJ9A 2R25A 2Q9CA 2B0HA 3LAYA 2NG1A 3W2WA 1ZHWA 2YL3A 2KQ9A 5T3WA 5JUAA 2H8AA 3AQCA 3ECSA 5KYUA 3UMIA 1QKRA 1VLTA 2XM0A 2CDQA 3DAFA 3ABMC 3SXYA 3RW0A 1CGOA 3RF3A 1SMYF 1Q0DA 4ULVA 1LS4A 1YLMA 2H7VC 1ORYA 3B0PA 4MTFA 3VM6A 2ZXRA 4CBEA 1E2XA 3S84A 2R7SA 1EA8A 2W4MA 1HY5A 1QVXA 3NYMA 3HNIA 1I4ZA 4CIPA 1A7VA 2OKUA 4Q5SF 2A1DD 5T3TA 1M56C 2IXMA 2L6FA 3NG1A 5DLJA 4PJLA 4AK9A 3JYYA 4BJ5C 4QI0A 2BE5F 5DS6A 3ZVRA 1ST6A 2ASRA 1IW7F 1GQAA 1RCPA 1H9GA 1WN0A 3QZCA 3LNMB 2HFIA 1J8MF 1I5NA 3M4CA 3A11A 3H2UA 3DMDA 3HTKC 1NZEA 1OW7A 1FR0A 1M2VB 2M4EA 2YL7A 3Q6NA 2KC3A 2XSEA 4JTCB 5JS5A 1M57C 4PJMA 1RMVA 2AWCA 4WABA 1BZ4A 3IQTA 4Q7CA 2HJ3A 2XLVA 256BA 4U5FE 3NMJA 3SXKA 1F1MA 4FESA 4WGZA 2J0WA 3U2MA 1R4TA 3U9MA 2H7OA 5EGYA 3EZHA 1MNDA 1T5OA 5F5HA 1J8YF 3G50A 3EFOB 1QQ3A 2AP3A 1D0XA 1YA9A 4YK5A 3RQFA 2EPNA 1OXBA 2D4UA 1HMOA 2HS5A 1LM3B 3AG4C 3KYJA 3B29A 1WOLA 1NU9C 2PNOA 4J30B 5F28E 3AG1C 4G0HA 2R7VA 4C7OA 1AVOB 1K04A 2QE9A 1VK5A 4CS9C 2RD9A 5A6BD 1OR2A 1IZMA 3Q7GA 2TMVP 3TQOA 4E17A 5CIVA 4JKVA 4U9EA 2EIKC 4DRHB 1Z5ZA 3N24A 3JSZA 2IXOA 2P61A 3R7CA 3OEOA 4J32B 4JEBA 4P9FA 1Z63A 2EIJC 1HE9A 1Z3IX 2UUIA 2VB6A 1HE1A 3U5SA 5IY5C 2LSEA 3DXJF 1OKKA 4Z9IA 5DVWA 3MYFA 2OU6A 2WVNA 2YZSA 1QLEC 3M4BA 1D0ZA 2QLAA 4WGYA 5L3VA 1A41A 1QSPA 4XEVA 4QI2A 2P7VA 5E2QA 2OCCC 2WZLA 2ZPAA 2MYSA 4OINF 3J06A 2DYRC 1ZHYA 1U6HA 1NLXA 3B71A 1OKKD 4H54A 4MVSA 3V5XA 4Q4ZF 1XWJA 4EUKB 2GDCA 3C8ZA 1JR8A 4AX2A 1XZQA 1HW1A 5DS4A 1OQCA 1D0YA 3S27A 1HW2A 1YYJA 3NKEA 1PCXA 4GYTA 1ORJA 1HMDA 3O10A 1I4YA 1Q0MA 1G8XA 4O79A 4XPYA 5COMA 1WTYA 3ZQVA 1T9KA 4CS8C 4EBBA 1SF8A 2OJED 4Z9HA 3EG9A 3KH2A 1N1CA 2LCHA 2R02A 3AGUA 3SZRA 3TJ6A 2XM4A 4OIOF 1LI5A 2KJGA 3T9OA 2E87A 1K05A 1WGWA 3DD7A 2VASA 3GEIA 1OCZC 3L8JA 1G4WR 1KNYA 3PCVA 3SYNA 4U5HA 2QUPA 1ZU4A 3IQCA 3U3BA 4ANJA 1G5ZA 3L8IA 2J9UA 1NSGB 4P6IC 3DKAA 3NDBB 2Q4FA 1MMNA 4G7HF 4O6MA 3GANA 4RBNA 4LACB 5L0HA 2YQYA 3FVYA 3I5QA 3OA1A 4DJ9A 3HNKA 5COFA 1EI7A 3NRHA 3OWTA 4IARA 2YKZA 3B0VC 2EINC 2ETSA 3AG2C 1U0BB 3ASOC 4MS2A 1LVKA 4CX9A 3AOUA 2J0XA 4JC7A 1V55C 3AJMA 2HUJA 3EH2A 1JMWA 3K6BA 3K1IA 4QDLA 2FFHA 2Q9BA 4X0RA 2YLGA 3U8PA 1ZYRF 4R32A 2P0NA 4U5EE 5KYWA 1BR2A 5TJ5E 2XS8A 1Y4CA
chains in the Genus database with same CATH topology
3T6JA 3S0XA 2KNHA 4U5BE 4E7SA 2L81A 4DVYP 2YEVA 4EWCA 2KGOA 3AG3C 1VYKA 4CSAA 5T1DB 4JVSA 2EILC 1PD0A 2XXAA 4U5DE 5F5FA 2GFHA 1LKXA 2IXPA 5KYNA 1FTSA 2PP4A 3LLIA 1FMVA 2J45A 4C7OB 2Y3HA 3EH1A 3O39A 1VMAA 1OCOC 3K1HA 3LESA 2J7PD 5EHHA 1TR2A 2QTVA 3V7OA 3I5PA 3SNHA 5HSWA 3Q6MA 1FMWA 1SZIA 4W8KA 1D1BA 3L0IA 2G3KA 2HV7A 2Q9AA 3L34A 2EIMC 2NUTA 4KI2A 3B0UX 3K66A 2W9YA 4K0DA 4O6NA 4ULWA 3AQBA 4OIRF 3EGDA 3X1OA 2IXNA 3EZIA 1QZXA 3RKOF 5KYYA 3FAJA 1MMDA 3HLZA 4IAOA 3MLGA 5B1AC 3W8HA 3M1CB 2D5RB 3LS1A 3JRTA 3EG9B 2G3VA 3TD7A 4JCHA 3CSKA 3HJCA 3VAYA 1PD1A 3UGPA 4LLEA 2WB7A 1TWAA 3LS0A 4BJ6A 2ZXOA 3EQLF 3X2QC 4AE4B 3ZC4A 1S7ZA 3RYLA 2R7TA 2NUPA 2V26A 4YWQA 4HFKB 1VYIA 3F47A 1JPJA 3IEEA 3EHNA 4I3MA 4JW1A 1FFHA 3CZ6A 4A2NB 3JCUQ 2R7XA 4G7OF 3H65A 3ZIBA 5KYWB 4JURI 2KW3C 2J9VA 4I1OB 4JJGA 1RJ9B 3LEVA 1BR1A 4O7GA 4PJNA 4U5CE 5KYUB 3FDQA 4OIPF 4DBRA 4ZLCA 2G62A 2IYLD 2Y3DA 3Q7LA 4FWVA 4M63A 4MNDA 3LNRA 4OD4A 4DVZA 4F4BA 2XXAB 4BJ5A 2WL8A 1JPNA 2A69F 1NG1A 4LERA 2IOQA 4RD9A 2H7BA 3E9VA 3KMIA 4I1MA 4DOZA 4G7ZF 1KU2A 1BR4A 2Y3BA 3ITFA 3SP1A 2C03A 3UR3C 4YN0B 1ZHZA 2DGJA 1O5HA 3RFYA 2R7RA 3UGOA 3EHMA 4PFPA 3WODF 5BUOA 3VYWA 2NUTB 5CI8A 4LLCA 2WVQA 3DM5A 1MMAA 1VOMA 3LJBA 4BJ1A 4PK4A 4C3BA 2R7WA 4BEJA 5KYYB 2JD3A 3LLKA 5E33A 4NY3A 3T6BA 1D1CA 4HE8D 4BG0A 2J7PA 3T4RA 2CNWD 2B0JA 3SEOA 3DZAA 4KNWA 1ZHXA 3FHDA 3ZSUA 4CIHA 4XLPF 3N2ZB 2L9JA 4CS9A 3EGXA 2PF4E 4H4KC 4ZLDA 3MX3A 5FCLA 2J46A 2PX0A 3K33A 2OG2A 2O9XA 4MQ9F 2VH3A 4I44A 5DQZA 4PFOA 1OCRC 3UNGC 4E7ZA 2NUPB 5B1BC 2Y69C 2P6VA 2X51A 2Z15A 3PHF2 3CQZA 4CS8A 2A6EF 3WG7C 1NU7D 4WJ0A 3DJUB 4HFFB 2R7OA 5D92A 4YT2A 4N06A 3JT1A 4XLNF 2I8BA 1M2OA 2Q3TA 2W45A 4RDAA 5B3SC 2CGEA 3K1IC 4KC9A 4IJJA 2CW0F 3E70C 2WZFA 3RIPA 3KL4A 2A68F 4XWJA 5D91A 5KYXB 4GEHA 1Z23A 4CSAC 2W4BA 1LS1A 4KNVA 2V3CC 2YHSA 3W8IA 1O87A 3NYLA 2WZGA 1W2WA 4PJJA 4YT5A 4YJWA 3EJNA 2ZXWC 2FGYA 3UMKA 3F46A 4IRUA 3S29A 4DBQA 4BJTA 1M2VA 4FX5A 3PMRA 2ZXPA 4KBLA 4C3DA 2A6HF 5E3CA 2Y39A 3N0TA 3NYJA 1ZHTA 3S28A 1FFTC 3KKBA 4CS7A 3B9QA 3W2VA 4U5GA 3ABLC 4B6IA 3I4UA 4K7BA 3EFOA 2PX3A 3POVA 4YT4A 2XL4A 4O6YA 3ASNC 1Z6AA 2Y3GA 2MWQA 4OD5A 4IWBA 3DAGA 5DQTA 1V54C 3O6XA 2WVOA 2XRHA 4C3EA 2C04A 1TWCA 2DYSC 3ABKC 1TKNA 1TWGA 1ZU5A 5CI9A 1D1AA 2HV6A 3EGXB 5DS5A 2J9WA 1MNEA 3DJNB 5L3QA 4AE4A 4XTKA 5E3AA 4BJ6C 3EPVA 4JZAA 1OCCC 4JJFA 4YT8A 2R7UA 4OIQF 3EGDB 2QY9A 3RH3A 2CNWA 3GODA 3DM9B 4HEAJ 3ZG1A 2PFDA 3JYHA 3UMHA 3NKDA 1TWHA 3QMKA 1MMGA 2R7QA 1RJ9A 2Q9CA 3LAYA 2NG1A 3W2WA 1ZHWA 5T3WA 2KQ9A 3ECSA 3AQCA 5KYUA 3UMIA 2CDQA 3DAFA 3ABMC 1SMYF 2H7VC 3B0PA 4CBEA 2R7SA 2ZXRA 2W4MA 3NYMA 4Q5SF 2A1DD 5T3TA 1M56C 2IXMA 5DLJA 3NG1A 4PJLA 4AK9A 4BJ5C 4QI0A 2BE5F 5DS6A 3ZVRA 1ST6A 1IW7F 3QZCA 1J8MF 3DMDA 3HTKC 1NZEA 1M2VB 2M4EA 3Q6NA 2XSEA 1M57C 4PJMA 4Q7CA 4U5FE 5EGYA 4FESA 2J0WA 2H7OA 3EZHA 1MNDA 5F5HA 1J8YF 3EFOB 1D0XA 3AG4C 1NU9C 4J30B 3AG1C 4G0HA 2R7VA 4C7OA 1VK5A 1IZMA 3Q7GA 2EIKC 1Z5ZA 3N24A 3JSZA 2IXOA 3OEOA 4J32B 1Z63A 2EIJC 1Z3IX 2VB6A 5IY5C 2LSEA 3DXJF 1OKKA 4CS9C 5DVWA 2WVNA 2YZSA 1QLEC 1D0ZA 5L3VA 4QI2A 2P7VA 5E2QA 2OCCC 2WZLA 2ZPAA 2MYSA 4OINF 2DYRC 1ZHYA 1OKKD 4Q4ZF 4AX2A 5DS4A 1D0YA 3S27A 3NKEA 1PCXA 4GYTA 4O79A 1G8XA 4CS8C 4EBBA 1SF8A 3EG9A 3KH2A 1N1CA 3SZRA 4OIOF 2KJGA 2E87A 1WGWA 3DD7A 5KYXA 2VASA 3SYNA 1OCZC 4U5HA 1ZU4A 4ANJA 2J9UA 4P6IC 3NDBB 1MMNA 4G7HF 4O6MA 3GANA 4RBNA 4LACB 3FVYA 3I5QA 3OA1A 3NRHA 3OWTA 3B0VC 2EINC 3AG2C 3ASOC 1LVKA 2J0XA 1V55C 4QDLA 3EH2A 4X0RA 3K6BA 2FFHA 2Q9BA 5KYWA 1ZYRF 4U5EE 1BR2A 3K7DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AQC A;  3AQB A; 
#chains in the Genus database with same CATH topology
 3JSE O;  2UUH A;  3T6J A;  3S0X A;  2KNH A;  4U5B E;  4E7S A;  2L81 A;  4AL1 A;  1WAS A;  4DVY P;  1B68 A;  3FMS A;  2NSG A;  2YEV A;  4EWC A;  5A6A A;  1BBH A;  1NBB A;  1L7C A;  1VYK A;  2KGO A;  3AG3 C;  4XPX A;  5FZT A;  4CSA A;  2GWW A;  5T1D B;  2EPM X;  4JTA B;  3ZDL A;  1OR3 A;  1CGN A;  3VRC A;  4JVS A;  3TK0 A;  4XPW A;  2EIL C;  1PD0 A;  1WWP A;  2XXA A;  1YAR O;  4U5D E;  4AL0 A;  2GFH A;  4ONS A;  1LKX A;  2IXP A;  5F5F A;  5KYN A;  3C63 A;  1AEP A;  1FTS A;  1TFK B;  2PP4 A;  2HKV A;  3LLI A;  3ZTZ A;  1FMV A;  2J45 A;  4LDK A;  1QPU A;  4C7O B;  2Y3H A;  2XLH A;  2GAQ A;  3EH1 A;  3KPH A;  3O39 A;  1SYQ A;  3QW1 A;  1VMA A;  1OCO C;  3K1H A;  1S05 A;  3JZ0 A;  3LES A;  3TOM A;  2J7P D;  5EHH A;  1TR2 A;  1YZA A;  1VLS A;  2AWY A;  2QTV A;  1LPE A;  1H9T A;  3V7O A;  3I5P A;  3SNH A;  5HSW A;  4CDY A;  2IM8 A;  4PAC A;  3Q6M A;  4JCZ A;  1V4A A;  1FMW A;  1SZI A;  4W8K A;  4N6H A;  1GGQ A;  2HMZ A;  1E83 A;  2LFF A;  3R2P A;  2R9R B;  5JVE A;  2XL8 A;  2XS1 A;  1D1B A;  3L0I A;  2G3K A;  2GA0 A;  2HV7 A;  2Q9A A;  3L34 A;  2EIM C;  2NUT A;  4KI2 A;  3B0U X;  5A6J A;  3K66 A;  2W9Y A;  4K0D A;  4O6N A;  4ULW A;  3IHU A;  3AQB A;  5JP7 A;  4OIR F;  1SR2 A;  2Q00 A;  1T6U A;  1UG7 A;  3EGD A;  2IXN A;  3X1O A;  3EZI A;  1QZX A;  5GPG B;  2JPU A;  4MVR A;  3RKO F;  1CPR A;  1XZP A;  4NQF A;  3U2L A;  1MMD A;  2YVK A;  3FAJ A;  5KYY A;  1RKE A;  2XL6 A;  2DB4 A;  4GQH A;  3L1M A;  3HLZ A;  3DE8 A;  3C8G A;  5A6B A;  4IAO A;  3MLG A;  5BQG A;  2YLD A;  3HKK A;  1DOW A;  3V5Z A;  5B1A C;  3W8H A;  2VCC A;  3M1C B;  2D5R B;  3IQ5 A;  4NCQ A;  3FXH A;  3JRT A;  3C8G D;  3EG9 B;  3LS1 A;  1GM5 A;  2YLI A;  2FAP B;  2VC9 A;  3MFN A;  3K7D A;  4EBK A;  1VB5 A;  2G3V A;  2EPO A;  3TD7 A;  4JCH A;  3CSK A;  3HJC A;  3VAY A;  1PD1 A;  3UGP A;  4YL1 A;  3HNJ A;  2WB7 A;  4LLE A;  1TWA A;  2L7A A;  3LS0 A;  4MVU A;  4BJ6 A;  5L0D A;  3QVZ A;  2ZXO A;  3EQL F;  3GWN A;  4MTO A;  3X2Q C;  4YL3 A;  4AE4 B;  3ZC4 A;  2AU5 A;  1C02 A;  1S7Z A;  3RYL A;  2RSE B;  2R7T A;  2ZD9 A;  2NUP A;  2V26 A;  3GM1 A;  3M15 A;  3RVZ A;  4YWQ A;  4HFK B;  1VYI A;  3F47 A;  3US6 A;  2DI3 A;  3ZQY A;  3AGT A;  3M79 A;  5L0I A;  1JPJ A;  2CCY A;  3IEE A;  3EHN A;  4I3M A;  4JW1 A;  1FFH A;  3CZ6 A;  4XEK A;  2LQG A;  4A2N B;  1BDJ B;  4JE9 A;  3JCU Q;  2R7X A;  4G7O F;  3H65 A;  3DWW A;  4CJO A;  4LDR A;  3ZIB A;  1A7D A;  3CEX A;  2Q7R A;  5KYW B;  4XQ1 A;  4JUR I;  2CYD A;  5HV9 A;  2HSB A;  2KW3 C;  2J9V A;  1T6Q A;  4I1O B;  4JJG A;  1RJ9 B;  3LEV A;  5K0I A;  4BPM A;  4IB4 A;  1A0B A;  1BR1 A;  2J9B A;  1WAT A;  2AVK A;  5L0G A;  1VTM P;  4O7G A;  4PJN A;  1E85 A;  4U5C E;  5KYU B;  3FDQ A;  4OIP F;  2BL2 A;  4DBR A;  4ZLC A;  2G62 A;  2IYL D;  2Y3D A;  3Q7L A;  4FWV A;  4M63 A;  4MND A;  3LNR A;  4MVQ A;  4OD4 A;  3TOL A;  2XXA B;  4IAQ A;  4BJ5 A;  2WL8 A;  1JPN A;  2HSQ A;  2A69 F;  4D4X A;  1NG1 A;  4LER A;  2IOQ A;  4K1O A;  4RD9 A;  1YDI A;  1JRA A;  2H7B A;  3IPM O;  3BEH A;  5AC4 A;  3E9V A;  2J8W A;  3KMI A;  4I1M A;  4DOZ A;  4G7Z F;  1KU2 A;  1BR4 A;  2Y3B A;  3ITF A;  4MVZ A;  3SP1 A;  2C03 A;  3UR3 C;  4YN0 B;  1ZHZ A;  2DGJ A;  1RKC A;  1O5H A;  3BRJ A;  4J7T A;  4CJG A;  3MYI A;  4PR9 A;  1O3U A;  1R5I D;  4N6C A;  3RFY A;  5L0F A;  2R7R A;  1EQ1 A;  3UGO A;  3EHM A;  4N4W A;  4PFP A;  4EKW A;  1YJG A;  4LDQ A;  3WOD F;  5BUO A;  2JX0 A;  4DVZ A;  3VYW A;  2NUT B;  3V5Y A;  3QTH A;  4LLC A;  5CI8 A;  3RQG A;  3TUL A;  1CGM E;  2WVQ A;  2YWA A;  3JRM O;  3DM5 A;  1MMA A;  5KYX A;  1VOM A;  2EPK X;  3DE9 A;  3LJB A;  4BJ1 A;  4PK4 A;  4C3B A;  2R7W A;  3GOR A;  4BEJ A;  5KYY B;  2NSF A;  4UDV A;  2NPU A;  2JD3 A;  1G4U S;  1RKE B;  2VCB A;  3LLK A;  4JRZ A;  4FAP B;  5E33 A;  5B3I A;  4E0H A;  4NY3 A;  3T6B A;  3O55 A;  1U89 A;  3JTL O;  1D1C A;  4HE8 D;  1Z7Q c;  2J7P A;  4BG0 A;  2OEV A;  4U9D A;  2KK1 A;  4E0I A;  2LIG A;  3T4R A;  2OJQ A;  2CNW D;  2B0J A;  3SEO A;  3DZA A;  1CPQ A;  2LD6 A;  2MHR A;  2M64 A;  4KNW A;  1ZHX A;  2HMQ A;  3FHD A;  3ZSU A;  4D4N A;  4CIH A;  2LFD A;  3LUT B;  2A0U A;  2XLO A;  4XLP F;  2HJM A;  3N2Z B;  3NMI A;  4MVO A;  2L9J A;  4CS9 A;  3LEO A;  3G4X A;  3S9O A;  3EGX A;  2PF4 E;  4H4K C;  3RVY A;  4ZLD A;  4MW3 A;  3MX3 A;  5FCL A;  2J46 A;  1ZVZ A;  1ZW2 A;  2KYH A;  2PX0 A;  2OG2 A;  3K33 A;  2O9X A;  4MQ9 F;  4EBJ A;  3S90 A;  3NMK A;  3VF0 A;  2VH3 A;  3IQ6 A;  4I44 A;  5DQZ A;  2R05 A;  4PFO A;  1OCR C;  1H6G A;  3UNG C;  4E7Z A;  2NUP B;  4J7Y A;  4DRJ B;  1T01 A;  4CDV A;  1FNT c;  5B1B C;  2Y69 C;  3C7J A;  2P6V A;  2X51 A;  2IBF A;  2Z15 A;  3PHF 2;  3CQZ A;  1C17 M;  4CS8 A;  5A69 A;  2KSF A;  2A6E F;  3G4Z A;  3MBG A;  3SXM A;  3U0C A;  3WG7 C;  1GS9 A;  1NU7 D;  4WJ0 A;  3DJU B;  4HFF B;  2BC5 A;  2R7O A;  5D92 A;  4YT2 A;  1A7E A;  1ZZP A;  3JT1 A;  4N06 A;  1Y6D A;  4NTA A;  4XLN F;  3RQE A;  2PBE A;  2OQM A;  2I8B A;  1M2O A;  2Q3T A;  2W45 A;  4RDA A;  5B3S C;  2CGE A;  3K1I C;  4KC9 A;  4IJJ A;  2CW0 F;  3E70 C;  3T6G B;  4E18 A;  1NFN A;  2WZF A;  3RIP A;  3ZWI A;  3KL4 A;  3WAQ A;  1MQV A;  2A68 F;  4XWJ A;  4P9T A;  5D91 A;  3HNL A;  5KYX B;  1LI7 A;  4GEH A;  1Z23 A;  1C03 A;  3GEE A;  1LE2 A;  3TJ5 A;  5BQI A;  3PDM P;  4CSA C;  2VCA A;  2W4B A;  3W4Y A;  4BEM J;  1LS1 A;  4KNV A;  1UFB A;  2F22 A;  4G78 A;  1LIH A;  2YHS A;  2L6H A;  1E84 A;  2P1A A;  3WHN A;  5JLI A;  2V3C C;  3W8I A;  1O87 A;  3NYL A;  1M6T A;  2WZG A;  3H2V A;  3QVY A;  1PV3 A;  4ER9 A;  1W2W A;  3KYI A;  5JT4 A;  3U3F A;  4PJJ A;  4YT5 A;  4YJW A;  3EJN A;  2ZXW C;  5L0C A;  2FGY A;  1JAF A;  4IGG A;  3UMK A;  1APC A;  5AGF A;  4A4A A;  4DXW A;  1YVI A;  3F46 A;  1OW8 A;  4IRU A;  4YL0 A;  3S29 A;  2LK4 A;  1YAU O;  1KTM A;  1RXQ A;  4BJT A;  4DBQ A;  3ATP A;  1M2V A;  2XLD A;  4FX5 A;  5BQH A;  3PMR A;  2ZXP A;  4KBL A;  4C3D A;  2A6H F;  5E3C A;  2Y39 A;  3N0T A;  3NYJ A;  1ZHT A;  4NC3 A;  5AC5 A;  1OXK A;  3S28 A;  1FFT C;  1JOG A;  3KKB A;  4NTB A;  1TFO B;  4CS7 A;  2OEX A;  3B9Q A;  1OW6 A;  3W2V A;  4U5G A;  1FAP B;  1V74 B;  3U8V A;  3ABL C;  4B6I A;  5L0J A;  3I4U A;  4K7B A;  3EFO A;  3C62 A;  4F4B A;  2PX3 A;  3POV A;  5EK0 A;  4YT4 A;  1Q0G A;  2XL4 A;  3ZTM A;  1Q0K A;  4JEA A;  3DI5 A;  3GWL A;  4O6Y A;  5A6K A;  5JSL A;  2A0B A;  3ASN C;  1ORS C;  4CDA A;  3FAP B;  2ICW G;  3C18 A;  5JRA A;  1Z6A A;  2Y3G A;  2MWQ A;  3GEH A;  4MTG A;  2I15 A;  4OD5 A;  1TQG A;  3FOP A;  4IWB A;  2QNL A;  3A9C A;  1T6I A;  1H7I A;  3DAG A;  5DQT A;  1V54 C;  2LP4 A;  3O6X A;  2R03 A;  2WVO A;  2XRH A;  4C3E A;  4EHP A;  2YRF A;  2C04 A;  2EPL X;  1YYX A;  4Z9J A;  1TWC A;  2DYS C;  2OOC A;  1TKN A;  1TWG A;  1AUE A;  1ZU5 A;  1ZW3 A;  3ABK C;  4JTD B;  1D1A A;  2HV6 A;  3EGX B;  4XEF A;  5CI9 A;  5DS5 A;  1L3P A;  2L6G A;  4NTF A;  2X0C A;  3SXZ A;  1EKY A;  2J9W A;  1MNE A;  3DJN B;  5L3Q A;  4AE4 A;  4XTK A;  5E3A A;  3CAX A;  4BJ6 C;  3EPV A;  4JZA A;  1NFO A;  4JIO A;  1OCC C;  4JJF A;  4L6R A;  4YT8 A;  2R7U A;  5COG A;  4OIQ F;  1LE4 A;  3EGD B;  2QY9 A;  4MW8 A;  2XLW A;  1K40 A;  4DRI B;  3RH3 A;  3QW0 A;  2CNW A;  4W8P A;  1Q0F A;  1E86 A;  2YL0 A;  2XLE A;  3GOD A;  2HZ8 A;  3U9J A;  3DM9 B;  3GM2 A;  3C8G B;  4HEA J;  3ZG1 A;  2PFD A;  3JYH A;  3FOO A;  3UMH A;  4EIY A;  3GM3 A;  3NKD A;  1DOV A;  2YL1 A;  4MVM A;  1TWH A;  2XLM A;  3QMK A;  1MMG A;  1YZC A;  2R7Q A;  1YA7 O;  1RJ9 A;  2R25 A;  2Q9C A;  2B0H A;  3LAY A;  2NG1 A;  3W2W A;  1ZHW A;  2YL3 A;  2KQ9 A;  5T3W A;  5JUA A;  2H8A A;  3AQC A;  3ECS A;  5KYU A;  3UMI A;  1QKR A;  1VLT A;  2XM0 A;  2CDQ A;  3DAF A;  3ABM C;  3SXY A;  3RW0 A;  1CGO A;  3RF3 A;  1SMY F;  1Q0D A;  4ULV A;  1LS4 A;  1YLM A;  2H7V C;  1ORY A;  3B0P A;  4MTF A;  3VM6 A;  2ZXR A;  4CBE A;  1E2X A;  3S84 A;  2R7S A;  1EA8 A;  2W4M A;  1HY5 A;  1QVX A;  3NYM A;  3HNI A;  1I4Z A;  4CIP A;  1A7V A;  2OKU A;  4Q5S F;  2A1D D;  5T3T A;  1M56 C;  2IXM A;  2L6F A;  3NG1 A;  5DLJ A;  4PJL A;  4AK9 A;  3JYY A;  4BJ5 C;  4QI0 A;  2BE5 F;  5DS6 A;  3ZVR A;  1ST6 A;  2ASR A;  1IW7 F;  1GQA A;  1RCP A;  1H9G A;  1WN0 A;  3QZC A;  3LNM B;  2HFI A;  1J8M F;  1I5N A;  3M4C A;  3A11 A;  3H2U A;  3DMD A;  3HTK C;  1NZE A;  1OW7 A;  1FR0 A;  1M2V B;  2M4E A;  2YL7 A;  3Q6N A;  2KC3 A;  2XSE A;  4JTC B;  5JS5 A;  1M57 C;  4PJM A;  1RMV A;  2AWC A;  4WAB A;  1BZ4 A;  3IQT A;  4Q7C A;  2HJ3 A;  2XLV A;  256B A;  4U5F E;  3NMJ A;  3SXK A;  1F1M A;  4FES A;  4WGZ A;  2J0W A;  3U2M A;  1R4T A;  3U9M A;  2H7O A;  5EGY A;  3EZH A;  1MND A;  1T5O A;  5F5H A;  1J8Y F;  3G50 A;  3EFO B;  1QQ3 A;  2AP3 A;  1D0X A;  1YA9 A;  4YK5 A;  3RQF A;  2EPN A;  1OXB A;  2D4U A;  1HMO A;  2HS5 A;  1LM3 B;  3AG4 C;  3KYJ A;  3B29 A;  1WOL A;  1NU9 C;  2PNO A;  4J30 B;  5F28 E;  3AG1 C;  4G0H A;  2R7V A;  4C7O A;  1AVO B;  1K04 A;  2QE9 A;  1VK5 A;  4CS9 C;  2RD9 A;  5A6B D;  1OR2 A;  1IZM A;  3Q7G A;  2TMV P;  3TQO A;  4E17 A;  5CIV A;  4JKV A;  4U9E A;  2EIK C;  4DRH B;  1Z5Z A;  3N24 A;  3JSZ A;  2IXO A;  2P61 A;  3R7C A;  3OEO A;  4J32 B;  4JEB A;  4P9F A;  1Z63 A;  2EIJ C;  1HE9 A;  1Z3I X;  2UUI A;  2VB6 A;  1HE1 A;  3U5S A;  5IY5 C;  2LSE A;  3DXJ F;  1OKK A;  4Z9I A;  5DVW A;  3MYF A;  2OU6 A;  2WVN A;  2YZS A;  1QLE C;  3M4B A;  1D0Z A;  2QLA A;  4WGY A;  5L3V A;  1A41 A;  1QSP A;  4XEV A;  4QI2 A;  2P7V A;  5E2Q A;  2OCC C;  2WZL A;  2ZPA A;  2MYS A;  4OIN F;  3J06 A;  2DYR C;  1ZHY A;  1U6H A;  1NLX A;  3B71 A;  1OKK D;  4H54 A;  4MVS A;  3V5X A;  4Q4Z F;  1XWJ A;  4EUK B;  2GDC A;  3C8Z A;  1JR8 A;  4AX2 A;  1XZQ A;  1HW1 A;  5DS4 A;  1OQC A;  1D0Y A;  3S27 A;  1HW2 A;  1YYJ A;  3NKE A;  1PCX A;  4GYT A;  1ORJ A;  1HMD A;  3O10 A;  1I4Y A;  1Q0M A;  1G8X A;  4O79 A;  4XPY A;  5COM A;  1WTY A;  3ZQV A;  1T9K A;  4CS8 C;  4EBB A;  1SF8 A;  2OJE D;  4Z9H A;  3EG9 A;  3KH2 A;  1N1C A;  2LCH A;  2R02 A;  3AGU A;  3SZR A;  3TJ6 A;  2XM4 A;  4OIO F;  1LI5 A;  2KJG A;  3T9O A;  2E87 A;  1K05 A;  1WGW A;  3DD7 A;  2VAS A;  3GEI A;  1OCZ C;  3L8J A;  1G4W R;  1KNY A;  3PCV A;  3SYN A;  4U5H A;  2QUP A;  1ZU4 A;  3IQC A;  3U3B A;  4ANJ A;  1G5Z A;  3L8I A;  2J9U A;  1NSG B;  4P6I C;  3DKA A;  3NDB B;  2Q4F A;  1MMN A;  4G7H F;  4O6M A;  3GAN A;  4RBN A;  4LAC B;  5L0H A;  2YQY A;  3FVY A;  3I5Q A;  3OA1 A;  4DJ9 A;  3HNK A;  5COF A;  1EI7 A;  3NRH A;  3OWT A;  4IAR A;  2YKZ A;  3B0V C;  2EIN C;  2ETS A;  3AG2 C;  1U0B B;  3ASO C;  4MS2 A;  1LVK A;  4CX9 A;  3AOU A;  2J0X A;  4JC7 A;  1V55 C;  3AJM A;  2HUJ A;  3EH2 A;  1JMW A;  3K6B A;  3K1I A;  4QDL A;  2FFH A;  2Q9B A;  4X0R A;  2YLG A;  3U8P A;  1ZYR F;  4R32 A;  2P0N A;  4U5E E;  5KYW A;  1BR2 A;  5TJ5 E;  2XS8 A;  1Y4C A; 
#chains in the Genus database with same CATH homology
 3T6J A;  3S0X A;  2KNH A;  4U5B E;  4E7S A;  2L81 A;  4DVY P;  2YEV A;  4EWC A;  2KGO A;  3AG3 C;  1VYK A;  4CSA A;  5T1D B;  4JVS A;  2EIL C;  1PD0 A;  2XXA A;  4U5D E;  5F5F A;  2GFH A;  1LKX A;  2IXP A;  5KYN A;  1FTS A;  2PP4 A;  3LLI A;  1FMV A;  2J45 A;  4C7O B;  2Y3H A;  3EH1 A;  3O39 A;  1VMA A;  1OCO C;  3K1H A;  3LES A;  2J7P D;  5EHH A;  1TR2 A;  2QTV A;  3V7O A;  3I5P A;  3SNH A;  5HSW A;  3Q6M A;  1FMW A;  1SZI A;  4W8K A;  1D1B A;  3L0I A;  2G3K A;  2HV7 A;  2Q9A A;  3L34 A;  2EIM C;  2NUT A;  4KI2 A;  3B0U X;  3K66 A;  2W9Y A;  4K0D A;  4O6N A;  4ULW A;  3AQB A;  4OIR F;  3EGD A;  3X1O A;  2IXN A;  3EZI A;  1QZX A;  3RKO F;  5KYY A;  3FAJ A;  1MMD A;  3HLZ A;  4IAO A;  3MLG A;  5B1A C;  3W8H A;  3M1C B;  2D5R B;  3LS1 A;  3JRT A;  3EG9 B;  2G3V A;  3TD7 A;  4JCH A;  3CSK A;  3HJC A;  3VAY A;  1PD1 A;  3UGP A;  4LLE A;  2WB7 A;  1TWA A;  3LS0 A;  4BJ6 A;  2ZXO A;  3EQL F;  3X2Q C;  4AE4 B;  3ZC4 A;  1S7Z A;  3RYL A;  2R7T A;  2NUP A;  2V26 A;  4YWQ A;  4HFK B;  1VYI A;  3F47 A;  1JPJ A;  3IEE A;  3EHN A;  4I3M A;  4JW1 A;  1FFH A;  3CZ6 A;  4A2N B;  3JCU Q;  2R7X A;  4G7O F;  3H65 A;  3ZIB A;  5KYW B;  4JUR I;  2KW3 C;  2J9V A;  4I1O B;  4JJG A;  1RJ9 B;  3LEV A;  1BR1 A;  4O7G A;  4PJN A;  4U5C E;  5KYU B;  3FDQ A;  4OIP F;  4DBR A;  4ZLC A;  2G62 A;  2IYL D;  2Y3D A;  3Q7L A;  4FWV A;  4M63 A;  4MND A;  3LNR A;  4OD4 A;  4DVZ A;  4F4B A;  2XXA B;  4BJ5 A;  2WL8 A;  1JPN A;  2A69 F;  1NG1 A;  4LER A;  2IOQ A;  4RD9 A;  2H7B A;  3E9V A;  3KMI A;  4I1M A;  4DOZ A;  4G7Z F;  1KU2 A;  1BR4 A;  2Y3B A;  3ITF A;  3SP1 A;  2C03 A;  3UR3 C;  4YN0 B;  1ZHZ A;  2DGJ A;  1O5H A;  3RFY A;  2R7R A;  3UGO A;  3EHM A;  4PFP A;  3WOD F;  5BUO A;  3VYW A;  2NUT B;  5CI8 A;  4LLC A;  2WVQ A;  3DM5 A;  1MMA A;  1VOM A;  3LJB A;  4BJ1 A;  4PK4 A;  4C3B A;  2R7W A;  4BEJ A;  5KYY B;  2JD3 A;  3LLK A;  5E33 A;  4NY3 A;  3T6B A;  1D1C A;  4HE8 D;  4BG0 A;  2J7P A;  3T4R A;  2CNW D;  2B0J A;  3SEO A;  3DZA A;  4KNW A;  1ZHX A;  3FHD A;  3ZSU A;  4CIH A;  4XLP F;  3N2Z B;  2L9J A;  4CS9 A;  3EGX A;  2PF4 E;  4H4K C;  4ZLD A;  3MX3 A;  5FCL A;  2J46 A;  2PX0 A;  3K33 A;  2OG2 A;  2O9X A;  4MQ9 F;  2VH3 A;  4I44 A;  5DQZ A;  4PFO A;  1OCR C;  3UNG C;  4E7Z A;  2NUP B;  5B1B C;  2Y69 C;  2P6V A;  2X51 A;  2Z15 A;  3PHF 2;  3CQZ A;  4CS8 A;  2A6E F;  3WG7 C;  1NU7 D;  4WJ0 A;  3DJU B;  4HFF B;  2R7O A;  5D92 A;  4YT2 A;  4N06 A;  3JT1 A;  4XLN F;  2I8B A;  1M2O A;  2Q3T A;  2W45 A;  4RDA A;  5B3S C;  2CGE A;  3K1I C;  4KC9 A;  4IJJ A;  2CW0 F;  3E70 C;  2WZF A;  3RIP A;  3KL4 A;  2A68 F;  4XWJ A;  5D91 A;  5KYX B;  4GEH A;  1Z23 A;  4CSA C;  2W4B A;  1LS1 A;  4KNV A;  2V3C C;  2YHS A;  3W8I A;  1O87 A;  3NYL A;  2WZG A;  1W2W A;  4PJJ A;  4YT5 A;  4YJW A;  3EJN A;  2ZXW C;  2FGY A;  3UMK A;  3F46 A;  4IRU A;  3S29 A;  4DBQ A;  4BJT A;  1M2V A;  4FX5 A;  3PMR A;  2ZXP A;  4KBL A;  4C3D A;  2A6H F;  5E3C A;  2Y39 A;  3N0T A;  3NYJ A;  1ZHT A;  3S28 A;  1FFT C;  3KKB A;  4CS7 A;  3B9Q A;  3W2V A;  4U5G A;  3ABL C;  4B6I A;  3I4U A;  4K7B A;  3EFO A;  2PX3 A;  3POV A;  4YT4 A;  2XL4 A;  4O6Y A;  3ASN C;  1Z6A A;  2Y3G A;  2MWQ A;  4OD5 A;  4IWB A;  3DAG A;  5DQT A;  1V54 C;  3O6X A;  2WVO A;  2XRH A;  4C3E A;  2C04 A;  1TWC A;  2DYS C;  3ABK C;  1TKN A;  1TWG A;  1ZU5 A;  5CI9 A;  1D1A A;  2HV6 A;  3EGX B;  5DS5 A;  2J9W A;  1MNE A;  3DJN B;  5L3Q A;  4AE4 A;  4XTK A;  5E3A A;  4BJ6 C;  3EPV A;  4JZA A;  1OCC C;  4JJF A;  4YT8 A;  2R7U A;  4OIQ F;  3EGD B;  2QY9 A;  3RH3 A;  2CNW A;  3GOD A;  3DM9 B;  4HEA J;  3ZG1 A;  2PFD A;  3JYH A;  3UMH A;  3NKD A;  1TWH A;  3QMK A;  1MMG A;  2R7Q A;  1RJ9 A;  2Q9C A;  3LAY A;  2NG1 A;  3W2W A;  1ZHW A;  5T3W A;  2KQ9 A;  3ECS A;  3AQC A;  5KYU A;  3UMI A;  2CDQ A;  3DAF A;  3ABM C;  1SMY F;  2H7V C;  3B0P A;  4CBE A;  2R7S A;  2ZXR A;  2W4M A;  3NYM A;  4Q5S F;  2A1D D;  5T3T A;  1M56 C;  2IXM A;  5DLJ A;  3NG1 A;  4PJL A;  4AK9 A;  4BJ5 C;  4QI0 A;  2BE5 F;  5DS6 A;  3ZVR A;  1ST6 A;  1IW7 F;  3QZC A;  1J8M F;  3DMD A;  3HTK C;  1NZE A;  1M2V B;  2M4E A;  3Q6N A;  2XSE A;  1M57 C;  4PJM A;  4Q7C A;  4U5F E;  5EGY A;  4FES A;  2J0W A;  2H7O A;  3EZH A;  1MND A;  5F5H A;  1J8Y F;  3EFO B;  1D0X A;  3AG4 C;  1NU9 C;  4J30 B;  3AG1 C;  4G0H A;  2R7V A;  4C7O A;  1VK5 A;  1IZM A;  3Q7G A;  2EIK C;  1Z5Z A;  3N24 A;  3JSZ A;  2IXO A;  3OEO A;  4J32 B;  1Z63 A;  2EIJ C;  1Z3I X;  2VB6 A;  5IY5 C;  2LSE A;  3DXJ F;  1OKK A;  4CS9 C;  5DVW A;  2WVN A;  2YZS A;  1QLE C;  1D0Z A;  5L3V A;  4QI2 A;  2P7V A;  5E2Q A;  2OCC C;  2WZL A;  2ZPA A;  2MYS A;  4OIN F;  2DYR C;  1ZHY A;  1OKK D;  4Q4Z F;  4AX2 A;  5DS4 A;  1D0Y A;  3S27 A;  3NKE A;  1PCX A;  4GYT A;  4O79 A;  1G8X A;  4CS8 C;  4EBB A;  1SF8 A;  3EG9 A;  3KH2 A;  1N1C A;  3SZR A;  4OIO F;  2KJG A;  2E87 A;  1WGW A;  3DD7 A;  5KYX A;  2VAS A;  3SYN A;  1OCZ C;  4U5H A;  1ZU4 A;  4ANJ A;  2J9U A;  4P6I C;  3NDB B;  1MMN A;  4G7H F;  4O6M A;  3GAN A;  4RBN A;  4LAC B;  3FVY A;  3I5Q A;  3OA1 A;  3NRH A;  3OWT A;  3B0V C;  2EIN C;  3AG2 C;  3ASO C;  1LVK A;  2J0X A;  1V55 C;  4QDL A;  3EH2 A;  4X0R A;  3K6B A;  2FFH A;  2Q9B A;  5KYW A;  1ZYR F;  4U5E E;  1BR2 A;  3K7D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...