1LE2A

Structural basis for altered function in the common mutants of human apolipoprotein-e
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
144
structure length
144
Chain Sequence
b'GQRWELALGRFWDYLRWVQTLSEQVQEELLSSQVTQELRALMDETMKELKAYKSELEEQLTPVAEETRARLSKELQAAQARLGADMEDVCGRLVQYRGEVQAMLGQSTEELRVRLASHLRKLRKRLLRDADDLQKCLAVYQAGA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Salt bridge relay triggers defective LDL receptor binding by a mutant apolipoprotein.
pubmed doi rcsb
molecule keywords APOLIPOPROTEIN E2
source organism Homo sapiens
molecule tags Lipoprotein
total genus 57
structure length 144
sequence length 144
ec nomenclature
pdb deposition date 1991-08-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.20 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Apolipoprotein 1le2A00
1BZ4A 1LPEA 1LE4A 1OR2A 1LS4A 3R2PA 1LE2A 1OR3A 1AEPA 1B68A 3S84A 1GS9A 1EA8A 1H7IA 2KC3A 1NFOA 1EQ1A 1YA9A 1NFNA
chains in the Genus database with same CATH superfamily
3HLZA 4G7HF 4JKVA 4U5CE 1XZPA 3SNHA 4FAPB 2W45A 2ZXWC 4XPYA 3B0VC 2EPLX 1OCOC 2Q7RA 3DXJF 2HKVA 4XLPF 1M56C 4ANJA 1N1CA 3LEVA 4XPWA 3K1HA 1TFKB 4NTFA 2P6VA 2VH3A 2XLEA 2EPNA 2HFIA 1DOWA 2OEXA 2W4BA 3MX3A 4YT5A 1GS9A 4JJFA 1UG7A 4MS2A 4O7GA 3ZVRA 1H7IA 1VK5A 1MNDA 1Q0DA 2BL2A 1VLSA 3JTLO 4AL0A 1APCA 3SP1A 5HV9A 5FCLA 2KJGA 4YL0A 2OG2A 1YA9A 1L3PA 4U5BE 1G5ZA 4BEMJ 4FESA 4C3DA 2PP4A 3RQGA 3HNJA 3W8IA 3KH2A 2J9BA 1BZ4A 1T01A 3DJNB 3X1OA 2I8BA 5COFA 2VB6A 4DJ9A 3UGPA 4DOZA 3T6BA 3M4CA 5KYXB 2P0NA 2OEVA 1O5HA 4YL1A 3N0TA 2A69F 5L0CA 2XXAA 3A9CA 1M6TA 4AK9A 3K66A 4C3BA 1RMVA 2QE9A 2EPKX 3DKAA 3QMKA 3IEEA 2AU5A 4J7YA 2NSFA 1HW1A 5KYYB 4OD5A 3IQCA 5DQTA 2XLVA 1T6QA 1C02A 5F5FA 1PCXA 3A11A 3QVZA 4XEVA 1YZCA 3FAJA 4G78A 4YN0B 4CS9C 5KYUB 2R7OA 3JT1A 2L6FA 2YKZA 4K1OA 3U3FA 4QI2A 5JRAA 3C8GA 3ZTMA 3CQZA 4J32B 3FHDA 1VYIA 3O6XA 3RKOF 3FXHA 2QY9A 3HNIA 2RSEB 2HS5A 3ABLC 5AC4A 3DZAA 1NU7D 1A7DA 2VCBA 3K1IA 4IAQA 4BPMA 3H2VA 3I4UA 4WGZA 5A69A 4LACB 1NU9C 1R5ID 4OIOF 3VYWA 3AG4C 4RDAA 3ATPA 3G4XA 2EILC 1CGOA 3G4ZA 3LLKA 1E84A 4AL1A 1FMVA 1H9GA 2LK4A 3QZCA 4HEAJ 3RQFA 1OW8A 3LUTB 2UUIA 2V26A 3H2UA 3RF3A 1KNYA 1TWCA 1ZYRF 3NKEA 4MQ9F 1ZU4A 4U5GA 2EPOA 1QQ3A 1NFOA 1FTSA 3SXYA 3GM1A 5HSWA 1T5OA 4XQ1A 1IZMA 1OKKD 3K33A 5L3QA 1PD0A 1V54C 2PX3A 1K40A 1WATA 3RIPA 3B29A 2OQMA 1TWHA 3HKKA 3CEXA 2EIKC 4JURI 4WJ0A 2YL3A 2IXMA 1D0ZA 1FFTC 2DYRC 2R05A 4JRZA 2VCAA 4GYTA 3U8PA 4DVYP 3RYLA 2H8AA 4YT4A 4PR9A 1TWAA 4MNDA 2OU6A 3C18A 1U89A 4U5FE 5L0HA 1LE2A 2YQYA 1S7ZA 2LD6A 3KYJA 1NSGB 3AG3C 1MMNA 5BQGA 2H7BA 1OKKA 4KNWA 4CIHA 4HE8D 5AGFA 2PF4E 3O55A 2R7RA 4NY3A 1EA8A 1CPRA 4K7BA 4CDAA 4I44A 3ZDLA 2MYSA 3Q6NA 1G4US 2QLAA 2HMQA 3TJ5A 4LDRA 1AUEA 4FWVA 4N06A 3U8VA 2M4EA 1OQCA 4J30B 3T6JA 2ICWG 3NYJA 1LS1A 4MW8A 4EBKA 1PD1A 3LEOA 2IOQA 3O10A 3EGDA 3QW1A 5DVWA 1E83A 4PACA 5T3TA 1QLEC 3ZSUA 3FVYA 4AE4A 4XEFA 4DRHB 1T6UA 2NPUA 3GWNA 3OWTA 3LNMB 2AWYA 4O6YA 1Z7Qc 3R7CA 3S90A 1NZEA 2XLMA 3B0UX 1LM3B 4G7ZF 2CDQA 1GQAA 4XLNF 3EQLF 1ZHWA 3GANA 2WVNA 5B1BC 4OIPF 4XWJA 4DXWA 4P6IC 3RFYA 1YA7O 1LI5A 2MHRA 1T6IA 1JOGA 3MYIA 3V5YA 5DS6A 5L0DA 4I1OB 1D1AA 2OJQA 3SXZA 3JCUQ 4PFOA 2J0WA 2VC9A 2HJMA 1O87A 3MFNA 1ZVZA 2XXAB 4DRJB 5KYNA 2IXPA 2O9XA 3F47A 1M2VB 4NTAA 3UMHA 1OR2A 4MVUA 3DI5A 3JSEO 2PX0A 4IGGA 2YLIA 1L7CA 3FAPB 3PMRA 4IAOA 4U5EE 4YL3A 4JTAB 4Z9HA 1R4TA 1T9KA 2J46A 1QPUA 3HTKC 5FZTA 1AEPA 4MTFA 3CSKA 1OXKA 1J8MF 1WOLA 2W4MA 2YZSA 1Y6DA 2XL6A 3ZIBA 2LCHA 4Q5SF 2ZXOA 4P9FA 3EFOA 3AQCA 3U9MA 2TMVP 2A0BA 1IW7F 4I3MA 4JZAA 3GWLA 1RKEA 1KTMA 4LERA 2XLHA 2LSEA 1RJ9A 4PJLA 1UFBA 2Y3BA 1NLXA 1FMWA 3EGXB 1G4WR 2D4UA 3S0XA 1HW2A 2IM8A 1K04A 2J7PA 4CIPA 3J06A 2LIGA 1MMGA 3K1IC 3U5SA 4A2NB 1Q0GA 3TJ6A 5EHHA 3LS0A 5A6AA 4PJJA 1LE4A 1JR8A 3DD7A 4B6IA 1Z3IX 5CI9A 1YDIA 2GAQA 3TD7A 1HMDA 5KYWA 3LAYA 4MW3A 3C8GD 4O79A 2NSGA 2R03A 3PCVA 4MVQA 3TOLA 1XWJA 5F28E 5EGYA 3NMIA 4OIQF 2NUPA 1CGME 5B1AC 1LIHA 1YLMA 3TOMA 2DB4A 4MVSA 5TJ5E 1PV3A 3AG1C 4EBJA 4PJNA 1NBBA 1YARO 2X0CA 2F22A 4NQFA 1O3UA 4ER9A 4W8KA 3GEIA 1E85A 1AVOB 4WGYA 3ABMC 1JPJA 3BEHA 2L9JA 2XLDA 1TR2A 2A68F 2L6GA 3AJMA 3M15A 3QW0A 2P61A 3FMSA 3K7DA 4F4BA 2PBEA 2QTVA 3ZQYA 4K0DA 5L0IA 2BC5A 1DOVA 2CGEA 4NTBA 4J7TA 2B0HA 4YWQA 3JSZA 4MVRA 4PJMA 3UR3C 1TKNA 2WB7A 1F1MA 2YRFA 3IQ5A 4H4KC 5AC5A 1U0BB 3KKBA 4MVOA 3B9QA 4FX5A 1JRAA 2CCYA 3B0PA 2L81A 3G50A 4JJGA 4R32A 4Z9IA 3U9JA 3FDQA 3NMJA 1KU2A 5EK0A 3V5ZA 4ULVA 4DVZA 2IXOA 2KNHA 4IARA 3ECSA 3C63A 2ZPAA 4D4NA 3ABKC 3VRCA 2YHSA 5A6KA 3N2ZB 1OCRC 1D0YA 2E87A 2B0JA 4AE4B 5BUOA 4KI2A 2EPMX 2J8WA 1EKYA 2QNLA 5DLJA 4BJ6A 3MBGA 2LQGA 4N4WA 4JEBA 2WL8A 3ZWIA 1QZXA 2KSFA 4JCHA 3WAQA 1CGNA 1ZU5A 2GA0A 3DE8A 4Q7CA 3ITFA 2NUTB 5K0IA 2OJED 2XS1A 2V3CC 1Q0MA 4IB4A 4BJTA 2ZXRA 4C7OB 1OR3A 1ZW3A 2C04A 3LS1A 1TWGA 3C8ZA 1ZHYA 4CX9A 1FR0A 4JC7A 4ULWA 1HE9A 1BR4A 3U3BA 5JSLA 5DQZA 2KQ9A 2KC3A 3HNKA 1MMDA 2WZLA 2H7VC 3KL4A 3N24A 3L0IA 4CJOA 1BR2A 2Y39A 1OW6A 3GODA 5D91A 1ST6A 3RQEA 1MNEA 3WODF 1D0XA 1I5NA 3NRHA 2GFHA 2GWWA 3EPVA 256BA 1E86A 1JPNA 3EH1A 1WTYA 4GEHA 3NYLA 3DMDA 1A7EA 4EUKB 2LFDA 2XL8A 3JZ0A 3KPHA 5L0JA 4QI0A 4GQHA 4RD9A 4CJGA 1JMWA 2M64A 3T9OA 2KK1A 1YAUO 4G0HA 3T4RA 1OW7A 5JVEA 3W8HA 1Z6AA 3TK0A 1WASA 2Q00A 3EFOB 3OEOA 4P9TA 2XSEA 3I5QA 1RKEB 2LP4A 1RJ9B 2DGJA 4JVSA 2RD9A 2H7OA 2J9VA 3L8IA 4N6HA 4RBNA 3LLIA 2KGOA 2YLDA 3L34A 2XM4A 3AQBA 5JUAA 4WABA 1TFOB 1NG1A 1VTMP 1YJGA 2FGYA 3GM2A 3M79A 4A4AA 3AGTA 3PHF2 1YYJA 2G62A 4C3EA 2X51A 3LNRA 3RVZA 4YK5A 1JAFA 2HZ8A 4XTKA 5KYWB 2R7UA 1HY5A 3Q6MA 4AX2A 4BJ1A 1D1CA 2R9RB 1YVIA 1ZZPA 1ORYA 2G3VA 3ZC4A 5L0GA 2YWAA 1ORSC 2GDCA 1LS4A 1YYXA 4BEJA 3UGOA 1OXBA 2NUPB 3R2PA 4XPXA 1V4AA 3EH2A 3ZTZA 2PNOA 2EIJC 5CI8A 3Q7LA 2J7PD 4BJ5A 4KC9A 1SR2A 3S9OA 1A41A 3LESA 2Y3DA 3M1CB 1E2XA 1ZW2A 3ASOC 3GEEA 1U6HA 2WZFA 4U9EA 4E7SA 1YZAA 2EIMC 1I4ZA 2WVQA 2XS8A 2Q4FA 2R25A 3C8GB 3F46A 4U5DE 3C7JA 4NCQA 4CDYA 2R7XA 1BBHA 3DWWA 1QKRA 3Q7GA 4N6CA 3VF0A 2YLGA 4OD4A 3WG7C 5BQIA 1OCZC 3KMIA 2R7SA 3L1MA 3NYMA 2AVKA 2Y3HA 3KYIA 2VCCA 5BQHA 2ZXPA 3AOUA 3NG1A 2IBFA 2A1DD 2G3KA 3EZHA 4EKWA 1Y4CA 2C03A 2R7VA 4LDQA 3VM6A 3ASNC 2JD3A 1VLTA 1C17M 3E9VA 3EG9A 1Q0KA 2P7VA 3GEHA 1XZQA 3VAYA 4U9DA 2KYHA 1H9TA 4CS8A 4BG0A 3LJBA 4MVZA 2XM0A 4E0IA 4E7ZA 1HE1A 4CSAA 5D92A 4YT2A 4M63A 2Q3TA 3NKDA 1SF8A 1BDJB 2CNWD 2JPUA 2MWQA 4BJ6C 3ZG1A 3CZ6A 4O6MA 3FOPA 3NMKA 3HJCA 4MTOA 3RVYA 3X2QC 4DRIB 4EIYA 1SYQA 1Q0FA 3MLGA 4EHPA 2R02A 4KNVA 3RH3A 1M2OA 4IJJA 2L6HA 1ZHZA 2YL7A 2HUJA 5DS5A 1M2VA 4KBLA 3V7OA 1CPQA 2J0XA 5DS4A 2Q9BA 2P1AA 4XEKA 3TQOA 4E18A 4PFPA 2D5RB 2CNWA 4UDVA 4E17A 3S84A 5A6JA 3SEOA 2AP3A 1SMYF 5F5HA 5E3CA 5JT4A 4HFKB 3GM3A 3EHNA 1LVKA 2VASA 4LDKA 2ETSA 4YJWA 3W2VA 3M4BA 3W2WA 4LLEA 2WZGA 4JCZA 2OCCC 3EGDB 1GGQA 3JRMO 4HFFB 2CW0F 5A6BD 5COGA 2YL0A 1ZHXA 4I1MA 2KW3C 1Z63A 1LPEA 3DAFA 4Q4ZF 2L7AA 1H6GA 2YVKA 3EGXA 1HMOA 4W8PA 1M57C 4JE9A 1MQVA 3TULA 2JX0A 4OIRF 3IQ6A 1I4YA 1EI7A 2DYSC 2HSBA 3AG2C 5E3AA 3UMKA 2HV6A 4Z9JA 3K6BA 4DBRA 4G7OF 4D4XA 1G8XA 2HSQA 2XLOA 5E2QA 5L3VA 3H65A 5KYXA 4O6NA 2NG1A 1MMAA 2J45A 3O39A 3SXMA 1RKCA 2Y3GA 4DBQA 4JEAA 2FAPB 1OCCC 3S29A 1VMAA 3EJNA 2OKUA 5A6BA 3GORA 3UMIA 5B3SC 3DJUB 5CIVA 3SXKA 3C62A 5COMA 1BR1A 1VYKA 5KYYA 3QVYA 1FAPB 1TQGA 4JIOA 5IY5C 1LI7A 2HMZA 2W9YA 2XL4A 3JRTA 2Y69C 3B71A 4CS9A 5B3IA 1ORJA 5KYUA 2R7TA 3EZIA 4MTGA 4YT8A 3EHMA 3IHUA 3ZQVA 2YL1A 3POVA 5L0FA 2J9WA 5T3WA 3SYNA 1WWPA 3U2LA 4U5HA 2LFFA 2OOCA 3JYHA 1FNTc 2BE5F 1K05A 1VOMA 1WGWA 3U2MA 2Q9CA 4BJ5C 1SZIA 3DM5A 3OA1A 1V55C 1VB5A 2QUPA 3E70C 3I5PA 1A7VA 4CS7A 1V74B 4JTCB 1B68A 2A6HF 2IXNA 3JYYA 2FFHA 3MYFA 4ONSA 1GM5A 2CYDA 2XRHA 5GPGB 1RXQA 3WHNA 4L6RA 4EBBA 4EWCA 5JS5A 4JTDB 1LKXA 3QTHA 5E33A 3V5XA 3T6GB 4CDVA 2A6EF 1D1BA 1W2WA 2ASRA 2WVOA 3NDBB 1EQ1A 2Q9AA 3PDMP 1NFNA 1C03A 2Z15A 3FOOA 3U0CA 3L8JA 3UNGC 2ZD9A 3HNLA 5JLIA 3US6A 1Z23A 4IWBA 3DE9A 1QSPA 4LLCA 1RCPA 2PFDA 2XLWA 4CBEA 1A0BA 4MVMA 2IYLD 3RW0A 5T1DB 3DM9B 3DAGA 2HJ3A 2YEVA 1Z5ZA 3EG9B 4NC3A 3S28A 4OINF 3SZRA 2AWCA 2NUTA 4QDLA 3W4YA 4CS8C 2DI3A 4C7OA 2A0UA 1QVXA 4JW1A 1WN0A 1FFHA 2HV7A 3AGUA 5JP7A 4CSAC 4ZLDA 1J8YF 3CAXA 4PK4A 3S27A 2R7QA 2EINC 2UUHA 3IQTA 2R7WA 4H54A 2J9UA 3IPMO 2I15A 3BRJA 4IRUA 1S05A 4E0HA 4X0RA 4ZLCA 1ZHTA
chains in the Genus database with same CATH topology
1BZ4A 1LPEA 1LE4A 1OR2A 1LS4A 3R2PA 1LE2A 1OR3A 1AEPA 1B68A 3S84A 1GS9A 1EA8A 1H7IA 2KC3A 1NFOA 1EQ1A 1YA9A 1NFNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BZ4 A;  1LPE A;  1LE4 A;  1OR2 A;  1LS4 A;  3R2P A;  1LE2 A;  1OR3 A;  1AEP A;  1B68 A;  3S84 A;  1GS9 A;  1EA8 A;  1H7I A;  2KC3 A;  1NFO A;  1EQ1 A;  1YA9 A;  1NFN A; 
#chains in the Genus database with same CATH topology
 3HLZ A;  4G7H F;  4JKV A;  4U5C E;  1XZP A;  3SNH A;  4FAP B;  2W45 A;  2ZXW C;  4XPY A;  3B0V C;  2EPL X;  1OCO C;  2Q7R A;  3DXJ F;  2HKV A;  4XLP F;  1M56 C;  4ANJ A;  1N1C A;  3LEV A;  4XPW A;  3K1H A;  1TFK B;  4NTF A;  2P6V A;  2VH3 A;  2XLE A;  2EPN A;  2HFI A;  1DOW A;  2OEX A;  2W4B A;  3MX3 A;  4YT5 A;  1GS9 A;  4JJF A;  1UG7 A;  4MS2 A;  4O7G A;  3ZVR A;  1H7I A;  1VK5 A;  1MND A;  1Q0D A;  2BL2 A;  1VLS A;  3JTL O;  4AL0 A;  1APC A;  3SP1 A;  5HV9 A;  5FCL A;  2KJG A;  4YL0 A;  2OG2 A;  1YA9 A;  1L3P A;  4U5B E;  1G5Z A;  4BEM J;  4FES A;  4C3D A;  2PP4 A;  3RQG A;  3HNJ A;  3W8I A;  3KH2 A;  2J9B A;  1BZ4 A;  1T01 A;  3DJN B;  3X1O A;  2I8B A;  5COF A;  2VB6 A;  4DJ9 A;  3UGP A;  4DOZ A;  3T6B A;  3M4C A;  5KYX B;  2P0N A;  2OEV A;  1O5H A;  4YL1 A;  3N0T A;  2A69 F;  5L0C A;  2XXA A;  3A9C A;  1M6T A;  4AK9 A;  3K66 A;  4C3B A;  1RMV A;  2QE9 A;  2EPK X;  3DKA A;  3QMK A;  3IEE A;  2AU5 A;  4J7Y A;  2NSF A;  1HW1 A;  5KYY B;  4OD5 A;  3IQC A;  5DQT A;  2XLV A;  1T6Q A;  1C02 A;  5F5F A;  1PCX A;  3A11 A;  3QVZ A;  4XEV A;  1YZC A;  3FAJ A;  4G78 A;  4YN0 B;  4CS9 C;  5KYU B;  2R7O A;  3JT1 A;  2L6F A;  2YKZ A;  4K1O A;  3U3F A;  4QI2 A;  5JRA A;  3C8G A;  3ZTM A;  3CQZ A;  4J32 B;  3FHD A;  1VYI A;  3O6X A;  3RKO F;  3FXH A;  2QY9 A;  3HNI A;  2RSE B;  2HS5 A;  3ABL C;  5AC4 A;  3DZA A;  1NU7 D;  1A7D A;  2VCB A;  3K1I A;  4IAQ A;  4BPM A;  3H2V A;  3I4U A;  4WGZ A;  5A69 A;  4LAC B;  1NU9 C;  1R5I D;  4OIO F;  3VYW A;  3AG4 C;  4RDA A;  3ATP A;  3G4X A;  2EIL C;  1CGO A;  3G4Z A;  3LLK A;  1E84 A;  4AL1 A;  1FMV A;  1H9G A;  2LK4 A;  3QZC A;  4HEA J;  3RQF A;  1OW8 A;  3LUT B;  2UUI A;  2V26 A;  3H2U A;  3RF3 A;  1KNY A;  1TWC A;  1ZYR F;  3NKE A;  4MQ9 F;  1ZU4 A;  4U5G A;  2EPO A;  1QQ3 A;  1NFO A;  1FTS A;  3SXY A;  3GM1 A;  5HSW A;  1T5O A;  4XQ1 A;  1IZM A;  1OKK D;  3K33 A;  5L3Q A;  1PD0 A;  1V54 C;  2PX3 A;  1K40 A;  1WAT A;  3RIP A;  3B29 A;  2OQM A;  1TWH A;  3HKK A;  3CEX A;  2EIK C;  4JUR I;  4WJ0 A;  2YL3 A;  2IXM A;  1D0Z A;  1FFT C;  2DYR C;  2R05 A;  4JRZ A;  2VCA A;  4GYT A;  3U8P A;  4DVY P;  3RYL A;  2H8A A;  4YT4 A;  4PR9 A;  1TWA A;  4MND A;  2OU6 A;  3C18 A;  1U89 A;  4U5F E;  5L0H A;  1LE2 A;  2YQY A;  1S7Z A;  2LD6 A;  3KYJ A;  1NSG B;  3AG3 C;  1MMN A;  5BQG A;  2H7B A;  1OKK A;  4KNW A;  4CIH A;  4HE8 D;  5AGF A;  2PF4 E;  3O55 A;  2R7R A;  4NY3 A;  1EA8 A;  1CPR A;  4K7B A;  4CDA A;  4I44 A;  3ZDL A;  2MYS A;  3Q6N A;  1G4U S;  2QLA A;  2HMQ A;  3TJ5 A;  4LDR A;  1AUE A;  4FWV A;  4N06 A;  3U8V A;  2M4E A;  1OQC A;  4J30 B;  3T6J A;  2ICW G;  3NYJ A;  1LS1 A;  4MW8 A;  4EBK A;  1PD1 A;  3LEO A;  2IOQ A;  3O10 A;  3EGD A;  3QW1 A;  5DVW A;  1E83 A;  4PAC A;  5T3T A;  1QLE C;  3ZSU A;  3FVY A;  4AE4 A;  4XEF A;  4DRH B;  1T6U A;  2NPU A;  3GWN A;  3OWT A;  3LNM B;  2AWY A;  4O6Y A;  1Z7Q c;  3R7C A;  3S90 A;  1NZE A;  2XLM A;  3B0U X;  1LM3 B;  4G7Z F;  2CDQ A;  1GQA A;  4XLN F;  3EQL F;  1ZHW A;  3GAN A;  2WVN A;  5B1B C;  4OIP F;  4XWJ A;  4DXW A;  4P6I C;  3RFY A;  1YA7 O;  1LI5 A;  2MHR A;  1T6I A;  1JOG A;  3MYI A;  3V5Y A;  5DS6 A;  5L0D A;  4I1O B;  1D1A A;  2OJQ A;  3SXZ A;  3JCU Q;  4PFO A;  2J0W A;  2VC9 A;  2HJM A;  1O87 A;  3MFN A;  1ZVZ A;  2XXA B;  4DRJ B;  5KYN A;  2IXP A;  2O9X A;  3F47 A;  1M2V B;  4NTA A;  3UMH A;  1OR2 A;  4MVU A;  3DI5 A;  3JSE O;  2PX0 A;  4IGG A;  2YLI A;  1L7C A;  3FAP B;  3PMR A;  4IAO A;  4U5E E;  4YL3 A;  4JTA B;  4Z9H A;  1R4T A;  1T9K A;  2J46 A;  1QPU A;  3HTK C;  5FZT A;  1AEP A;  4MTF A;  3CSK A;  1OXK A;  1J8M F;  1WOL A;  2W4M A;  2YZS A;  1Y6D A;  2XL6 A;  3ZIB A;  2LCH A;  4Q5S F;  2ZXO A;  4P9F A;  3EFO A;  3AQC A;  3U9M A;  2TMV P;  2A0B A;  1IW7 F;  4I3M A;  4JZA A;  3GWL A;  1RKE A;  1KTM A;  4LER A;  2XLH A;  2LSE A;  1RJ9 A;  4PJL A;  1UFB A;  2Y3B A;  1NLX A;  1FMW A;  3EGX B;  1G4W R;  2D4U A;  3S0X A;  1HW2 A;  2IM8 A;  1K04 A;  2J7P A;  4CIP A;  3J06 A;  2LIG A;  1MMG A;  3K1I C;  3U5S A;  4A2N B;  1Q0G A;  3TJ6 A;  5EHH A;  3LS0 A;  5A6A A;  4PJJ A;  1LE4 A;  1JR8 A;  3DD7 A;  4B6I A;  1Z3I X;  5CI9 A;  1YDI A;  2GAQ A;  3TD7 A;  1HMD A;  5KYW A;  3LAY A;  4MW3 A;  3C8G D;  4O79 A;  2NSG A;  2R03 A;  3PCV A;  4MVQ A;  3TOL A;  1XWJ A;  5F28 E;  5EGY A;  3NMI A;  4OIQ F;  2NUP A;  1CGM E;  5B1A C;  1LIH A;  1YLM A;  3TOM A;  2DB4 A;  4MVS A;  5TJ5 E;  1PV3 A;  3AG1 C;  4EBJ A;  4PJN A;  1NBB A;  1YAR O;  2X0C A;  2F22 A;  4NQF A;  1O3U A;  4ER9 A;  4W8K A;  3GEI A;  1E85 A;  1AVO B;  4WGY A;  3ABM C;  1JPJ A;  3BEH A;  2L9J A;  2XLD A;  1TR2 A;  2A68 F;  2L6G A;  3AJM A;  3M15 A;  3QW0 A;  2P61 A;  3FMS A;  3K7D A;  4F4B A;  2PBE A;  2QTV A;  3ZQY A;  4K0D A;  5L0I A;  2BC5 A;  1DOV A;  2CGE A;  4NTB A;  4J7T A;  2B0H A;  4YWQ A;  3JSZ A;  4MVR A;  4PJM A;  3UR3 C;  1TKN A;  2WB7 A;  1F1M A;  2YRF A;  3IQ5 A;  4H4K C;  5AC5 A;  1U0B B;  3KKB A;  4MVO A;  3B9Q A;  4FX5 A;  1JRA A;  2CCY A;  3B0P A;  2L81 A;  3G50 A;  4JJG A;  4R32 A;  4Z9I A;  3U9J A;  3FDQ A;  3NMJ A;  1KU2 A;  5EK0 A;  3V5Z A;  4ULV A;  4DVZ A;  2IXO A;  2KNH A;  4IAR A;  3ECS A;  3C63 A;  2ZPA A;  4D4N A;  3ABK C;  3VRC A;  2YHS A;  5A6K A;  3N2Z B;  1OCR C;  1D0Y A;  2E87 A;  2B0J A;  4AE4 B;  5BUO A;  4KI2 A;  2EPM X;  2J8W A;  1EKY A;  2QNL A;  5DLJ A;  4BJ6 A;  3MBG A;  2LQG A;  4N4W A;  4JEB A;  2WL8 A;  3ZWI A;  1QZX A;  2KSF A;  4JCH A;  3WAQ A;  1CGN A;  1ZU5 A;  2GA0 A;  3DE8 A;  4Q7C A;  3ITF A;  2NUT B;  5K0I A;  2OJE D;  2XS1 A;  2V3C C;  1Q0M A;  4IB4 A;  4BJT A;  2ZXR A;  4C7O B;  1OR3 A;  1ZW3 A;  2C04 A;  3LS1 A;  1TWG A;  3C8Z A;  1ZHY A;  4CX9 A;  1FR0 A;  4JC7 A;  4ULW A;  1HE9 A;  1BR4 A;  3U3B A;  5JSL A;  5DQZ A;  2KQ9 A;  2KC3 A;  3HNK A;  1MMD A;  2WZL A;  2H7V C;  3KL4 A;  3N24 A;  3L0I A;  4CJO A;  1BR2 A;  2Y39 A;  1OW6 A;  3GOD A;  5D91 A;  1ST6 A;  3RQE A;  1MNE A;  3WOD F;  1D0X A;  1I5N A;  3NRH A;  2GFH A;  2GWW A;  3EPV A;  256B A;  1E86 A;  1JPN A;  3EH1 A;  1WTY A;  4GEH A;  3NYL A;  3DMD A;  1A7E A;  4EUK B;  2LFD A;  2XL8 A;  3JZ0 A;  3KPH A;  5L0J A;  4QI0 A;  4GQH A;  4RD9 A;  4CJG A;  1JMW A;  2M64 A;  3T9O A;  2KK1 A;  1YAU O;  4G0H A;  3T4R A;  1OW7 A;  5JVE A;  3W8H A;  1Z6A A;  3TK0 A;  1WAS A;  2Q00 A;  3EFO B;  3OEO A;  4P9T A;  2XSE A;  3I5Q A;  1RKE B;  2LP4 A;  1RJ9 B;  2DGJ A;  4JVS A;  2RD9 A;  2H7O A;  2J9V A;  3L8I A;  4N6H A;  4RBN A;  3LLI A;  2KGO A;  2YLD A;  3L34 A;  2XM4 A;  3AQB A;  5JUA A;  4WAB A;  1TFO B;  1NG1 A;  1VTM P;  1YJG A;  2FGY A;  3GM2 A;  3M79 A;  4A4A A;  3AGT A;  3PHF 2;  1YYJ A;  2G62 A;  4C3E A;  2X51 A;  3LNR A;  3RVZ A;  4YK5 A;  1JAF A;  2HZ8 A;  4XTK A;  5KYW B;  2R7U A;  1HY5 A;  3Q6M A;  4AX2 A;  4BJ1 A;  1D1C A;  2R9R B;  1YVI A;  1ZZP A;  1ORY A;  2G3V A;  3ZC4 A;  5L0G A;  2YWA A;  1ORS C;  2GDC A;  1LS4 A;  1YYX A;  4BEJ A;  3UGO A;  1OXB A;  2NUP B;  3R2P A;  4XPX A;  1V4A A;  3EH2 A;  3ZTZ A;  2PNO A;  2EIJ C;  5CI8 A;  3Q7L A;  2J7P D;  4BJ5 A;  4KC9 A;  1SR2 A;  3S9O A;  1A41 A;  3LES A;  2Y3D A;  3M1C B;  1E2X A;  1ZW2 A;  3ASO C;  3GEE A;  1U6H A;  2WZF A;  4U9E A;  4E7S A;  1YZA A;  2EIM C;  1I4Z A;  2WVQ A;  2XS8 A;  2Q4F A;  2R25 A;  3C8G B;  3F46 A;  4U5D E;  3C7J A;  4NCQ A;  4CDY A;  2R7X A;  1BBH A;  3DWW A;  1QKR A;  3Q7G A;  4N6C A;  3VF0 A;  2YLG A;  4OD4 A;  3WG7 C;  5BQI A;  1OCZ C;  3KMI A;  2R7S A;  3L1M A;  3NYM A;  2AVK A;  2Y3H A;  3KYI A;  2VCC A;  5BQH A;  2ZXP A;  3AOU A;  3NG1 A;  2IBF A;  2A1D D;  2G3K A;  3EZH A;  4EKW A;  1Y4C A;  2C03 A;  2R7V A;  4LDQ A;  3VM6 A;  3ASN C;  2JD3 A;  1VLT A;  1C17 M;  3E9V A;  3EG9 A;  1Q0K A;  2P7V A;  3GEH A;  1XZQ A;  3VAY A;  4U9D A;  2KYH A;  1H9T A;  4CS8 A;  4BG0 A;  3LJB A;  4MVZ A;  2XM0 A;  4E0I A;  4E7Z A;  1HE1 A;  4CSA A;  5D92 A;  4YT2 A;  4M63 A;  2Q3T A;  3NKD A;  1SF8 A;  1BDJ B;  2CNW D;  2JPU A;  2MWQ A;  4BJ6 C;  3ZG1 A;  3CZ6 A;  4O6M A;  3FOP A;  3NMK A;  3HJC A;  4MTO A;  3RVY A;  3X2Q C;  4DRI B;  4EIY A;  1SYQ A;  1Q0F A;  3MLG A;  4EHP A;  2R02 A;  4KNV A;  3RH3 A;  1M2O A;  4IJJ A;  2L6H A;  1ZHZ A;  2YL7 A;  2HUJ A;  5DS5 A;  1M2V A;  4KBL A;  3V7O A;  1CPQ A;  2J0X A;  5DS4 A;  2Q9B A;  2P1A A;  4XEK A;  3TQO A;  4E18 A;  4PFP A;  2D5R B;  2CNW A;  4UDV A;  4E17 A;  3S84 A;  5A6J A;  3SEO A;  2AP3 A;  1SMY F;  5F5H A;  5E3C A;  5JT4 A;  4HFK B;  3GM3 A;  3EHN A;  1LVK A;  2VAS A;  4LDK A;  2ETS A;  4YJW A;  3W2V A;  3M4B A;  3W2W A;  4LLE A;  2WZG A;  4JCZ A;  2OCC C;  3EGD B;  1GGQ A;  3JRM O;  4HFF B;  2CW0 F;  5A6B D;  5COG A;  2YL0 A;  1ZHX A;  4I1M A;  2KW3 C;  1Z63 A;  1LPE A;  3DAF A;  4Q4Z F;  2L7A A;  1H6G A;  2YVK A;  3EGX A;  1HMO A;  4W8P A;  1M57 C;  4JE9 A;  1MQV A;  3TUL A;  2JX0 A;  4OIR F;  3IQ6 A;  1I4Y A;  1EI7 A;  2DYS C;  2HSB A;  3AG2 C;  5E3A A;  3UMK A;  2HV6 A;  4Z9J A;  3K6B A;  4DBR A;  4G7O F;  4D4X A;  1G8X A;  2HSQ A;  2XLO A;  5E2Q A;  5L3V A;  3H65 A;  5KYX A;  4O6N A;  2NG1 A;  1MMA A;  2J45 A;  3O39 A;  3SXM A;  1RKC A;  2Y3G A;  4DBQ A;  4JEA A;  2FAP B;  1OCC C;  3S29 A;  1VMA A;  3EJN A;  2OKU A;  5A6B A;  3GOR A;  3UMI A;  5B3S C;  3DJU B;  5CIV A;  3SXK A;  3C62 A;  5COM A;  1BR1 A;  1VYK A;  5KYY A;  3QVY A;  1FAP B;  1TQG A;  4JIO A;  5IY5 C;  1LI7 A;  2HMZ A;  2W9Y A;  2XL4 A;  3JRT A;  2Y69 C;  3B71 A;  4CS9 A;  5B3I A;  1ORJ A;  5KYU A;  2R7T A;  3EZI A;  4MTG A;  4YT8 A;  3EHM A;  3IHU A;  3ZQV A;  2YL1 A;  3POV A;  5L0F A;  2J9W A;  5T3W A;  3SYN A;  1WWP A;  3U2L A;  4U5H A;  2LFF A;  2OOC A;  3JYH A;  1FNT c;  2BE5 F;  1K05 A;  1VOM A;  1WGW A;  3U2M A;  2Q9C A;  4BJ5 C;  1SZI A;  3DM5 A;  3OA1 A;  1V55 C;  1VB5 A;  2QUP A;  3E70 C;  3I5P A;  1A7V A;  4CS7 A;  1V74 B;  4JTC B;  1B68 A;  2A6H F;  2IXN A;  3JYY A;  2FFH A;  3MYF A;  4ONS A;  1GM5 A;  2CYD A;  2XRH A;  5GPG B;  1RXQ A;  3WHN A;  4L6R A;  4EBB A;  4EWC A;  5JS5 A;  4JTD B;  1LKX A;  3QTH A;  5E33 A;  3V5X A;  3T6G B;  4CDV A;  2A6E F;  1D1B A;  1W2W A;  2ASR A;  2WVO A;  3NDB B;  1EQ1 A;  2Q9A A;  3PDM P;  1NFN A;  1C03 A;  2Z15 A;  3FOO A;  3U0C A;  3L8J A;  3UNG C;  2ZD9 A;  3HNL A;  5JLI A;  3US6 A;  1Z23 A;  4IWB A;  3DE9 A;  1QSP A;  4LLC A;  1RCP A;  2PFD A;  2XLW A;  4CBE A;  1A0B A;  4MVM A;  2IYL D;  3RW0 A;  5T1D B;  3DM9 B;  3DAG A;  2HJ3 A;  2YEV A;  1Z5Z A;  3EG9 B;  4NC3 A;  3S28 A;  4OIN F;  3SZR A;  2AWC A;  2NUT A;  4QDL A;  3W4Y A;  4CS8 C;  2DI3 A;  4C7O A;  2A0U A;  1QVX A;  4JW1 A;  1WN0 A;  1FFH A;  2HV7 A;  3AGU A;  5JP7 A;  4CSA C;  4ZLD A;  1J8Y F;  3CAX A;  4PK4 A;  3S27 A;  2R7Q A;  2EIN C;  2UUH A;  3IQT A;  2R7W A;  4H54 A;  2J9U A;  3IPM O;  2I15 A;  3BRJ A;  4IRU A;  1S05 A;  4E0H A;  4X0R A;  4ZLC A;  1ZHT A; 
#chains in the Genus database with same CATH homology
 1BZ4 A;  1LPE A;  1LE4 A;  1OR2 A;  1LS4 A;  3R2P A;  1LE2 A;  1OR3 A;  1AEP A;  1B68 A;  3S84 A;  1GS9 A;  1EA8 A;  1H7I A;  2KC3 A;  1NFO A;  1EQ1 A;  1YA9 A;  1NFN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...