1LE2A

Structural basis for altered function in the common mutants of human apolipoprotein-e
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
144
structure length
144
Chain Sequence
GQRWELALGRFWDYLRWVQTLSEQVQEELLSSQVTQELRALMDETMKELKAYKSELEEQLTPVAEETRARLSKELQAAQARLGADMEDVCGRLVQYRGEVQAMLGQSTEELRVRLASHLRKLRKRLLRDADDLQKCLAVYQAGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords APOLIPOPROTEIN E2
publication title Salt bridge relay triggers defective LDL receptor binding by a mutant apolipoprotein.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lipoprotein
total genus 57
structure length 144
sequence length 144
ec nomenclature
pdb deposition date 1991-08-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.20 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Apolipoprotein 1le2A00
1NFOA 1GS9A 1LPEA 1OR3A 1EQ1A 1LE4A 1EA8A 1YA9A 1H7IA 1NFNA 3R2PA 1B68A 1LS4A 2KC3A 3S84A 1AEPA 1OR2A 1BZ4A 1LE2A
chains in the Genus database with same CATH superfamily
2Y69C 3C18A 1O5HA 3HJCA 3O39A 3PDMP 3RQGA 4BEJA 3JZ0A 2G3VA 3F47A 3JSEO 3ZQVA 2YHSA 1E85A 1Q0GA 3DE8A 4WJ0A 1R4TA 2EIKC 2CCYA 3W2WA 1BR1A 4MTOA 4C3BA 3DJNB 5AC4A 4CDAA 3U2LA 4IB4A 2VH3A 3QVZA 5DS4A 4U5DE 1D1AA 2HZ8A 1ZU5A 4MVSA 2TMVP 3MLGA 2VASA 4D4NA 1KU2A 3ZWIA 2L81A 1H6GA 1PD0A 1D0ZA 3RFYA 3S90A 1Q0MA 3I5QA 3LUTB 2XM0A 4YT2A 3S84A 2V26A 3U9MA 2YZSA 4CSAA 2A6EF 1HY5A 3FHDA 4OIOF 2YL1A 1RKEB 3UNGC 2MYSA 1A0BA 1YYXA 2HFIA 3KPHA 5L3VA 1WTYA 2NPUA 3T9OA 3N24A 3C63A 3IEEA 4QDLA 4JEAA 2WVNA 4GEHA 2HSQA 4ZLDA 5A6BA 5E33A 1U6HA 3VYWA 4Q7CA 3E9VA 3LAYA 4LDRA 5COFA 4G7ZF 1EI7A 3X1OA 2KW3C 4XLNF 4L6RA 4EBBA 4YL0A 3E70C 1TQGA 2XSEA 4AL1A 4RBNA 3VAYA 3HLZA 3GM2A 1YZAA 4R32A 1OCOC 1YAUO 1ZU4A 3VF0A 4CBEA 2XS8A 3WAQA 5L0CA 1H9TA 2Y3GA 5L3QA 3C62A 3DXJF 3S27A 3UMHA 2HV7A 4BG0A 3TJ6A 2KSFA 1WGWA 2KK1A 3ABMC 1Z3IX 1T6UA 1CGOA 3EG9A 2AU5A 2W4MA 3I4UA 1HMOA 4JJGA 3NMKA 4XWJA 1C17M 1M2VA 3SZRA 4DBRA 5FCLA 4MQ9F 2YKZA 2PBEA 3ZTMA 4YJWA 4AE4A 2J9UA 2OJQA 3RF3A 4ER9A 2XXAB 1NU9C 4NCQA 2RD9A 4XEFA 4EWCA 1SF8A 1ZHZA 5DS6A 3IPMO 4OIQF 3EHMA 4JIOA 3FAJA 2QLAA 1TFKB 1YLMA 3EG9B 3M1CB 3OWTA 4U5CE 2WVOA 4YWQA 2GAQA 3SYNA 2KYHA 5KYXA 3JTLO 2XLHA 3R2PA 3C8GA 5JP7A 4KC9A 1JPNA 2IOQA 4JKVA 4AE4B 5BQHA 1G4WR 4OIRF 2IBFA 3ITFA 3TULA 3EFOB 4LACB 3X2QC 1I4YA 3Q7GA 5COMA 1Y4CA 2EILC 1OKKD 3JSZA 3V5XA 2HUJA 4BEMJ 5A6KA 2R7UA 3NKEA 4I3MA 4MW8A 1M6TA 4MW3A 1LI5A 3EQLF 3GM3A 1YARO 2KJGA 1TKNA 3F46A 4N6CA 4EHPA 2YVKA 2EPMX 2L7AA 4JTDB 1LPEA 2CW0F 3NMIA 4QI2A 1MQVA 1LI7A 1TWAA 3BRJA 3GWNA 2MWQA 1E84A 2YL7A 2B0JA 2KNHA 4HEAJ 2DYSC 4J7YA 4AL0A 5DS5A 4BPMA 1JOGA 2WL8A 4JRZA 1QVXA 3IQ5A 3DE9A 3FAPB 2OEXA 2P0NA 4U9DA 4YK5A 4IAQA 2R9RB 3QMKA 4CJOA 5JT4A 4PJMA 3JCUQ 5JVEA 1Y6DA 2UUIA 2IM8A 2ZPAA 5L0DA 3M4BA 2XS1A 3NRHA 1JMWA 3W4YA 1TR2A 5JRAA 1E83A 3FVYA 3GANA 1S05A 3TQOA 2CNWD 3M15A 4O6NA 4PFOA 4XQ1A 1VTMP 3B9QA 1EKYA 1K40A 2F22A 1GQAA 4F4BA 3WODF 2L6GA 4NY3A 1E2XA 2OQMA 2P1AA 4YT5A 1CGNA 3FOOA 4MNDA 3SXMA 4JTAB 3WHNA 2HJMA 4XPYA 1LS4A 3GEHA 3W8HA 1T9KA 1S7ZA 2J0WA 3K1IA 1ZZPA 3UR3C 1A7EA 2J7PA 5F5HA 2EIJC 2AWCA 4M63A 3DKAA 1YYJA 4P6IC 4E17A 3WG7C 4G7HF 4D4XA 3EGXB 1I4ZA 3GM1A 4U5GA 1Q0FA 4Q5SF 3SNHA 1RJ9B 1OW8A 2R02A 3KMIA 4JURI 2M4EA 4DRJB 5JS5A 3NMJA 5JUAA 4FESA 2EPOA 3PCVA 5E3CA 1Z6AA 1CPQA 1ZW2A 2FAPB 3EGDA 2Q9AA 1AUEA 3QW1A 2A69F 4PFPA 1G5ZA 1OKKA 1RKEA 5L0IA 3KYJA 5EGYA 2PFDA 5B3SC 1NFNA 1M2OA 2J9VA 2GWWA 1V4AA 1RCPA 1VYIA 2HS5A 2J8WA 2W9YA 1I5NA 2LFFA 2KGOA 2WZLA 2D5RB 2Y3DA 3S9OA 3ZVRA 4E7ZA 1T6QA 1LVKA 1LM3B 3MFNA 4XPXA 4CSAC 3EGDB 1Z5ZA 2LQGA 2P6VA 2WB7A 3AGUA 2IXNA 3LS0A 4RDAA 4Z9IA 2R05A 3S29A 4KI2A 2DYRC 2Q4FA 4YL1A 5AC5A 5L0FA 1SYQA 4CDVA 3LNMB 1D0XA 1VYKA 3KKBA 4E18A 3QVYA 4OIPF 3TK0A 1H9GA 2WZFA 3ASOC 3DI5A 3Q6NA 4N6HA 4MVQA 3HNIA 4QI0A 4WGZA 1J8MF 3ZC4A 1F1MA 3FOPA 1LS1A 2A0BA 2LIGA 4DOZA 2NG1A 3SEOA 2M64A 2X51A 3U5SA 2CYDA 3L1MA 3G50A 1MMNA 2ETSA 1NU7D 3S0XA 4U5BE 1CGME 2OKUA 1OQCA 3ECSA 2Y39A 1O87A 3NYMA 4W8PA 5D92A 4O6MA 3ATPA 2CNWA 1V74B 4CS8C 2XXAA 4CS8A 3SXYA 4DRIB 1FMVA 1MNDA 1QQ3A 1A41A 3A9CA 3CSKA 3SP1A 4MTFA 1HE1A 1VOMA 4BJ6A 2P61A 2PX0A 1NFOA 2R7OA 1JPJA 4MVOA 3C7JA 5FZTA 3RW0A 1XZPA 1U0BB 1T6IA 2OCCC 4PJNA 4DBQA 4N4WA 4DXWA 2KQ9A 4RD9A 4JZAA 2Q7RA 4PR9A 2A68F 3HNKA 4I44A 4YT4A 5JLIA 5L0HA 2Q00A 3EFOA 4HFKB 1PD1A 3VM6A 2YL0A 2LSEA 2YLGA 3RKOF 2A0UA 3EH1A 3LESA 5A69A 3JYYA 4ONSA 1OW6A 2YQYA 3AGTA 3J06A 1A7VA 4H4KC 2EIMC 5L0GA 3T6GB 2A6HF 3DM9B 5JSLA 5T3WA 3ZTZA 1BBHA 5A6JA 4ANJA 3NDBB 1RXQA 1LKXA 1OCZC 1E86A 2YWAA 1Q0KA 3N2ZB 1OXKA 3UMKA 1D0YA 2E87A 2PP4A 3POVA 3K1HA 4XEKA 2ZXWC 3HKKA 3PHF2 5HSWA 4AK9A 2HSBA 4MVUA 2VC9A 1G8XA 4OINF 4LLCA 4LLEA 3CAXA 1FAPB 2G3KA 2VCCA 3ABLC 4O6YA 3V5ZA 3GORA 1M56C 3US6A 2YLDA 2J45A 4P9FA 4LERA 2HKVA 3AG2C 3MYIA 4JEBA 1D1BA 2QUPA 1IZMA 1VMAA 2H8AA 2NSFA 3GWLA 3O55A 4OD4A 4WABA 4C3EA 1K04A 3EHNA 2RSEB 4NTAA 4X0RA 5IY5C 3QZCA 3H2VA 1OCRC 256BA 5B1AC 2NUTB 2J0XA 2R7TA 4XEVA 3W2VA 4EKWA 4Z9JA 1YVIA 3GEEA 4MVZA 3QW0A 2EINC 2OU6A 3IQTA 2PF4E 4BJ1A 1JRAA 4PK4A 5TJ5E 2QY9A 3Q6MA 1FNTc 2WVQA 2DI3A 3G4ZA 4XPWA 2GA0A 2YRFA 3ZIBA 2XL6A 4K7BA 3DZAA 5BQIA 1EQ1A 2EPNA 1LE4A 2O9XA 1FFHA 4MVRA 2ZXRA 3ASNC 1BR4A 1YA9A 1H7IA 3RYLA 2L9JA 2XRHA 3EGXA 4U5FE 4YN0B 5DVWA 4IAOA 4CS7A 2NUPB 2XM4A 1DOWA 1B68A 4JE9A 1RJ9A 2AWYA 3L0IA 4CIPA 2JX0A 2OJED 1VLSA 4I1MA 3B0UX 3K1IC 2R7XA 1FTSA 1YA7O 4G0HA 1GM5A 5D91A 4CX9A 4EBJA 5E3AA 5CI8A 5DQTA 1K05A 3DMDA 3JRMO 1C03A 2XLMA 1T5OA 1KNYA 1YZCA 2YL3A 3LNRA 3FMSA 2Q3TA 2LCHA 4U5EE 4ULWA 1JAFA 1JR8A 1HW1A 2LFDA 3JT1A 1PCXA 1SMYF 4J30B 4P9TA 2WZGA 4GQHA 3TJ5A 3IHUA 2EPKX 3EZIA 1Z23A 5A6AA 4G7OF 3PMRA 3RQFA 4DJ9A 5HV9A 1KTMA 3U8VA 4CS9A 4J32B 4JW1A 1FR0A 1SR2A 3MX3A 2I8BA 2VCBA 5BUOA 3UGPA 3GEIA 4ZLCA 3SXZA 5EK0A 3RVZA 3K66A 3R7CA 2KC3A 1QZXA 3ZG1A 2R7SA 4NC3A 3NKDA 4Q4ZF 4PACA 1DOVA 4IWBA 1BZ4A 1TFOB 2IYLD 1TWGA 2L6FA 3AG3C 3NG1A 3DWWA 3KH2A 2HMQA 3AQBA 3K6BA 1ZHXA 4GYTA 3CEXA 4XTKA 1Z7Qc 3C8GD 1OCCC 1M57C 3FXHA 4FX5A 3CQZA 1W2WA 1GGQA 2VCAA 3O10A 4YL3A 2BE5F 3GODA 1TWCA 4LDQA 1HMDA 1NG1A 2OOCA 3C8ZA 5KYUA 1XWJA 4E0IA 3IQCA 1SZIA 2R7QA 2L6HA 3G4XA 2QNLA 1BDJB 5B1BC 2IXMA 2QTVA 2P7VA 4MTGA 3TD7A 3TOMA 1ORYA 5B3IA 1QPUA 3IQ6A 4A2NB 4PJLA 4E7SA 4LDKA 2BL2A 4JCZA 3V7OA 2AP3A 3ZDLA 1T01A 2BC5A 1APCA 2FGYA 2OG2A 3LS1A 5KYUB 3T6JA 1ST6A 2JD3A 4FWVA 3MBGA 1R5ID 3B29A 3LLKA 2XLEA 2IXOA 5KYWA 1HW2A 1WN0A 1YJGA 5F5FA 4C3DA 2IXPA 2D4UA 1WASA 1ZHTA 2H7VC 3A11A 4JTCB 4BJ6C 3U2MA 2PNOA 3JYHA 4HE8D 1RMVA 4DVZA 3UGOA 4H54A 1Q0DA 3QTHA 4KNWA 1QSPA 1G4US 1IW7F 1XZQA 1OR3A 4WGYA 2Q9BA 3L8JA 2DGJA 1EA8A 1WATA 3ZSUA 2LP4A 3NYJA 1D1CA 2CGEA 5KYNA 3SXKA 5KYWB 3T4RA 1UFBA 2H7BA 3DJUB 3S28A 2B0HA 2EPLX 3KYIA 3TOLA 3U8PA 3ZQYA 2J9BA 1VLTA 2A1DD 4JVSA 4Z9HA 1FFTC 1OR2A 1LIHA 1NZEA 3BEHA 1LE2A 1WOLA 3H2UA 5DQZA 2YLIA 1ORSC 2J9WA 4XLPF 3OA1A 4I1OB 2XL4A 1BR2A 2I15A 4A4AA 4UDVA 2Y3BA 2X0CA 2J7PD 5L0JA 1HE9A 2DB4A 3I5PA 5BQGA 4ULVA 2ICWG 3B71A 1MMGA 2LK4A 1V54C 1ZHWA 3HNJA 3KL4A 4MS2A 4N06A 5E2QA 1MMDA 1U89A 3EH2A 5AGFA 3U3BA 3DAGA 4IRUA 3LLIA 5COGA 2NUTA 2FFHA 5T1DB 3RH3A 2OEVA 1OXBA 1M2VB 4K0DA 3L8IA 5GPGB 2R25A 2V3CC 2NSGA 1J8YF 1QKRA 2XLWA 3UMIA 4KBLA 4BJ5C 1OW7A 1ZW3A 2UUHA 4BJ5A 2W4BA 4FAPB 1L7CA 2W45A 4EBKA 3U9JA 2J46A 2XLVA 1CPRA 3Q7LA 3CZ6A 3M4CA 2Q9CA 5KYXB 2ZXOA 4NTBA 2LD6A 4C7OA 1VK5A 3LEOA 3MYFA 4KNVA 3LJBA 3DM5A 3C8GB 3H65A 4O7GA 1NLXA 3LEVA 1ZYRF 5F28E 2CDQA 2R7VA 2NUPA 1L3PA 2Y3HA 3N0TA 1RKCA 4CJGA 4O79A 1QLEC 2HMZA 3L34A 3RVYA 4BJTA 3U3FA 1ZVZA 2AVKA 4C7OB 1YDIA 2VB6A 4PJJA 2MHRA 2C04A 4NTFA 4MVMA 5A6BD 1NSGB 3EJNA 3ABKC 3DAFA 3W8IA 2H7OA 1UG7A 3OEOA 1ORJA 2XLOA 1TWHA 4IJJA 3FDQA 1VB5A 4JJFA 5EHHA 2XL8A 5DLJA 4CDYA 4U5HA 4EIYA 1MNEA 1AVOB 2Z15A 2R7WA 3K7DA 2HJ3A 4J7TA 4AX2A 3B0PA 1O3UA 3AQCA 3HNLA 5K0IA 1Z63A 2PX3A 4DVYP 1GS9A 3AJMA 3O6XA 1PV3A 4B6IA 2GDCA 2YEVA 1FMWA 4NQFA 1NBBA 2R03A 5KYYA 5CI9A 4IGGA 4CS9C 1MMAA 4HFFB 3M79A 2JPUA 4U9EA 2ZXPA 2C03A 1ZHYA 4JC7A 3B0VC 1V55C 4G78A 4K1OA 3NYLA 5T3TA 3AOUA 2ASRA 3EZHA 3T6BA 2QE9A 3EPVA 3AG1C 4YT8A 1A7DA 3AG4C 3RQEA 4E0HA 1C02A 4JCHA 2R7RA 1AEPA 2XLDA 3HTKC 1WWPA 3JRTA 3DD7A 5CIVA 3RIPA 2HV6A 5KYYB 2GFHA 1N1CA 3K33A 4EUKB 4CIHA 2G62A 4OD5A 2ZD9A 3V5YA 3VRCA 4DRHB 3U0CA 4W8KA 4IARA
chains in the Genus database with same CATH topology
1NFOA 1GS9A 1LPEA 1OR3A 1EQ1A 1LE4A 1EA8A 1YA9A 1H7IA 1NFNA 3R2PA 1B68A 1LS4A 2KC3A 3S84A 1AEPA 1OR2A 1BZ4A 1LE2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NFO A;  1GS9 A;  1LPE A;  1OR3 A;  1EQ1 A;  1LE4 A;  1EA8 A;  1YA9 A;  1H7I A;  1NFN A;  3R2P A;  1B68 A;  1LS4 A;  2KC3 A;  3S84 A;  1AEP A;  1OR2 A;  1BZ4 A;  1LE2 A; 
#chains in the Genus database with same CATH topology
 2Y69 C;  3C18 A;  1O5H A;  3HJC A;  3O39 A;  3PDM P;  3RQG A;  4BEJ A;  3JZ0 A;  2G3V A;  3F47 A;  3JSE O;  3ZQV A;  2YHS A;  1E85 A;  1Q0G A;  3DE8 A;  4WJ0 A;  1R4T A;  2EIK C;  2CCY A;  3W2W A;  1BR1 A;  4MTO A;  4C3B A;  3DJN B;  5AC4 A;  4CDA A;  3U2L A;  4IB4 A;  2VH3 A;  3QVZ A;  5DS4 A;  4U5D E;  1D1A A;  2HZ8 A;  1ZU5 A;  4MVS A;  2TMV P;  3MLG A;  2VAS A;  4D4N A;  1KU2 A;  3ZWI A;  2L81 A;  1H6G A;  1PD0 A;  1D0Z A;  3RFY A;  3S90 A;  1Q0M A;  3I5Q A;  3LUT B;  2XM0 A;  4YT2 A;  3S84 A;  2V26 A;  3U9M A;  2YZS A;  4CSA A;  2A6E F;  1HY5 A;  3FHD A;  4OIO F;  2YL1 A;  1RKE B;  3UNG C;  2MYS A;  1A0B A;  1YYX A;  2HFI A;  3KPH A;  5L3V A;  1WTY A;  2NPU A;  3T9O A;  3N24 A;  3C63 A;  3IEE A;  4QDL A;  4JEA A;  2WVN A;  4GEH A;  2HSQ A;  4ZLD A;  5A6B A;  5E33 A;  1U6H A;  3VYW A;  4Q7C A;  3E9V A;  3LAY A;  4LDR A;  5COF A;  4G7Z F;  1EI7 A;  3X1O A;  2KW3 C;  4XLN F;  4L6R A;  4EBB A;  4YL0 A;  3E70 C;  1TQG A;  2XSE A;  4AL1 A;  4RBN A;  3VAY A;  3HLZ A;  3GM2 A;  1YZA A;  4R32 A;  1OCO C;  1YAU O;  1ZU4 A;  3VF0 A;  4CBE A;  2XS8 A;  3WAQ A;  5L0C A;  1H9T A;  2Y3G A;  5L3Q A;  3C62 A;  3DXJ F;  3S27 A;  3UMH A;  2HV7 A;  4BG0 A;  3TJ6 A;  2KSF A;  1WGW A;  2KK1 A;  3ABM C;  1Z3I X;  1T6U A;  1CGO A;  3EG9 A;  2AU5 A;  2W4M A;  3I4U A;  1HMO A;  4JJG A;  3NMK A;  4XWJ A;  1C17 M;  1M2V A;  3SZR A;  4DBR A;  5FCL A;  4MQ9 F;  2YKZ A;  2PBE A;  3ZTM A;  4YJW A;  4AE4 A;  2J9U A;  2OJQ A;  3RF3 A;  4ER9 A;  2XXA B;  1NU9 C;  4NCQ A;  2RD9 A;  4XEF A;  4EWC A;  1SF8 A;  1ZHZ A;  5DS6 A;  3IPM O;  4OIQ F;  3EHM A;  4JIO A;  3FAJ A;  2QLA A;  1TFK B;  1YLM A;  3EG9 B;  3M1C B;  3OWT A;  4U5C E;  2WVO A;  4YWQ A;  2GAQ A;  3SYN A;  2KYH A;  5KYX A;  3JTL O;  2XLH A;  3R2P A;  3C8G A;  5JP7 A;  4KC9 A;  1JPN A;  2IOQ A;  4JKV A;  4AE4 B;  5BQH A;  1G4W R;  4OIR F;  2IBF A;  3ITF A;  3TUL A;  3EFO B;  4LAC B;  3X2Q C;  1I4Y A;  3Q7G A;  5COM A;  1Y4C A;  2EIL C;  1OKK D;  3JSZ A;  3V5X A;  2HUJ A;  4BEM J;  5A6K A;  2R7U A;  3NKE A;  4I3M A;  4MW8 A;  1M6T A;  4MW3 A;  1LI5 A;  3EQL F;  3GM3 A;  1YAR O;  2KJG A;  1TKN A;  3F46 A;  4N6C A;  4EHP A;  2YVK A;  2EPM X;  2L7A A;  4JTD B;  1LPE A;  2CW0 F;  3NMI A;  4QI2 A;  1MQV A;  1LI7 A;  1TWA A;  3BRJ A;  3GWN A;  2MWQ A;  1E84 A;  2YL7 A;  2B0J A;  2KNH A;  4HEA J;  2DYS C;  4J7Y A;  4AL0 A;  5DS5 A;  4BPM A;  1JOG A;  2WL8 A;  4JRZ A;  1QVX A;  3IQ5 A;  3DE9 A;  3FAP B;  2OEX A;  2P0N A;  4U9D A;  4YK5 A;  4IAQ A;  2R9R B;  3QMK A;  4CJO A;  5JT4 A;  4PJM A;  3JCU Q;  5JVE A;  1Y6D A;  2UUI A;  2IM8 A;  2ZPA A;  5L0D A;  3M4B A;  2XS1 A;  3NRH A;  1JMW A;  3W4Y A;  1TR2 A;  5JRA A;  1E83 A;  3FVY A;  3GAN A;  1S05 A;  3TQO A;  2CNW D;  3M15 A;  4O6N A;  4PFO A;  4XQ1 A;  1VTM P;  3B9Q A;  1EKY A;  1K40 A;  2F22 A;  1GQA A;  4F4B A;  3WOD F;  2L6G A;  4NY3 A;  1E2X A;  2OQM A;  2P1A A;  4YT5 A;  1CGN A;  3FOO A;  4MND A;  3SXM A;  4JTA B;  3WHN A;  2HJM A;  4XPY A;  1LS4 A;  3GEH A;  3W8H A;  1T9K A;  1S7Z A;  2J0W A;  3K1I A;  1ZZP A;  3UR3 C;  1A7E A;  2J7P A;  5F5H A;  2EIJ C;  2AWC A;  4M63 A;  3DKA A;  1YYJ A;  4P6I C;  4E17 A;  3WG7 C;  4G7H F;  4D4X A;  3EGX B;  1I4Z A;  3GM1 A;  4U5G A;  1Q0F A;  4Q5S F;  3SNH A;  1RJ9 B;  1OW8 A;  2R02 A;  3KMI A;  4JUR I;  2M4E A;  4DRJ B;  5JS5 A;  3NMJ A;  5JUA A;  4FES A;  2EPO A;  3PCV A;  5E3C A;  1Z6A A;  1CPQ A;  1ZW2 A;  2FAP B;  3EGD A;  2Q9A A;  1AUE A;  3QW1 A;  2A69 F;  4PFP A;  1G5Z A;  1OKK A;  1RKE A;  5L0I A;  3KYJ A;  5EGY A;  2PFD A;  5B3S C;  1NFN A;  1M2O A;  2J9V A;  2GWW A;  1V4A A;  1RCP A;  1VYI A;  2HS5 A;  2J8W A;  2W9Y A;  1I5N A;  2LFF A;  2KGO A;  2WZL A;  2D5R B;  2Y3D A;  3S9O A;  3ZVR A;  4E7Z A;  1T6Q A;  1LVK A;  1LM3 B;  3MFN A;  4XPX A;  4CSA C;  3EGD B;  1Z5Z A;  2LQG A;  2P6V A;  2WB7 A;  3AGU A;  2IXN A;  3LS0 A;  4RDA A;  4Z9I A;  2R05 A;  3S29 A;  4KI2 A;  2DYR C;  2Q4F A;  4YL1 A;  5AC5 A;  5L0F A;  1SYQ A;  4CDV A;  3LNM B;  1D0X A;  1VYK A;  3KKB A;  4E18 A;  3QVY A;  4OIP F;  3TK0 A;  1H9G A;  2WZF A;  3ASO C;  3DI5 A;  3Q6N A;  4N6H A;  4MVQ A;  3HNI A;  4QI0 A;  4WGZ A;  1J8M F;  3ZC4 A;  1F1M A;  3FOP A;  1LS1 A;  2A0B A;  2LIG A;  4DOZ A;  2NG1 A;  3SEO A;  2M64 A;  2X51 A;  3U5S A;  2CYD A;  3L1M A;  3G50 A;  1MMN A;  2ETS A;  1NU7 D;  3S0X A;  4U5B E;  1CGM E;  2OKU A;  1OQC A;  3ECS A;  2Y39 A;  1O87 A;  3NYM A;  4W8P A;  5D92 A;  4O6M A;  3ATP A;  2CNW A;  1V74 B;  4CS8 C;  2XXA A;  4CS8 A;  3SXY A;  4DRI B;  1FMV A;  1MND A;  1QQ3 A;  1A41 A;  3A9C A;  3CSK A;  3SP1 A;  4MTF A;  1HE1 A;  1VOM A;  4BJ6 A;  2P61 A;  2PX0 A;  1NFO A;  2R7O A;  1JPJ A;  4MVO A;  3C7J A;  5FZT A;  3RW0 A;  1XZP A;  1U0B B;  1T6I A;  2OCC C;  4PJN A;  4DBQ A;  4N4W A;  4DXW A;  2KQ9 A;  4RD9 A;  4JZA A;  2Q7R A;  4PR9 A;  2A68 F;  3HNK A;  4I44 A;  4YT4 A;  5JLI A;  5L0H A;  2Q00 A;  3EFO A;  4HFK B;  1PD1 A;  3VM6 A;  2YL0 A;  2LSE A;  2YLG A;  3RKO F;  2A0U A;  3EH1 A;  3LES A;  5A69 A;  3JYY A;  4ONS A;  1OW6 A;  2YQY A;  3AGT A;  3J06 A;  1A7V A;  4H4K C;  2EIM C;  5L0G A;  3T6G B;  2A6H F;  3DM9 B;  5JSL A;  5T3W A;  3ZTZ A;  1BBH A;  5A6J A;  4ANJ A;  3NDB B;  1RXQ A;  1LKX A;  1OCZ C;  1E86 A;  2YWA A;  1Q0K A;  3N2Z B;  1OXK A;  3UMK A;  1D0Y A;  2E87 A;  2PP4 A;  3POV A;  3K1H A;  4XEK A;  2ZXW C;  3HKK A;  3PHF 2;  5HSW A;  4AK9 A;  2HSB A;  4MVU A;  2VC9 A;  1G8X A;  4OIN F;  4LLC A;  4LLE A;  3CAX A;  1FAP B;  2G3K A;  2VCC A;  3ABL C;  4O6Y A;  3V5Z A;  3GOR A;  1M56 C;  3US6 A;  2YLD A;  2J45 A;  4P9F A;  4LER A;  2HKV A;  3AG2 C;  3MYI A;  4JEB A;  1D1B A;  2QUP A;  1IZM A;  1VMA A;  2H8A A;  2NSF A;  3GWL A;  3O55 A;  4OD4 A;  4WAB A;  4C3E A;  1K04 A;  3EHN A;  2RSE B;  4NTA A;  4X0R A;  5IY5 C;  3QZC A;  3H2V A;  1OCR C;  256B A;  5B1A C;  2NUT B;  2J0X A;  2R7T A;  4XEV A;  3W2V A;  4EKW A;  4Z9J A;  1YVI A;  3GEE A;  4MVZ A;  3QW0 A;  2EIN C;  2OU6 A;  3IQT A;  2PF4 E;  4BJ1 A;  1JRA A;  4PK4 A;  5TJ5 E;  2QY9 A;  3Q6M A;  1FNT c;  2WVQ A;  2DI3 A;  3G4Z A;  4XPW A;  2GA0 A;  2YRF A;  3ZIB A;  2XL6 A;  4K7B A;  3DZA A;  5BQI A;  1EQ1 A;  2EPN A;  1LE4 A;  2O9X A;  1FFH A;  4MVR A;  2ZXR A;  3ASN C;  1BR4 A;  1YA9 A;  1H7I A;  3RYL A;  2L9J A;  2XRH A;  3EGX A;  4U5F E;  4YN0 B;  5DVW A;  4IAO A;  4CS7 A;  2NUP B;  2XM4 A;  1DOW A;  1B68 A;  4JE9 A;  1RJ9 A;  2AWY A;  3L0I A;  4CIP A;  2JX0 A;  2OJE D;  1VLS A;  4I1M A;  3B0U X;  3K1I C;  2R7X A;  1FTS A;  1YA7 O;  4G0H A;  1GM5 A;  5D91 A;  4CX9 A;  4EBJ A;  5E3A A;  5CI8 A;  5DQT A;  1K05 A;  3DMD A;  3JRM O;  1C03 A;  2XLM A;  1T5O A;  1KNY A;  1YZC A;  2YL3 A;  3LNR A;  3FMS A;  2Q3T A;  2LCH A;  4U5E E;  4ULW A;  1JAF A;  1JR8 A;  1HW1 A;  2LFD A;  3JT1 A;  1PCX A;  1SMY F;  4J30 B;  4P9T A;  2WZG A;  4GQH A;  3TJ5 A;  3IHU A;  2EPK X;  3EZI A;  1Z23 A;  5A6A A;  4G7O F;  3PMR A;  3RQF A;  4DJ9 A;  5HV9 A;  1KTM A;  3U8V A;  4CS9 A;  4J32 B;  4JW1 A;  1FR0 A;  1SR2 A;  3MX3 A;  2I8B A;  2VCB A;  5BUO A;  3UGP A;  3GEI A;  4ZLC A;  3SXZ A;  5EK0 A;  3RVZ A;  3K66 A;  3R7C A;  2KC3 A;  1QZX A;  3ZG1 A;  2R7S A;  4NC3 A;  3NKD A;  4Q4Z F;  4PAC A;  1DOV A;  4IWB A;  1BZ4 A;  1TFO B;  2IYL D;  1TWG A;  2L6F A;  3AG3 C;  3NG1 A;  3DWW A;  3KH2 A;  2HMQ A;  3AQB A;  3K6B A;  1ZHX A;  4GYT A;  3CEX A;  4XTK A;  1Z7Q c;  3C8G D;  1OCC C;  1M57 C;  3FXH A;  4FX5 A;  3CQZ A;  1W2W A;  1GGQ A;  2VCA A;  3O10 A;  4YL3 A;  2BE5 F;  3GOD A;  1TWC A;  4LDQ A;  1HMD A;  1NG1 A;  2OOC A;  3C8Z A;  5KYU A;  1XWJ A;  4E0I A;  3IQC A;  1SZI A;  2R7Q A;  2L6H A;  3G4X A;  2QNL A;  1BDJ B;  5B1B C;  2IXM A;  2QTV A;  2P7V A;  4MTG A;  3TD7 A;  3TOM A;  1ORY A;  5B3I A;  1QPU A;  3IQ6 A;  4A2N B;  4PJL A;  4E7S A;  4LDK A;  2BL2 A;  4JCZ A;  3V7O A;  2AP3 A;  3ZDL A;  1T01 A;  2BC5 A;  1APC A;  2FGY A;  2OG2 A;  3LS1 A;  5KYU B;  3T6J A;  1ST6 A;  2JD3 A;  4FWV A;  3MBG A;  1R5I D;  3B29 A;  3LLK A;  2XLE A;  2IXO A;  5KYW A;  1HW2 A;  1WN0 A;  1YJG A;  5F5F A;  4C3D A;  2IXP A;  2D4U A;  1WAS A;  1ZHT A;  2H7V C;  3A11 A;  4JTC B;  4BJ6 C;  3U2M A;  2PNO A;  3JYH A;  4HE8 D;  1RMV A;  4DVZ A;  3UGO A;  4H54 A;  1Q0D A;  3QTH A;  4KNW A;  1QSP A;  1G4U S;  1IW7 F;  1XZQ A;  1OR3 A;  4WGY A;  2Q9B A;  3L8J A;  2DGJ A;  1EA8 A;  1WAT A;  3ZSU A;  2LP4 A;  3NYJ A;  1D1C A;  2CGE A;  5KYN A;  3SXK A;  5KYW B;  3T4R A;  1UFB A;  2H7B A;  3DJU B;  3S28 A;  2B0H A;  2EPL X;  3KYI A;  3TOL A;  3U8P A;  3ZQY A;  2J9B A;  1VLT A;  2A1D D;  4JVS A;  4Z9H A;  1FFT C;  1OR2 A;  1LIH A;  1NZE A;  3BEH A;  1LE2 A;  1WOL A;  3H2U A;  5DQZ A;  2YLI A;  1ORS C;  2J9W A;  4XLP F;  3OA1 A;  4I1O B;  2XL4 A;  1BR2 A;  2I15 A;  4A4A A;  4UDV A;  2Y3B A;  2X0C A;  2J7P D;  5L0J A;  1HE9 A;  2DB4 A;  3I5P A;  5BQG A;  4ULV A;  2ICW G;  3B71 A;  1MMG A;  2LK4 A;  1V54 C;  1ZHW A;  3HNJ A;  3KL4 A;  4MS2 A;  4N06 A;  5E2Q A;  1MMD A;  1U89 A;  3EH2 A;  5AGF A;  3U3B A;  3DAG A;  4IRU A;  3LLI A;  5COG A;  2NUT A;  2FFH A;  5T1D B;  3RH3 A;  2OEV A;  1OXB A;  1M2V B;  4K0D A;  3L8I A;  5GPG B;  2R25 A;  2V3C C;  2NSG A;  1J8Y F;  1QKR A;  2XLW A;  3UMI A;  4KBL A;  4BJ5 C;  1OW7 A;  1ZW3 A;  2UUH A;  4BJ5 A;  2W4B A;  4FAP B;  1L7C A;  2W45 A;  4EBK A;  3U9J A;  2J46 A;  2XLV A;  1CPR A;  3Q7L A;  3CZ6 A;  3M4C A;  2Q9C A;  5KYX B;  2ZXO A;  4NTB A;  2LD6 A;  4C7O A;  1VK5 A;  3LEO A;  3MYF A;  4KNV A;  3LJB A;  3DM5 A;  3C8G B;  3H65 A;  4O7G A;  1NLX A;  3LEV A;  1ZYR F;  5F28 E;  2CDQ A;  2R7V A;  2NUP A;  1L3P A;  2Y3H A;  3N0T A;  1RKC A;  4CJG A;  4O79 A;  1QLE C;  2HMZ A;  3L34 A;  3RVY A;  4BJT A;  3U3F A;  1ZVZ A;  2AVK A;  4C7O B;  1YDI A;  2VB6 A;  4PJJ A;  2MHR A;  2C04 A;  4NTF A;  4MVM A;  5A6B D;  1NSG B;  3EJN A;  3ABK C;  3DAF A;  3W8I A;  2H7O A;  1UG7 A;  3OEO A;  1ORJ A;  2XLO A;  1TWH A;  4IJJ A;  3FDQ A;  1VB5 A;  4JJF A;  5EHH A;  2XL8 A;  5DLJ A;  4CDY A;  4U5H A;  4EIY A;  1MNE A;  1AVO B;  2Z15 A;  2R7W A;  3K7D A;  2HJ3 A;  4J7T A;  4AX2 A;  3B0P A;  1O3U A;  3AQC A;  3HNL A;  5K0I A;  1Z63 A;  2PX3 A;  4DVY P;  1GS9 A;  3AJM A;  3O6X A;  1PV3 A;  4B6I A;  2GDC A;  2YEV A;  1FMW A;  4NQF A;  1NBB A;  2R03 A;  5KYY A;  5CI9 A;  4IGG A;  4CS9 C;  1MMA A;  4HFF B;  3M79 A;  2JPU A;  4U9E A;  2ZXP A;  2C03 A;  1ZHY A;  4JC7 A;  3B0V C;  1V55 C;  4G78 A;  4K1O A;  3NYL A;  5T3T A;  3AOU A;  2ASR A;  3EZH A;  3T6B A;  2QE9 A;  3EPV A;  3AG1 C;  4YT8 A;  1A7D A;  3AG4 C;  3RQE A;  4E0H A;  1C02 A;  4JCH A;  2R7R A;  1AEP A;  2XLD A;  3HTK C;  1WWP A;  3JRT A;  3DD7 A;  5CIV A;  3RIP A;  2HV6 A;  5KYY B;  2GFH A;  1N1C A;  3K33 A;  4EUK B;  4CIH A;  2G62 A;  4OD5 A;  2ZD9 A;  3V5Y A;  3VRC A;  4DRH B;  3U0C A;  4W8K A;  4IAR A; 
#chains in the Genus database with same CATH homology
 1NFO A;  1GS9 A;  1LPE A;  1OR3 A;  1EQ1 A;  1LE4 A;  1EA8 A;  1YA9 A;  1H7I A;  1NFN A;  3R2P A;  1B68 A;  1LS4 A;  2KC3 A;  3S84 A;  1AEP A;  1OR2 A;  1BZ4 A;  1LE2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...