1LE2A

Structural basis for altered function in the common mutants of human apolipoprotein-e
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
144
structure length
144
Chain Sequence
b'GQRWELALGRFWDYLRWVQTLSEQVQEELLSSQVTQELRALMDETMKELKAYKSELEEQLTPVAEETRARLSKELQAAQARLGADMEDVCGRLVQYRGEVQAMLGQSTEELRVRLASHLRKLRKRLLRDADDLQKCLAVYQAGA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords APOLIPOPROTEIN E2
publication title Salt bridge relay triggers defective LDL receptor binding by a mutant apolipoprotein.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lipoprotein
total genus 57
structure length 144
sequence length 144
ec nomenclature
pdb deposition date 1991-08-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.20 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Apolipoprotein 1le2A00
3R2PA 1EQ1A 2KC3A 1LS4A 1H7IA 1EA8A 1LE4A 1LE2A 1NFNA 1BZ4A 1AEPA 1B68A 1GS9A 1OR2A 1YA9A 1LPEA 1NFOA 3S84A 1OR3A
chains in the Genus database with same CATH superfamily
3DAGA 2DGJA 4JJGA 4Q7CA 4OD4A 2IXOA 1R5ID 2W45A 4QI0A 2OQMA 4XPYA 3TJ6A 2EIJC 2J9WA 1TWGA 3JSZA 3KH2A 3ZTMA 4E18A 1L3PA 3ZQVA 2L9JA 4XWJA 3RKOF 1HMDA 3HJCA 1M2VA 3LJBA 4U5FE 2WZGA 3W4YA 3H2VA 1HW1A 4JJFA 4BEJA 2QUPA 3O39A 5L0DA 2PNOA 3DZAA 2HV7A 2HMZA 3G50A 3VM6A 4AK9A 4OIPF 3DAFA 4G78A 1EKYA 2W4BA 1ZW2A 1OKKD 3GM1A 1SF8A 3QW0A 4O7GA 3GEEA 1W2WA 4R32A 3KKBA 2AVKA 2EPKX 1T6IA 2HKVA 2P6VA 3K7DA 4WGYA 3F47A 1CGOA 3SP1A 2UUIA 2YEVA 1OQCA 1VB5A 1TR2A 2WVQA 3HLZA 3K33A 1I5NA 3LLKA 3C63A 5JS5A 1H6GA 1SYQA 3NDBB 3SEOA 1LI5A 5E3AA 4MVOA 3NYLA 2ETSA 3EFOA 2UUHA 3T6JA 3ZWIA 3QVYA 4MVZA 3FDQA 1EA8A 2Q00A 4E0HA 2RSEB 3MYFA 2HJMA 5KYYA 3KPHA 1LE2A 1CGNA 4CDVA 1ZHTA 5DS4A 3UMIA 1T01A 3U2MA 4H4KC 4CS9C 2IYLD 1HE9A 2XL4A 2DB4A 4BJ6C 1B68A 3FOPA 1OCZC 4KI2A 4C7OB 1K40A 5KYWB 4EHPA 4UDVA 4NTFA 3S29A 4ULWA 3U8VA 4CS8C 3GEIA 2DYRC 4JCHA 4PJLA 1OR3A 2EPNA 1RKEA 2HS5A 2R02A 2XXAB 3AOUA 4JCZA 3VYWA 4FWVA 3RQGA 1OW6A 3V5XA 1TKNA 3EGXA 4MTGA 1LI7A 2NUTB 2HSQA 3C62A 1KU2A 2H8AA 1YJGA 1TWHA 1WGWA 1IZMA 3TOLA 4CDYA 4DJ9A 2IOQA 1N1CA 3LUTB 3PMRA 3RIPA 2JD3A 4LDRA 2IXPA 2PF4E 4CBEA 2B0HA 1YARO 2Y3GA 2R7XA 4E0IA 5KYUA 2Q3TA 3EZIA 2XM0A 3LS0A 5DVWA 4DVYP 4IB4A 3N24A 2E87A 2FFHA 3UMHA 2WVNA 3KYJA 1M2VB 3DJUB 3DE9A 5L0GA 2J9BA 1NFOA 2XM4A 4U9EA 2EIKC 4O79A 4PJMA 4DRIB 5BQGA 1D0ZA 4J7YA 2EPMX 2PBEA 1HW2A 2P0NA 4MW8A 4J32B 1R4TA 2X0CA 1I4YA 1SR2A 1YZCA 4XEKA 4C3BA 4BJ1A 3B0UX 2KJGA 3L1MA 3IQCA 2IXNA 4EIYA 2LK4A 4A2NB 3DI5A 1IW7F 1T6QA 3CZ6A 3A9CA 1E86A 3S90A 4Q4ZF 2DYSC 2P7VA 2NG1A 2XLEA 4QI2A 1VK5A 1VYIA 4MW3A 1V54C 3ZDLA 2XL8A 4YT2A 4LLCA 2LFFA 3VRCA 3SXKA 3U9JA 1Z7Qc 4PJNA 2J9VA 4CIPA 1K04A 5HV9A 1VLSA 2M4EA 4OD5A 2GWWA 4K0DA 1NU9C 3IHUA 4G0HA 4JZAA 4K7BA 2P61A 2O9XA 1BR1A 3H65A 4HE8D 5KYYB 3JRTA 5COFA 2XRHA 4GYTA 4Z9IA 3LNMB 1HY5A 3X1OA 1BBHA 4YN0B 2GAQA 1RXQA 2NUPA 3O10A 4EUKB 2J8WA 4MVRA 4DOZA 1GGQA 1TWCA 5L0IA 4JRZA 2YRFA 1LM3B 1FFTC 3MLGA 4AX2A 1TFOB 4J30B 2NSFA 2W4MA 1MMAA 1T6UA 1PCXA 2WB7A 3HNLA 3DM9B 4HFFB 4U5CE 5AC4A 1L7CA 2PX3A 4PR9A 5A69A 3B0PA 1HE1A 5E2QA 2R05A 3SNHA 5BUOA 2CDQA 3ABKC 4AL0A 3KL4A 3OA1A 4FX5A 1DOWA 1ZHWA 2F22A 3ATPA 3CQZA 4IAQA 2OEXA 4YL0A 4Z9HA 1Q0GA 3LEOA 4GQHA 4KNVA 2NPUA 1UFBA 1HMOA 2MYSA 2YZSA 1T5OA 2G62A 4IAOA 4W8PA 4A4AA 1JPNA 1CPRA 1OCRC 1ORSC 4YL1A 4WABA 3O6XA 1J8MF 2YKZA 3U0CA 3AG1C 1A7EA 4AL1A 4I3MA 4MTFA 4K1OA 5JT4A 3E9VA 4DXWA 4I1OB 3S27A 1WOLA 3Q7LA 3TOMA 1FFHA 2J45A 1WWPA 4DRHB 1Z63A 3TULA 3J06A 2R7VA 3HNKA 1H7IA 4D4XA 3GWLA 3ZSUA 2IBFA 3ZTZA 1UG7A 3IQ6A 3JZ0A 1NFNA 4LDKA 3X2QC 1QLEC 2OJED 1V55C 3M1CB 3VAYA 3WHNA 5IY5C 2ZXOA 2YWAA 1VOMA 2A6EF 4PJJA 4CSAC 1YYJA 2J46A 2OOCA 4YL3A 1NU7D 5A6AA 4KNWA 4LDQA 3T6BA 5L3VA 4OIRF 3IQTA 3BEHA 4N6CA 1F1MA 3RH3A 1ZW3A 2XLDA 2RD9A 1ZHZA 3EPVA 3VF0A 4CS9A 5K0IA 3K1IA 2CNWA 1PD1A 256BA 5JP7A 3U2LA 2GA0A 1ZVZA 1G5ZA 1NLXA 1XZPA 3S28A 3WG7C 4XTKA 3ECSA 2WZFA 3JTLO 1M6TA 3N2ZB 1XWJA 3L0IA 1Z23A 2R03A 4XEVA 1Z6AA 2GFHA 5E3CA 5CI8A 2XLMA 5F5HA 2R7TA 5COMA 5DLJA 5FCLA 1FMWA 2NUPB 2VC9A 4WGZA 5KYNA 3PDMP 2YL0A 2ASRA 5T3WA 2BE5F 4MVUA 1BZ4A 2WL8A 3MBGA 1KTMA 3FXHA 4NC3A 3HKKA 4O6YA 1H9TA 5GPGB 2AWCA 3ZC4A 3ZG1A 3C8GA 3SXZA 1U89A 1O87A 3V5YA 4PACA 1U0BB 3NMIA 2C03A 2J0WA 4BJ5A 4P6IC 1A41A 4MVQA 1JRAA 1JAFA 4DBQA 5DS5A 2A0UA 2YL7A 3LLIA 4CX9A 3LAYA 3V7OA 4CS7A 1GQAA 3JSEO 3RF3A 2P1AA 2R7RA 3U5SA 2G3VA 4U5EE 1E85A 1MNEA 1Z5ZA 2EIMC 4EBBA 2R7OA 2J0XA 3AQBA 3KMIA 4JEAA 5D92A 4NTBA 3AG4C 2R7UA 4O6NA 2JPUA 1S05A 2MHRA 3WAQA 4YT4A 1O3UA 1LS1A 3EH2A 1PV3A 3L8IA 1LKXA 2OG2A 1OR2A 1VLTA 2WZLA 5EK0A 1C02A 3B71A 1ORYA 4PFOA 1PD0A 2XLWA 3DM5A 5L0HA 3TD7A 5JVEA 1QKRA 2QY9A 4JC7A 3ZQYA 3POVA 3NMJA 2LQGA 2DI3A 1D1CA 4C3EA 4BG0A 2OU6A 3T6GB 1LS4A 2VCBA 3R7CA 4WJ0A 4DBRA 1VTMP 1SMYF 5KYXA 2ZPAA 3CSKA 5E33A 2VB6A 4I44A 1A7VA 4EBKA 2HV6A 2VCAA 3L8JA 1LE4A 3ZVRA 1WATA 2XL6A 3PHF2 2IM8A 3M4BA 4ONSA 5BQHA 5L3QA 4G7HF 1VMAA 1H9GA 2A1DD 2LD6A 3G4ZA 4JTCB 4F4BA 5B1BC 1BDJB 3EFOB 4LACB 4PFPA 4C3DA 2YL1A 5F5FA 4QDLA 3SYNA 1QQ3A 4XEFA 1AVOB 3V5ZA 5B3SC 3EGDA 1LPEA 2KGOA 4IJJA 4JEBA 3FVYA 4YT8A 3EHNA 2Z15A 4XQ1A 1S7ZA 3MX3A 3TJ5A 3U8PA 1YAUO 1Y4CA 3CEXA 3QW1A 4U5BE 3U3BA 4KC9A 4DVZA 2XLVA 4G7OF 1JMWA 3I5PA 3NYJA 2LP4A 4XLPF 3C8GB 1OW8A 1MQVA 3EHMA 4L6RA 2HMQA 3LEVA 3ITFA 5JRAA 2CGEA 4Z9JA 4MNDA 2M64A 2OJQA 2LFDA 2YHSA 4U5DE 3NKEA 5A6KA 4P9FA 4DRJB 1YZAA 2CNWD 4NCQA 1RKEB 2L6HA 5T3TA 3EQLF 3JRMO 2L7AA 3FHDA 4E17A 2Q4FA 3S9OA 4OIQF 2KNHA 3EGXB 3DMDA 3UGOA 1Q0FA 1ZHYA 1QZXA 1NG1A 2MWQA 2R7QA 3EG9A 4N4WA 4YT5A 1RCPA 2YQYA 3AQCA 4BJTA 3HNJA 2R7WA 2QLAA 2XLHA 1T9KA 2QE9A 4H54A 4MTOA 2QTVA 1MNDA 5DQZA 3U3FA 2PP4A 3DJNB 2KW3C 3IEEA 2Q7RA 1OXKA 3SZRA 1APCA 1ZYRF 3TQOA 1V74B 3GORA 3N0TA 3RVZA 4EBJA 3U9MA 3C8GD 3RYLA 1JOGA 3OWTA 2EPLX 3KYIA 4Q5SF 2QNLA 3HTKC 3IQ5A 4P9TA 1M2OA 2J9UA 1J8YF 4RDAA 5A6BA 2V26A 4FESA 5BQIA 3F46A 1RJ9A 2HSBA 3AG3C 3JCUQ 3K1HA 2YLGA 2EINC 4MS2A 4I1MA 1YLMA 4JKVA 2OCCC 2AU5A 2YLIA 2YVKA 4JW1A 4RD9A 1GS9A 3LNRA 3LS1A 5A6JA 3GM2A 3AGTA 2XS8A 4NQFA 1ORJA 5DQTA 3GM3A 3B29A 3M15A 5COGA 1BR4A 4N06A 1QSPA 2VCCA 3FMSA 3L34A 3TK0A 1TWAA 3QTHA 5F28E 4BJ6A 1I4ZA 4BPMA 3QVZA 2A68F 4G7ZF 1KNYA 3SXYA 1NSGB 2BL2A 4U5HA 4CDAA 2H7VC 3AG2C 3EGDB 4CS8A 1NBBA 3BRJA 1RMVA 1LVKA 5B1AC 3RVYA 2AP3A 4IARA 5L0FA 2VH3A 4D4NA 1OXBA 3G4XA 2J7PA 5B3IA 2IXMA 4LERA 2Q9BA 3W8IA 3B9QA 3DKAA 3AJMA 5FZTA 2CCYA 1OCOC 2L6FA 3JT1A 1WN0A 2PX0A 4BEMJ 4ER9A 1Q0DA 5HSWA 4CIHA 1YDIA 2W9YA 3QMKA 5EGYA 4XPXA 1C03A 4NY3A 3K66A 2A0BA 3SXMA 3A11A 5L0CA 2GDCA 1TQGA 3NYMA 2KC3A 1QPUA 2XLOA 2B0JA 2CYDA 2R7SA 3EJNA 4XPWA 3O55A 4ZLDA 2KK1A 4JTAB 3OEOA 4J7TA 5EHHA 3EG9B 2LIGA 2FGYA 4PK4A 1O5HA 2HJ3A 3WODF 3GODA 4ANJA 4JIOA 4E7SA 1CGME 2A6HF 4MVSA 5TJ5E 1WASA 1K05A 1Z3IX 3K1IC 1C17M 2G3KA 3ZIBA 2HFIA 1G8XA 2D5RB 3T9OA 4YWQA 2PFDA 1FAPB 2EILC 3DE8A 1YA9A 2L81A 3ABMC 1M57C 4W8KA 5CIVA 3M4CA 3MYIA 1U6HA 1FR0A 3HNIA 3US6A 4N6HA 4O6MA 1RJ9B 2Y39A 4HEAJ 3R2PA 4IWBA 1GM5A 1QVXA 1TFKB 2Y69C 4ZLCA 1ZU5A 5JSLA 3M79A 4IRUA 4MQ9F 1OKKA 1OCCC 2YLDA 4AE4A 5JUAA 3GWNA 3UMKA 1VYKA 2D4UA 3DD7A 1MMDA 3CAXA 1A7DA 1JPJA 4BJ5C 1FNTc 2ZXRA 2LSEA 2KSFA 3I4UA 3NMKA 1D1BA 1E83A 3IPMO 1EI7A 3FAJA 2WVOA 2FAPB 2L6GA 2LCHA 2Q9CA 1V4AA 1D0XA 1ZHXA 2CW0F 2H7BA 3NRHA 1A0BA 3DWWA 4HFKB 3PCVA 1FMVA 4MVMA 4YJWA 2ZXWC 3RW0A 4FAPB 1Q0MA 1MMNA 3ASOC 4IGGA 2OKUA 5A6BD 2ICWG 3E70C 1JR8A 1NZEA 3RFYA 2TMVP 1G4US 2YL3A 3MFNA 3UGPA 2R9RB 1EQ1A 1RKCA 1FTSA 2BC5A 3UR3C 5T1DB 3FOOA 3FAPB 4RBNA 1Y6DA 5CI9A 1OW7A 1WTYA 2JX0A 2Q9AA 1ST6A 3NG1A 3Q6MA 1Q0KA 2HZ8A 1E84A 3C8ZA 3Q7GA 2H7OA 3W2WA 1CPQA 3EH1A 1M56C 2OEVA 3K6BA 1DOVA 4XLNF 5L0JA 2KQ9A 2V3CC 5KYUB 3UNGC 2A69F 5AGFA 3S84A 3I5QA 2I15A 4B6IA 4CJGA 4GEHA 3Q6NA 2Y3HA 1ZU4A 1YA7O 4JTDB 5JLIA 4U5GA 4OIOF 2I8BA 2HUJA 1YYXA 3T4RA 1AUEA 3NKDA 1BR2A 3B0VC 4JE9A 3C18A 5AC5A 2EPOA 2J7PD 3LESA 2Y3DA 3ASNC 4CJOA 3EZHA 4KBLA 4NTAA 5DS6A 4JURI 4CSAA 2AWYA 1XZQA 1LIHA 2NSGA 4M63A 3RQEA 4C7OA 3W2VA 2ZXPA 3ABLC 5KYWA 2ZD9A 2Y3BA 2R25A 1G4WR 3AGUA 4ULVA 4EWCA 3S0XA 3RQFA 1D1AA 3C7JA 2XXAA 3W8HA 2VASA 4YK5A 2KYHA 4OINF 1AEPA 3JYYA 4X0RA 4AE4B 4EKWA 2XS1A 3GANA 4U9DA 3GEHA 1D0YA 2XSEA 2NUTA 2X51A 3DXJF 5KYXB 1MMGA 5D91A 2C04A 3H2UA 4LLEA 1SZIA 4JVSA 3QZCA 3JYHA 1ZZPA 1YVIA 4E7ZA 1E2XA
chains in the Genus database with same CATH topology
3R2PA 1EQ1A 2KC3A 1LS4A 1H7IA 1EA8A 1LE4A 1LE2A 1NFNA 1BZ4A 1AEPA 1B68A 1GS9A 1OR2A 1YA9A 1LPEA 1NFOA 3S84A 1OR3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3R2P A;  1EQ1 A;  2KC3 A;  1LS4 A;  1H7I A;  1EA8 A;  1LE4 A;  1LE2 A;  1NFN A;  1BZ4 A;  1AEP A;  1B68 A;  1GS9 A;  1OR2 A;  1YA9 A;  1LPE A;  1NFO A;  3S84 A;  1OR3 A; 
#chains in the Genus database with same CATH topology
 3DAG A;  2DGJ A;  4JJG A;  4Q7C A;  4OD4 A;  2IXO A;  1R5I D;  2W45 A;  4QI0 A;  2OQM A;  4XPY A;  3TJ6 A;  2EIJ C;  2J9W A;  1TWG A;  3JSZ A;  3KH2 A;  3ZTM A;  4E18 A;  1L3P A;  3ZQV A;  2L9J A;  4XWJ A;  3RKO F;  1HMD A;  3HJC A;  1M2V A;  3LJB A;  4U5F E;  2WZG A;  3W4Y A;  3H2V A;  1HW1 A;  4JJF A;  4BEJ A;  2QUP A;  3O39 A;  5L0D A;  2PNO A;  3DZA A;  2HV7 A;  2HMZ A;  3G50 A;  3VM6 A;  4AK9 A;  4OIP F;  3DAF A;  4G78 A;  1EKY A;  2W4B A;  1ZW2 A;  1OKK D;  3GM1 A;  1SF8 A;  3QW0 A;  4O7G A;  3GEE A;  1W2W A;  4R32 A;  3KKB A;  2AVK A;  2EPK X;  1T6I A;  2HKV A;  2P6V A;  3K7D A;  4WGY A;  3F47 A;  1CGO A;  3SP1 A;  2UUI A;  2YEV A;  1OQC A;  1VB5 A;  1TR2 A;  2WVQ A;  3HLZ A;  3K33 A;  1I5N A;  3LLK A;  3C63 A;  5JS5 A;  1H6G A;  1SYQ A;  3NDB B;  3SEO A;  1LI5 A;  5E3A A;  4MVO A;  3NYL A;  2ETS A;  3EFO A;  2UUH A;  3T6J A;  3ZWI A;  3QVY A;  4MVZ A;  3FDQ A;  1EA8 A;  2Q00 A;  4E0H A;  2RSE B;  3MYF A;  2HJM A;  5KYY A;  3KPH A;  1LE2 A;  1CGN A;  4CDV A;  1ZHT A;  5DS4 A;  3UMI A;  1T01 A;  3U2M A;  4H4K C;  4CS9 C;  2IYL D;  1HE9 A;  2XL4 A;  2DB4 A;  4BJ6 C;  1B68 A;  3FOP A;  1OCZ C;  4KI2 A;  4C7O B;  1K40 A;  5KYW B;  4EHP A;  4UDV A;  4NTF A;  3S29 A;  4ULW A;  3U8V A;  4CS8 C;  3GEI A;  2DYR C;  4JCH A;  4PJL A;  1OR3 A;  2EPN A;  1RKE A;  2HS5 A;  2R02 A;  2XXA B;  3AOU A;  4JCZ A;  3VYW A;  4FWV A;  3RQG A;  1OW6 A;  3V5X A;  1TKN A;  3EGX A;  4MTG A;  1LI7 A;  2NUT B;  2HSQ A;  3C62 A;  1KU2 A;  2H8A A;  1YJG A;  1TWH A;  1WGW A;  1IZM A;  3TOL A;  4CDY A;  4DJ9 A;  2IOQ A;  1N1C A;  3LUT B;  3PMR A;  3RIP A;  2JD3 A;  4LDR A;  2IXP A;  2PF4 E;  4CBE A;  2B0H A;  1YAR O;  2Y3G A;  2R7X A;  4E0I A;  5KYU A;  2Q3T A;  3EZI A;  2XM0 A;  3LS0 A;  5DVW A;  4DVY P;  4IB4 A;  3N24 A;  2E87 A;  2FFH A;  3UMH A;  2WVN A;  3KYJ A;  1M2V B;  3DJU B;  3DE9 A;  5L0G A;  2J9B A;  1NFO A;  2XM4 A;  4U9E A;  2EIK C;  4O79 A;  4PJM A;  4DRI B;  5BQG A;  1D0Z A;  4J7Y A;  2EPM X;  2PBE A;  1HW2 A;  2P0N A;  4MW8 A;  4J32 B;  1R4T A;  2X0C A;  1I4Y A;  1SR2 A;  1YZC A;  4XEK A;  4C3B A;  4BJ1 A;  3B0U X;  2KJG A;  3L1M A;  3IQC A;  2IXN A;  4EIY A;  2LK4 A;  4A2N B;  3DI5 A;  1IW7 F;  1T6Q A;  3CZ6 A;  3A9C A;  1E86 A;  3S90 A;  4Q4Z F;  2DYS C;  2P7V A;  2NG1 A;  2XLE A;  4QI2 A;  1VK5 A;  1VYI A;  4MW3 A;  1V54 C;  3ZDL A;  2XL8 A;  4YT2 A;  4LLC A;  2LFF A;  3VRC A;  3SXK A;  3U9J A;  1Z7Q c;  4PJN A;  2J9V A;  4CIP A;  1K04 A;  5HV9 A;  1VLS A;  2M4E A;  4OD5 A;  2GWW A;  4K0D A;  1NU9 C;  3IHU A;  4G0H A;  4JZA A;  4K7B A;  2P61 A;  2O9X A;  1BR1 A;  3H65 A;  4HE8 D;  5KYY B;  3JRT A;  5COF A;  2XRH A;  4GYT A;  4Z9I A;  3LNM B;  1HY5 A;  3X1O A;  1BBH A;  4YN0 B;  2GAQ A;  1RXQ A;  2NUP A;  3O10 A;  4EUK B;  2J8W A;  4MVR A;  4DOZ A;  1GGQ A;  1TWC A;  5L0I A;  4JRZ A;  2YRF A;  1LM3 B;  1FFT C;  3MLG A;  4AX2 A;  1TFO B;  4J30 B;  2NSF A;  2W4M A;  1MMA A;  1T6U A;  1PCX A;  2WB7 A;  3HNL A;  3DM9 B;  4HFF B;  4U5C E;  5AC4 A;  1L7C A;  2PX3 A;  4PR9 A;  5A69 A;  3B0P A;  1HE1 A;  5E2Q A;  2R05 A;  3SNH A;  5BUO A;  2CDQ A;  3ABK C;  4AL0 A;  3KL4 A;  3OA1 A;  4FX5 A;  1DOW A;  1ZHW A;  2F22 A;  3ATP A;  3CQZ A;  4IAQ A;  2OEX A;  4YL0 A;  4Z9H A;  1Q0G A;  3LEO A;  4GQH A;  4KNV A;  2NPU A;  1UFB A;  1HMO A;  2MYS A;  2YZS A;  1T5O A;  2G62 A;  4IAO A;  4W8P A;  4A4A A;  1JPN A;  1CPR A;  1OCR C;  1ORS C;  4YL1 A;  4WAB A;  3O6X A;  1J8M F;  2YKZ A;  3U0C A;  3AG1 C;  1A7E A;  4AL1 A;  4I3M A;  4MTF A;  4K1O A;  5JT4 A;  3E9V A;  4DXW A;  4I1O B;  3S27 A;  1WOL A;  3Q7L A;  3TOM A;  1FFH A;  2J45 A;  1WWP A;  4DRH B;  1Z63 A;  3TUL A;  3J06 A;  2R7V A;  3HNK A;  1H7I A;  4D4X A;  3GWL A;  3ZSU A;  2IBF A;  3ZTZ A;  1UG7 A;  3IQ6 A;  3JZ0 A;  1NFN A;  4LDK A;  3X2Q C;  1QLE C;  2OJE D;  1V55 C;  3M1C B;  3VAY A;  3WHN A;  5IY5 C;  2ZXO A;  2YWA A;  1VOM A;  2A6E F;  4PJJ A;  4CSA C;  1YYJ A;  2J46 A;  2OOC A;  4YL3 A;  1NU7 D;  5A6A A;  4KNW A;  4LDQ A;  3T6B A;  5L3V A;  4OIR F;  3IQT A;  3BEH A;  4N6C A;  1F1M A;  3RH3 A;  1ZW3 A;  2XLD A;  2RD9 A;  1ZHZ A;  3EPV A;  3VF0 A;  4CS9 A;  5K0I A;  3K1I A;  2CNW A;  1PD1 A;  256B A;  5JP7 A;  3U2L A;  2GA0 A;  1ZVZ A;  1G5Z A;  1NLX A;  1XZP A;  3S28 A;  3WG7 C;  4XTK A;  3ECS A;  2WZF A;  3JTL O;  1M6T A;  3N2Z B;  1XWJ A;  3L0I A;  1Z23 A;  2R03 A;  4XEV A;  1Z6A A;  2GFH A;  5E3C A;  5CI8 A;  2XLM A;  5F5H A;  2R7T A;  5COM A;  5DLJ A;  5FCL A;  1FMW A;  2NUP B;  2VC9 A;  4WGZ A;  5KYN A;  3PDM P;  2YL0 A;  2ASR A;  5T3W A;  2BE5 F;  4MVU A;  1BZ4 A;  2WL8 A;  3MBG A;  1KTM A;  3FXH A;  4NC3 A;  3HKK A;  4O6Y A;  1H9T A;  5GPG B;  2AWC A;  3ZC4 A;  3ZG1 A;  3C8G A;  3SXZ A;  1U89 A;  1O87 A;  3V5Y A;  4PAC A;  1U0B B;  3NMI A;  2C03 A;  2J0W A;  4BJ5 A;  4P6I C;  1A41 A;  4MVQ A;  1JRA A;  1JAF A;  4DBQ A;  5DS5 A;  2A0U A;  2YL7 A;  3LLI A;  4CX9 A;  3LAY A;  3V7O A;  4CS7 A;  1GQA A;  3JSE O;  3RF3 A;  2P1A A;  2R7R A;  3U5S A;  2G3V A;  4U5E E;  1E85 A;  1MNE A;  1Z5Z A;  2EIM C;  4EBB A;  2R7O A;  2J0X A;  3AQB A;  3KMI A;  4JEA A;  5D92 A;  4NTB A;  3AG4 C;  2R7U A;  4O6N A;  2JPU A;  1S05 A;  2MHR A;  3WAQ A;  4YT4 A;  1O3U A;  1LS1 A;  3EH2 A;  1PV3 A;  3L8I A;  1LKX A;  2OG2 A;  1OR2 A;  1VLT A;  2WZL A;  5EK0 A;  1C02 A;  3B71 A;  1ORY A;  4PFO A;  1PD0 A;  2XLW A;  3DM5 A;  5L0H A;  3TD7 A;  5JVE A;  1QKR A;  2QY9 A;  4JC7 A;  3ZQY A;  3POV A;  3NMJ A;  2LQG A;  2DI3 A;  1D1C A;  4C3E A;  4BG0 A;  2OU6 A;  3T6G B;  1LS4 A;  2VCB A;  3R7C A;  4WJ0 A;  4DBR A;  1VTM P;  1SMY F;  5KYX A;  2ZPA A;  3CSK A;  5E33 A;  2VB6 A;  4I44 A;  1A7V A;  4EBK A;  2HV6 A;  2VCA A;  3L8J A;  1LE4 A;  3ZVR A;  1WAT A;  2XL6 A;  3PHF 2;  2IM8 A;  3M4B A;  4ONS A;  5BQH A;  5L3Q A;  4G7H F;  1VMA A;  1H9G A;  2A1D D;  2LD6 A;  3G4Z A;  4JTC B;  4F4B A;  5B1B C;  1BDJ B;  3EFO B;  4LAC B;  4PFP A;  4C3D A;  2YL1 A;  5F5F A;  4QDL A;  3SYN A;  1QQ3 A;  4XEF A;  1AVO B;  3V5Z A;  5B3S C;  3EGD A;  1LPE A;  2KGO A;  4IJJ A;  4JEB A;  3FVY A;  4YT8 A;  3EHN A;  2Z15 A;  4XQ1 A;  1S7Z A;  3MX3 A;  3TJ5 A;  3U8P A;  1YAU O;  1Y4C A;  3CEX A;  3QW1 A;  4U5B E;  3U3B A;  4KC9 A;  4DVZ A;  2XLV A;  4G7O F;  1JMW A;  3I5P A;  3NYJ A;  2LP4 A;  4XLP F;  3C8G B;  1OW8 A;  1MQV A;  3EHM A;  4L6R A;  2HMQ A;  3LEV A;  3ITF A;  5JRA A;  2CGE A;  4Z9J A;  4MND A;  2M64 A;  2OJQ A;  2LFD A;  2YHS A;  4U5D E;  3NKE A;  5A6K A;  4P9F A;  4DRJ B;  1YZA A;  2CNW D;  4NCQ A;  1RKE B;  2L6H A;  5T3T A;  3EQL F;  3JRM O;  2L7A A;  3FHD A;  4E17 A;  2Q4F A;  3S9O A;  4OIQ F;  2KNH A;  3EGX B;  3DMD A;  3UGO A;  1Q0F A;  1ZHY A;  1QZX A;  1NG1 A;  2MWQ A;  2R7Q A;  3EG9 A;  4N4W A;  4YT5 A;  1RCP A;  2YQY A;  3AQC A;  4BJT A;  3HNJ A;  2R7W A;  2QLA A;  2XLH A;  1T9K A;  2QE9 A;  4H54 A;  4MTO A;  2QTV A;  1MND A;  5DQZ A;  3U3F A;  2PP4 A;  3DJN B;  2KW3 C;  3IEE A;  2Q7R A;  1OXK A;  3SZR A;  1APC A;  1ZYR F;  3TQO A;  1V74 B;  3GOR A;  3N0T A;  3RVZ A;  4EBJ A;  3U9M A;  3C8G D;  3RYL A;  1JOG A;  3OWT A;  2EPL X;  3KYI A;  4Q5S F;  2QNL A;  3HTK C;  3IQ5 A;  4P9T A;  1M2O A;  2J9U A;  1J8Y F;  4RDA A;  5A6B A;  2V26 A;  4FES A;  5BQI A;  3F46 A;  1RJ9 A;  2HSB A;  3AG3 C;  3JCU Q;  3K1H A;  2YLG A;  2EIN C;  4MS2 A;  4I1M A;  1YLM A;  4JKV A;  2OCC C;  2AU5 A;  2YLI A;  2YVK A;  4JW1 A;  4RD9 A;  1GS9 A;  3LNR A;  3LS1 A;  5A6J A;  3GM2 A;  3AGT A;  2XS8 A;  4NQF A;  1ORJ A;  5DQT A;  3GM3 A;  3B29 A;  3M15 A;  5COG A;  1BR4 A;  4N06 A;  1QSP A;  2VCC A;  3FMS A;  3L34 A;  3TK0 A;  1TWA A;  3QTH A;  5F28 E;  4BJ6 A;  1I4Z A;  4BPM A;  3QVZ A;  2A68 F;  4G7Z F;  1KNY A;  3SXY A;  1NSG B;  2BL2 A;  4U5H A;  4CDA A;  2H7V C;  3AG2 C;  3EGD B;  4CS8 A;  1NBB A;  3BRJ A;  1RMV A;  1LVK A;  5B1A C;  3RVY A;  2AP3 A;  4IAR A;  5L0F A;  2VH3 A;  4D4N A;  1OXB A;  3G4X A;  2J7P A;  5B3I A;  2IXM A;  4LER A;  2Q9B A;  3W8I A;  3B9Q A;  3DKA A;  3AJM A;  5FZT A;  2CCY A;  1OCO C;  2L6F A;  3JT1 A;  1WN0 A;  2PX0 A;  4BEM J;  4ER9 A;  1Q0D A;  5HSW A;  4CIH A;  1YDI A;  2W9Y A;  3QMK A;  5EGY A;  4XPX A;  1C03 A;  4NY3 A;  3K66 A;  2A0B A;  3SXM A;  3A11 A;  5L0C A;  2GDC A;  1TQG A;  3NYM A;  2KC3 A;  1QPU A;  2XLO A;  2B0J A;  2CYD A;  2R7S A;  3EJN A;  4XPW A;  3O55 A;  4ZLD A;  2KK1 A;  4JTA B;  3OEO A;  4J7T A;  5EHH A;  3EG9 B;  2LIG A;  2FGY A;  4PK4 A;  1O5H A;  2HJ3 A;  3WOD F;  3GOD A;  4ANJ A;  4JIO A;  4E7S A;  1CGM E;  2A6H F;  4MVS A;  5TJ5 E;  1WAS A;  1K05 A;  1Z3I X;  3K1I C;  1C17 M;  2G3K A;  3ZIB A;  2HFI A;  1G8X A;  2D5R B;  3T9O A;  4YWQ A;  2PFD A;  1FAP B;  2EIL C;  3DE8 A;  1YA9 A;  2L81 A;  3ABM C;  1M57 C;  4W8K A;  5CIV A;  3M4C A;  3MYI A;  1U6H A;  1FR0 A;  3HNI A;  3US6 A;  4N6H A;  4O6M A;  1RJ9 B;  2Y39 A;  4HEA J;  3R2P A;  4IWB A;  1GM5 A;  1QVX A;  1TFK B;  2Y69 C;  4ZLC A;  1ZU5 A;  5JSL A;  3M79 A;  4IRU A;  4MQ9 F;  1OKK A;  1OCC C;  2YLD A;  4AE4 A;  5JUA A;  3GWN A;  3UMK A;  1VYK A;  2D4U A;  3DD7 A;  1MMD A;  3CAX A;  1A7D A;  1JPJ A;  4BJ5 C;  1FNT c;  2ZXR A;  2LSE A;  2KSF A;  3I4U A;  3NMK A;  1D1B A;  1E83 A;  3IPM O;  1EI7 A;  3FAJ A;  2WVO A;  2FAP B;  2L6G A;  2LCH A;  2Q9C A;  1V4A A;  1D0X A;  1ZHX A;  2CW0 F;  2H7B A;  3NRH A;  1A0B A;  3DWW A;  4HFK B;  3PCV A;  1FMV A;  4MVM A;  4YJW A;  2ZXW C;  3RW0 A;  4FAP B;  1Q0M A;  1MMN A;  3ASO C;  4IGG A;  2OKU A;  5A6B D;  2ICW G;  3E70 C;  1JR8 A;  1NZE A;  3RFY A;  2TMV P;  1G4U S;  2YL3 A;  3MFN A;  3UGP A;  2R9R B;  1EQ1 A;  1RKC A;  1FTS A;  2BC5 A;  3UR3 C;  5T1D B;  3FOO A;  3FAP B;  4RBN A;  1Y6D A;  5CI9 A;  1OW7 A;  1WTY A;  2JX0 A;  2Q9A A;  1ST6 A;  3NG1 A;  3Q6M A;  1Q0K A;  2HZ8 A;  1E84 A;  3C8Z A;  3Q7G A;  2H7O A;  3W2W A;  1CPQ A;  3EH1 A;  1M56 C;  2OEV A;  3K6B A;  1DOV A;  4XLN F;  5L0J A;  2KQ9 A;  2V3C C;  5KYU B;  3UNG C;  2A69 F;  5AGF A;  3S84 A;  3I5Q A;  2I15 A;  4B6I A;  4CJG A;  4GEH A;  3Q6N A;  2Y3H A;  1ZU4 A;  1YA7 O;  4JTD B;  5JLI A;  4U5G A;  4OIO F;  2I8B A;  2HUJ A;  1YYX A;  3T4R A;  1AUE A;  3NKD A;  1BR2 A;  3B0V C;  4JE9 A;  3C18 A;  5AC5 A;  2EPO A;  2J7P D;  3LES A;  2Y3D A;  3ASN C;  4CJO A;  3EZH A;  4KBL A;  4NTA A;  5DS6 A;  4JUR I;  4CSA A;  2AWY A;  1XZQ A;  1LIH A;  2NSG A;  4M63 A;  3RQE A;  4C7O A;  3W2V A;  2ZXP A;  3ABL C;  5KYW A;  2ZD9 A;  2Y3B A;  2R25 A;  1G4W R;  3AGU A;  4ULV A;  4EWC A;  3S0X A;  3RQF A;  1D1A A;  3C7J A;  2XXA A;  3W8H A;  2VAS A;  4YK5 A;  2KYH A;  4OIN F;  1AEP A;  3JYY A;  4X0R A;  4AE4 B;  4EKW A;  2XS1 A;  3GAN A;  4U9D A;  3GEH A;  1D0Y A;  2XSE A;  2NUT A;  2X51 A;  3DXJ F;  5KYX B;  1MMG A;  5D91 A;  2C04 A;  3H2U A;  4LLE A;  1SZI A;  4JVS A;  3QZC A;  3JYH A;  1ZZP A;  1YVI A;  4E7Z A;  1E2X A; 
#chains in the Genus database with same CATH homology
 3R2P A;  1EQ1 A;  2KC3 A;  1LS4 A;  1H7I A;  1EA8 A;  1LE4 A;  1LE2 A;  1NFN A;  1BZ4 A;  1AEP A;  1B68 A;  1GS9 A;  1OR2 A;  1YA9 A;  1LPE A;  1NFO A;  3S84 A;  1OR3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...