1LE2A

Structural basis for altered function in the common mutants of human apolipoprotein-e
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
144
structure length
144
Chain Sequence
GQRWELALGRFWDYLRWVQTLSEQVQEELLSSQVTQELRALMDETMKELKAYKSELEEQLTPVAEETRARLSKELQAAQARLGADMEDVCGRLVQYRGEVQAMLGQSTEELRVRLASHLRKLRKRLLRDADDLQKCLAVYQAGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lipoprotein
molecule keywords APOLIPOPROTEIN E2
publication title Salt bridge relay triggers defective LDL receptor binding by a mutant apolipoprotein.
pubmed doi rcsb
source organism Homo sapiens
total genus 57
structure length 144
sequence length 144
ec nomenclature
pdb deposition date 1991-08-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.20 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Apolipoprotein 1le2A00
1BZ4A 3R2PA 1NFNA 1EA8A 1GS9A 1LS4A 1OR2A 1LE4A 1AEPA 1H7IA 1B68A 1LPEA 2KC3A 1NFOA 1OR3A 1YA9A 3S84A 1EQ1A 1LE2A
chains in the Genus database with same CATH superfamily
2FFHA 2GAQA 3QZCA 5A69A 1FNTc 4ZLDA 1GM5A 2HSBA 3WHNA 2OEXA 2C04A 3EJNA 4ULWA 5CIVA 2R9RB 2A69F 2H7BA 2R7TA 3NG1A 1ZHZA 2B0HA 3ABLC 5T3WA 3UGPA 5FCLA 3NKDA 4E0IA 5DLJA 1TWAA 2YKZA 5CI9A 1JR8A 2YL7A 2R7VA 3AG4C 4CIHA 1VMAA 3KYJA 3N0TA 4BEJA 4I1MA 1M2VA 1V54C 1V4AA 2NPUA 2R7RA 3QMKA 1HE9A 4MVSA 5A6BA 5B1AC 3C18A 3Q7LA 3AGTA 3GM3A 2YHSA 1CPRA 2IXOA 3S27A 2QNLA 3DM5A 4JZAA 2Y69C 3AJMA 4IAQA 3HNKA 4I3MA 3NYJA 1J8MF 4BJ5C 3ZTZA 1O87A 1ST6A 1XZPA 4HEAJ 5L0CA 2DI3A 1VB5A 2Y3BA 4L6RA 5JLIA 4G7HF 3BEHA 1Q0MA 3WODF 1QVXA 3HNJA 3DAGA 3LESA 5KYYA 1QQ3A 3UNGC 2JX0A 2LK4A 2ZXWC 4JJGA 3U2LA 2PBEA 3GODA 1PV3A 1I4YA 1KU2A 1N1CA 4KBLA 4U5DE 4ANJA 5KYXB 4DBRA 1OR2A 4YL3A 2P0NA 2ETSA 4YT8A 1KNYA 1RKEB 3MLGA 3T6GB 5JUAA 4X0RA 3LNMB 1BR1A 1H9GA 2NG1A 1JPNA 4DBQA 2KGOA 4RD9A 1D0ZA 1QSPA 4J7TA 5EK0A 2L6GA 3W2VA 5DS6A 2IBFA 1S05A 2ZD9A 3SXKA 5A6BD 1L7CA 3H2VA 4PFOA 4MTGA 2G3VA 2I8BA 2R7UA 1MNEA 2OCCC 3EZHA 4IARA 5DS5A 1Z7Qc 2XXAB 4JRZA 2WVOA 3B0PA 4J30B 2WZFA 2CNWA 2R05A 2XM0A 3MX3A 2WL8A 3EG9B 1NG1A 1AVOB 1EI7A 3UMIA 3HNIA 1RKCA 2OU6A 3WG7C 4PFPA 4P9FA 1E2XA 3SEOA 3HLZA 1FTSA 4DVYP 3EZIA 1UG7A 2HJ3A 4EBBA 3KMIA 1RXQA 3JRMO 4DXWA 5HV9A 2J46A 1BBHA 3ZQYA 2HUJA 2XL4A 2OOCA 2D5RB 3NYMA 4G7ZF 2XS1A 4MNDA 3POVA 4JKVA 3ZSUA 3HJCA 1T9KA 1FAPB 1YZAA 2QTVA 2VCCA 3NDBB 2VCBA 5K0IA 1G5ZA 1JRAA 1T6QA 5DVWA 3SZRA 3ATPA 3MYFA 1SZIA 4YT5A 4CSAA 5COFA 4MVMA 2EILC 5L0GA 3GM1A 1WWPA 4YL0A 3OEOA 4FESA 4CS8A 2XLHA 3U0CA 2EPNA 4E0HA 1JAFA 2G62A 3IQ6A 1G4US 2NUPA 1LS4A 1VOMA 3GEHA 1OW8A 1QKRA 4Z9IA 1M57C 4P6IC 5L0FA 2CNWD 2EPLX 2L9JA 5EHHA 5F5HA 1E85A 1EKYA 2QUPA 1MMGA 4GEHA 2HFIA 2EPKX 1LPEA 1VK5A 2ICWG 3B0VC 2HMZA 1LI5A 2A0BA 5E2QA 3FMSA 4QDLA 1YA9A 3VM6A 4LDRA 2X0CA 5IY5C 1LIHA 2KNHA 4JURI 4PK4A 1ZVZA 1CGNA 1ORJA 2FAPB 1PCXA 2A1DD 3V7OA 5L3VA 1V55C 1A41A 2RD9A 3M4CA 5BQIA 1IZMA 1HW1A 3LAYA 3LNRA 5L3QA 4LDKA 2R03A 2VH3A 3A11A 2LP4A 1BZ4A 3LUTB 4U5BE 5CI8A 4YT4A 1H6GA 3ZDLA 3V5XA 3ASNC 1RJ9B 2XLVA 2IYLD 5T1DB 2DYRC 2W45A 4U5GA 4EKWA 5KYWB 3H65A 3TK0A 3U3BA 3CSKA 3MBGA 2EPOA 4AL0A 1K05A 5JRAA 1OCRC 4G78A 2Y3GA 3M79A 4EBJA 3N2ZB 2GDCA 4JTAB 5L0JA 2J8WA 2YQYA 2PX0A 4ONSA 3JZ0A 4WGZA 2UUHA 3EGDB 3RVZA 4HE8D 1A0BA 1EQ1A 2PNOA 4H4KC 2L7AA 3TJ5A 3VRCA 3ZIBA 3A9CA 5T3TA 3S28A 3ASOC 2MHRA 1TWGA 3NYLA 3VF0A 4UDVA 3DE9A 2ZPAA 3UMHA 4FX5A 2GWWA 1YYXA 3W8IA 1ZW3A 4P9TA 4DRJB 4N6CA 4EUKB 3K33A 3L0IA 4EIYA 3Q6MA 4YK5A 4C3DA 1AUEA 1H7IA 2CYDA 3S29A 1U89A 2W4BA 3EGXB 3FOPA 1Z63A 2L81A 1YAUO 2A6EF 3L34A 2KQ9A 1QPUA 3GORA 1PD0A 2KJGA 2PF4E 4MW3A 4YN0B 3DD7A 4ZLCA 5KYNA 1M6TA 1SMYF 2NUTB 3H2UA 4A2NB 5HSWA 3C8GB 2J9BA 3S84A 4NC3A 1OXBA 2R7QA 4AK9A 3RKOF 2TMVP 1KTMA 1Z23A 2AVKA 4AE4A 3DJUB 5B3IA 2CCYA 4OIRF 3V5YA 3L8JA 2VC9A 3S9OA 4CJGA 4MVQA 4CSAC 3B71A 4K0DA 2AU5A 1ORSC 2XL6A 4JTCB 2X51A 1YLMA 4CS8C 4XPWA 2R7WA 1Y4CA 4Q7CA 2MWQA 4NCQA 4CDVA 2CW0F 1A7EA 1OW7A 2MYSA 1GS9A 4NTBA 2QE9A 4XLNF 1NBBA 3R7CA 3T4RA 2EIKC 3QTHA 1BDJB 2XS8A 1RJ9A 3EFOA 4Q5SF 3K7DA 3X2QC 3IQCA 1ZHYA 2XRHA 4XQ1A 4KNWA 4CX9A 5COMA 1MMNA 5B3SC 1RCPA 1W2WA 4JJFA 1CPQA 1OW6A 3ZTMA 2E87A 3G50A 3EHMA 3F46A 2Q9BA 4J7YA 5DQTA 2J0XA 3SXMA 5F28E 4A4AA 1HY5A 1NU7D 4LACB 1BR4A 3O55A 3DWWA 3GWNA 3ZG1A 2YVKA 3RFYA 1GQAA 3EQLF 4G0HA 4MVOA 1C03A 2YLIA 3GM2A 4Z9JA 4E17A 5KYUB 3HTKC 1VTMP 2Q9AA 3DE8A 3KYIA 4O6MA 4CS7A 1K40A 4YL1A 3B0UX 4E18A 2OEVA 5D92A 2QLAA 4MVUA 1JMWA 3IHUA 4LLEA 2WVNA 1M2OA 3SXZA 3U3FA 1XWJA 2A68F 1Y6DA 2A6HF 3TOLA 1YARO 3LLKA 4BJ6C 1B68A 3E70C 5L0DA 3IEEA 4DRHB 4C7OB 1G8XA 1OR3A 4BJTA 3SNHA 3FXHA 1T6UA 4YWQA 3C63A 1YVIA 4XEFA 5BQHA 3UGOA 4JEBA 4WABA 1APCA 1YJGA 2KSFA 3NMKA 4NTAA 2Q3TA 2C03A 2LSEA 3ZC4A 4CDYA 4DOZA 1D1BA 3JSEO 3MFNA 4CS9A 4IJJA 4IWBA 2O9XA 3QVZA 5AC5A 3X1OA 4H54A 1ZW2A 2PP4A 3TULA 2R7XA 256BA 2YEVA 2AWYA 4U5CE 2J9WA 3QVYA 1AEPA 4NQFA 2ZXPA 1DOVA 3KPHA 3OA1A 3RYLA 3U9JA 2BL2A 2YL3A 1ZHTA 5E3CA 3IQTA 3DZAA 1ZZPA 2J9UA 2PFDA 1MMAA 1M56C 4PACA 2R7OA 3O39A 3C7JA 2EINC 4Q4ZF 4JTDB 4XEVA 4D4XA 5KYXA 3CAXA 1D0YA 1SYQA 1BR2A 2VB6A 2XLOA 2J0WA 1JPJA 3AQBA 3K66A 4PJMA 3M1CB 4BJ5A 2VASA 2HJMA 3IPMO 1YA7O 4K1OA 2BE5F 1PD1A 1O3UA 1RKEA 3IQ5A 4MS2A 4CIPA 4N06A 1LM3B 2L6FA 2P7VA 3KL4A 3DM9B 3NMIA 4AL1A 2I15A 1M2VB 1VYIA 4MQ9F 1NFNA 3J06A 1T6IA 3JSZA 2WZGA 2LCHA 2LFDA 1YDIA 3B9QA 3LJBA 1EA8A 1V74B 3GANA 1TFOB 1LVKA 1R4TA 2CGEA 1WASA 3QW1A 5GPGB 1TQGA 4U5EE 3CZ6A 4DVZA 1ZYRF 3TOMA 3LS0A 4JW1A 2J7PA 1VYKA 2YL0A 2XXAA 2OJQA 4QI0A 2LQGA 4C3EA 4U9DA 4XEKA 2XL8A 3C62A 2YLGA 3LS1A 4M63A 5KYYB 5A6JA 3EG9A 2OG2A 2Y3HA 3PDMP 4EHPA 1UFBA 1OXKA 2Y3DA 3FAJA 3UR3C 3W8HA 1FFHA 2G3KA 2VCAA 1NZEA 1S7ZA 1TWCA 2F22A 2LFFA 5AC4A 4JIOA 4XLPF 2R25A 1J8YF 1OCZC 1WATA 3T9OA 5DQZA 3G4XA 1WN0A 3RIPA 3T6BA 2WZLA 3TQOA 5JVEA 4GYTA 5L0HA 1HW2A 4OIOF 1A7DA 2OJED 2NSGA 3O10A 1WOLA 3WAQA 4R32A 2XLMA 3RQGA 1E84A 1WGWA 1R5ID 4O6YA 4DRIB 1LE4A 2ZXRA 1OQCA 4OD5A 1RMVA 3HKKA 4KC9A 4W8KA 3JYHA 3AG2C 4DJ9A 1QZXA 3LEVA 2YZSA 2H8AA 5A6AA 2EPMX 3G4ZA 1E83A 1Z5ZA 5E3AA 2J7PD 4W8PA 2WB7A 5JT4A 3DXJF 3EH1A 1G4WR 2BC5A 4JCZA 4WGYA 1NLXA 3RQEA 2Q9CA 3T6JA 1Z6AA 3FOOA 4MVZA 2LIGA 3K1IA 2YL1A 3L1MA 3PMRA 4HFKB 1QLEC 3FAPB 1YZCA 4CS9C 1Q0DA 1FMVA 1ZU5A 4OIQF 2CDQA 3I5QA 3UMKA 4O79A 2ASRA 3RQFA 3Q6NA 3Q7GA 1FMWA 1D1AA 2FGYA 2R02A 3AQCA 4HFFB 5COGA 3PHF2 3AG3C 4PJLA 3SXYA 1C02A 4NY3A 3OWTA 2XLEA 3JRTA 1A7VA 3AOUA 3CQZA 3K6BA 2IXPA 4U5FE 4OINF 4O6NA 3U5SA 2V26A 1SF8A 2Q00A 2XLDA 3DAFA 1HMDA 3GEEA 3US6A 3DKAA 4OD4A 5KYWA 1I4ZA 1TWHA 3DMDA 1U0BB 4KI2A 2NUPB 5L0IA 4PJJA 1NSGB 3PCVA 4YJWA 1Z3IX 3RW0A 2QY9A 3E9VA 3R2PA 2IOQA 4GQHA 1LS1A 4XPYA 4Z9HA 3W2WA 2P1AA 3NMJA 3KKBA 5AGFA 3I5PA 4IAOA 4FWVA 4WJ0A 4CDAA 5F5FA 3U8VA 2HZ8A 3EGDA 5TJ5E 1T01A 2IXMA 5JSLA 4BG0A 1JOGA 2ZXOA 4PJNA 2JPUA 2L6HA 1Q0GA 2YLDA 4RDAA 2H7OA 2HSQA 3NRHA 2Q7RA 1H9TA 4ULVA 4IGGA 1LI7A 2J9VA 2IXNA 3RF3A 2Y39A 3U8PA 1I5NA 2P6VA 3SP1A 3JYYA 4KNVA 3JCUQ 3ZVRA 4LLCA 3EPVA 3EHNA 4JVSA 3EGXA 2JD3A 2P61A 3W4YA 3GEIA 2YRFA 3CEXA 1MNDA 2NUTA 2EIJC 2UUIA 3C8GA 2DGJA 1HMOA 3U2MA 1YYJA 5JS5A 2LD6A 3ITFA 3DJNB 3TJ6A 4D4NA 4B6IA 2HKVA 3M4BA 4MVRA 3S0XA 2NSFA 4IRUA 4MTFA 3VYWA 1VLTA 3DI5A 2Q4FA 3TD7A 1SR2A 2DYSC 2EIMC 1T5OA 3AGUA 3RVYA 4BEMJ 3FDQA 3O6XA 4C3BA 2HV7A 3N24A 4MTOA 1CGOA 4XWJA 1HE1A 1OKKA 5JP7A 4CBEA 4LDQA 4BJ1A 3K1HA 1TFKB 4I1OB 5EGYA 1GGQA 4CJOA 3K1IC 5BUOA 4JC7A 1TKNA 4J32B 1LKXA 3QW0A 4XTKA 5B1BC 2W9YA 1D1CA 2XSEA 3C8ZA 1C17M 1VLSA 3HNLA 2XLWA 1OCOC 3L8IA 4RBNA 2GFHA 3I4UA 3RH3A 2R7SA 1D0XA 3ZWIA 1ZHXA 4JCHA 4E7SA 5A6KA 2AWCA 3SYNA 4AX2A 3C8GD 3V5ZA 1OCCC 2A0UA 1Q0KA 4N6HA 4AE4B 1F1MA 3KH2A 1K04A 1TR2A 2WVQA 3AG1C 4YT2A 2KC3A 1XZQA 2OQMA 5KYUA 1NFOA 1ORYA 2KW3C 4PR9A 1E86A 1L3PA 3FHDA 1ZU4A 2GA0A 3LEOA 4JE9A 5FZTA 4U5HA 4XPXA 1MMDA 5BQGA 1CGME 1FR0A 4O7GA 4FAPB 3BRJA 2KK1A 4U9EA 1LE2A 4IB4A 4EBKA 2H7VC 1ZHWA 3JT1A 2PX3A 2KYHA 3ECSA 3F47A 1OKKD 4C7OA 2HS5A 3M15A 3S90A 4JEAA 2XM4A 4LERA 2IM8A 3ABKC 3EFOB 4MW8A 1IW7F 4NTFA 3VAYA 4OIPF 4I44A 4QI2A 3NKEA 4E7ZA 3ABMC 2YWAA 3B29A 4F4BA 2RSEB 3LLIA 4K7BA 1DOWA 1WTYA 3GWLA 4N4WA 4ER9A 2D4UA 4G7OF 2HV6A 5E33A 5D91A 1MQVA 4BJ6A 2V3CC 2HMQA 1Q0FA 2W4MA 3FVYA 5DS4A 3EH2A 3JTLO 1O5HA 1FFTC 1U6HA 2AP3A 2DB4A 1NU9C 2OKUA 4EWCA 2J45A 2Z15A 2M4EA 3MYIA 4BPMA 3U9MA 3ZQVA 2B0JA 2M64A
chains in the Genus database with same CATH topology
1BZ4A 3R2PA 1NFNA 1EA8A 1GS9A 1LS4A 1OR2A 1LE4A 1AEPA 1H7IA 1B68A 1LPEA 2KC3A 1NFOA 1OR3A 1YA9A 3S84A 1EQ1A 1LE2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BZ4 A;  3R2P A;  1NFN A;  1EA8 A;  1GS9 A;  1LS4 A;  1OR2 A;  1LE4 A;  1AEP A;  1H7I A;  1B68 A;  1LPE A;  2KC3 A;  1NFO A;  1OR3 A;  1YA9 A;  3S84 A;  1EQ1 A;  1LE2 A; 
#chains in the Genus database with same CATH topology
 2FFH A;  2GAQ A;  3QZC A;  5A69 A;  1FNT c;  4ZLD A;  1GM5 A;  2HSB A;  3WHN A;  2OEX A;  2C04 A;  3EJN A;  4ULW A;  5CIV A;  2R9R B;  2A69 F;  2H7B A;  2R7T A;  3NG1 A;  1ZHZ A;  2B0H A;  3ABL C;  5T3W A;  3UGP A;  5FCL A;  3NKD A;  4E0I A;  5DLJ A;  1TWA A;  2YKZ A;  5CI9 A;  1JR8 A;  2YL7 A;  2R7V A;  3AG4 C;  4CIH A;  1VMA A;  3KYJ A;  3N0T A;  4BEJ A;  4I1M A;  1M2V A;  1V54 C;  1V4A A;  2NPU A;  2R7R A;  3QMK A;  1HE9 A;  4MVS A;  5A6B A;  5B1A C;  3C18 A;  3Q7L A;  3AGT A;  3GM3 A;  2YHS A;  1CPR A;  2IXO A;  3S27 A;  2QNL A;  3DM5 A;  4JZA A;  2Y69 C;  3AJM A;  4IAQ A;  3HNK A;  4I3M A;  3NYJ A;  1J8M F;  4BJ5 C;  3ZTZ A;  1O87 A;  1ST6 A;  1XZP A;  4HEA J;  5L0C A;  2DI3 A;  1VB5 A;  2Y3B A;  4L6R A;  5JLI A;  4G7H F;  3BEH A;  1Q0M A;  3WOD F;  1QVX A;  3HNJ A;  3DAG A;  3LES A;  5KYY A;  1QQ3 A;  3UNG C;  2JX0 A;  2LK4 A;  2ZXW C;  4JJG A;  3U2L A;  2PBE A;  3GOD A;  1PV3 A;  1I4Y A;  1KU2 A;  1N1C A;  4KBL A;  4U5D E;  4ANJ A;  5KYX B;  4DBR A;  1OR2 A;  4YL3 A;  2P0N A;  2ETS A;  4YT8 A;  1KNY A;  1RKE B;  3MLG A;  3T6G B;  5JUA A;  4X0R A;  3LNM B;  1BR1 A;  1H9G A;  2NG1 A;  1JPN A;  4DBQ A;  2KGO A;  4RD9 A;  1D0Z A;  1QSP A;  4J7T A;  5EK0 A;  2L6G A;  3W2V A;  5DS6 A;  2IBF A;  1S05 A;  2ZD9 A;  3SXK A;  5A6B D;  1L7C A;  3H2V A;  4PFO A;  4MTG A;  2G3V A;  2I8B A;  2R7U A;  1MNE A;  2OCC C;  3EZH A;  4IAR A;  5DS5 A;  1Z7Q c;  2XXA B;  4JRZ A;  2WVO A;  3B0P A;  4J30 B;  2WZF A;  2CNW A;  2R05 A;  2XM0 A;  3MX3 A;  2WL8 A;  3EG9 B;  1NG1 A;  1AVO B;  1EI7 A;  3UMI A;  3HNI A;  1RKC A;  2OU6 A;  3WG7 C;  4PFP A;  4P9F A;  1E2X A;  3SEO A;  3HLZ A;  1FTS A;  4DVY P;  3EZI A;  1UG7 A;  2HJ3 A;  4EBB A;  3KMI A;  1RXQ A;  3JRM O;  4DXW A;  5HV9 A;  2J46 A;  1BBH A;  3ZQY A;  2HUJ A;  2XL4 A;  2OOC A;  2D5R B;  3NYM A;  4G7Z F;  2XS1 A;  4MND A;  3POV A;  4JKV A;  3ZSU A;  3HJC A;  1T9K A;  1FAP B;  1YZA A;  2QTV A;  2VCC A;  3NDB B;  2VCB A;  5K0I A;  1G5Z A;  1JRA A;  1T6Q A;  5DVW A;  3SZR A;  3ATP A;  3MYF A;  1SZI A;  4YT5 A;  4CSA A;  5COF A;  4MVM A;  2EIL C;  5L0G A;  3GM1 A;  1WWP A;  4YL0 A;  3OEO A;  4FES A;  4CS8 A;  2XLH A;  3U0C A;  2EPN A;  4E0H A;  1JAF A;  2G62 A;  3IQ6 A;  1G4U S;  2NUP A;  1LS4 A;  1VOM A;  3GEH A;  1OW8 A;  1QKR A;  4Z9I A;  1M57 C;  4P6I C;  5L0F A;  2CNW D;  2EPL X;  2L9J A;  5EHH A;  5F5H A;  1E85 A;  1EKY A;  2QUP A;  1MMG A;  4GEH A;  2HFI A;  2EPK X;  1LPE A;  1VK5 A;  2ICW G;  3B0V C;  2HMZ A;  1LI5 A;  2A0B A;  5E2Q A;  3FMS A;  4QDL A;  1YA9 A;  3VM6 A;  4LDR A;  2X0C A;  5IY5 C;  1LIH A;  2KNH A;  4JUR I;  4PK4 A;  1ZVZ A;  1CGN A;  1ORJ A;  2FAP B;  1PCX A;  2A1D D;  3V7O A;  5L3V A;  1V55 C;  1A41 A;  2RD9 A;  3M4C A;  5BQI A;  1IZM A;  1HW1 A;  3LAY A;  3LNR A;  5L3Q A;  4LDK A;  2R03 A;  2VH3 A;  3A11 A;  2LP4 A;  1BZ4 A;  3LUT B;  4U5B E;  5CI8 A;  4YT4 A;  1H6G A;  3ZDL A;  3V5X A;  3ASN C;  1RJ9 B;  2XLV A;  2IYL D;  5T1D B;  2DYR C;  2W45 A;  4U5G A;  4EKW A;  5KYW B;  3H65 A;  3TK0 A;  3U3B A;  3CSK A;  3MBG A;  2EPO A;  4AL0 A;  1K05 A;  5JRA A;  1OCR C;  4G78 A;  2Y3G A;  3M79 A;  4EBJ A;  3N2Z B;  2GDC A;  4JTA B;  5L0J A;  2J8W A;  2YQY A;  2PX0 A;  4ONS A;  3JZ0 A;  4WGZ A;  2UUH A;  3EGD B;  3RVZ A;  4HE8 D;  1A0B A;  1EQ1 A;  2PNO A;  4H4K C;  2L7A A;  3TJ5 A;  3VRC A;  3ZIB A;  3A9C A;  5T3T A;  3S28 A;  3ASO C;  2MHR A;  1TWG A;  3NYL A;  3VF0 A;  4UDV A;  3DE9 A;  2ZPA A;  3UMH A;  4FX5 A;  2GWW A;  1YYX A;  3W8I A;  1ZW3 A;  4P9T A;  4DRJ B;  4N6C A;  4EUK B;  3K33 A;  3L0I A;  4EIY A;  3Q6M A;  4YK5 A;  4C3D A;  1AUE A;  1H7I A;  2CYD A;  3S29 A;  1U89 A;  2W4B A;  3EGX B;  3FOP A;  1Z63 A;  2L81 A;  1YAU O;  2A6E F;  3L34 A;  2KQ9 A;  1QPU A;  3GOR A;  1PD0 A;  2KJG A;  2PF4 E;  4MW3 A;  4YN0 B;  3DD7 A;  4ZLC A;  5KYN A;  1M6T A;  1SMY F;  2NUT B;  3H2U A;  4A2N B;  5HSW A;  3C8G B;  2J9B A;  3S84 A;  4NC3 A;  1OXB A;  2R7Q A;  4AK9 A;  3RKO F;  2TMV P;  1KTM A;  1Z23 A;  2AVK A;  4AE4 A;  3DJU B;  5B3I A;  2CCY A;  4OIR F;  3V5Y A;  3L8J A;  2VC9 A;  3S9O A;  4CJG A;  4MVQ A;  4CSA C;  3B71 A;  4K0D A;  2AU5 A;  1ORS C;  2XL6 A;  4JTC B;  2X51 A;  1YLM A;  4CS8 C;  4XPW A;  2R7W A;  1Y4C A;  4Q7C A;  2MWQ A;  4NCQ A;  4CDV A;  2CW0 F;  1A7E A;  1OW7 A;  2MYS A;  1GS9 A;  4NTB A;  2QE9 A;  4XLN F;  1NBB A;  3R7C A;  3T4R A;  2EIK C;  3QTH A;  1BDJ B;  2XS8 A;  1RJ9 A;  3EFO A;  4Q5S F;  3K7D A;  3X2Q C;  3IQC A;  1ZHY A;  2XRH A;  4XQ1 A;  4KNW A;  4CX9 A;  5COM A;  1MMN A;  5B3S C;  1RCP A;  1W2W A;  4JJF A;  1CPQ A;  1OW6 A;  3ZTM A;  2E87 A;  3G50 A;  3EHM A;  3F46 A;  2Q9B A;  4J7Y A;  5DQT A;  2J0X A;  3SXM A;  5F28 E;  4A4A A;  1HY5 A;  1NU7 D;  4LAC B;  1BR4 A;  3O55 A;  3DWW A;  3GWN A;  3ZG1 A;  2YVK A;  3RFY A;  1GQA A;  3EQL F;  4G0H A;  4MVO A;  1C03 A;  2YLI A;  3GM2 A;  4Z9J A;  4E17 A;  5KYU B;  3HTK C;  1VTM P;  2Q9A A;  3DE8 A;  3KYI A;  4O6M A;  4CS7 A;  1K40 A;  4YL1 A;  3B0U X;  4E18 A;  2OEV A;  5D92 A;  2QLA A;  4MVU A;  1JMW A;  3IHU A;  4LLE A;  2WVN A;  1M2O A;  3SXZ A;  3U3F A;  1XWJ A;  2A68 F;  1Y6D A;  2A6H F;  3TOL A;  1YAR O;  3LLK A;  4BJ6 C;  1B68 A;  3E70 C;  5L0D A;  3IEE A;  4DRH B;  4C7O B;  1G8X A;  1OR3 A;  4BJT A;  3SNH A;  3FXH A;  1T6U A;  4YWQ A;  3C63 A;  1YVI A;  4XEF A;  5BQH A;  3UGO A;  4JEB A;  4WAB A;  1APC A;  1YJG A;  2KSF A;  3NMK A;  4NTA A;  2Q3T A;  2C03 A;  2LSE A;  3ZC4 A;  4CDY A;  4DOZ A;  1D1B A;  3JSE O;  3MFN A;  4CS9 A;  4IJJ A;  4IWB A;  2O9X A;  3QVZ A;  5AC5 A;  3X1O A;  4H54 A;  1ZW2 A;  2PP4 A;  3TUL A;  2R7X A;  256B A;  2YEV A;  2AWY A;  4U5C E;  2J9W A;  3QVY A;  1AEP A;  4NQF A;  2ZXP A;  1DOV A;  3KPH A;  3OA1 A;  3RYL A;  3U9J A;  2BL2 A;  2YL3 A;  1ZHT A;  5E3C A;  3IQT A;  3DZA A;  1ZZP A;  2J9U A;  2PFD A;  1MMA A;  1M56 C;  4PAC A;  2R7O A;  3O39 A;  3C7J A;  2EIN C;  4Q4Z F;  4JTD B;  4XEV A;  4D4X A;  5KYX A;  3CAX A;  1D0Y A;  1SYQ A;  1BR2 A;  2VB6 A;  2XLO A;  2J0W A;  1JPJ A;  3AQB A;  3K66 A;  4PJM A;  3M1C B;  4BJ5 A;  2VAS A;  2HJM A;  3IPM O;  1YA7 O;  4K1O A;  2BE5 F;  1PD1 A;  1O3U A;  1RKE A;  3IQ5 A;  4MS2 A;  4CIP A;  4N06 A;  1LM3 B;  2L6F A;  2P7V A;  3KL4 A;  3DM9 B;  3NMI A;  4AL1 A;  2I15 A;  1M2V B;  1VYI A;  4MQ9 F;  1NFN A;  3J06 A;  1T6I A;  3JSZ A;  2WZG A;  2LCH A;  2LFD A;  1YDI A;  3B9Q A;  3LJB A;  1EA8 A;  1V74 B;  3GAN A;  1TFO B;  1LVK A;  1R4T A;  2CGE A;  1WAS A;  3QW1 A;  5GPG B;  1TQG A;  4U5E E;  3CZ6 A;  4DVZ A;  1ZYR F;  3TOM A;  3LS0 A;  4JW1 A;  2J7P A;  1VYK A;  2YL0 A;  2XXA A;  2OJQ A;  4QI0 A;  2LQG A;  4C3E A;  4U9D A;  4XEK A;  2XL8 A;  3C62 A;  2YLG A;  3LS1 A;  4M63 A;  5KYY B;  5A6J A;  3EG9 A;  2OG2 A;  2Y3H A;  3PDM P;  4EHP A;  1UFB A;  1OXK A;  2Y3D A;  3FAJ A;  3UR3 C;  3W8H A;  1FFH A;  2G3K A;  2VCA A;  1NZE A;  1S7Z A;  1TWC A;  2F22 A;  2LFF A;  5AC4 A;  4JIO A;  4XLP F;  2R25 A;  1J8Y F;  1OCZ C;  1WAT A;  3T9O A;  5DQZ A;  3G4X A;  1WN0 A;  3RIP A;  3T6B A;  2WZL A;  3TQO A;  5JVE A;  4GYT A;  5L0H A;  1HW2 A;  4OIO F;  1A7D A;  2OJE D;  2NSG A;  3O10 A;  1WOL A;  3WAQ A;  4R32 A;  2XLM A;  3RQG A;  1E84 A;  1WGW A;  1R5I D;  4O6Y A;  4DRI B;  1LE4 A;  2ZXR A;  1OQC A;  4OD5 A;  1RMV A;  3HKK A;  4KC9 A;  4W8K A;  3JYH A;  3AG2 C;  4DJ9 A;  1QZX A;  3LEV A;  2YZS A;  2H8A A;  5A6A A;  2EPM X;  3G4Z A;  1E83 A;  1Z5Z A;  5E3A A;  2J7P D;  4W8P A;  2WB7 A;  5JT4 A;  3DXJ F;  3EH1 A;  1G4W R;  2BC5 A;  4JCZ A;  4WGY A;  1NLX A;  3RQE A;  2Q9C A;  3T6J A;  1Z6A A;  3FOO A;  4MVZ A;  2LIG A;  3K1I A;  2YL1 A;  3L1M A;  3PMR A;  4HFK B;  1QLE C;  3FAP B;  1YZC A;  4CS9 C;  1Q0D A;  1FMV A;  1ZU5 A;  4OIQ F;  2CDQ A;  3I5Q A;  3UMK A;  4O79 A;  2ASR A;  3RQF A;  3Q6N A;  3Q7G A;  1FMW A;  1D1A A;  2FGY A;  2R02 A;  3AQC A;  4HFF B;  5COG A;  3PHF 2;  3AG3 C;  4PJL A;  3SXY A;  1C02 A;  4NY3 A;  3OWT A;  2XLE A;  3JRT A;  1A7V A;  3AOU A;  3CQZ A;  3K6B A;  2IXP A;  4U5F E;  4OIN F;  4O6N A;  3U5S A;  2V26 A;  1SF8 A;  2Q00 A;  2XLD A;  3DAF A;  1HMD A;  3GEE A;  3US6 A;  3DKA A;  4OD4 A;  5KYW A;  1I4Z A;  1TWH A;  3DMD A;  1U0B B;  4KI2 A;  2NUP B;  5L0I A;  4PJJ A;  1NSG B;  3PCV A;  4YJW A;  1Z3I X;  3RW0 A;  2QY9 A;  3E9V A;  3R2P A;  2IOQ A;  4GQH A;  1LS1 A;  4XPY A;  4Z9H A;  3W2W A;  2P1A A;  3NMJ A;  3KKB A;  5AGF A;  3I5P A;  4IAO A;  4FWV A;  4WJ0 A;  4CDA A;  5F5F A;  3U8V A;  2HZ8 A;  3EGD A;  5TJ5 E;  1T01 A;  2IXM A;  5JSL A;  4BG0 A;  1JOG A;  2ZXO A;  4PJN A;  2JPU A;  2L6H A;  1Q0G A;  2YLD A;  4RDA A;  2H7O A;  2HSQ A;  3NRH A;  2Q7R A;  1H9T A;  4ULV A;  4IGG A;  1LI7 A;  2J9V A;  2IXN A;  3RF3 A;  2Y39 A;  3U8P A;  1I5N A;  2P6V A;  3SP1 A;  3JYY A;  4KNV A;  3JCU Q;  3ZVR A;  4LLC A;  3EPV A;  3EHN A;  4JVS A;  3EGX A;  2JD3 A;  2P61 A;  3W4Y A;  3GEI A;  2YRF A;  3CEX A;  1MND A;  2NUT A;  2EIJ C;  2UUI A;  3C8G A;  2DGJ A;  1HMO A;  3U2M A;  1YYJ A;  5JS5 A;  2LD6 A;  3ITF A;  3DJN B;  3TJ6 A;  4D4N A;  4B6I A;  2HKV A;  3M4B A;  4MVR A;  3S0X A;  2NSF A;  4IRU A;  4MTF A;  3VYW A;  1VLT A;  3DI5 A;  2Q4F A;  3TD7 A;  1SR2 A;  2DYS C;  2EIM C;  1T5O A;  3AGU A;  3RVY A;  4BEM J;  3FDQ A;  3O6X A;  4C3B A;  2HV7 A;  3N24 A;  4MTO A;  1CGO A;  4XWJ A;  1HE1 A;  1OKK A;  5JP7 A;  4CBE A;  4LDQ A;  4BJ1 A;  3K1H A;  1TFK B;  4I1O B;  5EGY A;  1GGQ A;  4CJO A;  3K1I C;  5BUO A;  4JC7 A;  1TKN A;  4J32 B;  1LKX A;  3QW0 A;  4XTK A;  5B1B C;  2W9Y A;  1D1C A;  2XSE A;  3C8Z A;  1C17 M;  1VLS A;  3HNL A;  2XLW A;  1OCO C;  3L8I A;  4RBN A;  2GFH A;  3I4U A;  3RH3 A;  2R7S A;  1D0X A;  3ZWI A;  1ZHX A;  4JCH A;  4E7S A;  5A6K A;  2AWC A;  3SYN A;  4AX2 A;  3C8G D;  3V5Z A;  1OCC C;  2A0U A;  1Q0K A;  4N6H A;  4AE4 B;  1F1M A;  3KH2 A;  1K04 A;  1TR2 A;  2WVQ A;  3AG1 C;  4YT2 A;  2KC3 A;  1XZQ A;  2OQM A;  5KYU A;  1NFO A;  1ORY A;  2KW3 C;  4PR9 A;  1E86 A;  1L3P A;  3FHD A;  1ZU4 A;  2GA0 A;  3LEO A;  4JE9 A;  5FZT A;  4U5H A;  4XPX A;  1MMD A;  5BQG A;  1CGM E;  1FR0 A;  4O7G A;  4FAP B;  3BRJ A;  2KK1 A;  4U9E A;  1LE2 A;  4IB4 A;  4EBK A;  2H7V C;  1ZHW A;  3JT1 A;  2PX3 A;  2KYH A;  3ECS A;  3F47 A;  1OKK D;  4C7O A;  2HS5 A;  3M15 A;  3S90 A;  4JEA A;  2XM4 A;  4LER A;  2IM8 A;  3ABK C;  3EFO B;  4MW8 A;  1IW7 F;  4NTF A;  3VAY A;  4OIP F;  4I44 A;  4QI2 A;  3NKE A;  4E7Z A;  3ABM C;  2YWA A;  3B29 A;  4F4B A;  2RSE B;  3LLI A;  4K7B A;  1DOW A;  1WTY A;  3GWL A;  4N4W A;  4ER9 A;  2D4U A;  4G7O F;  2HV6 A;  5E33 A;  5D91 A;  1MQV A;  4BJ6 A;  2V3C C;  2HMQ A;  1Q0F A;  2W4M A;  3FVY A;  5DS4 A;  3EH2 A;  3JTL O;  1O5H A;  1FFT C;  1U6H A;  2AP3 A;  2DB4 A;  1NU9 C;  2OKU A;  4EWC A;  2J45 A;  2Z15 A;  2M4E A;  3MYI A;  4BPM A;  3U9M A;  3ZQV A;  2B0J A;  2M64 A; 
#chains in the Genus database with same CATH homology
 1BZ4 A;  3R2P A;  1NFN A;  1EA8 A;  1GS9 A;  1LS4 A;  1OR2 A;  1LE4 A;  1AEP A;  1H7I A;  1B68 A;  1LPE A;  2KC3 A;  1NFO A;  1OR3 A;  1YA9 A;  3S84 A;  1EQ1 A;  1LE2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...