3T4RA

Lettuce necrotic yellow virus phosphoprotein c-terminal domain
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
72
structure length
72
Chain Sequence
RIRHEKEKLLADLDWEIGEIAQYTPLIVDFLVPDDILAMAADGLTPELKEKIQNEIIENHIALMALEEYSSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the C-terminal domain of lettuce necrotic yellows virus phosphoprotein.
pubmed doi rcsb
source organism Lettuce necrotic yellows virus
molecule tags Viral protein
molecule keywords Phosphoprotein
total genus 23
structure length 72
sequence length 72
ec nomenclature
pdb deposition date 2011-07-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1590 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3t4rA00
3T4RA
chains in the Genus database with same CATH superfamily
2A68F 4BJ5A 4M63A 1YYJA 1QQ3A 3SXZA 1T9KA 4D4NA 4CSAA 3IQ6A 1EA8A 1MQVA 5L0FA 3J06A 2B0JA 2AWYA 1BR1A 4EBBA 2L7AA 4YT8A 3LESA 5L0DA 1JMWA 3O55A 4K7BA 4U9DA 2QE9A 3ITFA 1G4WR 4KBLA 1MMDA 2YRFA 1EI7A 3JTLO 1A7EA 1WASA 3AQCA 3GORA 4K1OA 4U5EE 1FFHA 2NUTA 4YL0A 2L6HA 3ZVRA 5EHHA 2EIJC 4NCQA 2EILC 2R9RB 2Y39A 3AGUA 3QW1A 4HEAJ 4PFPA 2IXMA 4JTDB 4NTFA 1LI7A 2LIGA 5KYUB 1RMVA 2KK1A 1ORJA 4ULVA 4PJJA 3JZ0A 2VCAA 4YT5A 3A11A 2W9YA 4JJFA 1A7DA 4PFOA 1QSPA 1AVOB 2KW3C 3OWTA 1S7ZA 3JSEO 2FGYA 4MS2A 2P61A 3WODF 1UG7A 2IXNA 2ZXOA 4G78A 1K04A 2HJ3A 1LPEA 1VYIA 2ASRA 2F22A 3A9CA 3DXJF 2DGJA 3MYIA 5AC4A 2IBFA 4XLNF 4Q5SF 3AOUA 3TJ6A 1VYKA 1QKRA 4J30B 1ZZPA 5A6JA 2C04A 2L81A 1WN0A 2HUJA 3LEOA 1OW6A 1LE4A 2Q9AA 3L8JA 3DWWA 3MX3A 4ONSA 3V5YA 5F28E 1ZW3A 2NG1A 3S29A 4DRIB 1V4AA 4IARA 3EFOA 1MNEA 3DAFA 1BR2A 1OW8A 3ZQVA 1CPRA 1E2XA 1D1AA 1UFBA 4Q7CA 3FOPA 4LERA 3WHNA 3N2ZB 2YLDA 4Z9HA 3GM3A 3KPHA 4CX9A 3JCUQ 3RQGA 1LKXA 3M1CB 2WVNA 2Q3TA 3SXMA 2OG2A 3LLIA 2GAQA 2XM0A 1KNYA 1L7CA 3CAXA 3K1IA 4U9EA 4BPMA 3DE8A 2KYHA 2R7QA 2Y69C 4CS8A 2XSEA 2RD9A 1RKEA 1D1CA 5D92A 3GM1A 1OKKD 2DI3A 2LCHA 4CJGA 1Z7Qc 2OOCA 4FX5A 5K0IA 4BG0A 3DM5A 4NTAA 1WATA 3F46A 3S84A 4OIOF 1ZVZA 2LQGA 5L3QA 4EIYA 2VASA 5L0CA 1ST6A 3W2WA 1M6TA 1ZHZA 1XZQA 3N24A 3UMHA 3SP1A 3C62A 3TOLA 4AX2A 2A0BA 3S0XA 4MVOA 4OIRF 3BEHA 3BRJA 5DS5A 3C63A 3EQLF 5HV9A 4EWCA 3EGXB 4ZLDA 4PR9A 2J7PA 4DJ9A 1D0YA 1AUEA 1LS1A 2Y3BA 3JSZA 4NTBA 5KYXB 4LDRA 2LD6A 2B0HA 1Z5ZA 3MLGA 2L6FA 1ZW2A 3U3BA 3C8GA 2QLAA 3DKAA 1GM5A 2ZXRA 3W8HA 5T1DB 2A69F 4CS9A 5JLIA 1HW2A 3NKDA 3U9MA 2XL4A 1F1MA 2M64A 2XLWA 4N6CA 4U5FE 1E83A 4XWJA 3U2MA 1HMOA 1VK5A 1T5OA 2R7XA 2YVKA 1T6IA 4Z9IA 1TWAA 2IXOA 3K6BA 3ZG1A 1GGQA 5B3IA 3AG4C 3G50A 5COGA 5JSLA 2IXPA 3EPVA 2Y3HA 3HNIA 2BE5F 1YDIA 2I15A 2LK4A 5JS5A 5L0JA 1NSGB 3EG9A 2XXAB 2WZGA 3W8IA 4F4BA 5EGYA 1OKKA 1R4TA 2EPKX 2HKVA 3HLZA 5JRAA 1O3UA 1JAFA 1DOWA 1PV3A 2CNWD 4MVUA 3V5XA 2A1DD 2DYSC 3EGDB 4MVQA 1FMVA 1T01A 1Z63A 1M56C 2PNOA 4BJ6A 2H7OA 3M79A 5D91A 5DS4A 3W4YA 2P6VA 1Q0KA 1RKEB 1JR8A 5L3VA 2Y3DA 4MTOA 4XLPF 4A2NB 5AC5A 2EPOA 2EIMC 4N06A 4B6IA 2UUIA 4MNDA 1QLEC 3RKOF 3ATPA 3VAYA 4XPYA 4ANJA 5KYYB 1E85A 3K1IC 1TWGA 3B0PA 2GDCA 4NY3A 4CS8C 2Z15A 3C8GD 1C17M 2R7UA 1EQ1A 1Q0MA 3SZRA 2WL8A 4GQHA 1Z6AA 3CZ6A 2J9WA 3L8IA 3LEVA 4JEAA 1AEPA 4JEBA 1OQCA 4CIPA 1I5NA 1YYXA 4P6IC 4FWVA 5JVEA 1ZU4A 1YJGA 1I4YA 3U8VA 3ECSA 1Y6DA 2EPMX 4I1MA 3NDBB 5JUAA 2YL7A 4DXWA 5E33A 3Q7GA 3G4ZA 3FVYA 3RYLA 3JT1A 4I44A 4GYTA 1O87A 3O39A 3ZTMA 2RSEB 4G7ZF 1YVIA 4WGYA 1J8MF 5COFA 5HSWA 3DJNB 3GEHA 4WJ0A 1RXQA 4WABA 2NUTB 5F5HA 1Q0DA 1ZYRF 2A0UA 3AQBA 3QVYA 4OD5A 1RCPA 3I5QA 4AL1A 4CS9C 3MYFA 4JW1A 1TWHA 1ZHTA 3NMKA 1APCA 3GANA 4J32B 5KYUA 2HV7A 4EUKB 5A6BD 3EZIA 4FESA 1MMAA 2X0CA 4JIOA 1FR0A 2J0XA 2ZXPA 1HW1A 3DMDA 4E7ZA 1G4US 3AJMA 3DD7A 4U5GA 1D1BA 4G7OF 3DAGA 1WWPA 1BBHA 4PK4A 2R7SA 2KSFA 2GWWA 4DOZA 1H7IA 3LS0A 5BQIA 2WVQA 3C7JA 3FHDA 1K05A 1D0XA 4E0HA 1XWJA 3AGTA 1W2WA 1LM3B 1CGME 1WTYA 4BJ6C 2J9UA 3SNHA 4LDQA 4X0RA 3TK0A 1DOVA 1JRAA 1NG1A 2TMVP 4MVSA 2EINC 4PJLA 4RBNA 3TQOA 2O9XA 2D5RB 2Q00A 1IZMA 2YLIA 3QVZA 4IJJA 2YWAA 3IEEA 1VB5A 1ORSC 5B3SC 4E7SA 3X2QC 2BL2A 3U9JA 4LACB 1QPUA 2VH3A 2HFIA 3H2UA 2LP4A 3T4RA 4C3BA 2YL3A 1NZEA 2KNHA 3ABMC 3QMKA 2HV6A 2H8AA 1TFKB 1OW7A 1XZPA 1VLTA 2CNWA 3LS1A 3VF0A 2WB7A 2UUHA 3TJ5A 4E0IA 3Q6NA 4BEMJ 3SYNA 4JC7A 1MMGA 1QVXA 1TQGA 4DBRA 3FAJA 2OJED 4MW3A 4IAQA 2A6HF 4DRHB 3ZC4A 4JE9A 2VCBA 1VTMP 2C03A 3HJCA 2Y3GA 3DJUB 3M4CA 4CS7A 3IQTA 2YL0A 3C8ZA 1G5ZA 5EK0A 2NUPA 3NYJA 1GS9A 1PD0A 1SF8A 2LFFA 3V7OA 1HY5A 4ZLCA 3PHF2 2JX0A 1NLXA 2IOQA 3IHUA 3L0IA 2HSBA 5KYNA 5GPGB 3KH2A 3R2PA 4IAOA 1OCCC 2ZXWC 4DRJB 2I8BA 1SYQA 2CYDA 4HE8D 4ULWA 4LLEA 1A7VA 1KTMA 2XL6A 3FMSA 5BQGA 1WOLA 2XS8A 2KJGA 2QUPA 3AG1C 2PFDA 3PCVA 1FFTC 4U5CE 4EBKA 3HNLA 4C7OA 3C8GB 1E86A 2KQ9A 2BC5A 3F47A 2XLMA 3DE9A 4K0DA 3UMIA 1E84A 1O5HA 4YJWA 3S9OA 3S28A 3UNGC 2YKZA 4NQFA 1PCXA 3U8PA 3I5PA 2LFDA 3EHMA 4W8KA 3ASOC 4A4AA 4OIQF 1GQAA 1FMWA 2OKUA 4AE4A 3LLKA 2CGEA 4CDYA 1ZU5A 3T6BA 2OQMA 4C7OB 1Q0GA 3LJBA 3GODA 3KYJA 2R7RA 2ZPAA 3R7CA 4L6RA 4W8PA 4HFKB 3GWNA 1FNTc 3B0UX 2EIKC 4C3DA 5IY5C 2V26A 3Q7LA 1T6QA 3CSKA 2PX3A 3TD7A 3RQEA 4JZAA 2CCYA 4YWQA 3UGOA 5DQTA 4GEHA 2IM8A 2QNLA 4YK5A 1C03A 2LSEA 3ZWIA 1RJ9A 1YA9A 1TWCA 3JRMO 5E2QA 2MYSA 3UR3C 4U5BE 1EKYA 1HMDA 2OEVA 3DZAA 1FTSA 3B0VC 4XEKA 4OD4A 3TOMA 3CEXA 3K7DA 4IGGA 1JPNA 3H65A 5L0HA 5T3TA 3IQCA 2DB4A 4IRUA 4BJ1A 3UMKA 4PJMA 5KYYA 3X1OA 4U5DE 2YLGA 4U5HA 2CW0F 4KNWA 5JP7A 2NSGA 3WG7C 4AL0A 2P7VA 1OCRC 2D4UA 3DI5A 4O79A 4P9TA 3HKKA 2HSQA 4PJNA 4E17A 4CBEA 1L3PA 2FFHA 3VRCA 2J8WA 2H7BA 2AWCA 2JPUA 2QTVA 1ORYA 2HZ8A 2PF4E 4R32A 3S90A 1CPQA 4H54A 3FAPB 4G0HA 3SXKA 1YZAA 4RD9A 2AU5A 5CIVA 2XLOA 1TKNA 2J9VA 1M57C 2XLHA 3RQFA 1U6HA 4KC9A 1ZHYA 3RFYA 1LE2A 3EG9B 4EKWA 1NFOA 2XXAA 1K40A 3JYYA 3NG1A 4MQ9F 1R5ID 3V5ZA 5E3AA 4DBQA 1CGNA 2WZLA 4BEJA 3GM2A 2QY9A 1CGOA 4AE4B 3N0TA 4MW8A 2AP3A 4YL3A 2WVOA 2G3KA 3MFNA 4CDVA 4MVRA 2CDQA 1YAUO 4EHPA 2NSFA 4BJTA 5A69A 3FOOA 2R02A 2G3VA 1J8YF 1YARO 1M2OA 1TR2A 3JRTA 3OA1A 2PBEA 5FZTA 1G8XA 2L9JA 2MHRA 4O6NA 1JPJA 2OEXA 2GA0A 1OXKA 2Q9CA 3NMIA 3VM6A 1LI5A 2A6EF 3T9OA 1C02A 1RJ9B 1T6UA 2W4MA 3RVZA 1SMYF 4FAPB 2H7VC 3WAQA 2XLEA 3ZSUA 2JD3A 3KMIA 3NRHA 1PD1A 5BUOA 2Q7RA 1HE9A 5DLJA 1HE1A 5A6BA 2AVKA 4YT2A 2VCCA 5KYXA 3U2LA 1S05A 1U89A 2L6GA 4WGZA 5JT4A 3QZCA 4JTCB 1V74B 4Q4ZF 4EBJA 2NUPB 4H4KC 5BQHA 3TULA 4I3MA 3EHNA 2ETSA 5AGFA 2HMQA 3ZIBA 4E18A 3RF3A 4PACA 5CI9A 3GWLA 4ER9A 2VB6A 4NC3A 1V55C 3OEOA 1I4ZA 1VMAA 3T6JA 1BDJB 2YHSA 4N4WA 4XEFA 1Y4CA 2YQYA 3E9VA 3I4UA 1RKCA 2DYRC 2NPUA 1H9GA 4HFFB 4J7TA 4JCZA 2FAPB 3UGPA 4IWBA 1OXBA 2GFHA 3W2VA 4LDKA 3G4XA 2HJMA 2XS1A 3B29A 3KL4A 1ZHXA 3PMRA 1NBBA 3SEOA 2EPLX 1FAPB 3QW0A 3H2VA 4JKVA 2ZD9A 1VLSA 1BZ4A 3U0CA 1U0BB 4IB4A 1A41A 4I1OB 2W4BA 2R05A 1JOGA 4JCHA 4JURI 1H6GA 3LUTB 4MVZA 1OR2A 4YT4A 3CQZA 3RVYA 2YL1A 4QI2A 3IPMO 4OINF 5B1BC 1Z23A 2WZFA 1Q0FA 1OCOC 2E87A 2IYLD 3NYMA 3Q6MA 4MTFA 3U3FA 2OJQA 3LNMB 2J7PD 2V3CC 4J7YA 3K1HA 3T6GB 4XPWA 2M4EA 3RIPA 3ZTZA 3EH2A 2XL8A 3U5SA 3GEEA 4BJ5C 2W45A 4D4XA 2G62A 4CSAC 2ICWG 3M15A 3ABLC 1H9TA 1M2VB 4KNVA 5L0IA 3EGXA 2OCCC 1D0ZA 3EJNA 1ZHWA 2R7WA 5FCLA 3FDQA 1TFOB 2EPNA 4OIPF 3QTHA 2XLDA 4MTGA 2R7VA 1IW7F 2OU6A 2P1AA 3GEIA 3MBGA 1NU9C 2Q4FA 3LNRA 3O10A 4JJGA 1NFNA 5A6KA 4LLCA 5DS6A 4C3EA 2PP4A 3ZDLA 2XLVA 4YL1A 5DVWA 3K66A 1LS4A 1KU2A 4JVSA 3POVA 1WGWA 1B68A 4JRZA 2R7TA 3EH1A 1QZXA 1OCZC 5DQZA 3KKBA 3RW0A 2J46A 3JYHA 3B71A 3NMJA 2R25A 3B9QA 4DVZA 3C18A 4XPXA 4AK9A 4UDVA 4P9FA 1N1CA 1MMNA 3NKEA 4O6YA 1LVKA 2R7OA 1YZCA 3M4BA 5L0GA 3LAYA 1OR3A 4JTAB 3US6A 3NYLA 5F5FA 2MWQA 3ASNC 3EGDA 3RH3A 3O6XA 2KC3A 4O7GA 5T3WA 2Q9BA 4O6MA 3AG2C 5COMA 4Z9JA 4XTKA 4G7HF 1MNDA 2HMZA 4YN0B 3PDMP 4XQ1A 3KYIA 1LIHA 5KYWB 4N6HA 1YA7O 3SXYA 1V54C 4QI0A 3K33A 4MVMA 2J0WA 2YEVA 1Z3IX 3S27A 1NU7D 5A6AA 5B1AC 1A0BA 4DVYP 3FXHA 1YLMA 2YZSA 5E3CA 3L34A 1VOMA 3HTKC 1SR2A 2XRHA 256BA 3HNKA 4QDLA 2VC9A 4XEVA 4KI2A 1M2VA 5CI8A 3E70C 5KYWA 3AG3C 2XM4A 2R03A 3HNJA 3L1MA 5TJ5E 3IQ5A 4CIHA 2HS5A 3VYWA 1SZIA 3ABKC 2J45A 3EZHA 3EFOB 3DM9B 2J9BA 2P0NA 4CJOA 1BR4A 4CDAA 2X51A 4RDAA 3ZQYA 2KGOA 2PX0A
chains in the Genus database with same CATH topology
2A68F 4BJ5A 4M63A 4CSAA 2B0JA 1BR1A 4YT8A 3LESA 4K7BA 3ITFA 4KBLA 1MMDA 4U5EE 2NUTA 3AQCA 1FFHA 5EHHA 3ZVRA 2EIJC 2EILC 2Y39A 4HEAJ 4PFPA 2IXMA 5KYUB 4PJJA 4YT5A 4JJFA 2W9YA 4PFOA 2KW3C 3OWTA 1S7ZA 2FGYA 3WODF 2IXNA 2ZXOA 1VYIA 3DXJF 2DGJA 4XLNF 4Q5SF 1VYKA 4J30B 2C04A 2L81A 2Q9AA 3MX3A 2NG1A 3S29A 3EFOA 1MNEA 3DAFA 1BR2A 1D1AA 4Q7CA 4LERA 3N2ZB 3JCUQ 3M1CB 1LKXA 2WVNA 2Q3TA 2OG2A 3LLIA 4CS8A 2R7QA 2Y69C 2XSEA 1D1CA 5D92A 1OKKD 4FX5A 4BG0A 3DM5A 3F46A 4OIOF 5L3QA 2VASA 1ST6A 3W2WA 1ZHZA 3N24A 3UMHA 3SP1A 4AX2A 3S0XA 4OIRF 5DS5A 3EQLF 4ZLDA 4EWCA 3EGXB 2J7PA 1D0YA 1LS1A 2Y3BA 3JSZA 1Z5ZA 3MLGA 2ZXRA 3W8HA 5T1DB 2A69F 4CS9A 3NKDA 2XL4A 4U5FE 4XWJA 1VK5A 2R7XA 1TWAA 2IXOA 3K6BA 3ZG1A 3AG4C 2IXPA 3EPVA 2Y3HA 2BE5F 3EG9A 2XXAB 2WZGA 3W8IA 4F4BA 5EGYA 1OKKA 3HLZA 2CNWD 2A1DD 2DYSC 3EGDB 1Z63A 1FMVA 1M56C 4BJ6A 2H7OA 5D91A 5DS4A 2P6VA 5L3VA 2Y3DA 4XLPF 4A2NB 2EIMC 4N06A 4B6IA 4MNDA 1QLEC 3RKOF 3VAYA 4ANJA 5KYYB 3K1IC 1TWGA 3B0PA 4NY3A 4CS8C 2Z15A 2R7UA 3SZRA 2WL8A 1Z6AA 3CZ6A 2J9WA 3LEVA 4P6IC 4FWVA 1ZU4A 3ECSA 4I1MA 3NDBB 5E33A 3Q7GA 3FVYA 3RYLA 3JT1A 4I44A 4GYTA 1O87A 3O39A 4G7ZF 1J8MF 5HSWA 3DJNB 4WJ0A 2NUTB 5F5HA 4CS9C 1ZYRF 3AQBA 4OD5A 3I5QA 4JW1A 1ZHTA 1TWHA 3GANA 4J32B 5KYUA 2HV7A 3EZIA 4FESA 1MMAA 2J0XA 2ZXPA 3DMDA 4E7ZA 3DD7A 4U5GA 1D1BA 4G7OF 3DAGA 2R7SA 4PK4A 4DOZA 3LS0A 2WVQA 3FHDA 1D0XA 1W2WA 4BJ6C 2J9UA 3SNHA 4X0RA 1NG1A 2EINC 4PJLA 4RBNA 2O9XA 2D5RB 1IZMA 4IJJA 3IEEA 5B3SC 4E7SA 3X2QC 4LACB 4C3BA 2VH3A 3T4RA 1NZEA 2KNHA 3ABMC 3QMKA 2CNWA 2HV6A 4EBBA 3LS1A 2WB7A 3Q6NA 3SYNA 1MMGA 4DBRA 3FAJA 2A6HF 3ZC4A 2C03A 3HJCA 2Y3GA 3DJUB 4CS7A 2NUPA 3NYJA 1PD0A 1SF8A 3V7OA 4ZLCA 3PHF2 3L0IA 2IOQA 5KYNA 3KH2A 4IAOA 1OCCC 2ZXWC 2I8BA 4HE8D 2KGOA 4ULWA 4LLEA 2KJGA 3AG1C 2PFDA 1FFTC 4U5CE 4C7OA 2KQ9A 3F47A 4K0DA 3UMIA 1O5HA 4YJWA 3S28A 3UNGC 1PCXA 3I5PA 3EHMA 4W8KA 4OIQF 3ASOC 1FMWA 4AE4A 3LLKA 2CGEA 1ZU5A 3T6BA 4C7OB 3LJBA 3GODA 2R7RA 2ZPAA 4HFKB 3B0UX 2EIKC 4C3DA 5IY5C 2V26A 3Q7LA 3CSKA 2PX3A 3TD7A 4YWQA 4JZAA 3UGOA 5DQTA 4GEHA 2LSEA 1RJ9A 1TWCA 5E2QA 2MYSA 3UR3C 4U5BE 3DZAA 1FTSA 3B0VC 4OD4A 3K7DA 1JPNA 3H65A 5T3TA 4IRUA 4BJ1A 3UMKA 4PJMA 5KYYA 3X1OA 4U5DE 3WG7C 4U5HA 2CW0F 4KNWA 2P7VA 1OCRC 4O79A 4PJNA 4CBEA 2FFHA 2H7BA 2QTVA 2PF4E 4G0HA 4RD9A 1TKNA 2J9VA 1M57C 4KC9A 1ZHYA 3RFYA 3EG9B 2XXAA 3NG1A 4MQ9F 4DBQA 5E3AA 2WZLA 4BEJA 4AE4B 2QY9A 3N0TA 2WVOA 2G3KA 2CDQA 4BJTA 2G3VA 1J8YF 1M2OA 1TR2A 3JRTA 3OA1A 5KYXB 1G8XA 2L9JA 4O6NA 1JPJA 2Q9CA 2A6EF 1RJ9B 2W4MA 1SMYF 2H7VC 3ZSUA 3NRHA 3KMIA 2JD3A 1PD1A 5BUOA 5DLJA 4YT2A 5KYXA 3QZCA 4Q4ZF 2NUPB 4H4KC 4I3MA 3EHNA 3ZIBA 5CI9A 2VB6A 1V55C 3OEOA 3T6JA 1VMAA 2YHSA 3E9VA 3I4UA 2DYRC 4HFFB 3UGPA 4IWBA 2GFHA 3W2VA 3KL4A 1ZHXA 3PMRA 3SEOA 4I1OB 2W4BA 4JURI 4JCHA 4YT4A 4QI2A 3CQZA 4OINF 5B1BC 1Z23A 2WZFA 3Q6MA 1OCOC 2E87A 2IYLD 3NYMA 2J7PD 2V3CC 3K1HA 3RIPA 2M4EA 3EH2A 4BJ5C 2W45A 2G62A 4CSAC 3ABLC 1M2VB 4KNVA 3EGXA 2OCCC 1D0ZA 1ZHWA 2R7WA 5FCLA 3FDQA 4OIPF 2R7VA 1IW7F 1NU9C 3LNRA 4JJGA 4LLCA 5DS6A 4C3EA 2PP4A 5DVWA 3K66A 3POVA 1KU2A 4JVSA 1WGWA 2R7TA 3EH1A 1QZXA 1OCZC 5DQZA 3KKBA 2J46A 3JYHA 3B9QA 4DVZA 4AK9A 1N1CA 1MMNA 3NKEA 4O6YA 1LVKA 2R7OA 3LAYA 3NYLA 5F5FA 2MWQA 3ASNC 3EGDA 3RH3A 3O6XA 4O7GA 5T3WA 4G7HF 2Q9BA 4O6MA 3AG2C 4XTKA 1MNDA 4YN0B 5KYWB 1V54C 4QI0A 3K33A 2J0WA 2YEVA 1Z3IX 3S27A 1NU7D 5B1AC 4DVYP 2YZSA 5E3CA 3L34A 1VOMA 3HTKC 2XRHA 4QDLA 4KI2A 1M2VA 5CI8A 3E70C 5KYWA 3AG3C 4CIHA 3VYWA 1SZIA 3ABKC 2J45A 3EZHA 3EFOB 3DM9B 1BR4A 2X51A 4RDAA 3EJNA 2PX0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T4R A; 
#chains in the Genus database with same CATH topology
 2A68 F;  4BJ5 A;  4M63 A;  1YYJ A;  1QQ3 A;  3SXZ A;  1T9K A;  4D4N A;  4CSA A;  3IQ6 A;  1EA8 A;  1MQV A;  5L0F A;  3J06 A;  2B0J A;  2AWY A;  1BR1 A;  4EBB A;  2L7A A;  4YT8 A;  3LES A;  5L0D A;  1JMW A;  3O55 A;  4K7B A;  4U9D A;  2QE9 A;  3ITF A;  1G4W R;  4KBL A;  1MMD A;  2YRF A;  1EI7 A;  3JTL O;  1A7E A;  1WAS A;  3AQC A;  3GOR A;  4K1O A;  4U5E E;  1FFH A;  2NUT A;  4YL0 A;  2L6H A;  3ZVR A;  5EHH A;  2EIJ C;  4NCQ A;  2EIL C;  2R9R B;  2Y39 A;  3AGU A;  3QW1 A;  4HEA J;  4PFP A;  2IXM A;  4JTD B;  4NTF A;  1LI7 A;  2LIG A;  5KYU B;  1RMV A;  2KK1 A;  1ORJ A;  4ULV A;  4PJJ A;  3JZ0 A;  2VCA A;  4YT5 A;  3A11 A;  2W9Y A;  4JJF A;  1A7D A;  4PFO A;  1QSP A;  1AVO B;  2KW3 C;  3OWT A;  1S7Z A;  3JSE O;  2FGY A;  4MS2 A;  2P61 A;  3WOD F;  1UG7 A;  2IXN A;  2ZXO A;  4G78 A;  1K04 A;  2HJ3 A;  1LPE A;  1VYI A;  2ASR A;  2F22 A;  3A9C A;  3DXJ F;  2DGJ A;  3MYI A;  5AC4 A;  2IBF A;  4XLN F;  4Q5S F;  3AOU A;  3TJ6 A;  1VYK A;  1QKR A;  4J30 B;  1ZZP A;  5A6J A;  2C04 A;  2L81 A;  1WN0 A;  2HUJ A;  3LEO A;  1OW6 A;  1LE4 A;  2Q9A A;  3L8J A;  3DWW A;  3MX3 A;  4ONS A;  3V5Y A;  5F28 E;  1ZW3 A;  2NG1 A;  3S29 A;  4DRI B;  1V4A A;  4IAR A;  3EFO A;  1MNE A;  3DAF A;  1BR2 A;  1OW8 A;  3ZQV A;  1CPR A;  1E2X A;  1D1A A;  1UFB A;  4Q7C A;  3FOP A;  4LER A;  3WHN A;  3N2Z B;  2YLD A;  4Z9H A;  3GM3 A;  3KPH A;  4CX9 A;  3JCU Q;  3RQG A;  1LKX A;  3M1C B;  2WVN A;  2Q3T A;  3SXM A;  2OG2 A;  3LLI A;  2GAQ A;  2XM0 A;  1KNY A;  1L7C A;  3CAX A;  3K1I A;  4U9E A;  4BPM A;  3DE8 A;  2KYH A;  2R7Q A;  2Y69 C;  4CS8 A;  2XSE A;  2RD9 A;  1RKE A;  1D1C A;  5D92 A;  3GM1 A;  1OKK D;  2DI3 A;  2LCH A;  4CJG A;  1Z7Q c;  2OOC A;  4FX5 A;  5K0I A;  4BG0 A;  3DM5 A;  4NTA A;  1WAT A;  3F46 A;  3S84 A;  4OIO F;  1ZVZ A;  2LQG A;  5L3Q A;  4EIY A;  2VAS A;  5L0C A;  1ST6 A;  3W2W A;  1M6T A;  1ZHZ A;  1XZQ A;  3N24 A;  3UMH A;  3SP1 A;  3C62 A;  3TOL A;  4AX2 A;  2A0B A;  3S0X A;  4MVO A;  4OIR F;  3BEH A;  3BRJ A;  5DS5 A;  3C63 A;  3EQL F;  5HV9 A;  4EWC A;  3EGX B;  4ZLD A;  4PR9 A;  2J7P A;  4DJ9 A;  1D0Y A;  1AUE A;  1LS1 A;  2Y3B A;  3JSZ A;  4NTB A;  5KYX B;  4LDR A;  2LD6 A;  2B0H A;  1Z5Z A;  3MLG A;  2L6F A;  1ZW2 A;  3U3B A;  3C8G A;  2QLA A;  3DKA A;  1GM5 A;  2ZXR A;  3W8H A;  5T1D B;  2A69 F;  4CS9 A;  5JLI A;  1HW2 A;  3NKD A;  3U9M A;  2XL4 A;  1F1M A;  2M64 A;  2XLW A;  4N6C A;  4U5F E;  1E83 A;  4XWJ A;  3U2M A;  1HMO A;  1VK5 A;  1T5O A;  2R7X A;  2YVK A;  1T6I A;  4Z9I A;  1TWA A;  2IXO A;  3K6B A;  3ZG1 A;  1GGQ A;  5B3I A;  3AG4 C;  3G50 A;  5COG A;  5JSL A;  2IXP A;  3EPV A;  2Y3H A;  3HNI A;  2BE5 F;  1YDI A;  2I15 A;  2LK4 A;  5JS5 A;  5L0J A;  1NSG B;  3EG9 A;  2XXA B;  2WZG A;  3W8I A;  4F4B A;  5EGY A;  1OKK A;  1R4T A;  2EPK X;  2HKV A;  3HLZ A;  5JRA A;  1O3U A;  1JAF A;  1DOW A;  1PV3 A;  2CNW D;  4MVU A;  3V5X A;  2A1D D;  2DYS C;  3EGD B;  4MVQ A;  1FMV A;  1T01 A;  1Z63 A;  1M56 C;  2PNO A;  4BJ6 A;  2H7O A;  3M79 A;  5D91 A;  5DS4 A;  3W4Y A;  2P6V A;  1Q0K A;  1RKE B;  1JR8 A;  5L3V A;  2Y3D A;  4MTO A;  4XLP F;  4A2N B;  5AC5 A;  2EPO A;  2EIM C;  4N06 A;  4B6I A;  2UUI A;  4MND A;  1QLE C;  3RKO F;  3ATP A;  3VAY A;  4XPY A;  4ANJ A;  5KYY B;  1E85 A;  3K1I C;  1TWG A;  3B0P A;  2GDC A;  4NY3 A;  4CS8 C;  2Z15 A;  3C8G D;  1C17 M;  2R7U A;  1EQ1 A;  1Q0M A;  3SZR A;  2WL8 A;  4GQH A;  1Z6A A;  3CZ6 A;  2J9W A;  3L8I A;  3LEV A;  4JEA A;  1AEP A;  4JEB A;  1OQC A;  4CIP A;  1I5N A;  1YYX A;  4P6I C;  4FWV A;  5JVE A;  1ZU4 A;  1YJG A;  1I4Y A;  3U8V A;  3ECS A;  1Y6D A;  2EPM X;  4I1M A;  3NDB B;  5JUA A;  2YL7 A;  4DXW A;  5E33 A;  3Q7G A;  3G4Z A;  3FVY A;  3RYL A;  3JT1 A;  4I44 A;  4GYT A;  1O87 A;  3O39 A;  3ZTM A;  2RSE B;  4G7Z F;  1YVI A;  4WGY A;  1J8M F;  5COF A;  5HSW A;  3DJN B;  3GEH A;  4WJ0 A;  1RXQ A;  4WAB A;  2NUT B;  5F5H A;  1Q0D A;  1ZYR F;  2A0U A;  3AQB A;  3QVY A;  4OD5 A;  1RCP A;  3I5Q A;  4AL1 A;  4CS9 C;  3MYF A;  4JW1 A;  1TWH A;  1ZHT A;  3NMK A;  1APC A;  3GAN A;  4J32 B;  5KYU A;  2HV7 A;  4EUK B;  5A6B D;  3EZI A;  4FES A;  1MMA A;  2X0C A;  4JIO A;  1FR0 A;  2J0X A;  2ZXP A;  1HW1 A;  3DMD A;  4E7Z A;  1G4U S;  3AJM A;  3DD7 A;  4U5G A;  1D1B A;  4G7O F;  3DAG A;  1WWP A;  1BBH A;  4PK4 A;  2R7S A;  2KSF A;  2GWW A;  4DOZ A;  1H7I A;  3LS0 A;  5BQI A;  2WVQ A;  3C7J A;  3FHD A;  1K05 A;  1D0X A;  4E0H A;  1XWJ A;  3AGT A;  1W2W A;  1LM3 B;  1CGM E;  1WTY A;  4BJ6 C;  2J9U A;  3SNH A;  4LDQ A;  4X0R A;  3TK0 A;  1DOV A;  1JRA A;  1NG1 A;  2TMV P;  4MVS A;  2EIN C;  4PJL A;  4RBN A;  3TQO A;  2O9X A;  2D5R B;  2Q00 A;  1IZM A;  2YLI A;  3QVZ A;  4IJJ A;  2YWA A;  3IEE A;  1VB5 A;  1ORS C;  5B3S C;  4E7S A;  3X2Q C;  2BL2 A;  3U9J A;  4LAC B;  1QPU A;  2VH3 A;  2HFI A;  3H2U A;  2LP4 A;  3T4R A;  4C3B A;  2YL3 A;  1NZE A;  2KNH A;  3ABM C;  3QMK A;  2HV6 A;  2H8A A;  1TFK B;  1OW7 A;  1XZP A;  1VLT A;  2CNW A;  3LS1 A;  3VF0 A;  2WB7 A;  2UUH A;  3TJ5 A;  4E0I A;  3Q6N A;  4BEM J;  3SYN A;  4JC7 A;  1MMG A;  1QVX A;  1TQG A;  4DBR A;  3FAJ A;  2OJE D;  4MW3 A;  4IAQ A;  2A6H F;  4DRH B;  3ZC4 A;  4JE9 A;  2VCB A;  1VTM P;  2C03 A;  3HJC A;  2Y3G A;  3DJU B;  3M4C A;  4CS7 A;  3IQT A;  2YL0 A;  3C8Z A;  1G5Z A;  5EK0 A;  2NUP A;  3NYJ A;  1GS9 A;  1PD0 A;  1SF8 A;  2LFF A;  3V7O A;  1HY5 A;  4ZLC A;  3PHF 2;  2JX0 A;  1NLX A;  2IOQ A;  3IHU A;  3L0I A;  2HSB A;  5KYN A;  5GPG B;  3KH2 A;  3R2P A;  4IAO A;  1OCC C;  2ZXW C;  4DRJ B;  2I8B A;  1SYQ A;  2CYD A;  4HE8 D;  4ULW A;  4LLE A;  1A7V A;  1KTM A;  2XL6 A;  3FMS A;  5BQG A;  1WOL A;  2XS8 A;  2KJG A;  2QUP A;  3AG1 C;  2PFD A;  3PCV A;  1FFT C;  4U5C E;  4EBK A;  3HNL A;  4C7O A;  3C8G B;  1E86 A;  2KQ9 A;  2BC5 A;  3F47 A;  2XLM A;  3DE9 A;  4K0D A;  3UMI A;  1E84 A;  1O5H A;  4YJW A;  3S9O A;  3S28 A;  3UNG C;  2YKZ A;  4NQF A;  1PCX A;  3U8P A;  3I5P A;  2LFD A;  3EHM A;  4W8K A;  3ASO C;  4A4A A;  4OIQ F;  1GQA A;  1FMW A;  2OKU A;  4AE4 A;  3LLK A;  2CGE A;  4CDY A;  1ZU5 A;  3T6B A;  2OQM A;  4C7O B;  1Q0G A;  3LJB A;  3GOD A;  3KYJ A;  2R7R A;  2ZPA A;  3R7C A;  4L6R A;  4W8P A;  4HFK B;  3GWN A;  1FNT c;  3B0U X;  2EIK C;  4C3D A;  5IY5 C;  2V26 A;  3Q7L A;  1T6Q A;  3CSK A;  2PX3 A;  3TD7 A;  3RQE A;  4JZA A;  2CCY A;  4YWQ A;  3UGO A;  5DQT A;  4GEH A;  2IM8 A;  2QNL A;  4YK5 A;  1C03 A;  2LSE A;  3ZWI A;  1RJ9 A;  1YA9 A;  1TWC A;  3JRM O;  5E2Q A;  2MYS A;  3UR3 C;  4U5B E;  1EKY A;  1HMD A;  2OEV A;  3DZA A;  1FTS A;  3B0V C;  4XEK A;  4OD4 A;  3TOM A;  3CEX A;  3K7D A;  4IGG A;  1JPN A;  3H65 A;  5L0H A;  5T3T A;  3IQC A;  2DB4 A;  4IRU A;  4BJ1 A;  3UMK A;  4PJM A;  5KYY A;  3X1O A;  4U5D E;  2YLG A;  4U5H A;  2CW0 F;  4KNW A;  5JP7 A;  2NSG A;  3WG7 C;  4AL0 A;  2P7V A;  1OCR C;  2D4U A;  3DI5 A;  4O79 A;  4P9T A;  3HKK A;  2HSQ A;  4PJN A;  4E17 A;  4CBE A;  1L3P A;  2FFH A;  3VRC A;  2J8W A;  2H7B A;  2AWC A;  2JPU A;  2QTV A;  1ORY A;  2HZ8 A;  2PF4 E;  4R32 A;  3S90 A;  1CPQ A;  4H54 A;  3FAP B;  4G0H A;  3SXK A;  1YZA A;  4RD9 A;  2AU5 A;  5CIV A;  2XLO A;  1TKN A;  2J9V A;  1M57 C;  2XLH A;  3RQF A;  1U6H A;  4KC9 A;  1ZHY A;  3RFY A;  1LE2 A;  3EG9 B;  4EKW A;  1NFO A;  2XXA A;  1K40 A;  3JYY A;  3NG1 A;  4MQ9 F;  1R5I D;  3V5Z A;  5E3A A;  4DBQ A;  1CGN A;  2WZL A;  4BEJ A;  3GM2 A;  2QY9 A;  1CGO A;  4AE4 B;  3N0T A;  4MW8 A;  2AP3 A;  4YL3 A;  2WVO A;  2G3K A;  3MFN A;  4CDV A;  4MVR A;  2CDQ A;  1YAU O;  4EHP A;  2NSF A;  4BJT A;  5A69 A;  3FOO A;  2R02 A;  2G3V A;  1J8Y F;  1YAR O;  1M2O A;  1TR2 A;  3JRT A;  3OA1 A;  2PBE A;  5FZT A;  1G8X A;  2L9J A;  2MHR A;  4O6N A;  1JPJ A;  2OEX A;  2GA0 A;  1OXK A;  2Q9C A;  3NMI A;  3VM6 A;  1LI5 A;  2A6E F;  3T9O A;  1C02 A;  1RJ9 B;  1T6U A;  2W4M A;  3RVZ A;  1SMY F;  4FAP B;  2H7V C;  3WAQ A;  2XLE A;  3ZSU A;  2JD3 A;  3KMI A;  3NRH A;  1PD1 A;  5BUO A;  2Q7R A;  1HE9 A;  5DLJ A;  1HE1 A;  5A6B A;  2AVK A;  4YT2 A;  2VCC A;  5KYX A;  3U2L A;  1S05 A;  1U89 A;  2L6G A;  4WGZ A;  5JT4 A;  3QZC A;  4JTC B;  1V74 B;  4Q4Z F;  4EBJ A;  2NUP B;  4H4K C;  5BQH A;  3TUL A;  4I3M A;  3EHN A;  2ETS A;  5AGF A;  2HMQ A;  3ZIB A;  4E18 A;  3RF3 A;  4PAC A;  5CI9 A;  3GWL A;  4ER9 A;  2VB6 A;  4NC3 A;  1V55 C;  3OEO A;  1I4Z A;  1VMA A;  3T6J A;  1BDJ B;  2YHS A;  4N4W A;  4XEF A;  1Y4C A;  2YQY A;  3E9V A;  3I4U A;  1RKC A;  2DYR C;  2NPU A;  1H9G A;  4HFF B;  4J7T A;  4JCZ A;  2FAP B;  3UGP A;  4IWB A;  1OXB A;  2GFH A;  3W2V A;  4LDK A;  3G4X A;  2HJM A;  2XS1 A;  3B29 A;  3KL4 A;  1ZHX A;  3PMR A;  1NBB A;  3SEO A;  2EPL X;  1FAP B;  3QW0 A;  3H2V A;  4JKV A;  2ZD9 A;  1VLS A;  1BZ4 A;  3U0C A;  1U0B B;  4IB4 A;  1A41 A;  4I1O B;  2W4B A;  2R05 A;  1JOG A;  4JCH A;  4JUR I;  1H6G A;  3LUT B;  4MVZ A;  1OR2 A;  4YT4 A;  3CQZ A;  3RVY A;  2YL1 A;  4QI2 A;  3IPM O;  4OIN F;  5B1B C;  1Z23 A;  2WZF A;  1Q0F A;  1OCO C;  2E87 A;  2IYL D;  3NYM A;  3Q6M A;  4MTF A;  3U3F A;  2OJQ A;  3LNM B;  2J7P D;  2V3C C;  4J7Y A;  3K1H A;  3T6G B;  4XPW A;  2M4E A;  3RIP A;  3ZTZ A;  3EH2 A;  2XL8 A;  3U5S A;  3GEE A;  4BJ5 C;  2W45 A;  4D4X A;  2G62 A;  4CSA C;  2ICW G;  3M15 A;  3ABL C;  1H9T A;  1M2V B;  4KNV A;  5L0I A;  3EGX A;  2OCC C;  1D0Z A;  3EJN A;  1ZHW A;  2R7W A;  5FCL A;  3FDQ A;  1TFO B;  2EPN A;  4OIP F;  3QTH A;  2XLD A;  4MTG A;  2R7V A;  1IW7 F;  2OU6 A;  2P1A A;  3GEI A;  3MBG A;  1NU9 C;  2Q4F A;  3LNR A;  3O10 A;  4JJG A;  1NFN A;  5A6K A;  4LLC A;  5DS6 A;  4C3E A;  2PP4 A;  3ZDL A;  2XLV A;  4YL1 A;  5DVW A;  3K66 A;  1LS4 A;  1KU2 A;  4JVS A;  3POV A;  1WGW A;  1B68 A;  4JRZ A;  2R7T A;  3EH1 A;  1QZX A;  1OCZ C;  5DQZ A;  3KKB A;  3RW0 A;  2J46 A;  3JYH A;  3B71 A;  3NMJ A;  2R25 A;  3B9Q A;  4DVZ A;  3C18 A;  4XPX A;  4AK9 A;  4UDV A;  4P9F A;  1N1C A;  1MMN A;  3NKE A;  4O6Y A;  1LVK A;  2R7O A;  1YZC A;  3M4B A;  5L0G A;  3LAY A;  1OR3 A;  4JTA B;  3US6 A;  3NYL A;  5F5F A;  2MWQ A;  3ASN C;  3EGD A;  3RH3 A;  3O6X A;  2KC3 A;  4O7G A;  5T3W A;  2Q9B A;  4O6M A;  3AG2 C;  5COM A;  4Z9J A;  4XTK A;  4G7H F;  1MND A;  2HMZ A;  4YN0 B;  3PDM P;  4XQ1 A;  3KYI A;  1LIH A;  5KYW B;  4N6H A;  1YA7 O;  3SXY A;  1V54 C;  4QI0 A;  3K33 A;  4MVM A;  2J0W A;  2YEV A;  1Z3I X;  3S27 A;  1NU7 D;  5A6A A;  5B1A C;  1A0B A;  4DVY P;  3FXH A;  1YLM A;  2YZS A;  5E3C A;  3L34 A;  1VOM A;  3HTK C;  1SR2 A;  2XRH A;  256B A;  3HNK A;  4QDL A;  2VC9 A;  4XEV A;  4KI2 A;  1M2V A;  5CI8 A;  3E70 C;  5KYW A;  3AG3 C;  2XM4 A;  2R03 A;  3HNJ A;  3L1M A;  5TJ5 E;  3IQ5 A;  4CIH A;  2HS5 A;  3VYW A;  1SZI A;  3ABK C;  2J45 A;  3EZH A;  3EFO B;  3DM9 B;  2J9B A;  2P0N A;  4CJO A;  1BR4 A;  4CDA A;  2X51 A;  4RDA A;  3ZQY A;  2KGO A;  2PX0 A; 
#chains in the Genus database with same CATH homology
 2A68 F;  4BJ5 A;  4M63 A;  4CSA A;  2B0J A;  1BR1 A;  4YT8 A;  3LES A;  4K7B A;  3ITF A;  4KBL A;  1MMD A;  4U5E E;  2NUT A;  3AQC A;  1FFH A;  5EHH A;  3ZVR A;  2EIJ C;  2EIL C;  2Y39 A;  4HEA J;  4PFP A;  2IXM A;  5KYU B;  4PJJ A;  4YT5 A;  4JJF A;  2W9Y A;  4PFO A;  2KW3 C;  3OWT A;  1S7Z A;  2FGY A;  3WOD F;  2IXN A;  2ZXO A;  1VYI A;  3DXJ F;  2DGJ A;  4XLN F;  4Q5S F;  1VYK A;  4J30 B;  2C04 A;  2L81 A;  2Q9A A;  3MX3 A;  2NG1 A;  3S29 A;  3EFO A;  1MNE A;  3DAF A;  1BR2 A;  1D1A A;  4Q7C A;  4LER A;  3N2Z B;  3JCU Q;  3M1C B;  1LKX A;  2WVN A;  2Q3T A;  2OG2 A;  3LLI A;  4CS8 A;  2R7Q A;  2Y69 C;  2XSE A;  1D1C A;  5D92 A;  1OKK D;  4FX5 A;  4BG0 A;  3DM5 A;  3F46 A;  4OIO F;  5L3Q A;  2VAS A;  1ST6 A;  3W2W A;  1ZHZ A;  3N24 A;  3UMH A;  3SP1 A;  4AX2 A;  3S0X A;  4OIR F;  5DS5 A;  3EQL F;  4ZLD A;  4EWC A;  3EGX B;  2J7P A;  1D0Y A;  1LS1 A;  2Y3B A;  3JSZ A;  1Z5Z A;  3MLG A;  2ZXR A;  3W8H A;  5T1D B;  2A69 F;  4CS9 A;  3NKD A;  2XL4 A;  4U5F E;  4XWJ A;  1VK5 A;  2R7X A;  1TWA A;  2IXO A;  3K6B A;  3ZG1 A;  3AG4 C;  2IXP A;  3EPV A;  2Y3H A;  2BE5 F;  3EG9 A;  2XXA B;  2WZG A;  3W8I A;  4F4B A;  5EGY A;  1OKK A;  3HLZ A;  2CNW D;  2A1D D;  2DYS C;  3EGD B;  1Z63 A;  1FMV A;  1M56 C;  4BJ6 A;  2H7O A;  5D91 A;  5DS4 A;  2P6V A;  5L3V A;  2Y3D A;  4XLP F;  4A2N B;  2EIM C;  4N06 A;  4B6I A;  4MND A;  1QLE C;  3RKO F;  3VAY A;  4ANJ A;  5KYY B;  3K1I C;  1TWG A;  3B0P A;  4NY3 A;  4CS8 C;  2Z15 A;  2R7U A;  3SZR A;  2WL8 A;  1Z6A A;  3CZ6 A;  2J9W A;  3LEV A;  4P6I C;  4FWV A;  1ZU4 A;  3ECS A;  4I1M A;  3NDB B;  5E33 A;  3Q7G A;  3FVY A;  3RYL A;  3JT1 A;  4I44 A;  4GYT A;  1O87 A;  3O39 A;  4G7Z F;  1J8M F;  5HSW A;  3DJN B;  4WJ0 A;  2NUT B;  5F5H A;  4CS9 C;  1ZYR F;  3AQB A;  4OD5 A;  3I5Q A;  4JW1 A;  1ZHT A;  1TWH A;  3GAN A;  4J32 B;  5KYU A;  2HV7 A;  3EZI A;  4FES A;  1MMA A;  2J0X A;  2ZXP A;  3DMD A;  4E7Z A;  3DD7 A;  4U5G A;  1D1B A;  4G7O F;  3DAG A;  2R7S A;  4PK4 A;  4DOZ A;  3LS0 A;  2WVQ A;  3FHD A;  1D0X A;  1W2W A;  4BJ6 C;  2J9U A;  3SNH A;  4X0R A;  1NG1 A;  2EIN C;  4PJL A;  4RBN A;  2O9X A;  2D5R B;  1IZM A;  4IJJ A;  3IEE A;  5B3S C;  4E7S A;  3X2Q C;  4LAC B;  4C3B A;  2VH3 A;  3T4R A;  1NZE A;  2KNH A;  3ABM C;  3QMK A;  2CNW A;  2HV6 A;  4EBB A;  3LS1 A;  2WB7 A;  3Q6N A;  3SYN A;  1MMG A;  4DBR A;  3FAJ A;  2A6H F;  3ZC4 A;  2C03 A;  3HJC A;  2Y3G A;  3DJU B;  4CS7 A;  2NUP A;  3NYJ A;  1PD0 A;  1SF8 A;  3V7O A;  4ZLC A;  3PHF 2;  3L0I A;  2IOQ A;  5KYN A;  3KH2 A;  4IAO A;  1OCC C;  2ZXW C;  2I8B A;  4HE8 D;  2KGO A;  4ULW A;  4LLE A;  2KJG A;  3AG1 C;  2PFD A;  1FFT C;  4U5C E;  4C7O A;  2KQ9 A;  3F47 A;  4K0D A;  3UMI A;  1O5H A;  4YJW A;  3S28 A;  3UNG C;  1PCX A;  3I5P A;  3EHM A;  4W8K A;  4OIQ F;  3ASO C;  1FMW A;  4AE4 A;  3LLK A;  2CGE A;  1ZU5 A;  3T6B A;  4C7O B;  3LJB A;  3GOD A;  2R7R A;  2ZPA A;  4HFK B;  3B0U X;  2EIK C;  4C3D A;  5IY5 C;  2V26 A;  3Q7L A;  3CSK A;  2PX3 A;  3TD7 A;  4YWQ A;  4JZA A;  3UGO A;  5DQT A;  4GEH A;  2LSE A;  1RJ9 A;  1TWC A;  5E2Q A;  2MYS A;  3UR3 C;  4U5B E;  3DZA A;  1FTS A;  3B0V C;  4OD4 A;  3K7D A;  1JPN A;  3H65 A;  5T3T A;  4IRU A;  4BJ1 A;  3UMK A;  4PJM A;  5KYY A;  3X1O A;  4U5D E;  3WG7 C;  4U5H A;  2CW0 F;  4KNW A;  2P7V A;  1OCR C;  4O79 A;  4PJN A;  4CBE A;  2FFH A;  2H7B A;  2QTV A;  2PF4 E;  4G0H A;  4RD9 A;  1TKN A;  2J9V A;  1M57 C;  4KC9 A;  1ZHY A;  3RFY A;  3EG9 B;  2XXA A;  3NG1 A;  4MQ9 F;  4DBQ A;  5E3A A;  2WZL A;  4BEJ A;  4AE4 B;  2QY9 A;  3N0T A;  2WVO A;  2G3K A;  2CDQ A;  4BJT A;  2G3V A;  1J8Y F;  1M2O A;  1TR2 A;  3JRT A;  3OA1 A;  5KYX B;  1G8X A;  2L9J A;  4O6N A;  1JPJ A;  2Q9C A;  2A6E F;  1RJ9 B;  2W4M A;  1SMY F;  2H7V C;  3ZSU A;  3NRH A;  3KMI A;  2JD3 A;  1PD1 A;  5BUO A;  5DLJ A;  4YT2 A;  5KYX A;  3QZC A;  4Q4Z F;  2NUP B;  4H4K C;  4I3M A;  3EHN A;  3ZIB A;  5CI9 A;  2VB6 A;  1V55 C;  3OEO A;  3T6J A;  1VMA A;  2YHS A;  3E9V A;  3I4U A;  2DYR C;  4HFF B;  3UGP A;  4IWB A;  2GFH A;  3W2V A;  3KL4 A;  1ZHX A;  3PMR A;  3SEO A;  4I1O B;  2W4B A;  4JUR I;  4JCH A;  4YT4 A;  4QI2 A;  3CQZ A;  4OIN F;  5B1B C;  1Z23 A;  2WZF A;  3Q6M A;  1OCO C;  2E87 A;  2IYL D;  3NYM A;  2J7P D;  2V3C C;  3K1H A;  3RIP A;  2M4E A;  3EH2 A;  4BJ5 C;  2W45 A;  2G62 A;  4CSA C;  3ABL C;  1M2V B;  4KNV A;  3EGX A;  2OCC C;  1D0Z A;  1ZHW A;  2R7W A;  5FCL A;  3FDQ A;  4OIP F;  2R7V A;  1IW7 F;  1NU9 C;  3LNR A;  4JJG A;  4LLC A;  5DS6 A;  4C3E A;  2PP4 A;  5DVW A;  3K66 A;  3POV A;  1KU2 A;  4JVS A;  1WGW A;  2R7T A;  3EH1 A;  1QZX A;  1OCZ C;  5DQZ A;  3KKB A;  2J46 A;  3JYH A;  3B9Q A;  4DVZ A;  4AK9 A;  1N1C A;  1MMN A;  3NKE A;  4O6Y A;  1LVK A;  2R7O A;  3LAY A;  3NYL A;  5F5F A;  2MWQ A;  3ASN C;  3EGD A;  3RH3 A;  3O6X A;  4O7G A;  5T3W A;  4G7H F;  2Q9B A;  4O6M A;  3AG2 C;  4XTK A;  1MND A;  4YN0 B;  5KYW B;  1V54 C;  4QI0 A;  3K33 A;  2J0W A;  2YEV A;  1Z3I X;  3S27 A;  1NU7 D;  5B1A C;  4DVY P;  2YZS A;  5E3C A;  3L34 A;  1VOM A;  3HTK C;  2XRH A;  4QDL A;  4KI2 A;  1M2V A;  5CI8 A;  3E70 C;  5KYW A;  3AG3 C;  4CIH A;  3VYW A;  1SZI A;  3ABK C;  2J45 A;  3EZH A;  3EFO B;  3DM9 B;  1BR4 A;  2X51 A;  4RDA A;  3EJN A;  2PX0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...