3T4RA

Lettuce necrotic yellow virus phosphoprotein c-terminal domain
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
72
structure length
72
Chain Sequence
RIRHEKEKLLADLDWEIGEIAQYTPLIVDFLVPDDILAMAADGLTPELKEKIQNEIIENHIALMALEEYSSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphoprotein
publication title Structure of the C-terminal domain of lettuce necrotic yellows virus phosphoprotein.
pubmed doi rcsb
source organism Lettuce necrotic yellows virus
molecule tags Viral protein
total genus 23
structure length 72
sequence length 72
ec nomenclature
pdb deposition date 2011-07-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1590 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3t4rA00
3T4RA
chains in the Genus database with same CATH superfamily
3ZTZA 5KYYA 2LSEA 4E0HA 2EILC 2HKVA 4FX5A 2YHSA 3F47A 5JT4A 2Q9AA 3M15A 4U5GA 4BG0A 5HV9A 3GWLA 4X0RA 3B9QA 2A6HF 4DOZA 3DZAA 3H65A 1ORJA 3MLGA 2J45A 4NQFA 4XQ1A 1VMAA 3DJUB 1V55C 4IARA 3L0IA 1T5OA 4JC7A 3Q6NA 4K0DA 1Z7Qc 1OCCC 4MVRA 5JP7A 1TQGA 3AG4C 1MMGA 4RD9A 2ZXPA 4JEAA 1GM5A 3M4BA 3X1OA 5IY5C 3VYWA 1K40A 3UNGC 1VLSA 2DB4A 3DM9B 4DRIB 2R05A 3ZVRA 2CYDA 2KJGA 1YJGA 4RDAA 1I4YA 3V5ZA 4BPMA 2WVOA 1OCZC 2EIJC 2VCBA 2RD9A 1EI7A 3RF3A 5COFA 1K05A 1KU2A 2XRHA 1HMDA 2D4UA 1RKEB 4K7BA 3U8VA 1U89A 2VH3A 1QKRA 2QTVA 3ZWIA 3W2VA 3GEIA 4M63A 3AG1C 1JPNA 1KNYA 1JPJA 1TR2A 2UUHA 4ULVA 4YWQA 5BQIA 4XLPF 4EBBA 1OW7A 1IW7F 4CX9A 2ZXOA 3KKBA 4E7SA 4O7GA 1YDIA 4EWCA 4PJNA 2F22A 3OA1A 2XSEA 4KI2A 4NC3A 4XEFA 2AWYA 2W4MA 3DM5A 4KC9A 3W2WA 4BJ6C 2O9XA 3NRHA 1CGOA 1GS9A 3NMKA 4LERA 4CJOA 4IWBA 5B3IA 2HJMA 2PX3A 2OEVA 4OINF 5JS5A 3NYLA 5A6JA 1ZW3A 3MBGA 4IB4A 1ZU4A 3FAPB 2J7PD 2CW0F 1YZCA 3CAXA 3KH2A 3RVZA 2Q9CA 3VM6A 1GQAA 1SR2A 2Y3DA 3RFYA 5EGYA 2NSFA 1ORSC 3RQFA 2D5RB 4JURI 5COMA 5DQTA 3JYYA 3FOOA 3DAGA 5L0JA 1FMWA 3A9CA 3PHF2 3HLZA 4WABA 1TWAA 1K04A 3ASOC 4Z9HA 2KYHA 1OR3A 5AC5A 2NUTA 3UGPA 1VYIA 2QLAA 2XS8A 1XZPA 1LS4A 2EIKC 1YYJA 2MWQA 3C8GA 3SZRA 4U5HA 2YLGA 1TKNA 2LIGA 1G5ZA 3AQCA 4XWJA 1FR0A 1L7CA 1PD0A 2YEVA 4AE4B 2IOQA 2V26A 3CSKA 3LEVA 5A6BA 1DOVA 2QE9A 4NCQA 1T6IA 3A11A 4JIOA 5KYUA 4BJTA 2XXAA 4LDKA 1JAFA 1OXBA 3EJNA 3WHNA 4A4AA 4CS8C 5AC4A 2KNHA 5TJ5E 2VC9A 1CPRA 3K33A 4EBKA 3TJ6A 4G7ZF 4ZLDA 2WZLA 4C7OA 4N6HA 4E0IA 5F28E 1Z63A 2R9RB 4MVUA 3IQTA 1CGNA 4ANJA 3GM2A 2LFFA 4CSAA 4H4KC 1OCOC 4LDQA 1HE1A 1ZHYA 2Q00A 3FAJA 3IEEA 2KQ9A 2NUPB 5CIVA 4CIPA 3SP1A 3HKKA 1OW8A 4U5DE 4U5CE 4OD5A 5B1AC 5L0IA 4ONSA 1Y4CA 3U5SA 4U5FE 5JUAA 5A69A 4G7OF 3AG2C 3C18A 2H7OA 2IBFA 2YL0A 3SXKA 4MVMA 4JTAB 1XZQA 1TWHA 1XWJA 3KMIA 4OIQF 3AGTA 4JRZA 2NG1A 4PFOA 3NDBB 1LE2A 1OKKD 3LNMB 3T6BA 4JCZA 1CGME 3PDMP 1S05A 2LK4A 4I3MA 4NTFA 1T01A 2CDQA 2HZ8A 1Z6AA 1QPUA 2OKUA 3EGXB 3JSZA 3L34A 1OR2A 3MYIA 4L6RA 1HW2A 3K1IC 4JJGA 3NKDA 2IYLD 2KK1A 1T9KA 4DBQA 2YLDA 4AK9A 3LLIA 2YQYA 1T6UA 2QUPA 3AGUA 4CJGA 4IAQA 2HUJA 4EUKB 3S84A 2XL8A 4H54A 1GGQA 1C17M 1R5ID 1Q0GA 1AUEA 2HV7A 2OQMA 3DJNB 1T6QA 2Y3GA 3CEXA 1M2OA 3VRCA 5E33A 1OQCA 5KYWA 2EPOA 4OD4A 2J9UA 3BRJA 3EGDA 5KYXB 2M4EA 2R02A 3B29A 1D0YA 1EQ1A 1OXKA 2AP3A 2JD3A 3Q6MA 4GYTA 3R7CA 3RQGA 3AG3C 1FFHA 2IXOA 2G62A 1B68A 3IQ5A 3WAQA 5DS5A 3O10A 5L3VA 4CBEA 1E84A 2A68F 2R7SA 4PACA 3V5XA 2PFDA 1NBBA 1ZYRF 256BA 2YZSA 3U3BA 2HMQA 1PV3A 5K0IA 2R7RA 2OOCA 2XLOA 2J46A 4LLCA 2EPLX 1V54C 4JJFA 3DXJF 3POVA 1Z5ZA 2JPUA 2X0CA 2I8BA 4K1OA 5DLJA 5KYNA 2R7WA 3B71A 4MW8A 1ZVZA 2HJ3A 2IM8A 3GORA 3SXMA 4DRJB 4UDVA 1Y6DA 3ZIBA 1M2VB 1BR4A 2KW3C 1M6TA 2OEXA 1Q0FA 2EPMX 2P0NA 3ABLC 4PK4A 3ECSA 1TWGA 3TQOA 2HFIA 3O39A 1RKCA 1BZ4A 2YL3A 3DD7A 3U8PA 1VLTA 4YK5A 2J7PA 1LIHA 3NKEA 2KSFA 1A7VA 2Q9BA 3C8ZA 4NY3A 1ORYA 4CDYA 1JMWA 2YVKA 1ZHWA 3X2QC 2ETSA 3S0XA 1RMVA 4MVSA 1YLMA 3UMKA 1WWPA 5B1BC 4YL1A 3FXHA 2AU5A 1YYXA 2MYSA 3LS0A 3RH3A 2PBEA 4JZAA 4PJJA 3EHMA 3T6JA 4F4BA 2GFHA 1YAUO 3ABKC 3KYIA 3SXZA 4B6IA 1RJ9A 3JT1A 3FMSA 5D92A 1Q0MA 1A0BA 1NZEA 2WZFA 4IAOA 4W8PA 4W8KA 2XLDA 3ZG1A 4DXWA 4JTDB 5E2QA 4OIPF 3W4YA 1LKXA 2Y69C 4O6MA 1TFOB 5KYYB 1SYQA 3EH1A 2XM0A 1PD1A 1QZXA 4N06A 4Z9IA 4WJ0A 1MQVA 3Q7LA 2P7VA 2B0HA 3V5YA 4P9TA 4JKVA 3AJMA 3GODA 1O87A 4CDVA 1Q0KA 3JRMO 3EG9B 1DOWA 1HW1A 3LEOA 3LLKA 2PX0A 2CNWD 1BDJB 2R7VA 3S27A 3N24A 4PJLA 2UUIA 3EFOA 3RVYA 5L0FA 2V3CC 4XPXA 3EPVA 3ABMC 2P6VA 3TJ5A 4JE9A 4AX2A 5F5FA 4QDLA 1MNEA 4BJ5A 4EKWA 2FGYA 1NLXA 1VK5A 2NPUA 2EINC 2VB6A 1LI5A 3RQEA 1H9GA 3DMDA 5HSWA 1APCA 4YT5A 3R2PA 3LUTB 3PCVA 5E3AA 5CI9A 1FNTc 4CSAC 3MFNA 2Y3HA 4O6NA 2R7OA 2YL1A 1OKKA 2OCCC 3DE8A 4A2NB 3G50A 5E3CA 2NSGA 4JW1A 1RKEA 1JOGA 1M56C 1S7ZA 4YT8A 1M57C 1HMOA 4IGGA 2GWWA 4IRUA 2DGJA 4JCHA 3EQLF 4E18A 1W2WA 3V7OA 1VTMP 3GANA 1YARO 3DAFA 1WGWA 3LJBA 4LDRA 2Y39A 1YZAA 3NYJA 2EPNA 4YJWA 2BE5F 1WN0A 3JCUQ 3LAYA 2EIMC 3W8IA 3GEEA 4NTBA 3ZQVA 4U5EE 1FMVA 2H7VC 3TD7A 4AL1A 3KL4A 2LFDA 1FFTC 2IXNA 2W45A 1I5NA 4XTKA 2HSBA 3U2LA 4ZLCA 1QVXA 4BEJA 1NSGB 2XS1A 3FVYA 1BR2A 3K66A 4MTOA 2HS5A 3HNIA 3T9OA 2AWCA 2PF4E 4PJMA 2YRFA 3US6A 5B3SC 3IQCA 2BC5A 4IJJA 1ZHZA 2KC3A 1JR8A 2L6HA 1AVOB 2HSQA 3JSEO 3QZCA 3S29A 4P9FA 4YL3A 4G0HA 3ZC4A 4MTFA 4C3BA 4EIYA 1ZW2A 4OIOF 1U0BB 1L3PA 3EZHA 1HY5A 4NTAA 4DJ9A 3I5QA 1UG7A 4I1OB 4R32A 1NU7D 2A1DD 2LD6A 4MQ9F 4C3DA 1BR1A 1TFKB 1IZMA 2H7BA 2ZXWC 1JRAA 3K7DA 4J30B 5JRAA 1A7DA 3IHUA 3K6BA 5L0CA 3SNHA 1D1BA 2AVKA 2R7QA 4U5BE 4RBNA 3TOMA 2L6GA 1O5HA 2KGOA 4LACB 4QI0A 1QLEC 3M4CA 3I5PA 3HNJA 4HFFB 3QMKA 1MMDA 1RXQA 3E9VA 1WTYA 1YVIA 2L9JA 4FWVA 4AE4A 4KBLA 5T1DB 4DBRA 3NYMA 2C04A 1LI7A 4MTGA 5BUOA 3RW0A 3SEOA 5JLIA 1NG1A 3U3FA 1TWCA 1FTSA 3KPHA 3UMHA 4U9DA 3N0TA 4O6YA 2Q3TA 1EA8A 1WATA 3TK0A 4Q7CA 1MMAA 1ZHXA 4JTCB 1WASA 3L8JA 1D0ZA 1V74B 3Q7GA 1N1CA 4G7HF 4WGZA 3JYHA 3DE9A 3VAYA 4PFPA 2NUPA 2R7UA 2OG2A 3OWTA 5A6KA 3FHDA 1J8YF 2IXMA 2XM4A 4D4NA 4CS9A 4J7YA 4MVZA 1MMNA 3JRTA 2Q4FA 3DWWA 3SXYA 3U2MA 3ZDLA 3GWNA 2OU6A 3EFOB 4GQHA 2NUTB 1MNDA 4CS7A 1VOMA 5D91A 5BQHA 2L81A 3FOPA 2JX0A 3C8GB 2XLEA 1H6GA 1AEPA 2OJED 3IPMO 1EKYA 4CDAA 3T6GB 3MYFA 1CPQA 2CNWA 4AL0A 3EGXA 4MNDA 4EBJA 3LESA 3RKOF 2XXAB 2R7XA 5KYUB 2X51A 3MX3A 5DS4A 1QQ3A 1H7IA 5DVWA 3CZ6A 3HNKA 2W4BA 3ZTMA 2YL7A 3ZSUA 1Z23A 2B0JA 5JSLA 3W8HA 3L1MA 2HV6A 5A6AA 3B0UX 4XEVA 4N6CA 4DRHB 3NMIA 1ZHTA 2A0UA 2PNOA 2QNLA 2WL8A 5CI8A 4C7OB 2GA0A 2J9BA 4XPYA 4DVZA 5L0GA 1I4ZA 4Z9JA 1NU9C 3H2VA 3IQ6A 2ICWG 4YT4A 1QSPA 2RSEB 1WOLA 1LM3B 2WZGA 2MHRA 3N2ZB 5KYXA 2WVNA 4XPWA 3QVZA 3LNRA 3CQZA 4WGYA 4BJ5C 2Q7RA 5L0HA 2G3KA 3EZIA 1SMYF 4E7ZA 1F1MA 1Z3IX 4HE8D 3J06A 3ITFA 2GDCA 4XEKA 5EK0A 2M64A 3C7JA 4I44A 2LQGA 3HNLA 3H2UA 1YA7O 2Z15A 1E85A 3G4ZA 3QW1A 4BJ6A 2R25A 2XLMA 3M1CB 3SYNA 4MVQA 1M2VA 2YLIA 1LVKA 3JTLO 3U0CA 3WG7C 2ASRA 3GM1A 4HEAJ 4J7TA 3GEHA 3AQBA 1HE9A 3QW0A 4OIRF 5F5HA 5DQZA 4J32B 3NG1A 4N4WA 4CIHA 1E83A 1ZZPA 1C02A 3S9OA 4YN0B 2VCCA 3L8IA 3U9JA 3S90A 3QVYA 1U6HA 1D1AA 1ZU5A 2FFHA 1A7EA 2A6EF 1D0XA 2L7AA 4ULWA 1G4US 3HJCA 2W9YA 4MVOA 5KYWB 3GM3A 1RCPA 3EGDB 4D4XA 3BEHA 2L6FA 4HFKB 2WVQA 2EPKX 2J0XA 2ZXRA 3LS1A 2C03A 2QY9A 1FAPB 2DYSC 2FAPB 2VASA 2ZPAA 3E70C 1KTMA 2P1AA 3TOLA 3TULA 3C62A 1C03A 1VYKA 3UR3C 5EHHA 3B0VC 4GEHA 1SZIA 5L0DA 4JEBA 2XLVA 4KNWA 4KNVA 4Q4ZF 1OCRC 1D1CA 3ATPA 3WODF 2J9WA 4BJ1A 2DYRC 4C3EA 4FAPB 4Q5SF 2XL6A 3ZQYA 1J8MF 2IXPA 5DS6A 5FZTA 1UFBA 3NMJA 3UMIA 2XL4A 3B0PA 2P61A 3JZ0A 4QI2A 4CS8A 2GAQA 2XLHA 5GPGB 5L3QA 2VCAA 2DI3A 4YL0A 1YA9A 1H9TA 1LS1A 3DI5A 4P6IC 1A41A 3C8GD 4U9EA 3AOUA 4E17A 2CGEA 3U9MA 3EG9A 1G4WR 2Y3BA 2R7TA 2R03A 1ST6A 3QTHA 1NFNA 2E87A 2OJQA 3C63A 1V4AA 1NFOA 5A6BD 1VB5A 4JVSA 2TMVP 4BEMJ 4DVYP 4LLEA 1LPEA 2HMZA 2LCHA 2LP4A 1O3UA 3HTKC 4PR9A 2A0BA 3FDQA 2J9VA 5AGFA 2WB7A 5T3WA 3F46A 2CCYA 2H8AA 3DKAA 3VF0A 3G4XA 3I4UA 5FCLA 2ZD9A 2J0WA 1OW6A 1BBHA 5T3TA 3RIPA 3RYLA 2J8WA 2YWAA 3O6XA 3O55A 2YKZA 4O79A 3S28A 1PCXA 2I15A 4G78A 3T4RA 4EHPA 2G3VA 1E2XA 4I1MA 5JVEA 5BQGA 2PP4A 1R4TA 4MS2A 5COGA 3ASNC 1RJ9B 4XLNF 4CS9C 1LE4A 1G8XA 2BL2A 3K1HA 3KYJA 4FESA 4YT2A 4ER9A 1Q0DA 3OEOA 3UGOA 2A69F 3PMRA 1E86A 4MW3A 1SF8A 3M79A 3EHNA 3K1IA 2XLWA 3EH2A
chains in the Genus database with same CATH topology
5KYYA 2LSEA 2EILC 4FX5A 2YHSA 3F47A 2Q9AA 4U5GA 4BG0A 4X0RA 3B9QA 2A6HF 4DOZA 3DZAA 3H65A 3MLGA 2J45A 1VMAA 3DJUB 1V55C 4K0DA 3L0IA 3Q6NA 1OCCC 3AG4C 1MMGA 4RD9A 2ZXPA 3X1OA 5IY5C 3VYWA 3UNGC 3DM9B 3ZVRA 2KJGA 4RDAA 2WVOA 1OCZC 2EIJC 1KU2A 2XRHA 4K7BA 2VH3A 2QTVA 3W2VA 4M63A 3AG1C 1JPNA 1TR2A 1JPJA 4YWQA 4XLPF 4EBBA 1IW7F 2ZXOA 3KKBA 4E7SA 4O7GA 4EWCA 4PJNA 3OA1A 2XSEA 4KI2A 2W4MA 3DM5A 4KC9A 3W2WA 4BJ6C 2O9XA 3NRHA 4LERA 4IWBA 2PX3A 4OINF 3NYLA 1ZU4A 2J7PD 2CW0F 3KH2A 2Q9CA 2Y3DA 3RFYA 5EGYA 2D5RB 4JURI 5DQTA 3DAGA 1FMWA 3PHF2 3HLZA 1TWAA 3ASOC 2NUTA 3UGPA 1VYIA 2EIKC 2MWQA 3SZRA 4U5HA 1TKNA 3AQCA 4XWJA 1PD0A 2YEVA 4AE4B 2IOQA 2V26A 3CSKA 3LEVA 2XXAA 5KYUA 4BJTA 3EJNA 4CS8C 2KNHA 3K33A 4G7ZF 4ZLDA 2WZLA 4C7OA 1Z63A 4ANJA 4CSAA 4H4KC 1OCOC 3IEEA 1ZHYA 3FAJA 2KQ9A 2NUPB 3SP1A 4U5DE 4U5CE 4OD5A 5B1AC 4U5FE 4G7OF 3AG2C 2H7OA 1TWHA 3KMIA 4OIQF 3NDBB 4PFOA 2NG1A 1OKKD 3T6BA 4I3MA 2CDQA 1Z6AA 3EGXB 3JSZA 3L34A 3K1IC 4JJGA 3NKDA 2IYLD 4DBQA 3LLIA 3DJNB 2HV7A 2Y3GA 1M2OA 5E33A 5KYWA 4OD4A 2J9UA 3EGDA 5KYXB 2M4EA 1D0YA 2JD3A 4GYTA 3Q6MA 3AG3C 1FFHA 2IXOA 2G62A 5DS5A 5L3VA 4CBEA 2A68F 2R7SA 2PFDA 1ZYRF 2YZSA 2R7RA 2J46A 4LLCA 1V54C 4JJFA 3DXJF 3POVA 1Z5ZA 2I8BA 5KYNA 2R7WA 3ZIBA 1M2VB 1BR4A 2KW3C 3ABLC 4PK4A 3ECSA 1TWGA 3O39A 3DD7A 2J7PA 3NKEA 2Q9BA 4NY3A 1ZHWA 3X2QC 3S0XA 3UMKA 5B1BC 3T6JA 2MYSA 3LS0A 3RH3A 4PJJA 4JZAA 3EHMA 4F4BA 2GFHA 3ABKC 4B6IA 5DLJA 1RJ9A 3JT1A 5D92A 4DVYP 1NZEA 2WZFA 4IAOA 4W8KA 3ZG1A 5E2QA 4OIPF 1LKXA 2Y69C 4O6MA 3EH1A 1PD1A 1QZXA 4N06A 4WJ0A 3Q7LA 2P7VA 3GODA 1O87A 3EG9B 3LLKA 2PX0A 2CNWD 2R7VA 3S27A 3N24A 4PJLA 3EFOA 2V3CC 3EPVA 3ABMC 2P6VA 5F5FA 4AX2A 4QDLA 1MNEA 4BJ5A 2FGYA 1VK5A 2EINC 2VB6A 3DMDA 5HSWA 5E3AA 4YT5A 4CSAC 5CI9A 2Y3HA 4O6NA 2R7OA 1OKKA 2OCCC 4A2NB 5E3CA 4JW1A 4YT8A 1M56C 1S7ZA 1M57C 4IRUA 2DGJA 4JCHA 3EQLF 1W2WA 3V7OA 3GANA 3DAFA 1WGWA 3LJBA 2Y39A 3NYJA 5KYYB 4YJWA 3W8IA 2BE5F 3JCUQ 3LAYA 2EIMC 4U5EE 1FMVA 2H7VC 3TD7A 3KL4A 1FFTC 2IXNA 2W45A 4XTKA 4ZLCA 4BEJA 3FVYA 1BR2A 3K66A 2PF4E 4PJMA 5B3SC 4IJJA 1ZHZA 3QZCA 3S29A 3ZC4A 4C3BA 4G0HA 4OIOF 3EZHA 3I5QA 4I1OB 1NU7D 2A1DD 4MQ9F 4C3DA 1BR1A 2H7BA 1IZMA 2ZXWC 3K7DA 4J30B 3K6BA 3SNHA 1D1BA 2R7QA 4U5BE 4RBNA 4LACB 1O5HA 2KGOA 4QI0A 1QLEC 3I5PA 4HFFB 3QMKA 1MMDA 4AE4A 3E9VA 2L9JA 4FWVA 4KBLA 5T1DB 4DBRA 3NYMA 2C04A 5BUOA 3SEOA 1NG1A 1TWCA 1FTSA 3UMHA 3N0TA 4O6YA 2Q3TA 4Q7CA 1MMAA 1ZHXA 1D0ZA 3Q7GA 1N1CA 4G7HF 3JYHA 3VAYA 4PFPA 2NUPA 2R7UA 2OG2A 3OWTA 3FHDA 1J8YF 2IXMA 4CS9A 1MMNA 3JRTA 3EFOB 2NUTB 1MNDA 4CS7A 1VOMA 5D91A 2L81A 2CNWA 3EGXA 4MNDA 3LESA 3RKOF 2XXAB 2R7XA 5KYUB 2X51A 3MX3A 5DS4A 5DVWA 3CZ6A 2W4BA 3ZSUA 1Z23A 2B0JA 3W8HA 2HV6A 3B0UX 4C7OB 1ZHTA 2WL8A 5CI8A 4DVZA 1NU9C 4YT4A 2WZGA 3N2ZB 5KYXA 2WVNA 3LNRA 3CQZA 4BJ5C 2G3KA 3EZIA 1SMYF 4E7ZA 1Z3IX 4HE8D 3ITFA 4I44A 2Z15A 4BJ6A 3M1CB 3SYNA 1M2VA 1LVKA 3WG7C 4HEAJ 4OIRF 5F5HA 3AQBA 5DQZA 4J32B 3NG1A 4CIHA 4YN0B 1D1AA 1ZU5A 2FFHA 2A6EF 1D0XA 4ULWA 3HJCA 2W9YA 5KYWB 3EGDB 4HFKB 2WVQA 2J0XA 2ZXRA 3LS1A 2C03A 3E70C 2QY9A 2DYSC 2VASA 2ZPAA 1VYKA 3UR3C 5EHHA 3B0VC 4GEHA 1SZIA 4KNWA 4KNVA 4Q4ZF 1OCRC 1D1CA 3WODF 2J9WA 4BJ1A 2DYRC 4C3EA 4Q5SF 1J8MF 2IXPA 5DS6A 3UMIA 2XL4A 3B0PA 4QI2A 4CS8A 5L3QA 1LS1A 4P6IC 2CGEA 3EG9A 2Y3BA 2R7TA 1ST6A 2E87A 4JVSA 4LLEA 3HTKC 3FDQA 2J9VA 2WB7A 5T3WA 3F46A 3I4UA 5FCLA 3RIPA 2J0WA 3RYLA 5T3TA 3O6XA 4O79A 3T4RA 3S28A 1PCXA 2G3VA 4I1MA 2PP4A 3ASNC 1RJ9B 4XLNF 4CS9C 1G8XA 3K1HA 4FESA 4YT2A 3UGOA 3OEOA 2A69F 3PMRA 1SF8A 3EHNA 4AK9A 3EH2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T4R A; 
#chains in the Genus database with same CATH topology
 3ZTZ A;  5KYY A;  2LSE A;  4E0H A;  2EIL C;  2HKV A;  4FX5 A;  2YHS A;  3F47 A;  5JT4 A;  2Q9A A;  3M15 A;  4U5G A;  4BG0 A;  5HV9 A;  3GWL A;  4X0R A;  3B9Q A;  2A6H F;  4DOZ A;  3DZA A;  3H65 A;  1ORJ A;  3MLG A;  2J45 A;  4NQF A;  4XQ1 A;  1VMA A;  3DJU B;  1V55 C;  4IAR A;  3L0I A;  1T5O A;  4JC7 A;  3Q6N A;  4K0D A;  1Z7Q c;  1OCC C;  4MVR A;  5JP7 A;  1TQG A;  3AG4 C;  1MMG A;  4RD9 A;  2ZXP A;  4JEA A;  1GM5 A;  3M4B A;  3X1O A;  5IY5 C;  3VYW A;  1K40 A;  3UNG C;  1VLS A;  2DB4 A;  3DM9 B;  4DRI B;  2R05 A;  3ZVR A;  2CYD A;  2KJG A;  1YJG A;  4RDA A;  1I4Y A;  3V5Z A;  4BPM A;  2WVO A;  1OCZ C;  2EIJ C;  2VCB A;  2RD9 A;  1EI7 A;  3RF3 A;  5COF A;  1K05 A;  1KU2 A;  2XRH A;  1HMD A;  2D4U A;  1RKE B;  4K7B A;  3U8V A;  1U89 A;  2VH3 A;  1QKR A;  2QTV A;  3ZWI A;  3W2V A;  3GEI A;  4M63 A;  3AG1 C;  1JPN A;  1KNY A;  1JPJ A;  1TR2 A;  2UUH A;  4ULV A;  4YWQ A;  5BQI A;  4XLP F;  4EBB A;  1OW7 A;  1IW7 F;  4CX9 A;  2ZXO A;  3KKB A;  4E7S A;  4O7G A;  1YDI A;  4EWC A;  4PJN A;  2F22 A;  3OA1 A;  2XSE A;  4KI2 A;  4NC3 A;  4XEF A;  2AWY A;  2W4M A;  3DM5 A;  4KC9 A;  3W2W A;  4BJ6 C;  2O9X A;  3NRH A;  1CGO A;  1GS9 A;  3NMK A;  4LER A;  4CJO A;  4IWB A;  5B3I A;  2HJM A;  2PX3 A;  2OEV A;  4OIN F;  5JS5 A;  3NYL A;  5A6J A;  1ZW3 A;  3MBG A;  4IB4 A;  1ZU4 A;  3FAP B;  2J7P D;  2CW0 F;  1YZC A;  3CAX A;  3KH2 A;  3RVZ A;  2Q9C A;  3VM6 A;  1GQA A;  1SR2 A;  2Y3D A;  3RFY A;  5EGY A;  2NSF A;  1ORS C;  3RQF A;  2D5R B;  4JUR I;  5COM A;  5DQT A;  3JYY A;  3FOO A;  3DAG A;  5L0J A;  1FMW A;  3A9C A;  3PHF 2;  3HLZ A;  4WAB A;  1TWA A;  1K04 A;  3ASO C;  4Z9H A;  2KYH A;  1OR3 A;  5AC5 A;  2NUT A;  3UGP A;  1VYI A;  2QLA A;  2XS8 A;  1XZP A;  1LS4 A;  2EIK C;  1YYJ A;  2MWQ A;  3C8G A;  3SZR A;  4U5H A;  2YLG A;  1TKN A;  2LIG A;  1G5Z A;  3AQC A;  4XWJ A;  1FR0 A;  1L7C A;  1PD0 A;  2YEV A;  4AE4 B;  2IOQ A;  2V26 A;  3CSK A;  3LEV A;  5A6B A;  1DOV A;  2QE9 A;  4NCQ A;  1T6I A;  3A11 A;  4JIO A;  5KYU A;  4BJT A;  2XXA A;  4LDK A;  1JAF A;  1OXB A;  3EJN A;  3WHN A;  4A4A A;  4CS8 C;  5AC4 A;  2KNH A;  5TJ5 E;  2VC9 A;  1CPR A;  3K33 A;  4EBK A;  3TJ6 A;  4G7Z F;  4ZLD A;  2WZL A;  4C7O A;  4N6H A;  4E0I A;  5F28 E;  1Z63 A;  2R9R B;  4MVU A;  3IQT A;  1CGN A;  4ANJ A;  3GM2 A;  2LFF A;  4CSA A;  4H4K C;  1OCO C;  4LDQ A;  1HE1 A;  1ZHY A;  2Q00 A;  3FAJ A;  3IEE A;  2KQ9 A;  2NUP B;  5CIV A;  4CIP A;  3SP1 A;  3HKK A;  1OW8 A;  4U5D E;  4U5C E;  4OD5 A;  5B1A C;  5L0I A;  4ONS A;  1Y4C A;  3U5S A;  4U5F E;  5JUA A;  5A69 A;  4G7O F;  3AG2 C;  3C18 A;  2H7O A;  2IBF A;  2YL0 A;  3SXK A;  4MVM A;  4JTA B;  1XZQ A;  1TWH A;  1XWJ A;  3KMI A;  4OIQ F;  3AGT A;  4JRZ A;  2NG1 A;  4PFO A;  3NDB B;  1LE2 A;  1OKK D;  3LNM B;  3T6B A;  4JCZ A;  1CGM E;  3PDM P;  1S05 A;  2LK4 A;  4I3M A;  4NTF A;  1T01 A;  2CDQ A;  2HZ8 A;  1Z6A A;  1QPU A;  2OKU A;  3EGX B;  3JSZ A;  3L34 A;  1OR2 A;  3MYI A;  4L6R A;  1HW2 A;  3K1I C;  4JJG A;  3NKD A;  2IYL D;  2KK1 A;  1T9K A;  4DBQ A;  2YLD A;  4AK9 A;  3LLI A;  2YQY A;  1T6U A;  2QUP A;  3AGU A;  4CJG A;  4IAQ A;  2HUJ A;  4EUK B;  3S84 A;  2XL8 A;  4H54 A;  1GGQ A;  1C17 M;  1R5I D;  1Q0G A;  1AUE A;  2HV7 A;  2OQM A;  3DJN B;  1T6Q A;  2Y3G A;  3CEX A;  1M2O A;  3VRC A;  5E33 A;  1OQC A;  5KYW A;  2EPO A;  4OD4 A;  2J9U A;  3BRJ A;  3EGD A;  5KYX B;  2M4E A;  2R02 A;  3B29 A;  1D0Y A;  1EQ1 A;  1OXK A;  2AP3 A;  2JD3 A;  3Q6M A;  4GYT A;  3R7C A;  3RQG A;  3AG3 C;  1FFH A;  2IXO A;  2G62 A;  1B68 A;  3IQ5 A;  3WAQ A;  5DS5 A;  3O10 A;  5L3V A;  4CBE A;  1E84 A;  2A68 F;  2R7S A;  4PAC A;  3V5X A;  2PFD A;  1NBB A;  1ZYR F;  256B A;  2YZS A;  3U3B A;  2HMQ A;  1PV3 A;  5K0I A;  2R7R A;  2OOC A;  2XLO A;  2J46 A;  4LLC A;  2EPL X;  1V54 C;  4JJF A;  3DXJ F;  3POV A;  1Z5Z A;  2JPU A;  2X0C A;  2I8B A;  4K1O A;  5DLJ A;  5KYN A;  2R7W A;  3B71 A;  4MW8 A;  1ZVZ A;  2HJ3 A;  2IM8 A;  3GOR A;  3SXM A;  4DRJ B;  4UDV A;  1Y6D A;  3ZIB A;  1M2V B;  1BR4 A;  2KW3 C;  1M6T A;  2OEX A;  1Q0F A;  2EPM X;  2P0N A;  3ABL C;  4PK4 A;  3ECS A;  1TWG A;  3TQO A;  2HFI A;  3O39 A;  1RKC A;  1BZ4 A;  2YL3 A;  3DD7 A;  3U8P A;  1VLT A;  4YK5 A;  2J7P A;  1LIH A;  3NKE A;  2KSF A;  1A7V A;  2Q9B A;  3C8Z A;  4NY3 A;  1ORY A;  4CDY A;  1JMW A;  2YVK A;  1ZHW A;  3X2Q C;  2ETS A;  3S0X A;  1RMV A;  4MVS A;  1YLM A;  3UMK A;  1WWP A;  5B1B C;  4YL1 A;  3FXH A;  2AU5 A;  1YYX A;  2MYS A;  3LS0 A;  3RH3 A;  2PBE A;  4JZA A;  4PJJ A;  3EHM A;  3T6J A;  4F4B A;  2GFH A;  1YAU O;  3ABK C;  3KYI A;  3SXZ A;  4B6I A;  1RJ9 A;  3JT1 A;  3FMS A;  5D92 A;  1Q0M A;  1A0B A;  1NZE A;  2WZF A;  4IAO A;  4W8P A;  4W8K A;  2XLD A;  3ZG1 A;  4DXW A;  4JTD B;  5E2Q A;  4OIP F;  3W4Y A;  1LKX A;  2Y69 C;  4O6M A;  1TFO B;  5KYY B;  1SYQ A;  3EH1 A;  2XM0 A;  1PD1 A;  1QZX A;  4N06 A;  4Z9I A;  4WJ0 A;  1MQV A;  3Q7L A;  2P7V A;  2B0H A;  3V5Y A;  4P9T A;  4JKV A;  3AJM A;  3GOD A;  1O87 A;  4CDV A;  1Q0K A;  3JRM O;  3EG9 B;  1DOW A;  1HW1 A;  3LEO A;  3LLK A;  2PX0 A;  2CNW D;  1BDJ B;  2R7V A;  3S27 A;  3N24 A;  4PJL A;  2UUI A;  3EFO A;  3RVY A;  5L0F A;  2V3C C;  4XPX A;  3EPV A;  3ABM C;  2P6V A;  3TJ5 A;  4JE9 A;  4AX2 A;  5F5F A;  4QDL A;  1MNE A;  4BJ5 A;  4EKW A;  2FGY A;  1NLX A;  1VK5 A;  2NPU A;  2EIN C;  2VB6 A;  1LI5 A;  3RQE A;  1H9G A;  3DMD A;  5HSW A;  1APC A;  4YT5 A;  3R2P A;  3LUT B;  3PCV A;  5E3A A;  5CI9 A;  1FNT c;  4CSA C;  3MFN A;  2Y3H A;  4O6N A;  2R7O A;  2YL1 A;  1OKK A;  2OCC C;  3DE8 A;  4A2N B;  3G50 A;  5E3C A;  2NSG A;  4JW1 A;  1RKE A;  1JOG A;  1M56 C;  1S7Z A;  4YT8 A;  1M57 C;  1HMO A;  4IGG A;  2GWW A;  4IRU A;  2DGJ A;  4JCH A;  3EQL F;  4E18 A;  1W2W A;  3V7O A;  1VTM P;  3GAN A;  1YAR O;  3DAF A;  1WGW A;  3LJB A;  4LDR A;  2Y39 A;  1YZA A;  3NYJ A;  2EPN A;  4YJW A;  2BE5 F;  1WN0 A;  3JCU Q;  3LAY A;  2EIM C;  3W8I A;  3GEE A;  4NTB A;  3ZQV A;  4U5E E;  1FMV A;  2H7V C;  3TD7 A;  4AL1 A;  3KL4 A;  2LFD A;  1FFT C;  2IXN A;  2W45 A;  1I5N A;  4XTK A;  2HSB A;  3U2L A;  4ZLC A;  1QVX A;  4BEJ A;  1NSG B;  2XS1 A;  3FVY A;  1BR2 A;  3K66 A;  4MTO A;  2HS5 A;  3HNI A;  3T9O A;  2AWC A;  2PF4 E;  4PJM A;  2YRF A;  3US6 A;  5B3S C;  3IQC A;  2BC5 A;  4IJJ A;  1ZHZ A;  2KC3 A;  1JR8 A;  2L6H A;  1AVO B;  2HSQ A;  3JSE O;  3QZC A;  3S29 A;  4P9F A;  4YL3 A;  4G0H A;  3ZC4 A;  4MTF A;  4C3B A;  4EIY A;  1ZW2 A;  4OIO F;  1U0B B;  1L3P A;  3EZH A;  1HY5 A;  4NTA A;  4DJ9 A;  3I5Q A;  1UG7 A;  4I1O B;  4R32 A;  1NU7 D;  2A1D D;  2LD6 A;  4MQ9 F;  4C3D A;  1BR1 A;  1TFK B;  1IZM A;  2H7B A;  2ZXW C;  1JRA A;  3K7D A;  4J30 B;  5JRA A;  1A7D A;  3IHU A;  3K6B A;  5L0C A;  3SNH A;  1D1B A;  2AVK A;  2R7Q A;  4U5B E;  4RBN A;  3TOM A;  2L6G A;  1O5H A;  2KGO A;  4LAC B;  4QI0 A;  1QLE C;  3M4C A;  3I5P A;  3HNJ A;  4HFF B;  3QMK A;  1MMD A;  1RXQ A;  3E9V A;  1WTY A;  1YVI A;  2L9J A;  4FWV A;  4AE4 A;  4KBL A;  5T1D B;  4DBR A;  3NYM A;  2C04 A;  1LI7 A;  4MTG A;  5BUO A;  3RW0 A;  3SEO A;  5JLI A;  1NG1 A;  3U3F A;  1TWC A;  1FTS A;  3KPH A;  3UMH A;  4U9D A;  3N0T A;  4O6Y A;  2Q3T A;  1EA8 A;  1WAT A;  3TK0 A;  4Q7C A;  1MMA A;  1ZHX A;  4JTC B;  1WAS A;  3L8J A;  1D0Z A;  1V74 B;  3Q7G A;  1N1C A;  4G7H F;  4WGZ A;  3JYH A;  3DE9 A;  3VAY A;  4PFP A;  2NUP A;  2R7U A;  2OG2 A;  3OWT A;  5A6K A;  3FHD A;  1J8Y F;  2IXM A;  2XM4 A;  4D4N A;  4CS9 A;  4J7Y A;  4MVZ A;  1MMN A;  3JRT A;  2Q4F A;  3DWW A;  3SXY A;  3U2M A;  3ZDL A;  3GWN A;  2OU6 A;  3EFO B;  4GQH A;  2NUT B;  1MND A;  4CS7 A;  1VOM A;  5D91 A;  5BQH A;  2L81 A;  3FOP A;  2JX0 A;  3C8G B;  2XLE A;  1H6G A;  1AEP A;  2OJE D;  3IPM O;  1EKY A;  4CDA A;  3T6G B;  3MYF A;  1CPQ A;  2CNW A;  4AL0 A;  3EGX A;  4MND A;  4EBJ A;  3LES A;  3RKO F;  2XXA B;  2R7X A;  5KYU B;  2X51 A;  3MX3 A;  5DS4 A;  1QQ3 A;  1H7I A;  5DVW A;  3CZ6 A;  3HNK A;  2W4B A;  3ZTM A;  2YL7 A;  3ZSU A;  1Z23 A;  2B0J A;  5JSL A;  3W8H A;  3L1M A;  2HV6 A;  5A6A A;  3B0U X;  4XEV A;  4N6C A;  4DRH B;  3NMI A;  1ZHT A;  2A0U A;  2PNO A;  2QNL A;  2WL8 A;  5CI8 A;  4C7O B;  2GA0 A;  2J9B A;  4XPY A;  4DVZ A;  5L0G A;  1I4Z A;  4Z9J A;  1NU9 C;  3H2V A;  3IQ6 A;  2ICW G;  4YT4 A;  1QSP A;  2RSE B;  1WOL A;  1LM3 B;  2WZG A;  2MHR A;  3N2Z B;  5KYX A;  2WVN A;  4XPW A;  3QVZ A;  3LNR A;  3CQZ A;  4WGY A;  4BJ5 C;  2Q7R A;  5L0H A;  2G3K A;  3EZI A;  1SMY F;  4E7Z A;  1F1M A;  1Z3I X;  4HE8 D;  3J06 A;  3ITF A;  2GDC A;  4XEK A;  5EK0 A;  2M64 A;  3C7J A;  4I44 A;  2LQG A;  3HNL A;  3H2U A;  1YA7 O;  2Z15 A;  1E85 A;  3G4Z A;  3QW1 A;  4BJ6 A;  2R25 A;  2XLM A;  3M1C B;  3SYN A;  4MVQ A;  1M2V A;  2YLI A;  1LVK A;  3JTL O;  3U0C A;  3WG7 C;  2ASR A;  3GM1 A;  4HEA J;  4J7T A;  3GEH A;  3AQB A;  1HE9 A;  3QW0 A;  4OIR F;  5F5H A;  5DQZ A;  4J32 B;  3NG1 A;  4N4W A;  4CIH A;  1E83 A;  1ZZP A;  1C02 A;  3S9O A;  4YN0 B;  2VCC A;  3L8I A;  3U9J A;  3S90 A;  3QVY A;  1U6H A;  1D1A A;  1ZU5 A;  2FFH A;  1A7E A;  2A6E F;  1D0X A;  2L7A A;  4ULW A;  1G4U S;  3HJC A;  2W9Y A;  4MVO A;  5KYW B;  3GM3 A;  1RCP A;  3EGD B;  4D4X A;  3BEH A;  2L6F A;  4HFK B;  2WVQ A;  2EPK X;  2J0X A;  2ZXR A;  3LS1 A;  2C03 A;  2QY9 A;  1FAP B;  2DYS C;  2FAP B;  2VAS A;  2ZPA A;  3E70 C;  1KTM A;  2P1A A;  3TOL A;  3TUL A;  3C62 A;  1C03 A;  1VYK A;  3UR3 C;  5EHH A;  3B0V C;  4GEH A;  1SZI A;  5L0D A;  4JEB A;  2XLV A;  4KNW A;  4KNV A;  4Q4Z F;  1OCR C;  1D1C A;  3ATP A;  3WOD F;  2J9W A;  4BJ1 A;  2DYR C;  4C3E A;  4FAP B;  4Q5S F;  2XL6 A;  3ZQY A;  1J8M F;  2IXP A;  5DS6 A;  5FZT A;  1UFB A;  3NMJ A;  3UMI A;  2XL4 A;  3B0P A;  2P61 A;  3JZ0 A;  4QI2 A;  4CS8 A;  2GAQ A;  2XLH A;  5GPG B;  5L3Q A;  2VCA A;  2DI3 A;  4YL0 A;  1YA9 A;  1H9T A;  1LS1 A;  3DI5 A;  4P6I C;  1A41 A;  3C8G D;  4U9E A;  3AOU A;  4E17 A;  2CGE A;  3U9M A;  3EG9 A;  1G4W R;  2Y3B A;  2R7T A;  2R03 A;  1ST6 A;  3QTH A;  1NFN A;  2E87 A;  2OJQ A;  3C63 A;  1V4A A;  1NFO A;  5A6B D;  1VB5 A;  4JVS A;  2TMV P;  4BEM J;  4DVY P;  4LLE A;  1LPE A;  2HMZ A;  2LCH A;  2LP4 A;  1O3U A;  3HTK C;  4PR9 A;  2A0B A;  3FDQ A;  2J9V A;  5AGF A;  2WB7 A;  5T3W A;  3F46 A;  2CCY A;  2H8A A;  3DKA A;  3VF0 A;  3G4X A;  3I4U A;  5FCL A;  2ZD9 A;  2J0W A;  1OW6 A;  1BBH A;  5T3T A;  3RIP A;  3RYL A;  2J8W A;  2YWA A;  3O6X A;  3O55 A;  2YKZ A;  4O79 A;  3S28 A;  1PCX A;  2I15 A;  4G78 A;  3T4R A;  4EHP A;  2G3V A;  1E2X A;  4I1M A;  5JVE A;  5BQG A;  2PP4 A;  1R4T A;  4MS2 A;  5COG A;  3ASN C;  1RJ9 B;  4XLN F;  4CS9 C;  1LE4 A;  1G8X A;  2BL2 A;  3K1H A;  3KYJ A;  4FES A;  4YT2 A;  4ER9 A;  1Q0D A;  3OEO A;  3UGO A;  2A69 F;  3PMR A;  1E86 A;  4MW3 A;  1SF8 A;  3M79 A;  3EHN A;  3K1I A;  2XLW A;  3EH2 A; 
#chains in the Genus database with same CATH homology
 5KYY A;  2LSE A;  2EIL C;  4FX5 A;  2YHS A;  3F47 A;  2Q9A A;  4U5G A;  4BG0 A;  4X0R A;  3B9Q A;  2A6H F;  4DOZ A;  3DZA A;  3H65 A;  3MLG A;  2J45 A;  1VMA A;  3DJU B;  1V55 C;  4K0D A;  3L0I A;  3Q6N A;  1OCC C;  3AG4 C;  1MMG A;  4RD9 A;  2ZXP A;  3X1O A;  5IY5 C;  3VYW A;  3UNG C;  3DM9 B;  3ZVR A;  2KJG A;  4RDA A;  2WVO A;  1OCZ C;  2EIJ C;  1KU2 A;  2XRH A;  4K7B A;  2VH3 A;  2QTV A;  3W2V A;  4M63 A;  3AG1 C;  1JPN A;  1TR2 A;  1JPJ A;  4YWQ A;  4XLP F;  4EBB A;  1IW7 F;  2ZXO A;  3KKB A;  4E7S A;  4O7G A;  4EWC A;  4PJN A;  3OA1 A;  2XSE A;  4KI2 A;  2W4M A;  3DM5 A;  4KC9 A;  3W2W A;  4BJ6 C;  2O9X A;  3NRH A;  4LER A;  4IWB A;  2PX3 A;  4OIN F;  3NYL A;  1ZU4 A;  2J7P D;  2CW0 F;  3KH2 A;  2Q9C A;  2Y3D A;  3RFY A;  5EGY A;  2D5R B;  4JUR I;  5DQT A;  3DAG A;  1FMW A;  3PHF 2;  3HLZ A;  1TWA A;  3ASO C;  2NUT A;  3UGP A;  1VYI A;  2EIK C;  2MWQ A;  3SZR A;  4U5H A;  1TKN A;  3AQC A;  4XWJ A;  1PD0 A;  2YEV A;  4AE4 B;  2IOQ A;  2V26 A;  3CSK A;  3LEV A;  2XXA A;  5KYU A;  4BJT A;  3EJN A;  4CS8 C;  2KNH A;  3K33 A;  4G7Z F;  4ZLD A;  2WZL A;  4C7O A;  1Z63 A;  4ANJ A;  4CSA A;  4H4K C;  1OCO C;  3IEE A;  1ZHY A;  3FAJ A;  2KQ9 A;  2NUP B;  3SP1 A;  4U5D E;  4U5C E;  4OD5 A;  5B1A C;  4U5F E;  4G7O F;  3AG2 C;  2H7O A;  1TWH A;  3KMI A;  4OIQ F;  3NDB B;  4PFO A;  2NG1 A;  1OKK D;  3T6B A;  4I3M A;  2CDQ A;  1Z6A A;  3EGX B;  3JSZ A;  3L34 A;  3K1I C;  4JJG A;  3NKD A;  2IYL D;  4DBQ A;  3LLI A;  3DJN B;  2HV7 A;  2Y3G A;  1M2O A;  5E33 A;  5KYW A;  4OD4 A;  2J9U A;  3EGD A;  5KYX B;  2M4E A;  1D0Y A;  2JD3 A;  4GYT A;  3Q6M A;  3AG3 C;  1FFH A;  2IXO A;  2G62 A;  5DS5 A;  5L3V A;  4CBE A;  2A68 F;  2R7S A;  2PFD A;  1ZYR F;  2YZS A;  2R7R A;  2J46 A;  4LLC A;  1V54 C;  4JJF A;  3DXJ F;  3POV A;  1Z5Z A;  2I8B A;  5KYN A;  2R7W A;  3ZIB A;  1M2V B;  1BR4 A;  2KW3 C;  3ABL C;  4PK4 A;  3ECS A;  1TWG A;  3O39 A;  3DD7 A;  2J7P A;  3NKE A;  2Q9B A;  4NY3 A;  1ZHW A;  3X2Q C;  3S0X A;  3UMK A;  5B1B C;  3T6J A;  2MYS A;  3LS0 A;  3RH3 A;  4PJJ A;  4JZA A;  3EHM A;  4F4B A;  2GFH A;  3ABK C;  4B6I A;  5DLJ A;  1RJ9 A;  3JT1 A;  5D92 A;  4DVY P;  1NZE A;  2WZF A;  4IAO A;  4W8K A;  3ZG1 A;  5E2Q A;  4OIP F;  1LKX A;  2Y69 C;  4O6M A;  3EH1 A;  1PD1 A;  1QZX A;  4N06 A;  4WJ0 A;  3Q7L A;  2P7V A;  3GOD A;  1O87 A;  3EG9 B;  3LLK A;  2PX0 A;  2CNW D;  2R7V A;  3S27 A;  3N24 A;  4PJL A;  3EFO A;  2V3C C;  3EPV A;  3ABM C;  2P6V A;  5F5F A;  4AX2 A;  4QDL A;  1MNE A;  4BJ5 A;  2FGY A;  1VK5 A;  2EIN C;  2VB6 A;  3DMD A;  5HSW A;  5E3A A;  4YT5 A;  4CSA C;  5CI9 A;  2Y3H A;  4O6N A;  2R7O A;  1OKK A;  2OCC C;  4A2N B;  5E3C A;  4JW1 A;  4YT8 A;  1M56 C;  1S7Z A;  1M57 C;  4IRU A;  2DGJ A;  4JCH A;  3EQL F;  1W2W A;  3V7O A;  3GAN A;  3DAF A;  1WGW A;  3LJB A;  2Y39 A;  3NYJ A;  5KYY B;  4YJW A;  3W8I A;  2BE5 F;  3JCU Q;  3LAY A;  2EIM C;  4U5E E;  1FMV A;  2H7V C;  3TD7 A;  3KL4 A;  1FFT C;  2IXN A;  2W45 A;  4XTK A;  4ZLC A;  4BEJ A;  3FVY A;  1BR2 A;  3K66 A;  2PF4 E;  4PJM A;  5B3S C;  4IJJ A;  1ZHZ A;  3QZC A;  3S29 A;  3ZC4 A;  4C3B A;  4G0H A;  4OIO F;  3EZH A;  3I5Q A;  4I1O B;  1NU7 D;  2A1D D;  4MQ9 F;  4C3D A;  1BR1 A;  2H7B A;  1IZM A;  2ZXW C;  3K7D A;  4J30 B;  3K6B A;  3SNH A;  1D1B A;  2R7Q A;  4U5B E;  4RBN A;  4LAC B;  1O5H A;  2KGO A;  4QI0 A;  1QLE C;  3I5P A;  4HFF B;  3QMK A;  1MMD A;  4AE4 A;  3E9V A;  2L9J A;  4FWV A;  4KBL A;  5T1D B;  4DBR A;  3NYM A;  2C04 A;  5BUO A;  3SEO A;  1NG1 A;  1TWC A;  1FTS A;  3UMH A;  3N0T A;  4O6Y A;  2Q3T A;  4Q7C A;  1MMA A;  1ZHX A;  1D0Z A;  3Q7G A;  1N1C A;  4G7H F;  3JYH A;  3VAY A;  4PFP A;  2NUP A;  2R7U A;  2OG2 A;  3OWT A;  3FHD A;  1J8Y F;  2IXM A;  4CS9 A;  1MMN A;  3JRT A;  3EFO B;  2NUT B;  1MND A;  4CS7 A;  1VOM A;  5D91 A;  2L81 A;  2CNW A;  3EGX A;  4MND A;  3LES A;  3RKO F;  2XXA B;  2R7X A;  5KYU B;  2X51 A;  3MX3 A;  5DS4 A;  5DVW A;  3CZ6 A;  2W4B A;  3ZSU A;  1Z23 A;  2B0J A;  3W8H A;  2HV6 A;  3B0U X;  4C7O B;  1ZHT A;  2WL8 A;  5CI8 A;  4DVZ A;  1NU9 C;  4YT4 A;  2WZG A;  3N2Z B;  5KYX A;  2WVN A;  3LNR A;  3CQZ A;  4BJ5 C;  2G3K A;  3EZI A;  1SMY F;  4E7Z A;  1Z3I X;  4HE8 D;  3ITF A;  4I44 A;  2Z15 A;  4BJ6 A;  3M1C B;  3SYN A;  1M2V A;  1LVK A;  3WG7 C;  4HEA J;  4OIR F;  5F5H A;  3AQB A;  5DQZ A;  4J32 B;  3NG1 A;  4CIH A;  4YN0 B;  1D1A A;  1ZU5 A;  2FFH A;  2A6E F;  1D0X A;  4ULW A;  3HJC A;  2W9Y A;  5KYW B;  3EGD B;  4HFK B;  2WVQ A;  2J0X A;  2ZXR A;  3LS1 A;  2C03 A;  3E70 C;  2QY9 A;  2DYS C;  2VAS A;  2ZPA A;  1VYK A;  3UR3 C;  5EHH A;  3B0V C;  4GEH A;  1SZI A;  4KNW A;  4KNV A;  4Q4Z F;  1OCR C;  1D1C A;  3WOD F;  2J9W A;  4BJ1 A;  2DYR C;  4C3E A;  4Q5S F;  1J8M F;  2IXP A;  5DS6 A;  3UMI A;  2XL4 A;  3B0P A;  4QI2 A;  4CS8 A;  5L3Q A;  1LS1 A;  4P6I C;  2CGE A;  3EG9 A;  2Y3B A;  2R7T A;  1ST6 A;  2E87 A;  4JVS A;  4LLE A;  3HTK C;  3FDQ A;  2J9V A;  2WB7 A;  5T3W A;  3F46 A;  3I4U A;  5FCL A;  3RIP A;  2J0W A;  3RYL A;  5T3T A;  3O6X A;  4O79 A;  3T4R A;  3S28 A;  1PCX A;  2G3V A;  4I1M A;  2PP4 A;  3ASN C;  1RJ9 B;  4XLN F;  4CS9 C;  1G8X A;  3K1H A;  4FES A;  4YT2 A;  3UGO A;  3OEO A;  2A69 F;  3PMR A;  1SF8 A;  3EHN A;  4AK9 A;  3EH2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...