3T4RA

Lettuce necrotic yellow virus phosphoprotein c-terminal domain
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
72
structure length
72
Chain Sequence
RIRHEKEKLLADLDWEIGEIAQYTPLIVDFLVPDDILAMAADGLTPELKEKIQNEIIENHIALMALEEYSSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords Phosphoprotein
publication title Structure of the C-terminal domain of lettuce necrotic yellows virus phosphoprotein.
pubmed doi rcsb
source organism Lettuce necrotic yellows virus
total genus 23
structure length 72
sequence length 72
ec nomenclature
pdb deposition date 2011-07-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1590 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3t4rA00
3T4RA
chains in the Genus database with same CATH superfamily
1FAPB 4L6RA 3C8ZA 4LDKA 4O6NA 3AG4C 4MW3A 4MVQA 3AGUA 3TK0A 3ZQYA 2XLOA 3B29A 2JD3A 2HV7A 2HFIA 1VB5A 1SZIA 4DRIB 3KYJA 3ZDLA 4X0RA 4EWCA 2R9RB 1E83A 2H8AA 1CPRA 3ABKC 3KPHA 3LLKA 3ABLC 3CEXA 3QTHA 2EIJC 1GS9A 5K0IA 3LAYA 1YLMA 1H9TA 1UG7A 1VK5A 4BEMJ 4YL1A 1YVIA 1ZVZA 4OD5A 1V55C 2GWWA 3LNRA 4G7ZF 3K1HA 3AJMA 3EH1A 3L1MA 4JEAA 1YYXA 2LSEA 4Z9IA 1RJ9A 1HMDA 1TWHA 1MMGA 1NSGB 2IXMA 256BA 2R7RA 3EG9A 3VM6A 3I5PA 4YT4A 4YT8A 3EHNA 1O3UA 1BR1A 1K04A 2HSQA 1PD1A 5FCLA 1ZW2A 2EPKX 1FFTC 3K66A 5E33A 1G8XA 1L7CA 2FAPB 4DXWA 3MYIA 3Q7GA 1T6UA 1U89A 3FVYA 4XWJA 3UMIA 3U8VA 4BEJA 1OW7A 2HJ3A 3WG7C 3N24A 3HLZA 4CDVA 5KYUB 1LVKA 3DJNB 3L8JA 3NKEA 5T3TA 1Q0DA 3KYIA 2LCHA 2GFHA 2QY9A 3ZTZA 2Q9CA 2D4UA 3TJ6A 1T6QA 3QZCA 1WOLA 1WASA 4IARA 3NDBB 4MVOA 2F22A 1LI5A 4YN0B 2M4EA 3AG2C 2EINC 3BEHA 1M2OA 3DWWA 1LS1A 3MX3A 5JVEA 2RD9A 1VLSA 4JTDB 4EUKB 5BQIA 4C7OB 1B68A 4U9DA 2NG1A 3RFYA 3Q7LA 3C8GD 1ZHXA 3I4UA 4Q5SF 2YL3A 1FTSA 3U2MA 2NSGA 1FMVA 1OXBA 2PP4A 3CSKA 3KKBA 4CS8A 2HZ8A 2MHRA 3SEOA 1YJGA 1H9GA 3GEEA 5BUOA 3ATPA 2R7QA 1D1BA 3CQZA 3NYMA 4XEVA 4CDAA 1Z7Qc 4FAPB 1HMOA 4JC7A 1ZZPA 2A0UA 2FGYA 3RF3A 3SP1A 4MTOA 3M4CA 5JUAA 4J7YA 1D1CA 3QMKA 4PFPA 1C17M 1V74B 3LEVA 1O87A 3N0TA 4YL0A 1L3PA 3R7CA 4EBJA 5JRAA 3M4BA 4WABA 2YQYA 2HJMA 2HS5A 2VCCA 3ZVRA 3IQ6A 3W2WA 1CPQA 3T6JA 1GGQA 4G78A 2J0XA 2R7XA 1TQGA 2XM0A 4KNWA 1ZU4A 2WB7A 3KMIA 3DXJF 3G4ZA 2WZFA 3ASOC 4OIQF 4LDQA 3WAQA 4XPWA 2A0BA 3S0XA 4XPYA 3A11A 4J7TA 1XWJA 1G4WR 1R5ID 1T01A 4DVYP 1YA9A 1YZCA 4YL3A 4E0IA 4MVMA 2UUHA 2WZGA 1OCOC 5F28E 2XL4A 1A7EA 3JSZA 1VTMP 1EI7A 1QQ3A 2PNOA 1OKKD 1AEPA 4UDVA 1U0BB 2QLAA 1KNYA 5BQGA 4IRUA 3TD7A 5COFA 1MQVA 3V7OA 2IXOA 3M15A 1NBBA 1OW8A 2YLGA 2ZXWC 1CGNA 1K40A 1NU9C 3S84A 1FMWA 1KU2A 3U0CA 3SXYA 4GYTA 4PJMA 4BJ5C 1E84A 3O6XA 1OCZC 3AGTA 1FNTc 1F1MA 3UMKA 1T6IA 5KYYA 3VAYA 1E85A 4LERA 5B3IA 5JT4A 2Y3HA 1YDIA 5DQZA 4C3EA 2J9VA 5F5HA 5A69A 3GWNA 4EHPA 3FAPB 2CW0F 4JKVA 2XLWA 4E0HA 1OKKA 3QW0A 4XLPF 1NFNA 3UGOA 3DAGA 1RCPA 3ECSA 2CNWD 4Q4ZF 2Y3DA 2KK1A 4CJOA 1GM5A 3T6GB 4AE4A 1DOWA 4CSAC 4HFKB 2J7PD 2KW3C 3EGXA 3OA1A 2OQMA 2DB4A 2OJED 3FMSA 4JCZA 1CGOA 3HTKC 3ZG1A 5E2QA 1WN0A 5L3QA 3C18A 3EGDA 3JYYA 3BRJA 5A6BD 4W8PA 3RH3A 4BJ5A 4I1MA 1OCCC 3NKDA 4MVSA 3SXKA 3S27A 4ANJA 3GEHA 2ZD9A 5DLJA 4LLEA 1A0BA 3X2QC 1D0XA 1I4ZA 1RKEA 4P9FA 4RBNA 2R7SA 2H7OA 1VYIA 3K1IC 1NG1A 2J8WA 3H2VA 5F5FA 1WATA 5AGFA 4A2NB 2XXAA 2I8BA 2IM8A 2J7PA 3TOLA 5BQHA 3EQLF 2W4MA 1ORSC 5CIVA 2NUTA 2R7VA 5COMA 1V54C 3S90A 4QI2A 4CS9C 5L0DA 4R32A 1Q0FA 2Q3TA 1TWCA 4XPXA 4I44A 2NUPA 5AC4A 1ORJA 2J9WA 2B0JA 4HFFB 1LPEA 1Q0KA 5D92A 2VC9A 2C04A 1VYKA 1S7ZA 3F46A 1NZEA 4CSAA 1KTMA 3AG3C 5A6BA 1IZMA 3HNJA 1HW1A 1Z5ZA 4MNDA 1RJ9B 1Q0GA 1SF8A 5B1AC 4HEAJ 4DOZA 1U6HA 4H4KC 2RSEB 4MTGA 3EG9B 4IWBA 1A7VA 1V4AA 4P9TA 4QI0A 4JTCB 1ZHZA 1VLTA 3W4YA 1JRAA 3GORA 4CJGA 1UFBA 1ZHTA 1NLXA 3K33A 2EPNA 4LACB 3DM9B 2J46A 4ONSA 3B0VC 2M64A 2PX3A 3I5QA 3F47A 1AVOB 4KC9A 5A6AA 3G4XA 4PK4A 3LS1A 4YJWA 5JSLA 1BZ4A 4U5GA 3DD7A 3UMHA 1YYJA 2GA0A 4U5FE 3JCUQ 3U2LA 4NC3A 2X0CA 4O79A 3U9MA 3RW0A 2IOQA 4XEKA 2TMVP 2KC3A 1J8YF 4EBBA 2LIGA 1HY5A 2YHSA 3OWTA 3O39A 3VYWA 1JPJA 4ZLDA 4EKWA 1EKYA 3V5XA 3ASNC 2QE9A 2A69F 5CI9A 4J30B 2H7BA 1MMDA 2L6HA 3QVZA 4NY3A 2XSEA 4MW8A 5JLIA 4AK9A 3NG1A 4NCQA 2ZPAA 3M79A 4E17A 1TFOB 2EPOA 1JR8A 2QUPA 3AQBA 3FOPA 1J8MF 3LLIA 3ZC4A 3EFOA 4RDAA 4JVSA 5CI8A 2BC5A 3C8GA 5KYWA 3GWLA 3B0UX 2OCCC 2OOCA 4FWVA 3LESA 3RQEA 3GANA 3SZRA 2XLEA 5DQTA 1T5OA 1Z6AA 2OJQA 3JT1A 3OEOA 2P7VA 2YL0A 1JMWA 2Q9BA 2YEVA 4O6YA 4JURI 4OIOF 2HSBA 2KSFA 3GM3A 4Z9JA 3IQTA 5KYXB 3CAXA 3DZAA 3GM2A 3V5ZA 3FOOA 2GDCA 3E70C 1ZW3A 2ASRA 1JPNA 4LDRA 2HV6A 1QPUA 2WVQA 3EFOB 3ITFA 4N4WA 4P6IC 1MMAA 2PF4E 2V26A 4WGZA 4MVUA 3TOMA 4JCHA 5A6KA 2J45A 4O7GA 1AUEA 2XS8A 3DJUB 3RQGA 3W8IA 2AWYA 3WHNA 5DS6A 1EA8A 1EQ1A 1OXKA 3IEEA 2YWAA 5EHHA 1A7DA 3AQCA 2MYSA 4DRHB 5D91A 1YA7O 4OIPF 4AX2A 4FX5A 2KNHA 4XQ1A 1N1CA 4LLCA 4WGYA 4C3DA 2EIKC 4JTAB 3VRCA 1YAUO 3SXZA 4MTFA 3AG1C 3U3FA 3U9JA 3R2PA 3FAJA 2Y3GA 3MFNA 4K0DA 3S28A 4GQHA 2EILC 1DOVA 2DYSC 3LJBA 1QKRA 2WVNA 5DS5A 1QSPA 4MS2A 3NMKA 1QVXA 1LIHA 3US6A 3CZ6A 3H2UA 2XM4A 2WL8A 3ZTMA 3HNKA 2VCAA 3RYLA 4G7OF 3LEOA 1Y6DA 1QZXA 1YARO 3L8IA 4D4XA 4M63A 3FDQA 2OG2A 2O9XA 1OW6A 2BL2A 3RQFA 2L7AA 3RVYA 4MVZA 3EHMA 5AC5A 5KYYB 3DM5A 1SMYF 1FFHA 1OR2A 1SR2A 3SXMA 3NYLA 3JTLO 2CCYA 3LS0A 3O10A 4NTBA 1TR2A 2CYDA 3DI5A 4N06A 2L81A 3JZ0A 2YL7A 2P61A 3JRTA 4CX9A 2QNLA 1MMNA 1YZAA 2XLMA 4NTFA 3FXHA 1BR2A 4YT5A 4E18A 2ICWG 2A6HF 2WZLA 5KYNA 1ZHYA 4ULVA 3POVA 2AVKA 1I5NA 1K05A 4CBEA 3K6BA 1BDJB 1RMVA 4B6IA 5L3VA 2C03A 1LM3B 1D0YA 4U5BE 5E3AA 2DI3A 1TKNA 1GQAA 4C3BA 2PBEA 3PMRA 1BBHA 4N6CA 3U8PA 1H7IA 2YRFA 4AE4B 1Z3IX 2Y69C 2XLHA 1JOGA 1LKXA 2CNWA 1T9KA 2HUJA 3EGXB 2J9BA 5TJ5E 3RVZA 4DBQA 4I3MA 3IHUA 4JEBA 3ZSUA 2PFDA 2IYLD 2NPUA 2YL1A 3EGDB 4RD9A 5B1BC 1PD0A 1IW7F 5FZTA 4JJGA 2Q00A 3SYNA 2R02A 1E2XA 3EJNA 1M6TA 3G50A 1BR4A 3FHDA 1OR3A 1WWPA 5DVWA 4HE8D 3KH2A 1RKEB 3W8HA 3O55A 3DE9A 1SYQA 3A9CA 4N6HA 1Z23A 4U5CE 2WVOA 1O5HA 1APCA 3DE8A 3HJCA 3IPMO 2R7TA 1ZU5A 3EH2A 1QLEC 2XL8A 3S9OA 4EBKA 1Z63A 2XXAB 5L0JA 4OD4A 4JJFA 2CGEA 1NFOA 3GM1A 2NUTB 5JS5A 3U5SA 2XRHA 2G62A 4U5EE 5HV9A 2Q4FA 4J32B 2NUPB 5KYUA 2OEVA 3NRHA 4CDYA 1E86A 2B0HA 2LD6A 2D5RB 1Q0MA 3B0PA 2Y39A 3NMIA 3UR3C 4CS8C 4Z9HA 2YKZA 3K1IA 3T4RA 4BPMA 1TWAA 5B3SC 4JIOA 4OINF 3N2ZB 2JPUA 1H6GA 4IB4A 4G7HF 2OEXA 2VH3A 1PV3A 3ZIBA 5T1DB 4PR9A 1RXQA 1RKCA 4IGGA 3PDMP 3H65A 3IQCA 3B9QA 1LS4A 3GODA 4WJ0A 3RIPA 5GPGB 1PCXA 2R25A 2R7OA 2DGJA 4CS9A 1M56C 1M57C 2LP4A 2W4BA 4D4NA 4C7OA 1OCRC 4CIHA 1HW2A 4XLNF 1G5ZA 4W8KA 2J0WA 5DS4A 1A41A 1HE1A 1MNEA 2AU5A 2I15A 1LI7A 4BJ1A 4DRJB 2XLDA 3K7DA 3RKOF 2FFHA 2AP3A 2P0NA 4ULWA 1M2VA 2A68F 5T3WA 2DYRC 1NU7D 2IXNA 4YK5A 3DKAA 4GEHA 5COGA 1I4YA 2IBFA 2IXPA 2YLIA 3PHF2 3DMDA 4CS7A 1FR0A 1LE4A 3SNHA 2YZSA 2KJGA 3LNMB 4JRZA 4MVRA 2EPLX 3TQOA 3T6BA 3V5YA 5L0GA 4NTAA 1D0ZA 1TWGA 2JX0A 3C63A 2Z15A 2A6EF 4F4BA 2W45A 4JE9A 3VF0A 1W2WA 3JYHA 4ZLCA 5L0HA 2PX0A 4H54A 4YWQA 1TFKB 3HNLA 3Q6MA 1D1AA 4U5DE 4DVZA 5KYXA 3E9VA 1M2VB 2KGOA 3JRMO 3PCVA 3TJ5A 5L0FA 2ETSA 2ZXPA 1ST6A 3T9OA 2V3CC 1S05A 2HMZA 2EPMX 2A1DD 4FESA 2AWCA 4U5HA 3C8GB 2GAQA 2VB6A 4JW1A 2HKVA 5KYWB 2R7UA 1WTYA 2Y3BA 2L6FA 3EPVA 2W9YA 3NYJA 3IQ5A 1WGWA 2ZXRA 3GEIA 2R7WA 2ZXOA 4Q7CA 3ABMC 2KQ9A 2Q9AA 4CIPA 4PFOA 4JZAA 3AOUA 3U3BA 4PJLA 2LQGA 2R05A 4XEFA 4AL1A 4DBRA 1CGME 4MQ9F 1VMAA 4KI2A 3M1CB 5EGYA 5L0CA 3UGPA 2CDQA 2VASA 1G4US 4O6MA 3MBGA 4KBLA 2X51A 1MNDA 4BJ6C 1R4TA 2EIMC 5IY5C 2J9UA 4PJNA 4IAOA 2XLVA 3LUTB 1ORYA 4E7SA 2L9JA 3QW1A 1LE2A 3L0IA 3NMJA 4K1OA 4NQFA 1OQCA 4ER9A 3B71A 1C03A 2UUIA 3MYFA 3ZQVA 4AL0A 3JSEO 4EIYA 4QDLA 2HMQA 3C62A 2NSFA 2P1AA 1VOMA 4G0HA 2LFFA 2OU6A 3J06A 2G3VA 1HE9A 3EZHA 2BE5F 2LFDA 3Q6NA 2XS1A 4I1OB 2G3KA 2LK4A 2Q7RA 5L0IA 5JP7A 3KL4A 3C7JA 3W2VA 3EZIA 1JAFA 1XZQA 2E87A 3L34A 4OIRF 3S29A 3HKKA 5E3CA 3ZWIA 4U9EA 3TULA 4IAQA 4YT2A 2KYHA 5A6JA 3HNIA 4PJJA 4XTKA 2QTVA 3WODF 2OKUA 3X1OA 4A4AA 2VCBA 3UNGC 4IJJA 2YVKA 1C02A 4E7ZA 3MLGA 4PACA 2L6GA 4KNVA 4BJ6A 2YLDA 1ZHWA 5HSWA 2MWQA 5EK0A 1Y4CA 3QVYA 2H7VC 4BJTA 4K7BA 2XL6A 1XZPA 3DAFA 2R03A 4DJ9A 4BG0A 1ZYRF 2P6VA
chains in the Genus database with same CATH topology
4O6NA 3AG4C 2JD3A 2HV7A 1SZIA 4EWCA 4X0RA 3ABKC 3LLKA 3ABLC 2EIJC 3LAYA 1VK5A 4OD5A 1V55C 4G7ZF 3LNRA 3K1HA 3EH1A 2LSEA 1RJ9A 1TWHA 1MMGA 2R7RA 2IXMA 3EG9A 3I5PA 4YT4A 4YT8A 3EHNA 1BR1A 1PD1A 5FCLA 1FFTC 3K66A 5E33A 1G8XA 3Q7GA 3FVYA 4XWJA 3UMIA 4BEJA 3WG7C 3N24A 3HLZA 5KYUB 1LVKA 3DJNB 3NKEA 5T3TA 2GFHA 2QY9A 2Q9CA 3QZCA 3NDBB 4YN0B 2M4EA 3AG2C 2EINC 1M2OA 3MX3A 1LS1A 4C7OB 3RFYA 2NG1A 3Q7LA 1ZHXA 3I4UA 4Q5SF 1FTSA 1FMVA 3KKBA 2PP4A 3CSKA 4CS8A 3SEOA 5BUOA 2R7QA 1D1BA 3CQZA 3NYMA 2FGYA 3SP1A 1D1CA 3QMKA 4PFPA 5KYXA 3LEVA 1O87A 3N0TA 3ZVRA 3W2WA 3T6JA 2J0XA 2R7XA 4KNWA 1ZU4A 2WB7A 3KMIA 3DXJF 2WZFA 3ASOC 4OIQF 3S0XA 4DVYP 2WZGA 1OCOC 2XL4A 3JSZA 1OKKD 4IRUA 3TD7A 3V7OA 2IXOA 2ZXWC 1NU9C 1FMWA 1KU2A 4GYTA 4PJMA 4BJ5C 3O6XA 1OCZC 3UMKA 5KYYA 3VAYA 4LERA 2Y3HA 5DQZA 4C3EA 2J9VA 5F5HA 2CW0F 1OKKA 4XLPF 3UGOA 3DAGA 3ECSA 2CNWD 4Q4ZF 2Y3DA 4AE4A 4CSAC 4HFKB 2J7PD 2KW3C 3EGXA 3OA1A 3HTKC 3ZG1A 5E2QA 5L3QA 3EGDA 4BJ5A 3RH3A 4I1MA 1OCCC 3NKDA 3S27A 4ANJA 5DLJA 4LLEA 3X2QC 1D0XA 2R7SA 4RBNA 2H7OA 1VYIA 3K1IC 1NG1A 5F5FA 4A2NB 2XXAA 2I8BA 2J7PA 3EQLF 2W4MA 2NUTA 2R7VA 1V54C 4QI2A 4CS9C 2Q3TA 1TWCA 4I44A 2NUPA 2J9WA 2B0JA 4HFFB 5D92A 2C04A 1VYKA 1S7ZA 3F46A 1NZEA 4CSAA 3AG3C 1IZMA 1Z5ZA 4MNDA 1RJ9B 1SF8A 5B1AC 4HEAJ 4DOZA 4H4KC 3EG9B 4IWBA 4QI0A 1ZHZA 1ZHTA 3K33A 4LACB 3DM9B 2J46A 3B0VC 2PX3A 3I5QA 3F47A 4KC9A 4PK4A 3LS1A 4YJWA 4U5GA 3UMHA 3DD7A 4U5FE 3JCUQ 4O79A 2IOQA 1J8YF 4EBBA 2YHSA 3OWTA 3O39A 3VYWA 1JPJA 4ZLDA 3ASNC 2A69F 5CI9A 4J30B 2H7BA 1MMDA 4NY3A 2XSEA 4AK9A 3NG1A 2ZPAA 3AQBA 1J8MF 3LLIA 3ZC4A 3EFOA 4RDAA 4JVSA 5CI8A 5KYWA 3B0UX 2OCCC 4FWVA 3LESA 3GANA 3SZRA 5DQTA 1Z6AA 3JT1A 3OEOA 2P7VA 2Q9BA 2YEVA 4O6YA 4JURI 4OIOF 5KYXB 3DZAA 3E70C 1JPNA 2HV6A 3EFOB 2WVQA 3ITFA 4P6IC 1MMAA 2PF4E 2V26A 4JCHA 2J45A 4O7GA 3DJUB 3W8IA 5DS6A 3IEEA 5EHHA 4OIPF 3AQCA 2MYSA 5D91A 4AX2A 4FX5A 2KNHA 1N1CA 4LLCA 4C3DA 2EIKC 3AG1C 3FAJA 2Y3GA 4K0DA 3S28A 2EILC 3LJBA 2DYSC 2WVNA 5DS5A 3CZ6A 2WL8A 3RYLA 4G7OF 1QZXA 4M63A 3FDQA 2OG2A 2O9XA 3EHMA 5KYYB 3DM5A 1SMYF 1FFHA 3NYLA 3LS0A 1TR2A 4N06A 2L81A 3JRTA 1MMNA 1BR2A 4YT5A 2A6HF 2WZLA 5KYNA 1ZHYA 3POVA 4CBEA 3K6BA 4B6IA 5L3VA 2C03A 5E3AA 1D0YA 4U5BE 1TKNA 4C3BA 3PMRA 4AE4B 1Z3IX 2Y69C 1LKXA 3EGXB 2CNWA 4DBQA 4I3MA 3ZSUA 2PFDA 2IYLD 3EGDB 4RD9A 5B1BC 1PD0A 1IW7F 4JJGA 3SYNA 3EJNA 1BR4A 3FHDA 5DVWA 4HE8D 3KH2A 3W8HA 1Z23A 4U5CE 2WVOA 1O5HA 2R7TA 3HJCA 1ZU5A 3EH2A 1QLEC 2XXAB 1Z63A 4OD4A 4JJFA 2CGEA 2NUTB 2XRHA 2G62A 4U5EE 4J32B 2NUPB 5KYUA 3NRHA 2D5RB 3B0PA 2Y39A 3UR3C 4CS8C 3T4RA 5B3SC 1TWAA 4OINF 3N2ZB 4G7HF 2VH3A 3ZIBA 5T1DB 3H65A 3B9QA 3GODA 4WJ0A 3RIPA 1PCXA 2R7OA 4CS9A 2DGJA 4C7OA 1M56C 1M57C 2W4BA 1OCRC 4CIHA 4XLNF 4W8KA 5DS4A 2J0WA 1MNEA 4BJ1A 3K7DA 3RKOF 2FFHA 4ULWA 1M2VA 2A68F 5T3WA 2DYRC 1NU7D 2IXNA 4GEHA 2IXPA 3PHF2 3DMDA 4CS7A 3SNHA 2YZSA 2KJGA 3T6BA 1D0ZA 1TWGA 2Z15A 2A6EF 4F4BA 2W45A 4ZLCA 1W2WA 3JYHA 2PX0A 4YWQA 3Q6MA 4U5DE 4DVZA 1D1AA 3E9VA 1M2VB 2KGOA 2ZXPA 1ST6A 2V3CC 2A1DD 4FESA 4U5HA 5KYWB 2R7UA 2VB6A 4JW1A 2Y3BA 3EPVA 2W9YA 3NYJA 1WGWA 2ZXRA 2R7WA 2ZXOA 4Q7CA 3ABMC 2KQ9A 2Q9AA 4PFOA 4JZAA 4PJLA 4DBRA 4MQ9F 1VMAA 4KI2A 3M1CB 5EGYA 3UGPA 2CDQA 2VASA 4O6MA 4KBLA 2X51A 1MNDA 4BJ6C 2EIMC 5IY5C 2J9UA 4PJNA 4IAOA 4E7SA 2L9JA 3L0IA 4QDLA 4G0HA 1VOMA 2G3VA 3EZHA 2BE5F 3Q6NA 4I1OB 2G3KA 3KL4A 3W2VA 3EZIA 3L34A 2E87A 4OIRF 3S29A 5E3CA 4YT2A 4PJJA 4XTKA 2QTVA 3WODF 3X1OA 3UNGC 4IJJA 4E7ZA 3MLGA 4KNVA 5HSWA 4BJ6A 1ZHWA 2MWQA 2H7VC 4BJTA 4K7BA 3DAFA 4BG0A 1ZYRF 2P6VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T4R A; 
#chains in the Genus database with same CATH topology
 1FAP B;  4L6R A;  3C8Z A;  4LDK A;  4O6N A;  3AG4 C;  4MW3 A;  4MVQ A;  3AGU A;  3TK0 A;  3ZQY A;  2XLO A;  3B29 A;  2JD3 A;  2HV7 A;  2HFI A;  1VB5 A;  1SZI A;  4DRI B;  3KYJ A;  3ZDL A;  4X0R A;  4EWC A;  2R9R B;  1E83 A;  2H8A A;  1CPR A;  3ABK C;  3KPH A;  3LLK A;  3ABL C;  3CEX A;  3QTH A;  2EIJ C;  1GS9 A;  5K0I A;  3LAY A;  1YLM A;  1H9T A;  1UG7 A;  1VK5 A;  4BEM J;  4YL1 A;  1YVI A;  1ZVZ A;  4OD5 A;  1V55 C;  2GWW A;  3LNR A;  4G7Z F;  3K1H A;  3AJM A;  3EH1 A;  3L1M A;  4JEA A;  1YYX A;  2LSE A;  4Z9I A;  1RJ9 A;  1HMD A;  1TWH A;  1MMG A;  1NSG B;  2IXM A;  256B A;  2R7R A;  3EG9 A;  3VM6 A;  3I5P A;  4YT4 A;  4YT8 A;  3EHN A;  1O3U A;  1BR1 A;  1K04 A;  2HSQ A;  1PD1 A;  5FCL A;  1ZW2 A;  2EPK X;  1FFT C;  3K66 A;  5E33 A;  1G8X A;  1L7C A;  2FAP B;  4DXW A;  3MYI A;  3Q7G A;  1T6U A;  1U89 A;  3FVY A;  4XWJ A;  3UMI A;  3U8V A;  4BEJ A;  1OW7 A;  2HJ3 A;  3WG7 C;  3N24 A;  3HLZ A;  4CDV A;  5KYU B;  1LVK A;  3DJN B;  3L8J A;  3NKE A;  5T3T A;  1Q0D A;  3KYI A;  2LCH A;  2GFH A;  2QY9 A;  3ZTZ A;  2Q9C A;  2D4U A;  3TJ6 A;  1T6Q A;  3QZC A;  1WOL A;  1WAS A;  4IAR A;  3NDB B;  4MVO A;  2F22 A;  1LI5 A;  4YN0 B;  2M4E A;  3AG2 C;  2EIN C;  3BEH A;  1M2O A;  3DWW A;  1LS1 A;  3MX3 A;  5JVE A;  2RD9 A;  1VLS A;  4JTD B;  4EUK B;  5BQI A;  4C7O B;  1B68 A;  4U9D A;  2NG1 A;  3RFY A;  3Q7L A;  3C8G D;  1ZHX A;  3I4U A;  4Q5S F;  2YL3 A;  1FTS A;  3U2M A;  2NSG A;  1FMV A;  1OXB A;  2PP4 A;  3CSK A;  3KKB A;  4CS8 A;  2HZ8 A;  2MHR A;  3SEO A;  1YJG A;  1H9G A;  3GEE A;  5BUO A;  3ATP A;  2R7Q A;  1D1B A;  3CQZ A;  3NYM A;  4XEV A;  4CDA A;  1Z7Q c;  4FAP B;  1HMO A;  4JC7 A;  1ZZP A;  2A0U A;  2FGY A;  3RF3 A;  3SP1 A;  4MTO A;  3M4C A;  5JUA A;  4J7Y A;  1D1C A;  3QMK A;  4PFP A;  1C17 M;  1V74 B;  3LEV A;  1O87 A;  3N0T A;  4YL0 A;  1L3P A;  3R7C A;  4EBJ A;  5JRA A;  3M4B A;  4WAB A;  2YQY A;  2HJM A;  2HS5 A;  2VCC A;  3ZVR A;  3IQ6 A;  3W2W A;  1CPQ A;  3T6J A;  1GGQ A;  4G78 A;  2J0X A;  2R7X A;  1TQG A;  2XM0 A;  4KNW A;  1ZU4 A;  2WB7 A;  3KMI A;  3DXJ F;  3G4Z A;  2WZF A;  3ASO C;  4OIQ F;  4LDQ A;  3WAQ A;  4XPW A;  2A0B A;  3S0X A;  4XPY A;  3A11 A;  4J7T A;  1XWJ A;  1G4W R;  1R5I D;  1T01 A;  4DVY P;  1YA9 A;  1YZC A;  4YL3 A;  4E0I A;  4MVM A;  2UUH A;  2WZG A;  1OCO C;  5F28 E;  2XL4 A;  1A7E A;  3JSZ A;  1VTM P;  1EI7 A;  1QQ3 A;  2PNO A;  1OKK D;  1AEP A;  4UDV A;  1U0B B;  2QLA A;  1KNY A;  5BQG A;  4IRU A;  3TD7 A;  5COF A;  1MQV A;  3V7O A;  2IXO A;  3M15 A;  1NBB A;  1OW8 A;  2YLG A;  2ZXW C;  1CGN A;  1K40 A;  1NU9 C;  3S84 A;  1FMW A;  1KU2 A;  3U0C A;  3SXY A;  4GYT A;  4PJM A;  4BJ5 C;  1E84 A;  3O6X A;  1OCZ C;  3AGT A;  1FNT c;  1F1M A;  3UMK A;  1T6I A;  5KYY A;  3VAY A;  1E85 A;  4LER A;  5B3I A;  5JT4 A;  2Y3H A;  1YDI A;  5DQZ A;  4C3E A;  2J9V A;  5F5H A;  5A69 A;  3GWN A;  4EHP A;  3FAP B;  2CW0 F;  4JKV A;  2XLW A;  4E0H A;  1OKK A;  3QW0 A;  4XLP F;  1NFN A;  3UGO A;  3DAG A;  1RCP A;  3ECS A;  2CNW D;  4Q4Z F;  2Y3D A;  2KK1 A;  4CJO A;  1GM5 A;  3T6G B;  4AE4 A;  1DOW A;  4CSA C;  4HFK B;  2J7P D;  2KW3 C;  3EGX A;  3OA1 A;  2OQM A;  2DB4 A;  2OJE D;  3FMS A;  4JCZ A;  1CGO A;  3HTK C;  3ZG1 A;  5E2Q A;  1WN0 A;  5L3Q A;  3C18 A;  3EGD A;  3JYY A;  3BRJ A;  5A6B D;  4W8P A;  3RH3 A;  4BJ5 A;  4I1M A;  1OCC C;  3NKD A;  4MVS A;  3SXK A;  3S27 A;  4ANJ A;  3GEH A;  2ZD9 A;  5DLJ A;  4LLE A;  1A0B A;  3X2Q C;  1D0X A;  1I4Z A;  1RKE A;  4P9F A;  4RBN A;  2R7S A;  2H7O A;  1VYI A;  3K1I C;  1NG1 A;  2J8W A;  3H2V A;  5F5F A;  1WAT A;  5AGF A;  4A2N B;  2XXA A;  2I8B A;  2IM8 A;  2J7P A;  3TOL A;  5BQH A;  3EQL F;  2W4M A;  1ORS C;  5CIV A;  2NUT A;  2R7V A;  5COM A;  1V54 C;  3S90 A;  4QI2 A;  4CS9 C;  5L0D A;  4R32 A;  1Q0F A;  2Q3T A;  1TWC A;  4XPX A;  4I44 A;  2NUP A;  5AC4 A;  1ORJ A;  2J9W A;  2B0J A;  4HFF B;  1LPE A;  1Q0K A;  5D92 A;  2VC9 A;  2C04 A;  1VYK A;  1S7Z A;  3F46 A;  1NZE A;  4CSA A;  1KTM A;  3AG3 C;  5A6B A;  1IZM A;  3HNJ A;  1HW1 A;  1Z5Z A;  4MND A;  1RJ9 B;  1Q0G A;  1SF8 A;  5B1A C;  4HEA J;  4DOZ A;  1U6H A;  4H4K C;  2RSE B;  4MTG A;  3EG9 B;  4IWB A;  1A7V A;  1V4A A;  4P9T A;  4QI0 A;  4JTC B;  1ZHZ A;  1VLT A;  3W4Y A;  1JRA A;  3GOR A;  4CJG A;  1UFB A;  1ZHT A;  1NLX A;  3K33 A;  2EPN A;  4LAC B;  3DM9 B;  2J46 A;  4ONS A;  3B0V C;  2M64 A;  2PX3 A;  3I5Q A;  3F47 A;  1AVO B;  4KC9 A;  5A6A A;  3G4X A;  4PK4 A;  3LS1 A;  4YJW A;  5JSL A;  1BZ4 A;  4U5G A;  3DD7 A;  3UMH A;  1YYJ A;  2GA0 A;  4U5F E;  3JCU Q;  3U2L A;  4NC3 A;  2X0C A;  4O79 A;  3U9M A;  3RW0 A;  2IOQ A;  4XEK A;  2TMV P;  2KC3 A;  1J8Y F;  4EBB A;  2LIG A;  1HY5 A;  2YHS A;  3OWT A;  3O39 A;  3VYW A;  1JPJ A;  4ZLD A;  4EKW A;  1EKY A;  3V5X A;  3ASN C;  2QE9 A;  2A69 F;  5CI9 A;  4J30 B;  2H7B A;  1MMD A;  2L6H A;  3QVZ A;  4NY3 A;  2XSE A;  4MW8 A;  5JLI A;  4AK9 A;  3NG1 A;  4NCQ A;  2ZPA A;  3M79 A;  4E17 A;  1TFO B;  2EPO A;  1JR8 A;  2QUP A;  3AQB A;  3FOP A;  1J8M F;  3LLI A;  3ZC4 A;  3EFO A;  4RDA A;  4JVS A;  5CI8 A;  2BC5 A;  3C8G A;  5KYW A;  3GWL A;  3B0U X;  2OCC C;  2OOC A;  4FWV A;  3LES A;  3RQE A;  3GAN A;  3SZR A;  2XLE A;  5DQT A;  1T5O A;  1Z6A A;  2OJQ A;  3JT1 A;  3OEO A;  2P7V A;  2YL0 A;  1JMW A;  2Q9B A;  2YEV A;  4O6Y A;  4JUR I;  4OIO F;  2HSB A;  2KSF A;  3GM3 A;  4Z9J A;  3IQT A;  5KYX B;  3CAX A;  3DZA A;  3GM2 A;  3V5Z A;  3FOO A;  2GDC A;  3E70 C;  1ZW3 A;  2ASR A;  1JPN A;  4LDR A;  2HV6 A;  1QPU A;  2WVQ A;  3EFO B;  3ITF A;  4N4W A;  4P6I C;  1MMA A;  2PF4 E;  2V26 A;  4WGZ A;  4MVU A;  3TOM A;  4JCH A;  5A6K A;  2J45 A;  4O7G A;  1AUE A;  2XS8 A;  3DJU B;  3RQG A;  3W8I A;  2AWY A;  3WHN A;  5DS6 A;  1EA8 A;  1EQ1 A;  1OXK A;  3IEE A;  2YWA A;  5EHH A;  1A7D A;  3AQC A;  2MYS A;  4DRH B;  5D91 A;  1YA7 O;  4OIP F;  4AX2 A;  4FX5 A;  2KNH A;  4XQ1 A;  1N1C A;  4LLC A;  4WGY A;  4C3D A;  2EIK C;  4JTA B;  3VRC A;  1YAU O;  3SXZ A;  4MTF A;  3AG1 C;  3U3F A;  3U9J A;  3R2P A;  3FAJ A;  2Y3G A;  3MFN A;  4K0D A;  3S28 A;  4GQH A;  2EIL C;  1DOV A;  2DYS C;  3LJB A;  1QKR A;  2WVN A;  5DS5 A;  1QSP A;  4MS2 A;  3NMK A;  1QVX A;  1LIH A;  3US6 A;  3CZ6 A;  3H2U A;  2XM4 A;  2WL8 A;  3ZTM A;  3HNK A;  2VCA A;  3RYL A;  4G7O F;  3LEO A;  1Y6D A;  1QZX A;  1YAR O;  3L8I A;  4D4X A;  4M63 A;  3FDQ A;  2OG2 A;  2O9X A;  1OW6 A;  2BL2 A;  3RQF A;  2L7A A;  3RVY A;  4MVZ A;  3EHM A;  5AC5 A;  5KYY B;  3DM5 A;  1SMY F;  1FFH A;  1OR2 A;  1SR2 A;  3SXM A;  3NYL A;  3JTL O;  2CCY A;  3LS0 A;  3O10 A;  4NTB A;  1TR2 A;  2CYD A;  3DI5 A;  4N06 A;  2L81 A;  3JZ0 A;  2YL7 A;  2P61 A;  3JRT A;  4CX9 A;  2QNL A;  1MMN A;  1YZA A;  2XLM A;  4NTF A;  3FXH A;  1BR2 A;  4YT5 A;  4E18 A;  2ICW G;  2A6H F;  2WZL A;  5KYN A;  1ZHY A;  4ULV A;  3POV A;  2AVK A;  1I5N A;  1K05 A;  4CBE A;  3K6B A;  1BDJ B;  1RMV A;  4B6I A;  5L3V A;  2C03 A;  1LM3 B;  1D0Y A;  4U5B E;  5E3A A;  2DI3 A;  1TKN A;  1GQA A;  4C3B A;  2PBE A;  3PMR A;  1BBH A;  4N6C A;  3U8P A;  1H7I A;  2YRF A;  4AE4 B;  1Z3I X;  2Y69 C;  2XLH A;  1JOG A;  1LKX A;  2CNW A;  1T9K A;  2HUJ A;  3EGX B;  2J9B A;  5TJ5 E;  3RVZ A;  4DBQ A;  4I3M A;  3IHU A;  4JEB A;  3ZSU A;  2PFD A;  2IYL D;  2NPU A;  2YL1 A;  3EGD B;  4RD9 A;  5B1B C;  1PD0 A;  1IW7 F;  5FZT A;  4JJG A;  2Q00 A;  3SYN A;  2R02 A;  1E2X A;  3EJN A;  1M6T A;  3G50 A;  1BR4 A;  3FHD A;  1OR3 A;  1WWP A;  5DVW A;  4HE8 D;  3KH2 A;  1RKE B;  3W8H A;  3O55 A;  3DE9 A;  1SYQ A;  3A9C A;  4N6H A;  1Z23 A;  4U5C E;  2WVO A;  1O5H A;  1APC A;  3DE8 A;  3HJC A;  3IPM O;  2R7T A;  1ZU5 A;  3EH2 A;  1QLE C;  2XL8 A;  3S9O A;  4EBK A;  1Z63 A;  2XXA B;  5L0J A;  4OD4 A;  4JJF A;  2CGE A;  1NFO A;  3GM1 A;  2NUT B;  5JS5 A;  3U5S A;  2XRH A;  2G62 A;  4U5E E;  5HV9 A;  2Q4F A;  4J32 B;  2NUP B;  5KYU A;  2OEV A;  3NRH A;  4CDY A;  1E86 A;  2B0H A;  2LD6 A;  2D5R B;  1Q0M A;  3B0P A;  2Y39 A;  3NMI A;  3UR3 C;  4CS8 C;  4Z9H A;  2YKZ A;  3K1I A;  3T4R A;  4BPM A;  1TWA A;  5B3S C;  4JIO A;  4OIN F;  3N2Z B;  2JPU A;  1H6G A;  4IB4 A;  4G7H F;  2OEX A;  2VH3 A;  1PV3 A;  3ZIB A;  5T1D B;  4PR9 A;  1RXQ A;  1RKC A;  4IGG A;  3PDM P;  3H65 A;  3IQC A;  3B9Q A;  1LS4 A;  3GOD A;  4WJ0 A;  3RIP A;  5GPG B;  1PCX A;  2R25 A;  2R7O A;  2DGJ A;  4CS9 A;  1M56 C;  1M57 C;  2LP4 A;  2W4B A;  4D4N A;  4C7O A;  1OCR C;  4CIH A;  1HW2 A;  4XLN F;  1G5Z A;  4W8K A;  2J0W A;  5DS4 A;  1A41 A;  1HE1 A;  1MNE A;  2AU5 A;  2I15 A;  1LI7 A;  4BJ1 A;  4DRJ B;  2XLD A;  3K7D A;  3RKO F;  2FFH A;  2AP3 A;  2P0N A;  4ULW A;  1M2V A;  2A68 F;  5T3W A;  2DYR C;  1NU7 D;  2IXN A;  4YK5 A;  3DKA A;  4GEH A;  5COG A;  1I4Y A;  2IBF A;  2IXP A;  2YLI A;  3PHF 2;  3DMD A;  4CS7 A;  1FR0 A;  1LE4 A;  3SNH A;  2YZS A;  2KJG A;  3LNM B;  4JRZ A;  4MVR A;  2EPL X;  3TQO A;  3T6B A;  3V5Y A;  5L0G A;  4NTA A;  1D0Z A;  1TWG A;  2JX0 A;  3C63 A;  2Z15 A;  2A6E F;  4F4B A;  2W45 A;  4JE9 A;  3VF0 A;  1W2W A;  3JYH A;  4ZLC A;  5L0H A;  2PX0 A;  4H54 A;  4YWQ A;  1TFK B;  3HNL A;  3Q6M A;  1D1A A;  4U5D E;  4DVZ A;  5KYX A;  3E9V A;  1M2V B;  2KGO A;  3JRM O;  3PCV A;  3TJ5 A;  5L0F A;  2ETS A;  2ZXP A;  1ST6 A;  3T9O A;  2V3C C;  1S05 A;  2HMZ A;  2EPM X;  2A1D D;  4FES A;  2AWC A;  4U5H A;  3C8G B;  2GAQ A;  2VB6 A;  4JW1 A;  2HKV A;  5KYW B;  2R7U A;  1WTY A;  2Y3B A;  2L6F A;  3EPV A;  2W9Y A;  3NYJ A;  3IQ5 A;  1WGW A;  2ZXR A;  3GEI A;  2R7W A;  2ZXO A;  4Q7C A;  3ABM C;  2KQ9 A;  2Q9A A;  4CIP A;  4PFO A;  4JZA A;  3AOU A;  3U3B A;  4PJL A;  2LQG A;  2R05 A;  4XEF A;  4AL1 A;  4DBR A;  1CGM E;  4MQ9 F;  1VMA A;  4KI2 A;  3M1C B;  5EGY A;  5L0C A;  3UGP A;  2CDQ A;  2VAS A;  1G4U S;  4O6M A;  3MBG A;  4KBL A;  2X51 A;  1MND A;  4BJ6 C;  1R4T A;  2EIM C;  5IY5 C;  2J9U A;  4PJN A;  4IAO A;  2XLV A;  3LUT B;  1ORY A;  4E7S A;  2L9J A;  3QW1 A;  1LE2 A;  3L0I A;  3NMJ A;  4K1O A;  4NQF A;  1OQC A;  4ER9 A;  3B71 A;  1C03 A;  2UUI A;  3MYF A;  3ZQV A;  4AL0 A;  3JSE O;  4EIY A;  4QDL A;  2HMQ A;  3C62 A;  2NSF A;  2P1A A;  1VOM A;  4G0H A;  2LFF A;  2OU6 A;  3J06 A;  2G3V A;  1HE9 A;  3EZH A;  2BE5 F;  2LFD A;  3Q6N A;  2XS1 A;  4I1O B;  2G3K A;  2LK4 A;  2Q7R A;  5L0I A;  5JP7 A;  3KL4 A;  3C7J A;  3W2V A;  3EZI A;  1JAF A;  1XZQ A;  2E87 A;  3L34 A;  4OIR F;  3S29 A;  3HKK A;  5E3C A;  3ZWI A;  4U9E A;  3TUL A;  4IAQ A;  4YT2 A;  2KYH A;  5A6J A;  3HNI A;  4PJJ A;  4XTK A;  2QTV A;  3WOD F;  2OKU A;  3X1O A;  4A4A A;  2VCB A;  3UNG C;  4IJJ A;  2YVK A;  1C02 A;  4E7Z A;  3MLG A;  4PAC A;  2L6G A;  4KNV A;  4BJ6 A;  2YLD A;  1ZHW A;  5HSW A;  2MWQ A;  5EK0 A;  1Y4C A;  3QVY A;  2H7V C;  4BJT A;  4K7B A;  2XL6 A;  1XZP A;  3DAF A;  2R03 A;  4DJ9 A;  4BG0 A;  1ZYR F;  2P6V A; 
#chains in the Genus database with same CATH homology
 4O6N A;  3AG4 C;  2JD3 A;  2HV7 A;  1SZI A;  4EWC A;  4X0R A;  3ABK C;  3LLK A;  3ABL C;  2EIJ C;  3LAY A;  1VK5 A;  4OD5 A;  1V55 C;  4G7Z F;  3LNR A;  3K1H A;  3EH1 A;  2LSE A;  1RJ9 A;  1TWH A;  1MMG A;  2R7R A;  2IXM A;  3EG9 A;  3I5P A;  4YT4 A;  4YT8 A;  3EHN A;  1BR1 A;  1PD1 A;  5FCL A;  1FFT C;  3K66 A;  5E33 A;  1G8X A;  3Q7G A;  3FVY A;  4XWJ A;  3UMI A;  4BEJ A;  3WG7 C;  3N24 A;  3HLZ A;  5KYU B;  1LVK A;  3DJN B;  3NKE A;  5T3T A;  2GFH A;  2QY9 A;  2Q9C A;  3QZC A;  3NDB B;  4YN0 B;  2M4E A;  3AG2 C;  2EIN C;  1M2O A;  3MX3 A;  1LS1 A;  4C7O B;  3RFY A;  2NG1 A;  3Q7L A;  1ZHX A;  3I4U A;  4Q5S F;  1FTS A;  1FMV A;  3KKB A;  2PP4 A;  3CSK A;  4CS8 A;  3SEO A;  5BUO A;  2R7Q A;  1D1B A;  3CQZ A;  3NYM A;  2FGY A;  3SP1 A;  1D1C A;  3QMK A;  4PFP A;  5KYX A;  3LEV A;  1O87 A;  3N0T A;  3ZVR A;  3W2W A;  3T6J A;  2J0X A;  2R7X A;  4KNW A;  1ZU4 A;  2WB7 A;  3KMI A;  3DXJ F;  2WZF A;  3ASO C;  4OIQ F;  3S0X A;  4DVY P;  2WZG A;  1OCO C;  2XL4 A;  3JSZ A;  1OKK D;  4IRU A;  3TD7 A;  3V7O A;  2IXO A;  2ZXW C;  1NU9 C;  1FMW A;  1KU2 A;  4GYT A;  4PJM A;  4BJ5 C;  3O6X A;  1OCZ C;  3UMK A;  5KYY A;  3VAY A;  4LER A;  2Y3H A;  5DQZ A;  4C3E A;  2J9V A;  5F5H A;  2CW0 F;  1OKK A;  4XLP F;  3UGO A;  3DAG A;  3ECS A;  2CNW D;  4Q4Z F;  2Y3D A;  4AE4 A;  4CSA C;  4HFK B;  2J7P D;  2KW3 C;  3EGX A;  3OA1 A;  3HTK C;  3ZG1 A;  5E2Q A;  5L3Q A;  3EGD A;  4BJ5 A;  3RH3 A;  4I1M A;  1OCC C;  3NKD A;  3S27 A;  4ANJ A;  5DLJ A;  4LLE A;  3X2Q C;  1D0X A;  2R7S A;  4RBN A;  2H7O A;  1VYI A;  3K1I C;  1NG1 A;  5F5F A;  4A2N B;  2XXA A;  2I8B A;  2J7P A;  3EQL F;  2W4M A;  2NUT A;  2R7V A;  1V54 C;  4QI2 A;  4CS9 C;  2Q3T A;  1TWC A;  4I44 A;  2NUP A;  2J9W A;  2B0J A;  4HFF B;  5D92 A;  2C04 A;  1VYK A;  1S7Z A;  3F46 A;  1NZE A;  4CSA A;  3AG3 C;  1IZM A;  1Z5Z A;  4MND A;  1RJ9 B;  1SF8 A;  5B1A C;  4HEA J;  4DOZ A;  4H4K C;  3EG9 B;  4IWB A;  4QI0 A;  1ZHZ A;  1ZHT A;  3K33 A;  4LAC B;  3DM9 B;  2J46 A;  3B0V C;  2PX3 A;  3I5Q A;  3F47 A;  4KC9 A;  4PK4 A;  3LS1 A;  4YJW A;  4U5G A;  3UMH A;  3DD7 A;  4U5F E;  3JCU Q;  4O79 A;  2IOQ A;  1J8Y F;  4EBB A;  2YHS A;  3OWT A;  3O39 A;  3VYW A;  1JPJ A;  4ZLD A;  3ASN C;  2A69 F;  5CI9 A;  4J30 B;  2H7B A;  1MMD A;  4NY3 A;  2XSE A;  4AK9 A;  3NG1 A;  2ZPA A;  3AQB A;  1J8M F;  3LLI A;  3ZC4 A;  3EFO A;  4RDA A;  4JVS A;  5CI8 A;  5KYW A;  3B0U X;  2OCC C;  4FWV A;  3LES A;  3GAN A;  3SZR A;  5DQT A;  1Z6A A;  3JT1 A;  3OEO A;  2P7V A;  2Q9B A;  2YEV A;  4O6Y A;  4JUR I;  4OIO F;  5KYX B;  3DZA A;  3E70 C;  1JPN A;  2HV6 A;  3EFO B;  2WVQ A;  3ITF A;  4P6I C;  1MMA A;  2PF4 E;  2V26 A;  4JCH A;  2J45 A;  4O7G A;  3DJU B;  3W8I A;  5DS6 A;  3IEE A;  5EHH A;  4OIP F;  3AQC A;  2MYS A;  5D91 A;  4AX2 A;  4FX5 A;  2KNH A;  1N1C A;  4LLC A;  4C3D A;  2EIK C;  3AG1 C;  3FAJ A;  2Y3G A;  4K0D A;  3S28 A;  2EIL C;  3LJB A;  2DYS C;  2WVN A;  5DS5 A;  3CZ6 A;  2WL8 A;  3RYL A;  4G7O F;  1QZX A;  4M63 A;  3FDQ A;  2OG2 A;  2O9X A;  3EHM A;  5KYY B;  3DM5 A;  1SMY F;  1FFH A;  3NYL A;  3LS0 A;  1TR2 A;  4N06 A;  2L81 A;  3JRT A;  1MMN A;  1BR2 A;  4YT5 A;  2A6H F;  2WZL A;  5KYN A;  1ZHY A;  3POV A;  4CBE A;  3K6B A;  4B6I A;  5L3V A;  2C03 A;  5E3A A;  1D0Y A;  4U5B E;  1TKN A;  4C3B A;  3PMR A;  4AE4 B;  1Z3I X;  2Y69 C;  1LKX A;  3EGX B;  2CNW A;  4DBQ A;  4I3M A;  3ZSU A;  2PFD A;  2IYL D;  3EGD B;  4RD9 A;  5B1B C;  1PD0 A;  1IW7 F;  4JJG A;  3SYN A;  3EJN A;  1BR4 A;  3FHD A;  5DVW A;  4HE8 D;  3KH2 A;  3W8H A;  1Z23 A;  4U5C E;  2WVO A;  1O5H A;  2R7T A;  3HJC A;  1ZU5 A;  3EH2 A;  1QLE C;  2XXA B;  1Z63 A;  4OD4 A;  4JJF A;  2CGE A;  2NUT B;  2XRH A;  2G62 A;  4U5E E;  4J32 B;  2NUP B;  5KYU A;  3NRH A;  2D5R B;  3B0P A;  2Y39 A;  3UR3 C;  4CS8 C;  3T4R A;  5B3S C;  1TWA A;  4OIN F;  3N2Z B;  4G7H F;  2VH3 A;  3ZIB A;  5T1D B;  3H65 A;  3B9Q A;  3GOD A;  4WJ0 A;  3RIP A;  1PCX A;  2R7O A;  4CS9 A;  2DGJ A;  4C7O A;  1M56 C;  1M57 C;  2W4B A;  1OCR C;  4CIH A;  4XLN F;  4W8K A;  5DS4 A;  2J0W A;  1MNE A;  4BJ1 A;  3K7D A;  3RKO F;  2FFH A;  4ULW A;  1M2V A;  2A68 F;  5T3W A;  2DYR C;  1NU7 D;  2IXN A;  4GEH A;  2IXP A;  3PHF 2;  3DMD A;  4CS7 A;  3SNH A;  2YZS A;  2KJG A;  3T6B A;  1D0Z A;  1TWG A;  2Z15 A;  2A6E F;  4F4B A;  2W45 A;  4ZLC A;  1W2W A;  3JYH A;  2PX0 A;  4YWQ A;  3Q6M A;  4U5D E;  4DVZ A;  1D1A A;  3E9V A;  1M2V B;  2KGO A;  2ZXP A;  1ST6 A;  2V3C C;  2A1D D;  4FES A;  4U5H A;  5KYW B;  2R7U A;  2VB6 A;  4JW1 A;  2Y3B A;  3EPV A;  2W9Y A;  3NYJ A;  1WGW A;  2ZXR A;  2R7W A;  2ZXO A;  4Q7C A;  3ABM C;  2KQ9 A;  2Q9A A;  4PFO A;  4JZA A;  4PJL A;  4DBR A;  4MQ9 F;  1VMA A;  4KI2 A;  3M1C B;  5EGY A;  3UGP A;  2CDQ A;  2VAS A;  4O6M A;  4KBL A;  2X51 A;  1MND A;  4BJ6 C;  2EIM C;  5IY5 C;  2J9U A;  4PJN A;  4IAO A;  4E7S A;  2L9J A;  3L0I A;  4QDL A;  4G0H A;  1VOM A;  2G3V A;  3EZH A;  2BE5 F;  3Q6N A;  4I1O B;  2G3K A;  3KL4 A;  3W2V A;  3EZI A;  3L34 A;  2E87 A;  4OIR F;  3S29 A;  5E3C A;  4YT2 A;  4PJJ A;  4XTK A;  2QTV A;  3WOD F;  3X1O A;  3UNG C;  4IJJ A;  4E7Z A;  3MLG A;  4KNV A;  5HSW A;  4BJ6 A;  1ZHW A;  2MWQ A;  2H7V C;  4BJT A;  4K7B A;  3DAF A;  4BG0 A;  1ZYR F;  2P6V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...