3T4RA

Lettuce necrotic yellow virus phosphoprotein c-terminal domain
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
72
structure length
72
Chain Sequence
b'RIRHEKEKLLADLDWEIGEIAQYTPLIVDFLVPDDILAMAADGLTPELKEKIQNEIIENHIALMALEEYSSL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphoprotein
publication title Structure of the C-terminal domain of lettuce necrotic yellows virus phosphoprotein.
pubmed doi rcsb
source organism Lettuce necrotic yellows virus
molecule tags Viral protein
total genus 23
structure length 72
sequence length 72
ec nomenclature
pdb deposition date 2011-07-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1590 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3t4rA00
3T4RA
chains in the Genus database with same CATH superfamily
4MTFA 1WN0A 1K04A 1MNEA 3RVYA 2BC5A 1OW8A 1KNYA 2JD3A 1J8MF 4IGGA 4YL1A 2HKVA 2EPNA 2J0WA 3EZHA 3KYIA 2Q00A 3M4CA 5KYNA 4JEAA 1HE9A 1YA7O 1G5ZA 4D4XA 2XL6A 4JC7A 2XLEA 2FFHA 2GAQA 2XLWA 4NTAA 2C03A 3E70C 1IZMA 5L0CA 3AG2C 5D92A 1CPRA 3S29A 3C8ZA 1MMGA 4DVYP 2G3KA 3K66A 2GWWA 3FOOA 3LLKA 4J7TA 2XS8A 1LM3B 2HV6A 1LE2A 1PV3A 2OJED 4MVMA 4Q7CA 4RBNA 4U5DE 2E87A 3FAJA 3ZDLA 2LP4A 5E3CA 2V3CC 2OCCC 2WL8A 1YDIA 2F22A 2L6GA 1V4AA 4JJFA 4MW8A 4CSAC 3B0UX 2XL4A 4G0HA 4I1OB 2LD6A 3EJNA 1A7DA 4K1OA 4PFOA 2NSFA 2VCCA 3C18A 2P0NA 3LS0A 1E84A 1C17M 4JTCB 1OW6A 1Z3IX 1PD0A 3ZIBA 2CNWA 2EILC 4CX9A 1AEPA 4DBRA 4JVSA 3POVA 3EH1A 4XPWA 3UMHA 1WWPA 1NZEA 2KNHA 2YVKA 3QVYA 2EPLX 4IJJA 4O7GA 1YYJA 1ZW2A 4E0HA 4CSAA 2QE9A 1EKYA 3WAQA 3JYYA 1V54C 3NMKA 4EBJA 4MS2A 3T9OA 2KGOA 4ONSA 3LEVA 1BBHA 1Y4CA 2LQGA 1O5HA 1ZHXA 2DYRC 1T6IA 2FGYA 3ASNC 3EQLF 4O79A 3CSKA 2CYDA 4C3DA 4Z9HA 3ZVRA 1JPNA 2A6EF 1YYXA 2W9YA 4MTGA 2OU6A 4KNWA 4ULVA 2M4EA 3EHMA 1Z7Qc 3DD7A 3ZWIA 5A6JA 4L6RA 1D1AA 1TWCA 4LACB 1ORYA 5F5FA 5F28E 1NG1A 1OKKD 3LNMB 3AJMA 1M57C 3L8JA 3V7OA 2UUIA 4MVOA 5KYYA 3M15A 3M4BA 3SEOA 2W4MA 2WB7A 1WGWA 2W45A 4H54A 1EI7A 1HY5A 3ZTMA 2GFHA 2EIJC 3QVZA 5D91A 5T3TA 4BG0A 3J06A 4XLNF 2AWCA 4WABA 5DQTA 3B0VC 5A6AA 2J9WA 3TULA 3I5QA 3LS1A 4HEAJ 4NTFA 4Z9IA 4WJ0A 3SP1A 4E18A 1J8YF 2J8WA 4EBKA 2LK4A 1QQ3A 3AGTA 3DJNB 3U2MA 3UMIA 4DVZA 3FMSA 3IQ5A 5BQHA 4NY3A 2J46A 3K6BA 2V26A 3LESA 4C3EA 1BDJB 3LUTB 5KYYB 3G50A 5A69A 2HMQA 4N4WA 2LFFA 1VLSA 1FMVA 4CJGA 2OG2A 3FVYA 4OIRF 4DJ9A 4XLPF 1M56C 2H8AA 1YA9A 3I5PA 1BR1A 1GQAA 2KYHA 2M64A 1Q0MA 3H2UA 3SXZA 1E86A 4AK9A 2HV7A 2YL7A 1OCCC 3TOMA 4CBEA 3EGXA 1TFOB 4P6IC 2L9JA 3DE9A 2D4UA 4OD5A 3T6JA 2A1DD 3FDQA 2PP4A 4LDRA 4U5FE 1VYKA 1OXKA 3TJ6A 3B71A 4AX2A 3EG9A 5L0FA 1H6GA 4U5HA 3OWTA 3G4XA 2CNWD 3GEIA 3GEHA 3O39A 2XRHA 4MQ9F 4DBQA 2XLOA 1B68A 3W2VA 4YT4A 2A68F 2JX0A 2A6HF 4E17A 5A6BA 5DS5A 1LE4A 1E2XA 2R05A 3JCUQ 1OCZC 5FCLA 4GYTA 3EGXB 1ZZPA 2KK1A 4W8PA 5L3VA 3JSEO 3RKOF 4CS8C 4MVUA 2A69F 3CAXA 3K1HA 4JEBA 3EZIA 2QNLA 4XQ1A 3TJ5A 5L0GA 1ZHZA 2VB6A 3LAYA 3SYNA 1I4YA 4PFPA 5DQZA 3EG9B 5AC5A 2IOQA 1NU7D 2NUPA 2Y69C 3ABKC 3LEOA 4PR9A 3R2PA 2BL2A 2HZ8A 3OEOA 5TJ5E 1A7VA 1U89A 3NMIA 3AG1C 3NYJA 3RFYA 1BR2A 4MVQA 3RQGA 2ICWG 4BEJA 4EBBA 2XM4A 2MWQA 2AU5A 2RSEB 4CS8A 2IM8A 2XLDA 3U9MA 1QSPA 1RKEA 3SNHA 1ORSC 5AGFA 1I5NA 5CI8A 5KYUA 2XS1A 1D0XA 3CQZA 3LLIA 4XEFA 1Q0KA 2WVOA 4C3BA 5L0DA 2NUPB 1WASA 3ZSUA 1D1BA 2EINC 2ZPAA 1LVKA 3DAFA 3DJUB 5T1DB 3EH2A 1E83A 2GDCA 2O9XA 2L6HA 1YLMA 2HS5A 4PJMA 1Z6AA 4O6NA 4XEVA 1L3PA 3NYMA 4RDAA 3O10A 3DZAA 1QLEC 3ITFA 1RKEB 4JTAB 3HTKC 2J0XA 3CEXA 3IQCA 1V55C 1VB5A 1F1MA 4FX5A 5KYUB 2YEVA 2X0CA 1MMAA 3RVZA 3W4YA 3W8IA 1ST6A 1K05A 2HJ3A 2ZXWC 4CDVA 1OR3A 1FMWA 3EGDB 3FXHA 1QVXA 4YT8A 1VYIA 3C63A 2VCAA 3CZ6A 3GANA 4BJ5C 1NLXA 2R7QA 3B9QA 1R5ID 2I8BA 2HJMA 2Q9AA 1BR4A 1CPQA 3HNIA 4R32A 5JUAA 3JRMO 4K0DA 3Q7LA 2XXAA 3SXYA 3K7DA 1Q0GA 4Z9JA 3KMIA 3B0PA 1WOLA 4HFFB 4IRUA 4QI2A 1RJ9A 2WZFA 5JRAA 2NSGA 4DRIB 1Z63A 1RMVA 1HW2A 4XPYA 3RW0A 1XWJA 5BUOA 1D0YA 2KC3A 4BJ5A 1MQVA 1T01A 1LKXA 3OA1A 1HMOA 1T6QA 3L34A 2KW3C 1ZW3A 4YL0A 3UNGC 1HMDA 1V74B 3DAGA 2DB4A 4MW3A 4GQHA 2XXAB 5L0JA 5A6BD 3L1MA 1SR2A 2PX3A 1RJ9B 1RCPA 3GORA 2PX0A 3U8VA 2YL3A 1PCXA 2VASA 3O6XA 1JOGA 4KBLA 4PJNA 1JRAA 4LDQA 2OOCA 3IHUA 1NSGB 1NU9C 2R7TA 3V5ZA 3JSZA 1TKNA 2WVQA 2VH3A 2XLHA 1OXBA 3DE8A 3FHDA 2OEVA 4M63A 3W2WA 3ABLC 3JRTA 1ZU5A 2PBEA 3QW0A 4JE9A 2GA0A 4JCHA 2XM0A 3WHNA 3ZC4A 4BJ1A 4JURI 4E7SA 2IXOA 3DI5A 4J7YA 4WGYA 3QZCA 1MMNA 2IYLD 2OQMA 4O6YA 1NBBA 3W8HA 4BJTA 2PF4E 2WVNA 1G4US 4LLEA 3HJCA 3QW1A 2TMVP 256BA 2AVKA 1SF8A 3RYLA 2H7BA 3RQFA 2R7XA 2B0JA 1U0BB 3U3BA 4ZLCA 4OD4A 2EPKX 5CI9A 3ASOC 3S84A 3QMKA 4X0RA 5JVEA 2YL1A 3TD7A 2YLIA 1T6UA 4MNDA 4BJ6C 2Y3DA 1AUEA 2J9VA 1OCRC 3DM5A 3MBGA 2KJGA 3NYLA 4PACA 2KQ9A 5COMA 4CDYA 2L6FA 2ASRA 2DI3A 3US6A 1N1CA 3ABMC 3RF3A 5HV9A 2VC9A 3L0IA 1XZPA 3KYJA 3TK0A 4JKVA 4JJGA 2HSBA 3ZQVA 4B6IA 3Q7GA 4DRHB 1LS4A 4CDAA 4BJ6A 4YWQA 2Y3GA 3KL4A 1TWAA 3I4UA 3MYFA 3QTHA 1ZYRF 4XTKA 2FAPB 1JAFA 3NRHA 3U3FA 3EFOA 4EHPA 5EHHA 3KKBA 3N0TA 1EQ1A 2EIKC 2P61A 4OIOF 4JZAA 1GGQA 3JZ0A 4MVSA 2ZD9A 3EPVA 3DWWA 2CCYA 4MTOA 1UG7A 3NDBB 1TR2A 2Q9CA 3ZG1A 4FAPB 3IQTA 5F5HA 1JR8A 2R7OA 2YRFA 1ZVZA 2P6VA 3SXMA 3UMKA 1I4ZA 2Q9BA 5KYXA 3HLZA 1YARO 2ZXOA 3AG3C 3EFOB 4Q4ZF 5CIVA 1KTMA 1CGNA 1KU2A 3SXKA 1ORJA 2Y39A 3N2ZB 4IAOA 1WATA 3DKAA 1LIHA 2AP3A 1T5OA 1FFHA 3L8IA 3MYIA 2RD9A 1OCOC 3NKEA 3GODA 4N06A 1Z5ZA 4EUKB 3GWNA 1FTSA 1GS9A 3K1IC 4O6MA 1RKCA 1FNTc 2YHSA 5EGYA 1W2WA 1VOMA 3RQEA 1ZHYA 2YLGA 3U5SA 2D5RB 4J30B 5KYXB 4YL3A 5B1BC 5HSWA 3EGDA 4I3MA 1HE1A 4NC3A 2WZGA 3MFNA 3FAPB 1LI7A 5E33A 5K0IA 4YT2A 3K1IA 2DYSC 4JTDB 1MNDA 1S7ZA 2CDQA 2P1AA 4LLCA 3DXJF 2H7OA 1H9GA 2P7VA 2R03A 3EHNA 3F47A 3H65A 3UGPA 5L0IA 4KC9A 1JPJA 2J7PA 3X2QC 2ZXPA 1JMWA 4AE4B 3PHF2 2XLMA 4G7ZF 2HUJA 5JP7A 3UGOA 1UFBA 1G8XA 2R7RA 2A0UA 4UDVA 4ANJA 5AC4A 1M2VA 1MMDA 1EA8A 1VLTA 5BQGA 1R4TA 2Z15A 4I1MA 3C62A 2DGJA 1T9KA 2HFIA 1Y6DA 1ZU4A 5COGA 5COFA 4EWCA 4CIHA 3DMDA 3IQ6A 3GM1A 4EIYA 4RD9A 4ER9A 3GM2A 2CW0F 2IBFA 3N24A 4IWBA 4A4AA 5BQIA 3HNJA 4FWVA 3C8GA 3H2VA 4P9FA 5KYWA 1K40A 2R25A 3V5YA 1QPUA 5DVWA 4AL0A 2ETSA 1SZIA 1M6TA 1SYQA 4U5CE 3ZTZA 2QTVA 5T3WA 1C03A 1M2VB 2W4BA 2PFDA 5E2QA 1A41A 1AVOB 2XL8A 4HFKB 3AG4C 4OIQF 2R7SA 3IPMO 4G7OF 3MX3A 2X51A 3KH2A 4ULWA 4OINF 2YL0A 4JRZA 3U0CA 1FR0A 2AWYA 1BZ4A 3FOPA 4XPXA 3S28A 1VMAA 4NCQA 2LSEA 4U9EA 3O55A 3NMJA 1A7EA 1CGOA 3C8GB 2J9BA 3HNLA 4PJLA 5EK0A 5KYWB 2QY9A 4MVRA 1LS1A 2JPUA 4LDKA 4QDLA 3T6GB 1H9TA 3U8PA 1S05A 3ATPA 4D4NA 2EPMX 3WG7C 3HKKA 4JW1A 2EPOA 4A2NB 5IY5C 3K33A 3NKDA 3JT1A 3TOLA 5L0HA 2WZLA 1YZCA 2OKUA 5E3AA 2NUTA 5DS6A 3AOUA 1SMYF 3ECSA 3M79A 4YK5A 3VYWA 1ZHWA 4IARA 3T6BA 4DXWA 4PK4A 5B3IA 2L7AA 2HSQA 2J9UA 3BRJA 1FFTC 1Q0DA 4LERA 1LI5A 4WGZA 1H7IA 1OR2A 3S27A 3TQOA 3UR3C 4G7HF 4Q5SF 3PMRA 3GWLA 4AL1A 4HE8D 4N6HA 3S90A 2G62A 2LFDA 4KNVA 4G78A 2ZXRA 4PJJA 2PNOA 2Q3TA 2J45A 3KPHA 1O3UA 3X1OA 2NUTB 5GPGB 1OQCA 2IXPA 3G4ZA 5A6KA 3PCVA 4KI2A 1QZXA 2BE5F 2EIMC 3T4RA 3V5XA 3PDMP 3HNKA 4F4BA 2J7PD 3BEHA 2NPUA 4N6CA 3F46A 4QI0A 4NTBA 2R7UA 4NQFA 3NG1A 5B3SC 2MYSA 4P9TA 2LCHA 4FESA 3VRCA 4DRJB 5DS4A 2R7WA 3B29A 1WTYA 2Y3HA 1YJGA 5B1AC 3U2LA 3VF0A 3A11A 4CS9C 4K7BA 4I44A 3LJBA 4JCZA 1NFOA 4IB4A 3R7CA 1DOVA 3VM6A 1VTMP 2XLVA 4C7OA 4U5GA 2CGEA 1U6HA 2VCBA 5JT4A 2MHRA 4JIOA 4U5BE 4CJOA 1YZAA 3JTLO 1D0ZA 1L7CA 1VK5A 3LNRA 3RIPA 3AQCA 3C8GD 1RXQA 3U9JA 1NFNA 4ZLDA 4E0IA 2Q4FA 2G3VA 4YT5A 1XZQA 3ZQYA 2YZSA 2QLAA 1ZHTA 4IAQA 1C02A 2B0HA 1A0BA 2NG1A 2KSFA 4CS9A 1YVIA 1FAPB 1O87A 3A9CA 2A0BA 1D1CA 1LPEA 2QUPA 1DOWA 5JLIA 3Q6MA 3E9VA 2Y3BA 2YKZA 4C7OB 2C04A 2OEXA 4E7ZA 1QKRA 3AQBA 1E85A 4EKWA 4BPMA 2LIGA 1PD1A 1YAUO 3IEEA 4CIPA 2XSEA 1TFKB 5DLJA 5JS5A 2Q7RA 2IXMA 4OIPF 4U5EE 3MLGA 1IW7F 1G4WR 1TWGA 2UUHA 5FZTA 3VAYA 3GEEA 1APCA 3Q6NA 2YQYA 4AE4A 3S0XA 1Q0FA 4YJWA 3WODF 5JSLA 4XEKA 4DOZA 4YN0B 1HW1A 2R9RB 3GM3A 1TQGA 1CGME 3RH3A 1OKKA 2H7VC 3DM9B 3M1CB 4GEHA 1M2OA 2IXNA 4H4KC 2L81A 3C7JA 4U9DA 4W8KA 2YLDA 2YWAA 5L3QA 1OW7A 2R02A 3JYHA 4CS7A 3AGUA 2I15A 3S9OA 3SZRA 1TWHA 4BEMJ 4XWJA 2HMZA 2R7VA 4MVZA 1Z23A 1GM5A 2OJQA 4J32B
chains in the Genus database with same CATH topology
1MNEA 2JD3A 1J8MF 2J0WA 3EZHA 5KYNA 2FFHA 2C03A 3E70C 1IZMA 3AG2C 5D92A 3S29A 1MMGA 4DVYP 2G3KA 3K66A 3LLKA 2HV6A 4Q7CA 4RBNA 4U5DE 2E87A 3FAJA 2V3CC 5E3CA 2OCCC 2WL8A 4JJFA 4CSAC 3B0UX 2XL4A 4G0HA 4I1OB 3EJNA 4PFOA 3LS0A 1Z3IX 1PD0A 3ZIBA 2CNWA 2EILC 4DBRA 4JVSA 3POVA 3EH1A 3UMHA 1NZEA 2KNHA 4O7GA 4IJJA 4CSAA 1V54C 2KGOA 3LEVA 1O5HA 1ZHXA 2DYRC 3EQLF 2FGYA 3ASNC 4O79A 3CSKA 4C3DA 3ZVRA 1JPNA 2A6EF 2W9YA 4KNWA 2M4EA 3EHMA 3DD7A 5F5FA 1D1AA 1TWCA 4LACB 1NG1A 1OKKD 1M57C 3V7OA 5KYYA 3SEOA 2W4MA 2WB7A 1WGWA 2W45A 2GFHA 2EIJC 5D91A 4BG0A 5T3TA 4XLNF 5DQTA 3B0VC 2J9WA 3I5QA 3LS1A 4HEAJ 3SP1A 4WJ0A 1J8YF 4DVZA 3DJNB 3UMIA 4NY3A 2J46A 3K6BA 2V26A 3LESA 4C3EA 5KYYB 1FMVA 2OG2A 3FVYA 4OIRF 4XLPF 1M56C 3I5PA 1BR1A 4AK9A 2HV7A 1OCCC 4CBEA 3EGXA 4P6IC 2L9JA 3T6JA 2A1DD 3FDQA 2PP4A 4U5FE 1VYKA 4AX2A 3EG9A 4U5HA 3OWTA 2CNWD 3O39A 2XRHA 4MQ9F 4DBQA 3W2VA 4YT4A 2A68F 5DS5A 2A6HF 3JCUQ 1OCZC 5FCLA 4GYTA 3EGXB 5L3VA 3RKOF 4CS8C 2A69F 3EZIA 1ZHZA 2VB6A 3LAYA 3SYNA 4PFPA 3EG9B 2IOQA 1NU7D 2NUPA 2Y69C 3ABKC 3OEOA 3AG1C 3NYJA 3RFYA 1BR2A 4BEJA 4EBBA 2MWQA 4CS8A 3SNHA 5CI8A 5KYUA 1D0XA 3CQZA 3LLIA 4C3BA 2WVOA 2NUPB 3ZSUA 1D1BA 2EINC 2ZPAA 1LVKA 3DAFA 3DJUB 5T1DB 3EH2A 2O9XA 4PJMA 1Z6AA 4O6NA 3NYMA 4RDAA 3DZAA 1QLEC 3ITFA 3HTKC 2J0XA 1V55C 4FX5A 5KYUB 2YEVA 1MMAA 3W8IA 1ST6A 2ZXWC 1FMWA 3EGDB 4YT8A 1VYIA 3CZ6A 3GANA 4BJ5C 2R7QA 3B9QA 2I8BA 2Q9AA 1BR4A 4K0DA 3Q7LA 2XXAA 3K7DA 3KMIA 3B0PA 4IRUA 4HFFB 4QI2A 1RJ9A 2WZFA 1Z63A 5BUOA 1D0YA 4BJ5A 1LKXA 3OA1A 3L34A 2KW3C 3UNGC 3DAGA 2XXAB 2PX3A 1RJ9B 2PX0A 1PCXA 2VASA 3O6XA 4KBLA 4PJNA 1NU9C 2R7TA 3JSZA 1TKNA 2WVQA 2VH3A 3FHDA 4M63A 3W2WA 3ABLC 3JRTA 1ZU5A 4BJ1A 4JCHA 4E7SA 3ZC4A 4JURI 2IXOA 3QZCA 1MMNA 2IYLD 4O6YA 3W8HA 4BJTA 2WVNA 2PF4E 4LLEA 3HJCA 1SF8A 3RYLA 2H7BA 2R7XA 2B0JA 4ZLCA 4OD4A 5CI9A 3ASOC 3QMKA 4X0RA 3TD7A 4BJ6C 4MNDA 2Y3DA 2J9VA 1OCRC 3DM5A 2KJGA 3NYLA 2KQ9A 1N1CA 3ABMC 3L0IA 4JJGA 4B6IA 3Q7GA 4BJ6A 4YWQA 2Y3GA 3KL4A 1TWAA 3I4UA 3RH3A 4XTKA 1ZYRF 5DQZA 3NRHA 5EHHA 3EFOA 3KKBA 3N0TA 2EIKC 4OIOF 4JZAA 3EPVA 3NDBB 1TR2A 2Q9CA 3ZG1A 5F5HA 2R7OA 3UMKA 2P6VA 2Q9BA 5KYXA 3HLZA 2ZXOA 3AG3C 3EFOB 4Q4ZF 1KU2A 2Y39A 3N2ZB 4IAOA 3NKEA 1FFHA 4N06A 1OCOC 3GODA 1Z5ZA 1FTSA 4O6MA 3K1IC 2YHSA 5EGYA 1W2WA 1VOMA 1ZHYA 2D5RB 4J30B 5KYXB 5HSWA 5B1BC 3EGDA 4I3MA 2WZGA 5E33A 4YT2A 2DYSC 4LLCA 1MNDA 1S7ZA 2CDQA 3DXJF 2H7OA 2P7VA 3EHNA 3H65A 3F47A 3UGPA 4KC9A 1JPJA 2J7PA 3X2QC 2ZXPA 3PHF2 4AE4B 4G7ZF 3UGOA 1G8XA 2R7RA 4ANJA 1M2VA 1MMDA 2Z15A 4I1MA 2DGJA 1ZU4A 4EWCA 4CIHA 3DMDA 4RD9A 2CW0F 4IWBA 3N24A 4FWVA 5KYWA 5DVWA 1SZIA 4U5CE 2QTVA 5T3WA 1M2VB 2W4BA 2PFDA 5E2QA 4HFKB 4OIQF 3AG4C 2R7SA 4G7OF 3MX3A 2X51A 3KH2A 4ULWA 4OINF 3S28A 1VMAA 2LSEA 4PJLA 5KYWB 2QY9A 4QDLA 1LS1A 3WG7C 4JW1A 4A2NB 5IY5C 3K33A 3NKDA 3JT1A 2WZLA 5E3AA 2NUTA 5DS6A 1SMYF 3ECSA 3VYWA 1ZHWA 3T6BA 4PK4A 4LERA 2J9UA 1FFTC 3S27A 3UR3C 4Q5SF 4G7HF 3PMRA 4HE8D 2G62A 4KNVA 2ZXRA 4PJJA 2Q3TA 2J45A 3X1OA 2NUTB 2IXPA 4KI2A 1QZXA 2BE5F 2EIMC 3T4RA 4F4BA 2J7PD 4QI0A 3F46A 2R7UA 3NG1A 5B3SC 2MYSA 4FESA 5DS4A 2R7WA 2Y3HA 5B1AC 4CS9C 4K7BA 4I44A 3LJBA 4C7OA 4U5GA 2CGEA 4U5BE 3RIPA 1D0ZA 1VK5A 3LNRA 3AQCA 4ZLDA 2G3VA 4YT5A 2YZSA 1ZHTA 2NG1A 4CS9A 1O87A 1D1CA 3Q6MA 3E9VA 2Y3BA 4C7OB 2C04A 4E7ZA 3AQBA 1PD1A 3IEEA 2XSEA 5DLJA 4OIPF 2IXMA 4U5EE 3MLGA 1IW7F 1TWGA 3VAYA 3Q6NA 4AE4A 3S0XA 4YJWA 3WODF 4DOZA 4YN0B 1OKKA 2H7VC 3DM9B 3M1CB 4GEHA 1M2OA 2IXNA 4H4KC 2L81A 4W8KA 5L3QA 3JYHA 4CS7A 3SZRA 1TWHA 4XWJA 2R7VA 4OD5A 1Z23A 3K1HA 4J32B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T4R A; 
#chains in the Genus database with same CATH topology
 4MTF A;  1WN0 A;  1K04 A;  1MNE A;  3RVY A;  2BC5 A;  1OW8 A;  1KNY A;  2JD3 A;  1J8M F;  4IGG A;  4YL1 A;  2HKV A;  2EPN A;  2J0W A;  3EZH A;  3KYI A;  2Q00 A;  3M4C A;  5KYN A;  4JEA A;  1HE9 A;  1YA7 O;  1G5Z A;  4D4X A;  2XL6 A;  4JC7 A;  2XLE A;  2FFH A;  2GAQ A;  2XLW A;  4NTA A;  2C03 A;  3E70 C;  1IZM A;  5L0C A;  3AG2 C;  5D92 A;  1CPR A;  3S29 A;  3C8Z A;  1MMG A;  4DVY P;  2G3K A;  3K66 A;  2GWW A;  3FOO A;  3LLK A;  4J7T A;  2XS8 A;  1LM3 B;  2HV6 A;  1LE2 A;  1PV3 A;  2OJE D;  4MVM A;  4Q7C A;  4RBN A;  4U5D E;  2E87 A;  3FAJ A;  3ZDL A;  2LP4 A;  5E3C A;  2V3C C;  2OCC C;  2WL8 A;  1YDI A;  2F22 A;  2L6G A;  1V4A A;  4JJF A;  4MW8 A;  4CSA C;  3B0U X;  2XL4 A;  4G0H A;  4I1O B;  2LD6 A;  3EJN A;  1A7D A;  4K1O A;  4PFO A;  2NSF A;  2VCC A;  3C18 A;  2P0N A;  3LS0 A;  1E84 A;  1C17 M;  4JTC B;  1OW6 A;  1Z3I X;  1PD0 A;  3ZIB A;  2CNW A;  2EIL C;  4CX9 A;  1AEP A;  4DBR A;  4JVS A;  3POV A;  3EH1 A;  4XPW A;  3UMH A;  1WWP A;  1NZE A;  2KNH A;  2YVK A;  3QVY A;  2EPL X;  4IJJ A;  4O7G A;  1YYJ A;  1ZW2 A;  4E0H A;  4CSA A;  2QE9 A;  1EKY A;  3WAQ A;  3JYY A;  1V54 C;  3NMK A;  4EBJ A;  4MS2 A;  3T9O A;  2KGO A;  4ONS A;  3LEV A;  1BBH A;  1Y4C A;  2LQG A;  1O5H A;  1ZHX A;  2DYR C;  1T6I A;  2FGY A;  3ASN C;  3EQL F;  4O79 A;  3CSK A;  2CYD A;  4C3D A;  4Z9H A;  3ZVR A;  1JPN A;  2A6E F;  1YYX A;  2W9Y A;  4MTG A;  2OU6 A;  4KNW A;  4ULV A;  2M4E A;  3EHM A;  1Z7Q c;  3DD7 A;  3ZWI A;  5A6J A;  4L6R A;  1D1A A;  1TWC A;  4LAC B;  1ORY A;  5F5F A;  5F28 E;  1NG1 A;  1OKK D;  3LNM B;  3AJM A;  1M57 C;  3L8J A;  3V7O A;  2UUI A;  4MVO A;  5KYY A;  3M15 A;  3M4B A;  3SEO A;  2W4M A;  2WB7 A;  1WGW A;  2W45 A;  4H54 A;  1EI7 A;  1HY5 A;  3ZTM A;  2GFH A;  2EIJ C;  3QVZ A;  5D91 A;  5T3T A;  4BG0 A;  3J06 A;  4XLN F;  2AWC A;  4WAB A;  5DQT A;  3B0V C;  5A6A A;  2J9W A;  3TUL A;  3I5Q A;  3LS1 A;  4HEA J;  4NTF A;  4Z9I A;  4WJ0 A;  3SP1 A;  4E18 A;  1J8Y F;  2J8W A;  4EBK A;  2LK4 A;  1QQ3 A;  3AGT A;  3DJN B;  3U2M A;  3UMI A;  4DVZ A;  3FMS A;  3IQ5 A;  5BQH A;  4NY3 A;  2J46 A;  3K6B A;  2V26 A;  3LES A;  4C3E A;  1BDJ B;  3LUT B;  5KYY B;  3G50 A;  5A69 A;  2HMQ A;  4N4W A;  2LFF A;  1VLS A;  1FMV A;  4CJG A;  2OG2 A;  3FVY A;  4OIR F;  4DJ9 A;  4XLP F;  1M56 C;  2H8A A;  1YA9 A;  3I5P A;  1BR1 A;  1GQA A;  2KYH A;  2M64 A;  1Q0M A;  3H2U A;  3SXZ A;  1E86 A;  4AK9 A;  2HV7 A;  2YL7 A;  1OCC C;  3TOM A;  4CBE A;  3EGX A;  1TFO B;  4P6I C;  2L9J A;  3DE9 A;  2D4U A;  4OD5 A;  3T6J A;  2A1D D;  3FDQ A;  2PP4 A;  4LDR A;  4U5F E;  1VYK A;  1OXK A;  3TJ6 A;  3B71 A;  4AX2 A;  3EG9 A;  5L0F A;  1H6G A;  4U5H A;  3OWT A;  3G4X A;  2CNW D;  3GEI A;  3GEH A;  3O39 A;  2XRH A;  4MQ9 F;  4DBQ A;  2XLO A;  1B68 A;  3W2V A;  4YT4 A;  2A68 F;  2JX0 A;  2A6H F;  4E17 A;  5A6B A;  5DS5 A;  1LE4 A;  1E2X A;  2R05 A;  3JCU Q;  1OCZ C;  5FCL A;  4GYT A;  3EGX B;  1ZZP A;  2KK1 A;  4W8P A;  5L3V A;  3JSE O;  3RKO F;  4CS8 C;  4MVU A;  2A69 F;  3CAX A;  3K1H A;  4JEB A;  3EZI A;  2QNL A;  4XQ1 A;  3TJ5 A;  5L0G A;  1ZHZ A;  2VB6 A;  3LAY A;  3SYN A;  1I4Y A;  4PFP A;  5DQZ A;  3EG9 B;  5AC5 A;  2IOQ A;  1NU7 D;  2NUP A;  2Y69 C;  3ABK C;  3LEO A;  4PR9 A;  3R2P A;  2BL2 A;  2HZ8 A;  3OEO A;  5TJ5 E;  1A7V A;  1U89 A;  3NMI A;  3AG1 C;  3NYJ A;  3RFY A;  1BR2 A;  4MVQ A;  3RQG A;  2ICW G;  4BEJ A;  4EBB A;  2XM4 A;  2MWQ A;  2AU5 A;  2RSE B;  4CS8 A;  2IM8 A;  2XLD A;  3U9M A;  1QSP A;  1RKE A;  3SNH A;  1ORS C;  5AGF A;  1I5N A;  5CI8 A;  5KYU A;  2XS1 A;  1D0X A;  3CQZ A;  3LLI A;  4XEF A;  1Q0K A;  2WVO A;  4C3B A;  5L0D A;  2NUP B;  1WAS A;  3ZSU A;  1D1B A;  2EIN C;  2ZPA A;  1LVK A;  3DAF A;  3DJU B;  5T1D B;  3EH2 A;  1E83 A;  2GDC A;  2O9X A;  2L6H A;  1YLM A;  2HS5 A;  4PJM A;  1Z6A A;  4O6N A;  4XEV A;  1L3P A;  3NYM A;  4RDA A;  3O10 A;  3DZA A;  1QLE C;  3ITF A;  1RKE B;  4JTA B;  3HTK C;  2J0X A;  3CEX A;  3IQC A;  1V55 C;  1VB5 A;  1F1M A;  4FX5 A;  5KYU B;  2YEV A;  2X0C A;  1MMA A;  3RVZ A;  3W4Y A;  3W8I A;  1ST6 A;  1K05 A;  2HJ3 A;  2ZXW C;  4CDV A;  1OR3 A;  1FMW A;  3EGD B;  3FXH A;  1QVX A;  4YT8 A;  1VYI A;  3C63 A;  2VCA A;  3CZ6 A;  3GAN A;  4BJ5 C;  1NLX A;  2R7Q A;  3B9Q A;  1R5I D;  2I8B A;  2HJM A;  2Q9A A;  1BR4 A;  1CPQ A;  3HNI A;  4R32 A;  5JUA A;  3JRM O;  4K0D A;  3Q7L A;  2XXA A;  3SXY A;  3K7D A;  1Q0G A;  4Z9J A;  3KMI A;  3B0P A;  1WOL A;  4HFF B;  4IRU A;  4QI2 A;  1RJ9 A;  2WZF A;  5JRA A;  2NSG A;  4DRI B;  1Z63 A;  1RMV A;  1HW2 A;  4XPY A;  3RW0 A;  1XWJ A;  5BUO A;  1D0Y A;  2KC3 A;  4BJ5 A;  1MQV A;  1T01 A;  1LKX A;  3OA1 A;  1HMO A;  1T6Q A;  3L34 A;  2KW3 C;  1ZW3 A;  4YL0 A;  3UNG C;  1HMD A;  1V74 B;  3DAG A;  2DB4 A;  4MW3 A;  4GQH A;  2XXA B;  5L0J A;  5A6B D;  3L1M A;  1SR2 A;  2PX3 A;  1RJ9 B;  1RCP A;  3GOR A;  2PX0 A;  3U8V A;  2YL3 A;  1PCX A;  2VAS A;  3O6X A;  1JOG A;  4KBL A;  4PJN A;  1JRA A;  4LDQ A;  2OOC A;  3IHU A;  1NSG B;  1NU9 C;  2R7T A;  3V5Z A;  3JSZ A;  1TKN A;  2WVQ A;  2VH3 A;  2XLH A;  1OXB A;  3DE8 A;  3FHD A;  2OEV A;  4M63 A;  3W2W A;  3ABL C;  3JRT A;  1ZU5 A;  2PBE A;  3QW0 A;  4JE9 A;  2GA0 A;  4JCH A;  2XM0 A;  3WHN A;  3ZC4 A;  4BJ1 A;  4JUR I;  4E7S A;  2IXO A;  3DI5 A;  4J7Y A;  4WGY A;  3QZC A;  1MMN A;  2IYL D;  2OQM A;  4O6Y A;  1NBB A;  3W8H A;  4BJT A;  2PF4 E;  2WVN A;  1G4U S;  4LLE A;  3HJC A;  3QW1 A;  2TMV P;  256B A;  2AVK A;  1SF8 A;  3RYL A;  2H7B A;  3RQF A;  2R7X A;  2B0J A;  1U0B B;  3U3B A;  4ZLC A;  4OD4 A;  2EPK X;  5CI9 A;  3ASO C;  3S84 A;  3QMK A;  4X0R A;  5JVE A;  2YL1 A;  3TD7 A;  2YLI A;  1T6U A;  4MND A;  4BJ6 C;  2Y3D A;  1AUE A;  2J9V A;  1OCR C;  3DM5 A;  3MBG A;  2KJG A;  3NYL A;  4PAC A;  2KQ9 A;  5COM A;  4CDY A;  2L6F A;  2ASR A;  2DI3 A;  3US6 A;  1N1C A;  3ABM C;  3RF3 A;  5HV9 A;  2VC9 A;  3L0I A;  1XZP A;  3KYJ A;  3TK0 A;  4JKV A;  4JJG A;  2HSB A;  3ZQV A;  4B6I A;  3Q7G A;  4DRH B;  1LS4 A;  4CDA A;  4BJ6 A;  4YWQ A;  2Y3G A;  3KL4 A;  1TWA A;  3I4U A;  3MYF A;  3QTH A;  1ZYR F;  4XTK A;  2FAP B;  1JAF A;  3NRH A;  3U3F A;  3EFO A;  4EHP A;  5EHH A;  3KKB A;  3N0T A;  1EQ1 A;  2EIK C;  2P61 A;  4OIO F;  4JZA A;  1GGQ A;  3JZ0 A;  4MVS A;  2ZD9 A;  3EPV A;  3DWW A;  2CCY A;  4MTO A;  1UG7 A;  3NDB B;  1TR2 A;  2Q9C A;  3ZG1 A;  4FAP B;  3IQT A;  5F5H A;  1JR8 A;  2R7O A;  2YRF A;  1ZVZ A;  2P6V A;  3SXM A;  3UMK A;  1I4Z A;  2Q9B A;  5KYX A;  3HLZ A;  1YAR O;  2ZXO A;  3AG3 C;  3EFO B;  4Q4Z F;  5CIV A;  1KTM A;  1CGN A;  1KU2 A;  3SXK A;  1ORJ A;  2Y39 A;  3N2Z B;  4IAO A;  1WAT A;  3DKA A;  1LIH A;  2AP3 A;  1T5O A;  1FFH A;  3L8I A;  3MYI A;  2RD9 A;  1OCO C;  3NKE A;  3GOD A;  4N06 A;  1Z5Z A;  4EUK B;  3GWN A;  1FTS A;  1GS9 A;  3K1I C;  4O6M A;  1RKC A;  1FNT c;  2YHS A;  5EGY A;  1W2W A;  1VOM A;  3RQE A;  1ZHY A;  2YLG A;  3U5S A;  2D5R B;  4J30 B;  5KYX B;  4YL3 A;  5B1B C;  5HSW A;  3EGD A;  4I3M A;  1HE1 A;  4NC3 A;  2WZG A;  3MFN A;  3FAP B;  1LI7 A;  5E33 A;  5K0I A;  4YT2 A;  3K1I A;  2DYS C;  4JTD B;  1MND A;  1S7Z A;  2CDQ A;  2P1A A;  4LLC A;  3DXJ F;  2H7O A;  1H9G A;  2P7V A;  2R03 A;  3EHN A;  3F47 A;  3H65 A;  3UGP A;  5L0I A;  4KC9 A;  1JPJ A;  2J7P A;  3X2Q C;  2ZXP A;  1JMW A;  4AE4 B;  3PHF 2;  2XLM A;  4G7Z F;  2HUJ A;  5JP7 A;  3UGO A;  1UFB A;  1G8X A;  2R7R A;  2A0U A;  4UDV A;  4ANJ A;  5AC4 A;  1M2V A;  1MMD A;  1EA8 A;  1VLT A;  5BQG A;  1R4T A;  2Z15 A;  4I1M A;  3C62 A;  2DGJ A;  1T9K A;  2HFI A;  1Y6D A;  1ZU4 A;  5COG A;  5COF A;  4EWC A;  4CIH A;  3DMD A;  3IQ6 A;  3GM1 A;  4EIY A;  4RD9 A;  4ER9 A;  3GM2 A;  2CW0 F;  2IBF A;  3N24 A;  4IWB A;  4A4A A;  5BQI A;  3HNJ A;  4FWV A;  3C8G A;  3H2V A;  4P9F A;  5KYW A;  1K40 A;  2R25 A;  3V5Y A;  1QPU A;  5DVW A;  4AL0 A;  2ETS A;  1SZI A;  1M6T A;  1SYQ A;  4U5C E;  3ZTZ A;  2QTV A;  5T3W A;  1C03 A;  1M2V B;  2W4B A;  2PFD A;  5E2Q A;  1A41 A;  1AVO B;  2XL8 A;  4HFK B;  3AG4 C;  4OIQ F;  2R7S A;  3IPM O;  4G7O F;  3MX3 A;  2X51 A;  3KH2 A;  4ULW A;  4OIN F;  2YL0 A;  4JRZ A;  3U0C A;  1FR0 A;  2AWY A;  1BZ4 A;  3FOP A;  4XPX A;  3S28 A;  1VMA A;  4NCQ A;  2LSE A;  4U9E A;  3O55 A;  3NMJ A;  1A7E A;  1CGO A;  3C8G B;  2J9B A;  3HNL A;  4PJL A;  5EK0 A;  5KYW B;  2QY9 A;  4MVR A;  1LS1 A;  2JPU A;  4LDK A;  4QDL A;  3T6G B;  1H9T A;  3U8P A;  1S05 A;  3ATP A;  4D4N A;  2EPM X;  3WG7 C;  3HKK A;  4JW1 A;  2EPO A;  4A2N B;  5IY5 C;  3K33 A;  3NKD A;  3JT1 A;  3TOL A;  5L0H A;  2WZL A;  1YZC A;  2OKU A;  5E3A A;  2NUT A;  5DS6 A;  3AOU A;  1SMY F;  3ECS A;  3M79 A;  4YK5 A;  3VYW A;  1ZHW A;  4IAR A;  3T6B A;  4DXW A;  4PK4 A;  5B3I A;  2L7A A;  2HSQ A;  2J9U A;  3BRJ A;  1FFT C;  1Q0D A;  4LER A;  1LI5 A;  4WGZ A;  1H7I A;  1OR2 A;  3S27 A;  3TQO A;  3UR3 C;  4G7H F;  4Q5S F;  3PMR A;  3GWL A;  4AL1 A;  4HE8 D;  4N6H A;  3S90 A;  2G62 A;  2LFD A;  4KNV A;  4G78 A;  2ZXR A;  4PJJ A;  2PNO A;  2Q3T A;  2J45 A;  3KPH A;  1O3U A;  3X1O A;  2NUT B;  5GPG B;  1OQC A;  2IXP A;  3G4Z A;  5A6K A;  3PCV A;  4KI2 A;  1QZX A;  2BE5 F;  2EIM C;  3T4R A;  3V5X A;  3PDM P;  3HNK A;  4F4B A;  2J7P D;  3BEH A;  2NPU A;  4N6C A;  3F46 A;  4QI0 A;  4NTB A;  2R7U A;  4NQF A;  3NG1 A;  5B3S C;  2MYS A;  4P9T A;  2LCH A;  4FES A;  3VRC A;  4DRJ B;  5DS4 A;  2R7W A;  3B29 A;  1WTY A;  2Y3H A;  1YJG A;  5B1A C;  3U2L A;  3VF0 A;  3A11 A;  4CS9 C;  4K7B A;  4I44 A;  3LJB A;  4JCZ A;  1NFO A;  4IB4 A;  3R7C A;  1DOV A;  3VM6 A;  1VTM P;  2XLV A;  4C7O A;  4U5G A;  2CGE A;  1U6H A;  2VCB A;  5JT4 A;  2MHR A;  4JIO A;  4U5B E;  4CJO A;  1YZA A;  3JTL O;  1D0Z A;  1L7C A;  1VK5 A;  3LNR A;  3RIP A;  3AQC A;  3C8G D;  1RXQ A;  3U9J A;  1NFN A;  4ZLD A;  4E0I A;  2Q4F A;  2G3V A;  4YT5 A;  1XZQ A;  3ZQY A;  2YZS A;  2QLA A;  1ZHT A;  4IAQ A;  1C02 A;  2B0H A;  1A0B A;  2NG1 A;  2KSF A;  4CS9 A;  1YVI A;  1FAP B;  1O87 A;  3A9C A;  2A0B A;  1D1C A;  1LPE A;  2QUP A;  1DOW A;  5JLI A;  3Q6M A;  3E9V A;  2Y3B A;  2YKZ A;  4C7O B;  2C04 A;  2OEX A;  4E7Z A;  1QKR A;  3AQB A;  1E85 A;  4EKW A;  4BPM A;  2LIG A;  1PD1 A;  1YAU O;  3IEE A;  4CIP A;  2XSE A;  1TFK B;  5DLJ A;  5JS5 A;  2Q7R A;  2IXM A;  4OIP F;  4U5E E;  3MLG A;  1IW7 F;  1G4W R;  1TWG A;  2UUH A;  5FZT A;  3VAY A;  3GEE A;  1APC A;  3Q6N A;  2YQY A;  4AE4 A;  3S0X A;  1Q0F A;  4YJW A;  3WOD F;  5JSL A;  4XEK A;  4DOZ A;  4YN0 B;  1HW1 A;  2R9R B;  3GM3 A;  1TQG A;  1CGM E;  3RH3 A;  1OKK A;  2H7V C;  3DM9 B;  3M1C B;  4GEH A;  1M2O A;  2IXN A;  4H4K C;  2L81 A;  3C7J A;  4U9D A;  4W8K A;  2YLD A;  2YWA A;  5L3Q A;  1OW7 A;  2R02 A;  3JYH A;  4CS7 A;  3AGU A;  2I15 A;  3S9O A;  3SZR A;  1TWH A;  4BEM J;  4XWJ A;  2HMZ A;  2R7V A;  4MVZ A;  1Z23 A;  1GM5 A;  2OJQ A;  4J32 B; 
#chains in the Genus database with same CATH homology
 1MNE A;  2JD3 A;  1J8M F;  2J0W A;  3EZH A;  5KYN A;  2FFH A;  2C03 A;  3E70 C;  1IZM A;  3AG2 C;  5D92 A;  3S29 A;  1MMG A;  4DVY P;  2G3K A;  3K66 A;  3LLK A;  2HV6 A;  4Q7C A;  4RBN A;  4U5D E;  2E87 A;  3FAJ A;  2V3C C;  5E3C A;  2OCC C;  2WL8 A;  4JJF A;  4CSA C;  3B0U X;  2XL4 A;  4G0H A;  4I1O B;  3EJN A;  4PFO A;  3LS0 A;  1Z3I X;  1PD0 A;  3ZIB A;  2CNW A;  2EIL C;  4DBR A;  4JVS A;  3POV A;  3EH1 A;  3UMH A;  1NZE A;  2KNH A;  4O7G A;  4IJJ A;  4CSA A;  1V54 C;  2KGO A;  3LEV A;  1O5H A;  1ZHX A;  2DYR C;  3EQL F;  2FGY A;  3ASN C;  4O79 A;  3CSK A;  4C3D A;  3ZVR A;  1JPN A;  2A6E F;  2W9Y A;  4KNW A;  2M4E A;  3EHM A;  3DD7 A;  5F5F A;  1D1A A;  1TWC A;  4LAC B;  1NG1 A;  1OKK D;  1M57 C;  3V7O A;  5KYY A;  3SEO A;  2W4M A;  2WB7 A;  1WGW A;  2W45 A;  2GFH A;  2EIJ C;  5D91 A;  4BG0 A;  5T3T A;  4XLN F;  5DQT A;  3B0V C;  2J9W A;  3I5Q A;  3LS1 A;  4HEA J;  3SP1 A;  4WJ0 A;  1J8Y F;  4DVZ A;  3DJN B;  3UMI A;  4NY3 A;  2J46 A;  3K6B A;  2V26 A;  3LES A;  4C3E A;  5KYY B;  1FMV A;  2OG2 A;  3FVY A;  4OIR F;  4XLP F;  1M56 C;  3I5P A;  1BR1 A;  4AK9 A;  2HV7 A;  1OCC C;  4CBE A;  3EGX A;  4P6I C;  2L9J A;  3T6J A;  2A1D D;  3FDQ A;  2PP4 A;  4U5F E;  1VYK A;  4AX2 A;  3EG9 A;  4U5H A;  3OWT A;  2CNW D;  3O39 A;  2XRH A;  4MQ9 F;  4DBQ A;  3W2V A;  4YT4 A;  2A68 F;  5DS5 A;  2A6H F;  3JCU Q;  1OCZ C;  5FCL A;  4GYT A;  3EGX B;  5L3V A;  3RKO F;  4CS8 C;  2A69 F;  3EZI A;  1ZHZ A;  2VB6 A;  3LAY A;  3SYN A;  4PFP A;  3EG9 B;  2IOQ A;  1NU7 D;  2NUP A;  2Y69 C;  3ABK C;  3OEO A;  3AG1 C;  3NYJ A;  3RFY A;  1BR2 A;  4BEJ A;  4EBB A;  2MWQ A;  4CS8 A;  3SNH A;  5CI8 A;  5KYU A;  1D0X A;  3CQZ A;  3LLI A;  4C3B A;  2WVO A;  2NUP B;  3ZSU A;  1D1B A;  2EIN C;  2ZPA A;  1LVK A;  3DAF A;  3DJU B;  5T1D B;  3EH2 A;  2O9X A;  4PJM A;  1Z6A A;  4O6N A;  3NYM A;  4RDA A;  3DZA A;  1QLE C;  3ITF A;  3HTK C;  2J0X A;  1V55 C;  4FX5 A;  5KYU B;  2YEV A;  1MMA A;  3W8I A;  1ST6 A;  2ZXW C;  1FMW A;  3EGD B;  4YT8 A;  1VYI A;  3CZ6 A;  3GAN A;  4BJ5 C;  2R7Q A;  3B9Q A;  2I8B A;  2Q9A A;  1BR4 A;  4K0D A;  3Q7L A;  2XXA A;  3K7D A;  3KMI A;  3B0P A;  4IRU A;  4HFF B;  4QI2 A;  1RJ9 A;  2WZF A;  1Z63 A;  5BUO A;  1D0Y A;  4BJ5 A;  1LKX A;  3OA1 A;  3L34 A;  2KW3 C;  3UNG C;  3DAG A;  2XXA B;  2PX3 A;  1RJ9 B;  2PX0 A;  1PCX A;  2VAS A;  3O6X A;  4KBL A;  4PJN A;  1NU9 C;  2R7T A;  3JSZ A;  1TKN A;  2WVQ A;  2VH3 A;  3FHD A;  4M63 A;  3W2W A;  3ABL C;  3JRT A;  1ZU5 A;  4BJ1 A;  4JCH A;  4E7S A;  3ZC4 A;  4JUR I;  2IXO A;  3QZC A;  1MMN A;  2IYL D;  4O6Y A;  3W8H A;  4BJT A;  2WVN A;  2PF4 E;  4LLE A;  3HJC A;  1SF8 A;  3RYL A;  2H7B A;  2R7X A;  2B0J A;  4ZLC A;  4OD4 A;  5CI9 A;  3ASO C;  3QMK A;  4X0R A;  3TD7 A;  4BJ6 C;  4MND A;  2Y3D A;  2J9V A;  1OCR C;  3DM5 A;  2KJG A;  3NYL A;  2KQ9 A;  1N1C A;  3ABM C;  3L0I A;  4JJG A;  4B6I A;  3Q7G A;  4BJ6 A;  4YWQ A;  2Y3G A;  3KL4 A;  1TWA A;  3I4U A;  3RH3 A;  4XTK A;  1ZYR F;  5DQZ A;  3NRH A;  5EHH A;  3EFO A;  3KKB A;  3N0T A;  2EIK C;  4OIO F;  4JZA A;  3EPV A;  3NDB B;  1TR2 A;  2Q9C A;  3ZG1 A;  5F5H A;  2R7O A;  3UMK A;  2P6V A;  2Q9B A;  5KYX A;  3HLZ A;  2ZXO A;  3AG3 C;  3EFO B;  4Q4Z F;  1KU2 A;  2Y39 A;  3N2Z B;  4IAO A;  3NKE A;  1FFH A;  4N06 A;  1OCO C;  3GOD A;  1Z5Z A;  1FTS A;  4O6M A;  3K1I C;  2YHS A;  5EGY A;  1W2W A;  1VOM A;  1ZHY A;  2D5R B;  4J30 B;  5KYX B;  5HSW A;  5B1B C;  3EGD A;  4I3M A;  2WZG A;  5E33 A;  4YT2 A;  2DYS C;  4LLC A;  1MND A;  1S7Z A;  2CDQ A;  3DXJ F;  2H7O A;  2P7V A;  3EHN A;  3H65 A;  3F47 A;  3UGP A;  4KC9 A;  1JPJ A;  2J7P A;  3X2Q C;  2ZXP A;  3PHF 2;  4AE4 B;  4G7Z F;  3UGO A;  1G8X A;  2R7R A;  4ANJ A;  1M2V A;  1MMD A;  2Z15 A;  4I1M A;  2DGJ A;  1ZU4 A;  4EWC A;  4CIH A;  3DMD A;  4RD9 A;  2CW0 F;  4IWB A;  3N24 A;  4FWV A;  5KYW A;  5DVW A;  1SZI A;  4U5C E;  2QTV A;  5T3W A;  1M2V B;  2W4B A;  2PFD A;  5E2Q A;  4HFK B;  4OIQ F;  3AG4 C;  2R7S A;  4G7O F;  3MX3 A;  2X51 A;  3KH2 A;  4ULW A;  4OIN F;  3S28 A;  1VMA A;  2LSE A;  4PJL A;  5KYW B;  2QY9 A;  4QDL A;  1LS1 A;  3WG7 C;  4JW1 A;  4A2N B;  5IY5 C;  3K33 A;  3NKD A;  3JT1 A;  2WZL A;  5E3A A;  2NUT A;  5DS6 A;  1SMY F;  3ECS A;  3VYW A;  1ZHW A;  3T6B A;  4PK4 A;  4LER A;  2J9U A;  1FFT C;  3S27 A;  3UR3 C;  4Q5S F;  4G7H F;  3PMR A;  4HE8 D;  2G62 A;  4KNV A;  2ZXR A;  4PJJ A;  2Q3T A;  2J45 A;  3X1O A;  2NUT B;  2IXP A;  4KI2 A;  1QZX A;  2BE5 F;  2EIM C;  3T4R A;  4F4B A;  2J7P D;  4QI0 A;  3F46 A;  2R7U A;  3NG1 A;  5B3S C;  2MYS A;  4FES A;  5DS4 A;  2R7W A;  2Y3H A;  5B1A C;  4CS9 C;  4K7B A;  4I44 A;  3LJB A;  4C7O A;  4U5G A;  2CGE A;  4U5B E;  3RIP A;  1D0Z A;  1VK5 A;  3LNR A;  3AQC A;  4ZLD A;  2G3V A;  4YT5 A;  2YZS A;  1ZHT A;  2NG1 A;  4CS9 A;  1O87 A;  1D1C A;  3Q6M A;  3E9V A;  2Y3B A;  4C7O B;  2C04 A;  4E7Z A;  3AQB A;  1PD1 A;  3IEE A;  2XSE A;  5DLJ A;  4OIP F;  2IXM A;  4U5E E;  3MLG A;  1IW7 F;  1TWG A;  3VAY A;  3Q6N A;  4AE4 A;  3S0X A;  4YJW A;  3WOD F;  4DOZ A;  4YN0 B;  1OKK A;  2H7V C;  3DM9 B;  3M1C B;  4GEH A;  1M2O A;  2IXN A;  4H4K C;  2L81 A;  4W8K A;  5L3Q A;  3JYH A;  4CS7 A;  3SZR A;  1TWH A;  4XWJ A;  2R7V A;  4OD5 A;  1Z23 A;  3K1H A;  4J32 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...