3T4RA

Lettuce necrotic yellow virus phosphoprotein c-terminal domain
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
72
structure length
72
Chain Sequence
RIRHEKEKLLADLDWEIGEIAQYTPLIVDFLVPDDILAMAADGLTPELKEKIQNEIIENHIALMALEEYSSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the C-terminal domain of lettuce necrotic yellows virus phosphoprotein.
pubmed doi rcsb
source organism Lettuce necrotic yellows virus
molecule tags Viral protein
molecule keywords Phosphoprotein
total genus 23
structure length 72
sequence length 72
ec nomenclature
pdb deposition date 2011-07-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1590 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3t4rA00
3T4RA
chains in the Genus database with same CATH superfamily
3U2LA 4LLCA 2KNHA 3NRHA 1GQAA 2XM4A 2Y3BA 3EQLF 1OXBA 3M4CA 1I4ZA 2P6VA 3DE9A 3I5PA 1YYJA 5DS4A 4PR9A 1RKCA 4AL1A 3OA1A 1E84A 4CJOA 2A1DD 3EGDA 1BBHA 1LS1A 1T9KA 3F47A 1LVKA 2Q3TA 1GS9A 2J7PD 2Q00A 3O6XA 4LDKA 5L0CA 2J9UA 3EG9A 3IHUA 3PCVA 3EFOA 4MVRA 4OD4A 2M64A 2XL8A 3LLIA 4MQ9F 2DYSC 4MNDA 2IXPA 4P9TA 4DBRA 2HFIA 1SF8A 2EIJC 4OIQF 3TK0A 4I1OB 3JCUQ 1MMGA 2NUPB 3EHNA 1E2XA 1V55C 1G4US 4LLEA 3WG7C 4XWJA 1ST6A 5KYWB 2ZXWC 2RD9A 2R7RA 1V4AA 2W9YA 1HE9A 1OR2A 2CYDA 3QTHA 2HKVA 3ASOC 1JPNA 4R32A 4DBQA 3WHNA 5L0DA 3JRMO 3EG9B 5T3WA 3POVA 1H9GA 2G62A 1D0ZA 3L0IA 1Z23A 2PP4A 3RF3A 1YARO 1OCCC 1UFBA 2VASA 1ZHWA 4O7GA 1Q0MA 5E3AA 1A41A 3U8PA 3WAQA 3ZVRA 2XLHA 1EQ1A 1K05A 4XPWA 3JT1A 4BJ5C 1RKEA 3FOPA 3TQOA 4C3BA 5A6BA 2XLVA 3IQ6A 3TOMA 2YEVA 5A6JA 5KYNA 3HKKA 2ICWG 2D4UA 5HV9A 2G3KA 2A6EF 3O39A 3QVZA 3NDBB 3K1HA 1MQVA 2H8AA 2B0HA 2EIKC 3AGTA 4FWVA 3ZTMA 3UGPA 3K1IC 4U5EE 2AWYA 5KYUB 1YZCA 3Q7LA 2R7TA 2Q4FA 1TQGA 3H2VA 1TR2A 2R7QA 3KH2A 3RYLA 1PD0A 4DVYP 1JMWA 2Y3HA 1Z3IX 4PJNA 3R2PA 4F4BA 5A6KA 3B0UX 1IW7F 3GM1A 1H9TA 2R25A 1Y6DA 3L34A 3U3FA 2J9BA 4FX5A 3AQCA 2G3VA 4CX9A 4NTAA 2AU5A 2ZXRA 3S84A 3KKBA 3FHDA 3UGOA 2XLDA 3HNLA 3SXZA 3JTLO 2IM8A 5KYXA 4JKVA 2IBFA 4XPXA 4BJ6A 2JD3A 4IAOA 3QZCA 4MVQA 5A6AA 3V5YA 1SZIA 5E3CA 2A6HF 2P61A 3Q6NA 4YK5A 3HTKC 4KC9A 4CDAA 2H7OA 1WASA 4NC3A 3Q7GA 5CIVA 3VF0A 1WTYA 5B1BC 1LKXA 3C63A 2L7AA 1ZZPA 3EFOB 1OR3A 3TULA 4YT2A 2CGEA 5KYWA 3GWNA 2LSEA 4XTKA 3LEVA 5COFA 4E0HA 3AGUA 2XL4A 4G7OF 3ABMC 2CDQA 4IRUA 2TMVP 2R03A 3NYJA 4H4KC 4PACA 2XLWA 3W2WA 4CS7A 3U5SA 3V5ZA 3ZQYA 4CDYA 3JSZA 2I15A 3HNJA 3T4RA 1H7IA 2GDCA 1XZPA 3FVYA 3IQ5A 1U89A 1D0XA 1OQCA 4AK9A 1RXQA 1SYQA 1JRAA 3C8GA 5DVWA 3T6JA 2ETSA 2HJMA 2R7UA 4U5FE 4WABA 2EPKX 2XS1A 4Z9IA 2J0WA 3K7DA 5EK0A 1E86A 2HUJA 1M6TA 5K0IA 2CNWD 3SNHA 1D1AA 1Z5ZA 1BZ4A 2HMQA 4JZAA 4BJ1A 4Q4ZF 2BL2A 3IQTA 5FCLA 2J46A 3K66A 4AE4B 4MW8A 1U0BB 2PX0A 3V7OA 1T5OA 3Q6MA 3N24A 4DVZA 1MMAA 1QZXA 1D1BA 3ABKC 4QI2A 1G5ZA 2YWAA 4GQHA 4O6YA 2R7VA 2R7XA 3IPMO 3M15A 5L0HA 2WVNA 2Y3DA 3RFYA 2Y3GA 1HW1A 4MVSA 5EGYA 1IZMA 2J0XA 1NU7D 1PD1A 2H7VC 3UMHA 2X0CA 3EZIA 2JPUA 1N1CA 3I4UA 5JSLA 4PJMA 3BEHA 3M4BA 1AVOB 4YT8A 1BR2A 2EIMC 1U6HA 1HMOA 2UUIA 1CPQA 2I8BA 2QE9A 2XRHA 3EGDB 2P1AA 3C7JA 2L6GA 3M79A 3RIPA 5JVEA 2XLMA 3ZWIA 2KK1A 3TJ5A 3GEEA 1TWHA 2J9WA 4HFKB 4I3MA 4U5CE 3C8GD 4HEAJ 4MTGA 1OKKA 4IJJA 5KYXB 3AQBA 3G4ZA 2ASRA 3S29A 3FAJA 4JJFA 2IYLD 4MTOA 4ULWA 5B3SC 1XZQA 4EBBA 2CCYA 1AEPA 3GM3A 1Q0DA 3OEOA 2KSFA 2OCCC 4NCQA 3O55A 4ZLDA 3HLZA 3MBGA 1VTMP 1NSGB 3VM6A 1RKEB 1YYXA 4LERA 3ZDLA 1NZEA 2KQ9A 2VCCA 5B1AC 2AP3A 4DOZA 2WZFA 4E7ZA 3LLKA 3HNKA 3UNGC 4XLPF 3MYIA 2Q7RA 2LCHA 1VK5A 2QTVA 3GODA 2R7WA 1ZU4A 1XWJA 3K33A 2ZPAA 1S05A 2GFHA 1A7DA 2A69F 2PNOA 2DGJA 1K40A 2ZXOA 3C18A 4LACB 4AL0A 3WODF 1ORJA 1PCXA 2YLIA 4PK4A 4EIYA 3C62A 3CAXA 1W2WA 1Y4CA 2VCBA 4KNVA 3EGXB 3U8VA 2HV7A 1FTSA 2RSEB 1TWAA 3TD7A 2P0NA 3W8HA 1TWGA 3DJNB 1T6IA 4EHPA 4EUKB 4OD5A 3LEOA 4O6NA 1FNTc 2V3CC 1JR8A 3LS1A 3RQEA 4WJ0A 3X1OA 1DOWA 4DRHB 2BE5F 3NMJA 5T3TA 2HZ8A 2XS8A 1EA8A 2VB6A 4CIHA 2YHSA 5L3VA 2IXNA 3ABLC 2QNLA 2PX3A 2ZXPA 3DZAA 3F46A 3LESA 2MHRA 4J32B 4K1OA 5BUOA 3KYIA 5L0FA 1ZHZA 2XLEA 2NPUA 4ULVA 3DJUB 3LNRA 2XXAA 1F1MA 4P6IC 1NLXA 1A0BA 1KU2A 2NG1A 3O10A 2XXAB 1YLMA 3RKOF 2FAPB 4DXWA 4IARA 1FMWA 2C04A 4DRJB 1BDJB 3NG1A 5JRAA 1Q0FA 3IEEA 4XLNF 3DM9B 3EPVA 3J06A 3DKAA 1EI7A 1NG1A 5E2QA 1QQ3A 2H7BA 4XEKA 4YN0B 3DM5A 2C03A 1NU9C 3ZQVA 3UMIA 4E7SA 1D1CA 2WZLA 4W8KA 3KPHA 4IB4A 5COGA 3SXMA 3NKDA 4NY3A 1NFOA 4N6HA 1ZHTA 1LE2A 3DXJF 3U9JA 3T9OA 3R7CA 3FDQA 4OIPF 4MTFA 3UMKA 1TFKB 1VB5A 1CPRA 4ER9A 3C8GB 4BG0A 4K7BA 3ATPA 2LFDA 3PDMP 1ZHYA 4D4XA 1FMVA 4N4WA 2EILC 2J7PA 2YZSA 4YL3A 2A0UA 1CGNA 2DB4A 1YJGA 4W8PA 3AG4C 3W4YA 2WL8A 3KL4A 1OW8A 2Y39A 3T6BA 1PV3A 2XL6A 1R5ID 2OEVA 3SP1A 1RJ9B 4IAQA 3RQGA 2YL3A 3GEHA 4YL1A 1T01A 2QUPA 1ZVZA 1OCOC 4DRIB 4YT4A 2AWCA 2IXOA 5A69A 1CGME 4C7OB 3V5XA 1SR2A 1B68A 2YL7A 1M2OA 2YL1A 3ZIBA 3PHF2 1FFTC 4JVSA 3ZG1A 3A9CA 1ORSC 3B71A 2KJGA 3CSKA 5L0IA 2OQMA 1YVIA 3H65A 2KW3C 2R05A 3AJMA 4CDVA 2EINC 2WVQA 4WGZA 4CIPA 5KYYA 5CI9A 4EBKA 1J8YF 3IQCA 2AVKA 3G4XA 3I5QA 4A2NB 3GORA 2HV6A 1JOGA 3EH1A 3PMRA 5DLJA 3NKEA 1JPJA 4AE4A 1E85A 1Z6AA 4XQ1A 3S90A 2WVOA 2L9JA 4XEVA 1FAPB 4DJ9A 3OWTA 3AG2C 3JSEO 1YA9A 1YDIA 2NSFA 1KNYA 1VLSA 2W4BA 3LJBA 4GYTA 4JJGA 4JURI 3VRCA 4KNWA 1A7VA 1OW7A 2EPNA 2Y69C 3E9VA 1TWCA 2XSEA 3MYFA 4I44A 4MVOA 4OINF 2JX0A 4NTFA 3CZ6A 1OKKD 5JUAA 4JTDB 4LDRA 2YRFA 4K0DA 5B3IA 3ZC4A 2IOQA 3VAYA 4MS2A 2YLGA 2L81A 3SXYA 4JE9A 2LFFA 1D0YA 4U9DA 5JP7A 1C03A 5L3QA 2QLAA 1TKNA 1Q0KA 2XLOA 4NQFA 4CS9A 2Q9CA 1LI5A 3JRTA 2GA0A 2V26A 2CW0F 4MW3A 5A6BD 5L0JA 3U9MA 1WWPA 2R7OA 2X51A 1M2VA 1EKYA 3E70C 3SYNA 5E33A 2OOCA 1APCA 2UUHA 4GEHA 1SMYF 3JYHA 4RD9A 4EWCA 1UG7A 3B9QA 2Q9AA 3ZSUA 2VH3A 5GPGB 2QY9A 3MFNA 5EHHA 2YL0A 4PJLA 2KC3A 4WGYA 5BQIA 2VCAA 2EPLX 3VYWA 1NBBA 1WGWA 1AUEA 3DE8A 4CJGA 5D91A 3MLGA 3G50A 4OIOF 1M56C 3DD7A 5D92A 3RW0A 3N2ZB 3US6A 3DAGA 1Z7Qc 3S27A 1T6QA 2LQGA 1OW6A 3NMIA 3LNMB 4FAPB 5KYYB 1OCZC 4BJ5A 3EJNA 4N6CA 3ZTZA 2EPMX 1V74B 4EBJA 3W8IA 2LIGA 1QSPA 4CSAC 1LS4A 4XPYA 1RJ9A 4OIRF 4U5GA 1YAUO 4U5DE 4P9FA 2LK4A 5FZTA 2YQYA 4JCHA 2YLDA 4X0RA 4Z9HA 5T1DB 3CEXA 1ZYRF 4U9EA 256BA 5TJ5E 4BPMA 4J7TA 4XEFA 3S0XA 1VLTA 4Q7CA 4C7OA 3L8IA 4U5HA 5COMA 2CNWA 4CBEA 4AX2A 2YKZA 1L7CA 1MMNA 3KYJA 5CI8A 3KMIA 2DI3A 1WN0A 1WOLA 3SZRA 1O5HA 1M2VB 1I4YA 2PBEA 4NTBA 2NUTA 1ZW3A 4C3EA 2OJQA 3FXHA 1VYKA 1MMDA 4UDVA 4QDLA 1QPUA 4MVUA 2A68F 1DOVA 1VMAA 3ASNC 1WATA 2PF4E 4G0HA 4D4NA 3DWWA 4ANJA 5JT4A 2HMZA 3JZ0A 4ONSA 4Q5SF 2OKUA 4O6MA 2J45A 3LAYA 3GEIA 4JTAB 4JC7A 4IGGA 3ECSA 2HSBA 5AGFA 3TOLA 4CS8C 5BQHA 3NYMA 1RMVA 4BEMJ 1KTMA 2J9VA 1LM3B 1YA7O 1LPEA 5DS6A 4KI2A 3DMDA 1H6GA 5IY5C 2MYSA 5JS5A 1HMDA 2OJED 3FOOA 1ZW2A 3GWLA 3L1MA 4IWBA 1J8MF 2L6FA 1GM5A 2R9RB 3C8ZA 1QVXA 1QKRA 3HJCA 3QW1A 1O87A 1FR0A 4JRZA 5AC4A 2L6HA 4G7ZF 3HNIA 3MX3A 3RH3A 1G4WR 1GGQA 2GWWA 1K04A 3EH2A 3U0CA 4ZLCA 3FMSA 4N06A 2Z15A 2LD6A 1L3PA 2HSQA 4H54A 4E0IA 1G8XA 3M1CB 2XM0A 4YL0A 2B0JA 5KYUA 3RVYA 2OEXA 2KGOA 3AG3C 1YZAA 1RCPA 4YJWA 1BR1A 4JTCB 1T6UA 3FAPB 1O3UA 1Z63A 4G7HF 5F28E 3B29A 5AC5A 2KYHA 4J30B 1MNEA 2NUTB 1HW2A 3B0VC 1S7ZA 3QVYA 3S9OA 3SXKA 1QLEC 4L6RA 1NFNA 2DYRC 2R02A 4CSAA 3A11A 2E87A 1JAFA 4A4AA 3TJ6A 2FFHA 1ORYA 3S28A 3N0TA 2A0BA 3CQZA 4QI0A 2HS5A 5JLIA 5DQZA 2MWQA 1TFOB 3H2UA 4PFPA 4LDQA 2OG2A 3GANA 2O9XA 1C02A 1M57C 2IXMA 2LP4A 3QMKA 3NYLA 2NSGA 3W2VA 2R7SA 2BC5A 3DI5A 3JYYA 1HE1A 3K6BA 5DQTA 3LS0A 4J7YA 4E17A 2OU6A 1E83A 2Q9BA 1C17M 2GAQA 1FFHA 4BJ6C 2ZD9A 3K1IA 2NUPA 5HSWA 2W4MA 2P7VA 3DAFA 2F22A 4YT5A 5F5HA 4PFOA 3RVZA 4EKWA 3AG1C 2HJ3A 4O79A 4C3DA 1LIHA 1BR4A 3B0PA 2M4EA 4BEJA 4RBNA 1HY5A 4B6IA 3L8JA 3SEOA 1LI7A 3U3BA 3QW0A 4E18A 2WZGA 5BQGA 1Q0GA 4HE8D 4Z9JA 4BJTA 1CGOA 3UR3C 3AOUA 2VC9A 4CS9C 1A7EA 3EGXA 5F5FA 1VYIA 4KBLA 1V54C 2YVKA 3T6GB 5DS5A 3EHMA 3EZHA 4JW1A 4JCZA 4MVMA 4YWQA 3RQFA 1MNDA 1VOMA 3GM2A 3ITFA 1ZU5A 4G78A 4JIOA 4JEBA 4M63A 3U2MA 2FGYA 1R4TA 1ZHXA 1I5NA 3X2QC 4FESA 2EPOA 2W45A 3NMKA 4HFFB 2PFDA 4CS8A 4MVZA 3LUTB 5L0GA 2D5RB 2WB7A 4JEAA 3BRJA 1LE4A 4I1MA 2J8WA 4RDAA 4PJJA 4U5BE 1OCRC 1OXKA
chains in the Genus database with same CATH topology
4LLCA 2KNHA 3NRHA 2Y3BA 3EQLF 2P6VA 3I5PA 5DS4A 3OA1A 2A1DD 3EGDA 1LS1A 3F47A 1LVKA 2Q3TA 2J7PD 3O6XA 2J9UA 3EG9A 3EFOA 4OD4A 3LLIA 4MQ9F 2DYSC 4MNDA 2IXPA 4DBRA 1SF8A 2EIJC 4OIQF 4I1OB 3JCUQ 1MMGA 2NUPB 3EHNA 3WG7C 1V55C 4LLEA 4XWJA 1ST6A 5KYWB 2ZXWC 2R7RA 2W9YA 3ASOC 1JPNA 4DBQA 3EG9B 5T3WA 3POVA 2G62A 1D0ZA 3L0IA 1Z23A 2PP4A 1OCCC 2VASA 4O7GA 1ZHWA 5E3AA 3ZVRA 3JT1A 4BJ5C 4C3BA 2YEVA 5KYNA 2G3KA 2A6EF 3O39A 3NDBB 3K1HA 3UGPA 2EIKC 4FWVA 3K1IC 4U5EE 5KYUB 2R7TA 3Q7LA 1TR2A 2R7QA 3KH2A 3RYLA 1PD0A 4DVYP 2Y3HA 4PJNA 1Z3IX 4F4BA 3B0UX 1IW7F 3L34A 4FX5A 3AQCA 2G3VA 2ZXRA 3UGOA 3KKBA 3FHDA 5KYXA 4BJ6A 2JD3A 4IAOA 3QZCA 1SZIA 5E3CA 2A6HF 3Q6NA 3HTKC 4KC9A 2H7OA 3Q7GA 5B1BC 1LKXA 3EFOB 4YT2A 2CGEA 5KYWA 2LSEA 4XTKA 3LEVA 2XL4A 4G7OF 3ABMC 2CDQA 4IRUA 3NYJA 4H4KC 3W2WA 4CS7A 3JSZA 3T4RA 3FVYA 4AK9A 1D0XA 5DVWA 3T6JA 2R7UA 4U5FE 2J0WA 3K7DA 2CNWD 3SNHA 1D1AA 1Z5ZA 4JZAA 4BJ1A 4Q4ZF 5FCLA 2J46A 3K66A 4AE4B 2PX0A 3V7OA 3Q6MA 3N24A 4DVZA 1MMAA 1QZXA 1D1BA 3ABKC 4QI2A 4O6YA 2R7VA 2R7XA 2WVNA 2Y3DA 3RFYA 2Y3GA 5EGYA 1IZMA 2J0XA 1NU7D 1PD1A 2H7VC 3UMHA 3EZIA 1N1CA 3I4UA 4PJMA 4YT8A 1BR2A 2EIMC 4K0DA 2XRHA 2I8BA 3EGDB 3RIPA 1TWHA 2J9WA 4HFKB 4I3MA 4U5CE 4HEAJ 1OKKA 4IJJA 5KYXB 3AQBA 3S29A 3FAJA 4JJFA 2IYLD 4ULWA 5B3SC 4EBBA 3OEOA 2OCCC 4ZLDA 3HLZA 4LERA 4DOZA 4E7ZA 1NZEA 2KQ9A 5B1AC 2WZFA 3LLKA 3UNGC 4XLPF 1VK5A 2QTVA 3GODA 2R7WA 1ZU4A 3K33A 2ZPAA 2GFHA 2A69F 2ZXOA 2DGJA 4LACB 3WODF 1PCXA 4PK4A 1W2WA 4KNVA 3EGXB 2HV7A 1FTSA 1TWAA 3TD7A 3W8HA 1TWGA 3DJNB 2XXAA 4OD5A 4O6NA 2V3CC 3LS1A 4WJ0A 3X1OA 2BE5F 5T3TA 4CIHA 2VB6A 2YHSA 5L3VA 2IXNA 3ABLC 2ZXPA 2PX3A 3DZAA 3F46A 3LESA 4J32B 1ZHZA 3DJUB 3LNRA 4P6IC 1KU2A 2NG1A 2XXAB 3RKOF 1FMWA 2C04A 3NG1A 3IEEA 4XLNF 3DM9B 3EPVA 1NG1A 5E2QA 2H7BA 4YN0B 3DM5A 2C03A 1NU9C 3UMIA 4E7SA 1D1CA 2WZLA 4W8KA 3NKDA 4NY3A 1ZHTA 3DXJF 4OIPF 3UMKA 4BG0A 4K7BA 1ZHYA 1FMVA 2EILC 2J7PA 2YZSA 3AG4C 2WL8A 3KL4A 2Y39A 3T6BA 3SP1A 1RJ9B 1OCOC 4YT4A 2IXOA 4C7OB 1M2OA 3ZIBA 3PHF2 1FFTC 4JVSA 3ZG1A 2KJGA 3CSKA 3H65A 2KW3C 2EINC 2WVQA 5KYYA 5CI9A 1J8YF 3I5QA 4A2NB 2HV6A 3PMRA 3EH1A 5DLJA 3NKEA 1JPJA 4AE4A 1Z6AA 2WVOA 2L9JA 3OWTA 3AG2C 4JJGA 4JURI 2W4BA 3LJBA 4GYTA 3FDQA 4KNWA 4OINF 2Y69C 3E9VA 1TWCA 2XSEA 4I44A 3CZ6A 1OKKD 3ZC4A 2IOQA 3VAYA 2L81A 1D0YA 5L3QA 1TKNA 4CS9A 2Q9CA 3JRTA 2V26A 2CW0F 2R7OA 2X51A 1M2VA 3E70C 3SYNA 5E33A 4GEHA 1SMYF 3JYHA 4RD9A 4EWCA 3B9QA 2Q9AA 3ZSUA 2VH3A 2QY9A 5EHHA 4PJLA 3VYWA 1WGWA 5D91A 3MLGA 4OIOF 1M56C 3DD7A 5D92A 3N2ZB 3DAGA 3S27A 5KYYB 1OCZC 4BJ5A 3EJNA 3W8IA 4CSAC 4OIRF 1RJ9A 4U5GA 4U5DE 4JCHA 4X0RA 5T1DB 1ZYRF 3S0XA 4Q7CA 4C7OA 4U5HA 2CNWA 4CBEA 4AX2A 5CI8A 1MMNA 3KMIA 3SZRA 1M2VB 1O5HA 2NUTA 4C3EA 1VYKA 1MMDA 4QDLA 2A68F 1VMAA 3ASNC 4G0HA 2PF4E 4ANJA 4Q5SF 4O6MA 2J45A 3LAYA 5BUOA 4CS8C 3ECSA 3NYMA 2J9VA 5DS6A 4KI2A 3DMDA 5IY5C 2MYSA 4IWBA 1J8MF 3HJCA 1O87A 4G7ZF 3MX3A 3RH3A 3EH2A 4ZLCA 4N06A 2Z15A 1G8XA 3M1CB 2B0JA 5KYUA 3AG3C 2KGOA 4YJWA 1BR1A 1Z63A 4G7HF 4J30B 1MNEA 2NUTB 3B0VC 1S7ZA 1QLEC 2DYRC 4CSAA 2E87A 2FFHA 3S28A 3N0TA 3CQZA 4QI0A 5DQZA 2MWQA 4PFPA 2OG2A 3GANA 2O9XA 1M57C 2IXMA 3QMKA 2R7SA 3W2VA 3NYLA 5DQTA 3K6BA 3LS0A 2Q9BA 1FFHA 4BJ6C 2NUPA 5HSWA 2W4MA 2P7VA 3DAFA 4YT5A 5F5HA 4PFOA 3AG1C 4O79A 4C3DA 1BR4A 3B0PA 2M4EA 4BEJA 4RBNA 4B6IA 3SEOA 2WZGA 4HE8D 4BJTA 3UR3C 4CS9C 3EGXA 5F5FA 1VYIA 4KBLA 1V54C 5DS5A 3EHMA 3EZHA 4JW1A 4YWQA 1MNDA 1VOMA 3ITFA 1ZU5A 4M63A 2FGYA 1ZHXA 3X2QC 4FESA 2W45A 4HFFB 2PFDA 4CS8A 2D5RB 2WB7A 4I1MA 4RDAA 4PJJA 4U5BE 1OCRC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T4R A; 
#chains in the Genus database with same CATH topology
 3U2L A;  4LLC A;  2KNH A;  3NRH A;  1GQA A;  2XM4 A;  2Y3B A;  3EQL F;  1OXB A;  3M4C A;  1I4Z A;  2P6V A;  3DE9 A;  3I5P A;  1YYJ A;  5DS4 A;  4PR9 A;  1RKC A;  4AL1 A;  3OA1 A;  1E84 A;  4CJO A;  2A1D D;  3EGD A;  1BBH A;  1LS1 A;  1T9K A;  3F47 A;  1LVK A;  2Q3T A;  1GS9 A;  2J7P D;  2Q00 A;  3O6X A;  4LDK A;  5L0C A;  2J9U A;  3EG9 A;  3IHU A;  3PCV A;  3EFO A;  4MVR A;  4OD4 A;  2M64 A;  2XL8 A;  3LLI A;  4MQ9 F;  2DYS C;  4MND A;  2IXP A;  4P9T A;  4DBR A;  2HFI A;  1SF8 A;  2EIJ C;  4OIQ F;  3TK0 A;  4I1O B;  3JCU Q;  1MMG A;  2NUP B;  3EHN A;  1E2X A;  1V55 C;  1G4U S;  4LLE A;  3WG7 C;  4XWJ A;  1ST6 A;  5KYW B;  2ZXW C;  2RD9 A;  2R7R A;  1V4A A;  2W9Y A;  1HE9 A;  1OR2 A;  2CYD A;  3QTH A;  2HKV A;  3ASO C;  1JPN A;  4R32 A;  4DBQ A;  3WHN A;  5L0D A;  3JRM O;  3EG9 B;  5T3W A;  3POV A;  1H9G A;  2G62 A;  1D0Z A;  3L0I A;  1Z23 A;  2PP4 A;  3RF3 A;  1YAR O;  1OCC C;  1UFB A;  2VAS A;  1ZHW A;  4O7G A;  1Q0M A;  5E3A A;  1A41 A;  3U8P A;  3WAQ A;  3ZVR A;  2XLH A;  1EQ1 A;  1K05 A;  4XPW A;  3JT1 A;  4BJ5 C;  1RKE A;  3FOP A;  3TQO A;  4C3B A;  5A6B A;  2XLV A;  3IQ6 A;  3TOM A;  2YEV A;  5A6J A;  5KYN A;  3HKK A;  2ICW G;  2D4U A;  5HV9 A;  2G3K A;  2A6E F;  3O39 A;  3QVZ A;  3NDB B;  3K1H A;  1MQV A;  2H8A A;  2B0H A;  2EIK C;  3AGT A;  4FWV A;  3ZTM A;  3UGP A;  3K1I C;  4U5E E;  2AWY A;  5KYU B;  1YZC A;  3Q7L A;  2R7T A;  2Q4F A;  1TQG A;  3H2V A;  1TR2 A;  2R7Q A;  3KH2 A;  3RYL A;  1PD0 A;  4DVY P;  1JMW A;  2Y3H A;  1Z3I X;  4PJN A;  3R2P A;  4F4B A;  5A6K A;  3B0U X;  1IW7 F;  3GM1 A;  1H9T A;  2R25 A;  1Y6D A;  3L34 A;  3U3F A;  2J9B A;  4FX5 A;  3AQC A;  2G3V A;  4CX9 A;  4NTA A;  2AU5 A;  2ZXR A;  3S84 A;  3KKB A;  3FHD A;  3UGO A;  2XLD A;  3HNL A;  3SXZ A;  3JTL O;  2IM8 A;  5KYX A;  4JKV A;  2IBF A;  4XPX A;  4BJ6 A;  2JD3 A;  4IAO A;  3QZC A;  4MVQ A;  5A6A A;  3V5Y A;  1SZI A;  5E3C A;  2A6H F;  2P61 A;  3Q6N A;  4YK5 A;  3HTK C;  4KC9 A;  4CDA A;  2H7O A;  1WAS A;  4NC3 A;  3Q7G A;  5CIV A;  3VF0 A;  1WTY A;  5B1B C;  1LKX A;  3C63 A;  2L7A A;  1ZZP A;  3EFO B;  1OR3 A;  3TUL A;  4YT2 A;  2CGE A;  5KYW A;  3GWN A;  2LSE A;  4XTK A;  3LEV A;  5COF A;  4E0H A;  3AGU A;  2XL4 A;  4G7O F;  3ABM C;  2CDQ A;  4IRU A;  2TMV P;  2R03 A;  3NYJ A;  4H4K C;  4PAC A;  2XLW A;  3W2W A;  4CS7 A;  3U5S A;  3V5Z A;  3ZQY A;  4CDY A;  3JSZ A;  2I15 A;  3HNJ A;  3T4R A;  1H7I A;  2GDC A;  1XZP A;  3FVY A;  3IQ5 A;  1U89 A;  1D0X A;  1OQC A;  4AK9 A;  1RXQ A;  1SYQ A;  1JRA A;  3C8G A;  5DVW A;  3T6J A;  2ETS A;  2HJM A;  2R7U A;  4U5F E;  4WAB A;  2EPK X;  2XS1 A;  4Z9I A;  2J0W A;  3K7D A;  5EK0 A;  1E86 A;  2HUJ A;  1M6T A;  5K0I A;  2CNW D;  3SNH A;  1D1A A;  1Z5Z A;  1BZ4 A;  2HMQ A;  4JZA A;  4BJ1 A;  4Q4Z F;  2BL2 A;  3IQT A;  5FCL A;  2J46 A;  3K66 A;  4AE4 B;  4MW8 A;  1U0B B;  2PX0 A;  3V7O A;  1T5O A;  3Q6M A;  3N24 A;  4DVZ A;  1MMA A;  1QZX A;  1D1B A;  3ABK C;  4QI2 A;  1G5Z A;  2YWA A;  4GQH A;  4O6Y A;  2R7V A;  2R7X A;  3IPM O;  3M15 A;  5L0H A;  2WVN A;  2Y3D A;  3RFY A;  2Y3G A;  1HW1 A;  4MVS A;  5EGY A;  1IZM A;  2J0X A;  1NU7 D;  1PD1 A;  2H7V C;  3UMH A;  2X0C A;  3EZI A;  2JPU A;  1N1C A;  3I4U A;  5JSL A;  4PJM A;  3BEH A;  3M4B A;  1AVO B;  4YT8 A;  1BR2 A;  2EIM C;  1U6H A;  1HMO A;  2UUI A;  1CPQ A;  2I8B A;  2QE9 A;  2XRH A;  3EGD B;  2P1A A;  3C7J A;  2L6G A;  3M79 A;  3RIP A;  5JVE A;  2XLM A;  3ZWI A;  2KK1 A;  3TJ5 A;  3GEE A;  1TWH A;  2J9W A;  4HFK B;  4I3M A;  4U5C E;  3C8G D;  4HEA J;  4MTG A;  1OKK A;  4IJJ A;  5KYX B;  3AQB A;  3G4Z A;  2ASR A;  3S29 A;  3FAJ A;  4JJF A;  2IYL D;  4MTO A;  4ULW A;  5B3S C;  1XZQ A;  4EBB A;  2CCY A;  1AEP A;  3GM3 A;  1Q0D A;  3OEO A;  2KSF A;  2OCC C;  4NCQ A;  3O55 A;  4ZLD A;  3HLZ A;  3MBG A;  1VTM P;  1NSG B;  3VM6 A;  1RKE B;  1YYX A;  4LER A;  3ZDL A;  1NZE A;  2KQ9 A;  2VCC A;  5B1A C;  2AP3 A;  4DOZ A;  2WZF A;  4E7Z A;  3LLK A;  3HNK A;  3UNG C;  4XLP F;  3MYI A;  2Q7R A;  2LCH A;  1VK5 A;  2QTV A;  3GOD A;  2R7W A;  1ZU4 A;  1XWJ A;  3K33 A;  2ZPA A;  1S05 A;  2GFH A;  1A7D A;  2A69 F;  2PNO A;  2DGJ A;  1K40 A;  2ZXO A;  3C18 A;  4LAC B;  4AL0 A;  3WOD F;  1ORJ A;  1PCX A;  2YLI A;  4PK4 A;  4EIY A;  3C62 A;  3CAX A;  1W2W A;  1Y4C A;  2VCB A;  4KNV A;  3EGX B;  3U8V A;  2HV7 A;  1FTS A;  2RSE B;  1TWA A;  3TD7 A;  2P0N A;  3W8H A;  1TWG A;  3DJN B;  1T6I A;  4EHP A;  4EUK B;  4OD5 A;  3LEO A;  4O6N A;  1FNT c;  2V3C C;  1JR8 A;  3LS1 A;  3RQE A;  4WJ0 A;  3X1O A;  1DOW A;  4DRH B;  2BE5 F;  3NMJ A;  5T3T A;  2HZ8 A;  2XS8 A;  1EA8 A;  2VB6 A;  4CIH A;  2YHS A;  5L3V A;  2IXN A;  3ABL C;  2QNL A;  2PX3 A;  2ZXP A;  3DZA A;  3F46 A;  3LES A;  2MHR A;  4J32 B;  4K1O A;  5BUO A;  3KYI A;  5L0F A;  1ZHZ A;  2XLE A;  2NPU A;  4ULV A;  3DJU B;  3LNR A;  2XXA A;  1F1M A;  4P6I C;  1NLX A;  1A0B A;  1KU2 A;  2NG1 A;  3O10 A;  2XXA B;  1YLM A;  3RKO F;  2FAP B;  4DXW A;  4IAR A;  1FMW A;  2C04 A;  4DRJ B;  1BDJ B;  3NG1 A;  5JRA A;  1Q0F A;  3IEE A;  4XLN F;  3DM9 B;  3EPV A;  3J06 A;  3DKA A;  1EI7 A;  1NG1 A;  5E2Q A;  1QQ3 A;  2H7B A;  4XEK A;  4YN0 B;  3DM5 A;  2C03 A;  1NU9 C;  3ZQV A;  3UMI A;  4E7S A;  1D1C A;  2WZL A;  4W8K A;  3KPH A;  4IB4 A;  5COG A;  3SXM A;  3NKD A;  4NY3 A;  1NFO A;  4N6H A;  1ZHT A;  1LE2 A;  3DXJ F;  3U9J A;  3T9O A;  3R7C A;  3FDQ A;  4OIP F;  4MTF A;  3UMK A;  1TFK B;  1VB5 A;  1CPR A;  4ER9 A;  3C8G B;  4BG0 A;  4K7B A;  3ATP A;  2LFD A;  3PDM P;  1ZHY A;  4D4X A;  1FMV A;  4N4W A;  2EIL C;  2J7P A;  2YZS A;  4YL3 A;  2A0U A;  1CGN A;  2DB4 A;  1YJG A;  4W8P A;  3AG4 C;  3W4Y A;  2WL8 A;  3KL4 A;  1OW8 A;  2Y39 A;  3T6B A;  1PV3 A;  2XL6 A;  1R5I D;  2OEV A;  3SP1 A;  1RJ9 B;  4IAQ A;  3RQG A;  2YL3 A;  3GEH A;  4YL1 A;  1T01 A;  2QUP A;  1ZVZ A;  1OCO C;  4DRI B;  4YT4 A;  2AWC A;  2IXO A;  5A69 A;  1CGM E;  4C7O B;  3V5X A;  1SR2 A;  1B68 A;  2YL7 A;  1M2O A;  2YL1 A;  3ZIB A;  3PHF 2;  1FFT C;  4JVS A;  3ZG1 A;  3A9C A;  1ORS C;  3B71 A;  2KJG A;  3CSK A;  5L0I A;  2OQM A;  1YVI A;  3H65 A;  2KW3 C;  2R05 A;  3AJM A;  4CDV A;  2EIN C;  2WVQ A;  4WGZ A;  4CIP A;  5KYY A;  5CI9 A;  4EBK A;  1J8Y F;  3IQC A;  2AVK A;  3G4X A;  3I5Q A;  4A2N B;  3GOR A;  2HV6 A;  1JOG A;  3EH1 A;  3PMR A;  5DLJ A;  3NKE A;  1JPJ A;  4AE4 A;  1E85 A;  1Z6A A;  4XQ1 A;  3S90 A;  2WVO A;  2L9J A;  4XEV A;  1FAP B;  4DJ9 A;  3OWT A;  3AG2 C;  3JSE O;  1YA9 A;  1YDI A;  2NSF A;  1KNY A;  1VLS A;  2W4B A;  3LJB A;  4GYT A;  4JJG A;  4JUR I;  3VRC A;  4KNW A;  1A7V A;  1OW7 A;  2EPN A;  2Y69 C;  3E9V A;  1TWC A;  2XSE A;  3MYF A;  4I44 A;  4MVO A;  4OIN F;  2JX0 A;  4NTF A;  3CZ6 A;  1OKK D;  5JUA A;  4JTD B;  4LDR A;  2YRF A;  4K0D A;  5B3I A;  3ZC4 A;  2IOQ A;  3VAY A;  4MS2 A;  2YLG A;  2L81 A;  3SXY A;  4JE9 A;  2LFF A;  1D0Y A;  4U9D A;  5JP7 A;  1C03 A;  5L3Q A;  2QLA A;  1TKN A;  1Q0K A;  2XLO A;  4NQF A;  4CS9 A;  2Q9C A;  1LI5 A;  3JRT A;  2GA0 A;  2V26 A;  2CW0 F;  4MW3 A;  5A6B D;  5L0J A;  3U9M A;  1WWP A;  2R7O A;  2X51 A;  1M2V A;  1EKY A;  3E70 C;  3SYN A;  5E33 A;  2OOC A;  1APC A;  2UUH A;  4GEH A;  1SMY F;  3JYH A;  4RD9 A;  4EWC A;  1UG7 A;  3B9Q A;  2Q9A A;  3ZSU A;  2VH3 A;  5GPG B;  2QY9 A;  3MFN A;  5EHH A;  2YL0 A;  4PJL A;  2KC3 A;  4WGY A;  5BQI A;  2VCA A;  2EPL X;  3VYW A;  1NBB A;  1WGW A;  1AUE A;  3DE8 A;  4CJG A;  5D91 A;  3MLG A;  3G50 A;  4OIO F;  1M56 C;  3DD7 A;  5D92 A;  3RW0 A;  3N2Z B;  3US6 A;  3DAG A;  1Z7Q c;  3S27 A;  1T6Q A;  2LQG A;  1OW6 A;  3NMI A;  3LNM B;  4FAP B;  5KYY B;  1OCZ C;  4BJ5 A;  3EJN A;  4N6C A;  3ZTZ A;  2EPM X;  1V74 B;  4EBJ A;  3W8I A;  2LIG A;  1QSP A;  4CSA C;  1LS4 A;  4XPY A;  1RJ9 A;  4OIR F;  4U5G A;  1YAU O;  4U5D E;  4P9F A;  2LK4 A;  5FZT A;  2YQY A;  4JCH A;  2YLD A;  4X0R A;  4Z9H A;  5T1D B;  3CEX A;  1ZYR F;  4U9E A;  256B A;  5TJ5 E;  4BPM A;  4J7T A;  4XEF A;  3S0X A;  1VLT A;  4Q7C A;  4C7O A;  3L8I A;  4U5H A;  5COM A;  2CNW A;  4CBE A;  4AX2 A;  2YKZ A;  1L7C A;  1MMN A;  3KYJ A;  5CI8 A;  3KMI A;  2DI3 A;  1WN0 A;  1WOL A;  3SZR A;  1O5H A;  1M2V B;  1I4Y A;  2PBE A;  4NTB A;  2NUT A;  1ZW3 A;  4C3E A;  2OJQ A;  3FXH A;  1VYK A;  1MMD A;  4UDV A;  4QDL A;  1QPU A;  4MVU A;  2A68 F;  1DOV A;  1VMA A;  3ASN C;  1WAT A;  2PF4 E;  4G0H A;  4D4N A;  3DWW A;  4ANJ A;  5JT4 A;  2HMZ A;  3JZ0 A;  4ONS A;  4Q5S F;  2OKU A;  4O6M A;  2J45 A;  3LAY A;  3GEI A;  4JTA B;  4JC7 A;  4IGG A;  3ECS A;  2HSB A;  5AGF A;  3TOL A;  4CS8 C;  5BQH A;  3NYM A;  1RMV A;  4BEM J;  1KTM A;  2J9V A;  1LM3 B;  1YA7 O;  1LPE A;  5DS6 A;  4KI2 A;  3DMD A;  1H6G A;  5IY5 C;  2MYS A;  5JS5 A;  1HMD A;  2OJE D;  3FOO A;  1ZW2 A;  3GWL A;  3L1M A;  4IWB A;  1J8M F;  2L6F A;  1GM5 A;  2R9R B;  3C8Z A;  1QVX A;  1QKR A;  3HJC A;  3QW1 A;  1O87 A;  1FR0 A;  4JRZ A;  5AC4 A;  2L6H A;  4G7Z F;  3HNI A;  3MX3 A;  3RH3 A;  1G4W R;  1GGQ A;  2GWW A;  1K04 A;  3EH2 A;  3U0C A;  4ZLC A;  3FMS A;  4N06 A;  2Z15 A;  2LD6 A;  1L3P A;  2HSQ A;  4H54 A;  4E0I A;  1G8X A;  3M1C B;  2XM0 A;  4YL0 A;  2B0J A;  5KYU A;  3RVY A;  2OEX A;  2KGO A;  3AG3 C;  1YZA A;  1RCP A;  4YJW A;  1BR1 A;  4JTC B;  1T6U A;  3FAP B;  1O3U A;  1Z63 A;  4G7H F;  5F28 E;  3B29 A;  5AC5 A;  2KYH A;  4J30 B;  1MNE A;  2NUT B;  1HW2 A;  3B0V C;  1S7Z A;  3QVY A;  3S9O A;  3SXK A;  1QLE C;  4L6R A;  1NFN A;  2DYR C;  2R02 A;  4CSA A;  3A11 A;  2E87 A;  1JAF A;  4A4A A;  3TJ6 A;  2FFH A;  1ORY A;  3S28 A;  3N0T A;  2A0B A;  3CQZ A;  4QI0 A;  2HS5 A;  5JLI A;  5DQZ A;  2MWQ A;  1TFO B;  3H2U A;  4PFP A;  4LDQ A;  2OG2 A;  3GAN A;  2O9X A;  1C02 A;  1M57 C;  2IXM A;  2LP4 A;  3QMK A;  3NYL A;  2NSG A;  3W2V A;  2R7S A;  2BC5 A;  3DI5 A;  3JYY A;  1HE1 A;  3K6B A;  5DQT A;  3LS0 A;  4J7Y A;  4E17 A;  2OU6 A;  1E83 A;  2Q9B A;  1C17 M;  2GAQ A;  1FFH A;  4BJ6 C;  2ZD9 A;  3K1I A;  2NUP A;  5HSW A;  2W4M A;  2P7V A;  3DAF A;  2F22 A;  4YT5 A;  5F5H A;  4PFO A;  3RVZ A;  4EKW A;  3AG1 C;  2HJ3 A;  4O79 A;  4C3D A;  1LIH A;  1BR4 A;  3B0P A;  2M4E A;  4BEJ A;  4RBN A;  1HY5 A;  4B6I A;  3L8J A;  3SEO A;  1LI7 A;  3U3B A;  3QW0 A;  4E18 A;  2WZG A;  5BQG A;  1Q0G A;  4HE8 D;  4Z9J A;  4BJT A;  1CGO A;  3UR3 C;  3AOU A;  2VC9 A;  4CS9 C;  1A7E A;  3EGX A;  5F5F A;  1VYI A;  4KBL A;  1V54 C;  2YVK A;  3T6G B;  5DS5 A;  3EHM A;  3EZH A;  4JW1 A;  4JCZ A;  4MVM A;  4YWQ A;  3RQF A;  1MND A;  1VOM A;  3GM2 A;  3ITF A;  1ZU5 A;  4G78 A;  4JIO A;  4JEB A;  4M63 A;  3U2M A;  2FGY A;  1R4T A;  1ZHX A;  1I5N A;  3X2Q C;  4FES A;  2EPO A;  2W45 A;  3NMK A;  4HFF B;  2PFD A;  4CS8 A;  4MVZ A;  3LUT B;  5L0G A;  2D5R B;  2WB7 A;  4JEA A;  3BRJ A;  1LE4 A;  4I1M A;  2J8W A;  4RDA A;  4PJJ A;  4U5B E;  1OCR C;  1OXK A; 
#chains in the Genus database with same CATH homology
 4LLC A;  2KNH A;  3NRH A;  2Y3B A;  3EQL F;  2P6V A;  3I5P A;  5DS4 A;  3OA1 A;  2A1D D;  3EGD A;  1LS1 A;  3F47 A;  1LVK A;  2Q3T A;  2J7P D;  3O6X A;  2J9U A;  3EG9 A;  3EFO A;  4OD4 A;  3LLI A;  4MQ9 F;  2DYS C;  4MND A;  2IXP A;  4DBR A;  1SF8 A;  2EIJ C;  4OIQ F;  4I1O B;  3JCU Q;  1MMG A;  2NUP B;  3EHN A;  3WG7 C;  1V55 C;  4LLE A;  4XWJ A;  1ST6 A;  5KYW B;  2ZXW C;  2R7R A;  2W9Y A;  3ASO C;  1JPN A;  4DBQ A;  3EG9 B;  5T3W A;  3POV A;  2G62 A;  1D0Z A;  3L0I A;  1Z23 A;  2PP4 A;  1OCC C;  2VAS A;  4O7G A;  1ZHW A;  5E3A A;  3ZVR A;  3JT1 A;  4BJ5 C;  4C3B A;  2YEV A;  5KYN A;  2G3K A;  2A6E F;  3O39 A;  3NDB B;  3K1H A;  3UGP A;  2EIK C;  4FWV A;  3K1I C;  4U5E E;  5KYU B;  2R7T A;  3Q7L A;  1TR2 A;  2R7Q A;  3KH2 A;  3RYL A;  1PD0 A;  4DVY P;  2Y3H A;  4PJN A;  1Z3I X;  4F4B A;  3B0U X;  1IW7 F;  3L34 A;  4FX5 A;  3AQC A;  2G3V A;  2ZXR A;  3UGO A;  3KKB A;  3FHD A;  5KYX A;  4BJ6 A;  2JD3 A;  4IAO A;  3QZC A;  1SZI A;  5E3C A;  2A6H F;  3Q6N A;  3HTK C;  4KC9 A;  2H7O A;  3Q7G A;  5B1B C;  1LKX A;  3EFO B;  4YT2 A;  2CGE A;  5KYW A;  2LSE A;  4XTK A;  3LEV A;  2XL4 A;  4G7O F;  3ABM C;  2CDQ A;  4IRU A;  3NYJ A;  4H4K C;  3W2W A;  4CS7 A;  3JSZ A;  3T4R A;  3FVY A;  4AK9 A;  1D0X A;  5DVW A;  3T6J A;  2R7U A;  4U5F E;  2J0W A;  3K7D A;  2CNW D;  3SNH A;  1D1A A;  1Z5Z A;  4JZA A;  4BJ1 A;  4Q4Z F;  5FCL A;  2J46 A;  3K66 A;  4AE4 B;  2PX0 A;  3V7O A;  3Q6M A;  3N24 A;  4DVZ A;  1MMA A;  1QZX A;  1D1B A;  3ABK C;  4QI2 A;  4O6Y A;  2R7V A;  2R7X A;  2WVN A;  2Y3D A;  3RFY A;  2Y3G A;  5EGY A;  1IZM A;  2J0X A;  1NU7 D;  1PD1 A;  2H7V C;  3UMH A;  3EZI A;  1N1C A;  3I4U A;  4PJM A;  4YT8 A;  1BR2 A;  2EIM C;  4K0D A;  2XRH A;  2I8B A;  3EGD B;  3RIP A;  1TWH A;  2J9W A;  4HFK B;  4I3M A;  4U5C E;  4HEA J;  1OKK A;  4IJJ A;  5KYX B;  3AQB A;  3S29 A;  3FAJ A;  4JJF A;  2IYL D;  4ULW A;  5B3S C;  4EBB A;  3OEO A;  2OCC C;  4ZLD A;  3HLZ A;  4LER A;  4DOZ A;  4E7Z A;  1NZE A;  2KQ9 A;  5B1A C;  2WZF A;  3LLK A;  3UNG C;  4XLP F;  1VK5 A;  2QTV A;  3GOD A;  2R7W A;  1ZU4 A;  3K33 A;  2ZPA A;  2GFH A;  2A69 F;  2ZXO A;  2DGJ A;  4LAC B;  3WOD F;  1PCX A;  4PK4 A;  1W2W A;  4KNV A;  3EGX B;  2HV7 A;  1FTS A;  1TWA A;  3TD7 A;  3W8H A;  1TWG A;  3DJN B;  2XXA A;  4OD5 A;  4O6N A;  2V3C C;  3LS1 A;  4WJ0 A;  3X1O A;  2BE5 F;  5T3T A;  4CIH A;  2VB6 A;  2YHS A;  5L3V A;  2IXN A;  3ABL C;  2ZXP A;  2PX3 A;  3DZA A;  3F46 A;  3LES A;  4J32 B;  1ZHZ A;  3DJU B;  3LNR A;  4P6I C;  1KU2 A;  2NG1 A;  2XXA B;  3RKO F;  1FMW A;  2C04 A;  3NG1 A;  3IEE A;  4XLN F;  3DM9 B;  3EPV A;  1NG1 A;  5E2Q A;  2H7B A;  4YN0 B;  3DM5 A;  2C03 A;  1NU9 C;  3UMI A;  4E7S A;  1D1C A;  2WZL A;  4W8K A;  3NKD A;  4NY3 A;  1ZHT A;  3DXJ F;  4OIP F;  3UMK A;  4BG0 A;  4K7B A;  1ZHY A;  1FMV A;  2EIL C;  2J7P A;  2YZS A;  3AG4 C;  2WL8 A;  3KL4 A;  2Y39 A;  3T6B A;  3SP1 A;  1RJ9 B;  1OCO C;  4YT4 A;  2IXO A;  4C7O B;  1M2O A;  3ZIB A;  3PHF 2;  1FFT C;  4JVS A;  3ZG1 A;  2KJG A;  3CSK A;  3H65 A;  2KW3 C;  2EIN C;  2WVQ A;  5KYY A;  5CI9 A;  1J8Y F;  3I5Q A;  4A2N B;  2HV6 A;  3PMR A;  3EH1 A;  5DLJ A;  3NKE A;  1JPJ A;  4AE4 A;  1Z6A A;  2WVO A;  2L9J A;  3OWT A;  3AG2 C;  4JJG A;  4JUR I;  2W4B A;  3LJB A;  4GYT A;  3FDQ A;  4KNW A;  4OIN F;  2Y69 C;  3E9V A;  1TWC A;  2XSE A;  4I44 A;  3CZ6 A;  1OKK D;  3ZC4 A;  2IOQ A;  3VAY A;  2L81 A;  1D0Y A;  5L3Q A;  1TKN A;  4CS9 A;  2Q9C A;  3JRT A;  2V26 A;  2CW0 F;  2R7O A;  2X51 A;  1M2V A;  3E70 C;  3SYN A;  5E33 A;  4GEH A;  1SMY F;  3JYH A;  4RD9 A;  4EWC A;  3B9Q A;  2Q9A A;  3ZSU A;  2VH3 A;  2QY9 A;  5EHH A;  4PJL A;  3VYW A;  1WGW A;  5D91 A;  3MLG A;  4OIO F;  1M56 C;  3DD7 A;  5D92 A;  3N2Z B;  3DAG A;  3S27 A;  5KYY B;  1OCZ C;  4BJ5 A;  3EJN A;  3W8I A;  4CSA C;  4OIR F;  1RJ9 A;  4U5G A;  4U5D E;  4JCH A;  4X0R A;  5T1D B;  1ZYR F;  3S0X A;  4Q7C A;  4C7O A;  4U5H A;  2CNW A;  4CBE A;  4AX2 A;  5CI8 A;  1MMN A;  3KMI A;  3SZR A;  1M2V B;  1O5H A;  2NUT A;  4C3E A;  1VYK A;  1MMD A;  4QDL A;  2A68 F;  1VMA A;  3ASN C;  4G0H A;  2PF4 E;  4ANJ A;  4Q5S F;  4O6M A;  2J45 A;  3LAY A;  5BUO A;  4CS8 C;  3ECS A;  3NYM A;  2J9V A;  5DS6 A;  4KI2 A;  3DMD A;  5IY5 C;  2MYS A;  4IWB A;  1J8M F;  3HJC A;  1O87 A;  4G7Z F;  3MX3 A;  3RH3 A;  3EH2 A;  4ZLC A;  4N06 A;  2Z15 A;  1G8X A;  3M1C B;  2B0J A;  5KYU A;  3AG3 C;  2KGO A;  4YJW A;  1BR1 A;  1Z63 A;  4G7H F;  4J30 B;  1MNE A;  2NUT B;  3B0V C;  1S7Z A;  1QLE C;  2DYR C;  4CSA A;  2E87 A;  2FFH A;  3S28 A;  3N0T A;  3CQZ A;  4QI0 A;  5DQZ A;  2MWQ A;  4PFP A;  2OG2 A;  3GAN A;  2O9X A;  1M57 C;  2IXM A;  3QMK A;  2R7S A;  3W2V A;  3NYL A;  5DQT A;  3K6B A;  3LS0 A;  2Q9B A;  1FFH A;  4BJ6 C;  2NUP A;  5HSW A;  2W4M A;  2P7V A;  3DAF A;  4YT5 A;  5F5H A;  4PFO A;  3AG1 C;  4O79 A;  4C3D A;  1BR4 A;  3B0P A;  2M4E A;  4BEJ A;  4RBN A;  4B6I A;  3SEO A;  2WZG A;  4HE8 D;  4BJT A;  3UR3 C;  4CS9 C;  3EGX A;  5F5F A;  1VYI A;  4KBL A;  1V54 C;  5DS5 A;  3EHM A;  3EZH A;  4JW1 A;  4YWQ A;  1MND A;  1VOM A;  3ITF A;  1ZU5 A;  4M63 A;  2FGY A;  1ZHX A;  3X2Q C;  4FES A;  2W45 A;  4HFF B;  2PFD A;  4CS8 A;  2D5R B;  2WB7 A;  4I1M A;  4RDA A;  4PJJ A;  4U5B E;  1OCR C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...