3T4RA

Lettuce necrotic yellow virus phosphoprotein c-terminal domain
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
72
structure length
72
Chain Sequence
b'RIRHEKEKLLADLDWEIGEIAQYTPLIVDFLVPDDILAMAADGLTPELKEKIQNEIIENHIALMALEEYSSL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphoprotein
molecule tags Viral protein
source organism Lettuce necrotic yellows virus
publication title Structure of the C-terminal domain of lettuce necrotic yellows virus phosphoprotein.
pubmed doi rcsb
total genus 23
structure length 72
sequence length 72
ec nomenclature
pdb deposition date 2011-07-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1590 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3t4rA00
3T4RA
chains in the Genus database with same CATH superfamily
3TJ6A 3RYLA 2A0BA 1NU9C 1ZVZA 3EGXB 4YT5A 2HS5A 3NKDA 4ER9A 2DYRC 3A9CA 3S0XA 1Z63A 1H9TA 2Y3DA 2LQGA 3JYYA 2IXNA 2GDCA 3K1IA 4OD5A 3GEIA 4YL1A 3T9OA 2L6FA 3U5SA 3WODF 1E83A 3TOMA 2HFIA 3Q6MA 3O10A 1NU7D 1Q0KA 5AC4A 1S7ZA 4J7YA 1RCPA 3L1MA 5HV9A 3FVYA 1MQVA 3L8IA 1FFHA 4OD4A 2ICWG 2OEXA 3ITFA 3HNKA 1FTSA 1ST6A 1LKXA 3UMKA 1KU2A 4E18A 1YLMA 2YVKA 2EIJC 4LDRA 3RVZA 4DRJB 2YRFA 3K7DA 5F5HA 3EZIA 1ORJA 4PJJA 1YZCA 3IQ6A 5FZTA 3SXMA 1FMWA 3SXYA 3LJBA 2CW0F 4IAOA 2AVKA 4O6NA 3DWWA 1BBHA 3B9QA 4C3DA 2OJED 3H2VA 2HSQA 2KJGA 1WOLA 1VTMP 4NC3A 2IOQA 1K04A 3H2UA 1QVXA 2KYHA 2R7WA 3V5ZA 2QTVA 2AWCA 2J0XA 3PDMP 1HE1A 5L3QA 4MS2A 3KMIA 4OINF 1BZ4A 2YL3A 4JZAA 4N6HA 2KW3C 5BQHA 1RJ9B 2L6HA 4ZLDA 2HMQA 1PD1A 2BC5A 3DAFA 4M63A 4CS8C 3U9JA 5COGA 3POVA 2HJ3A 2ZXOA 3VYWA 2Y3BA 3V5XA 1M6TA 1D0XA 3U3FA 2Y39A 2R7TA 1OKKD 1M57C 2C04A 2IYLD 3FOOA 1VYIA 2OG2A 4XEFA 4BJTA 5JRAA 1O3UA 1Z5ZA 3S84A 3KH2A 2BE5F 2XM0A 3DI5A 3DMDA 3VAYA 1E85A 1RMVA 2IBFA 2P7VA 3JSZA 4NTAA 3ZDLA 2P1AA 3V7OA 5JT4A 3EGDA 4FWVA 2EIKC 5CI8A 4CDAA 5L0CA 1BR1A 1J8YF 3KYIA 4O79A 1MMGA 3DZAA 1XWJA 2M4EA 3I5QA 4FX5A 1M56C 2W4MA 4PR9A 4YL0A 4WABA 2L6GA 4KNVA 2AU5A 3HNIA 2EPNA 1M2VB 2XL4A 4NTFA 2L81A 1OCOC 3GM3A 3SZRA 3QZCA 1BR4A 2D5RB 4CSAC 1CPQA 4HFKB 4AE4B 3DM9B 1WN0A 2J9WA 4W8KA 3GODA 1SZIA 3DD7A 4X0RA 4MVOA 3DM5A 3TQOA 1XZPA 4XEKA 1TKNA 2F22A 4C7OA 4I3MA 4EBJA 3DAGA 2Q4FA 2XLMA 4JEAA 1GQAA 3TK0A 1SR2A 2BL2A 2NSGA 3FXHA 2NUPB 1LVKA 4JTDB 4Z9IA 3PHF2 1E84A 1FR0A 2KK1A 2HV7A 3R7CA 1JMWA 2WZFA 3AQBA 3ECSA 3SP1A 1NZEA 3I5PA 4JTAB 3IQCA 3VF0A 4J7TA 5BQGA 3AJMA 5KYNA 2Q00A 2LCHA 2EPKX 3HJCA 4P9FA 1D0ZA 1MMDA 2A0UA 4E17A 1A41A 3B0PA 4G78A 1FAPB 4E7SA 1D1CA 1W2WA 2J0WA 2VASA 3GEEA 2GA0A 3JZ0A 3B71A 3ZIBA 1Q0FA 1T6IA 2PBEA 2DYSC 2WVOA 2XLHA 3C8GB 1DOWA 4IAQA 3K33A 4MW3A 4QDLA 4JEBA 4LACB 1XZQA 4BPMA 4XPXA 3LAYA 1ZHXA 2R02A 2R7XA 2G3VA 4U9DA 4ZLCA 1K40A 2J9BA 2C03A 1HW1A 1HY5A 2MYSA 3G4ZA 2V26A 5D92A 3ZQVA 5HSWA 2ETSA 3TD7A 5E33A 3ZWIA 1QSPA 2H7OA 3C8ZA 1O87A 1OCRC 1I5NA 3SYNA 4I44A 5EHHA 1QPUA 1NFNA 5JSLA 5JS5A 3JYHA 3SXKA 3JRMO 3ABMC 3JCUQ 5T3TA 1RKCA 1NG1A 5E2QA 2HKVA 3WG7C 2YKZA 4BJ5C 3EG9B 4AX2A 1MNEA 1G4WR 5JUAA 5KYUA 1GS9A 1YA9A 3B0UX 3S28A 2V3CC 1EA8A 2JX0A 2GAQA 4WGZA 5T3WA 5E3CA 3ASNC 4EUKB 4CIPA 2R7UA 2EPOA 1Q0MA 5A69A 3RVYA 3ABLC 4EIYA 4MVQA 1VK5A 2KC3A 3MYFA 2KGOA 4EBBA 3IPMO 2W45A 4GQHA 3W4YA 1TWGA 3N24A 5COFA 5L0DA 3NMKA 2J46A 3FHDA 4DXWA 1G8XA 2ZXRA 4P9TA 3US6A 5KYWB 3X1OA 3C8GD 1KTMA 1TWCA 1YZAA 1JPJA 1Z6AA 3RFYA 3RQEA 4DBRA 4JW1A 3EHMA 3QVYA 4WGYA 1I4ZA 2R25A 2QE9A 2DGJA 2YZSA 3M4BA 3ZTZA 3ZSUA 2L9JA 2LFFA 1J8MF 2QNLA 4JKVA 1LI7A 4B6IA 2VB6A 1L7CA 4J32B 3DJNB 5DLJA 1MMNA 1T6QA 1A0BA 1U89A 4A2NB 2YHSA 4JJFA 4ONSA 5KYWA 1I4YA 3C18A 3UGPA 4DVZA 2R7SA 3UMHA 5A6AA 4BJ6C 2OQMA 5DQTA 1OW6A 2PNOA 1HE9A 3R2PA 1R5ID 2XLWA 2Q9BA 2R9RB 4XEVA 2Z15A 3EHNA 1ZZPA 2I15A 4XWJA 1U6HA 5E3AA 2JD3A 3GORA 4CBEA 3F46A 3SNHA 1N1CA 2XL6A 1FFTC 3K66A 1FNTc 256BA 1HMDA 4JCHA 4Z9JA 3JRTA 5KYUB 4YWQA 1OCCC 2CCYA 1LS4A 1O5HA 5L0HA 3EFOA 1PD0A 3ATPA 3C7JA 4D4XA 3KYJA 4YK5A 1T6UA 4Q4ZF 2YLIA 4U9EA 4U5EE 1VB5A 2Y3GA 4RDAA 4OIRF 4GEHA 3EGXA 3NMJA 4E0IA 3S90A 1AEPA 3S9OA 1CPRA 4JIOA 4C7OB 2G3KA 1LIHA 2AWYA 2Y3HA 5AC5A 2J45A 1EKYA 4XPYA 4G7HF 4YN0B 2CGEA 1S05A 4PACA 5GPGB 3TJ5A 1M2OA 4JVSA 3QW1A 3KL4A 1Z23A 1ZHWA 1A7EA 2IM8A 1WATA 1VYKA 1JRAA 1ZU5A 3JT1A 5COMA 3RH3A 2HZ8A 4GYTA 4DRIB 4JCZA 4MNDA 2A1DD 4MTGA 3K6BA 5L3VA 4RBNA 1VLTA 2GFHA 1MMAA 2OU6A 2QY9A 1EQ1A 3U8PA 4O7GA 5FCLA 2YQYA 3QW0A 5L0FA 3Q6NA 1T01A 2HSBA 2EPMX 3B0VC 2WL8A 2DI3A 2R03A 2H8AA 2X51A 4IGGA 4BJ1A 1AUEA 1PV3A 1Q0GA 2A69F 4E0HA 4F4BA 2PF4E 4U5DE 3U0CA 3G4XA 1C17M 2CNWD 4CJGA 4BJ5A 2PX3A 3AQCA 2P6VA 3AGUA 3T4RA 3W2VA 4AL0A 4JURI 2Q9AA 4Z9HA 3DXJF 3E70C 3NRHA 3SXZA 5KYXA 1QQ3A 2ZXWC 1WASA 2H7BA 3K1HA 4MVUA 3UGOA 3O6XA 5L0IA 3T6GB 2JPUA 2Y69C 3DE8A 2XS8A 1CGME 2YWAA 5A6JA 4DOZA 3BRJA 2LK4A 3AG1C 4HEAJ 1OCZC 1ZYRF 1ORSC 3S27A 2CYDA 4O6MA 1VOMA 4IJJA 5DQZA 3NDBB 5TJ5E 1E86A 4OIPF 4U5CE 4CX9A 1JPNA 2J8WA 5CI9A 5F28E 3UR3C 4BJ6A 5B3SC 5BUOA 4W8PA 1G4US 2M64A 2XL8A 4PJLA 4Q5SF 1TQGA 3ABKC 3SEOA 2NPUA 1YYJA 2J9UA 1OXKA 3EH1A 2R05A 5B3IA 4K1OA 1NBBA 4YL3A 1F1MA 4XTKA 2D4UA 3AG4C 3AG3C 3Q7LA 4XPWA 3IEEA 4MVMA 2A6EF 1A7VA 4CDVA 3VM6A 2YLDA 2KNHA 1YYXA 1LE4A 4FAPB 3LEOA 3LS0A 4MW8A 1RKEB 2XLEA 3GWLA 1CGNA 2LD6A 4PFPA 1IW7F 5B1BC 4YT4A 5JLIA 4MTOA 3QTHA 3UNGC 2O9XA 2YEVA 1CGOA 3NMIA 3X2QC 4MVRA 3M1CB 3GM2A 3EG9A 3DE9A 4JC7A 5L0GA 2VH3A 4FESA 4LDQA 2XXAA 1ZW3A 4I1MA 1T5OA 3U2LA 4U5FE 1OW8A 3L8JA 4NCQA 3RQFA 2ZD9A 2MHRA 4WJ0A 5EK0A 1LS1A 1TR2A 2XLOA 3LS1A 1FMVA 3NYMA 3IHUA 3OEOA 1L3PA 3A11A 4MQ9F 1D0YA 1NLXA 3FDQA 5DS6A 1WTYA 1JR8A 3GANA 3NYJA 4JJGA 4LDKA 4CS9A 1VMAA 4EBKA 4RD9A 5A6BA 5KYYA 3MX3A 5T1DB 1C03A 2CDQA 3C62A 4R32A 1TFOB 3EPVA 2MWQA 2VCAA 3NKEA 2EILC 3S29A 2R7VA 3B29A 3Q7GA 4CS8A 1G5ZA 1V74B 1UG7A 2A6HF 4PK4A 5EGYA 2NUPA 4JRZA 2R7QA 1V4AA 4EHPA 2XSEA 3RF3A 2WZLA 3AOUA 3GEHA 4H54A 3RQGA 3EZHA 1HMOA 4BEMJ 4K7BA 3UMIA 3ASOC 4H4KC 2LP4A 4DRHB 4U5BE 3J06A 2VC9A 2ASRA 1JOGA 1YA7O 2QLAA 3ZC4A 3EQLF 2A68F 2KQ9A 2YLGA 1M2VA 3FAJA 2FAPB 3LNRA 3OWTA 3RKOF 4LERA 2IXMA 1OKKA 2OKUA 5IY5C 1WGWA 4A4AA 5B1AC 3LEVA 1H9GA 3OA1A 2RSEB 4MVZA 1ORYA 1OQCA 3EJNA 5JVEA 1OR3A 3F47A 2OOCA 4P6IC 3HNJA 4AE4A 3L34A 3M79A 3O39A 2NUTA 3N2ZB 3U8VA 3DJUB 1SF8A 3MYIA 3KKBA 4HE8D 4U5GA 4C3EA 5A6KA 1TWHA 3ZQYA 3AG2C 5JP7A 1ZW2A 1OW7A 3U9MA 2HJMA 1RKEA 3PMRA 4NQFA 4CIHA 2UUIA 1D1BA 4LLCA 4YT8A 4PJNA 1VLSA 4PFOA 4LLEA 2W9YA 3ZTMA 4BEJA 3EGDB 4XLNF 2E87A 4DVYP 3N0TA 2WB7A 2ZPAA 4ULVA 1LE2A 1PCXA 1RJ9A 2EIMC 3NYLA 4XLPF 1UFBA 4NTBA 1TFKB 3C63A 3JTLO 3BEHA 3G50A 2B0JA 1APCA 1C02A 1E2XA 2WVNA 1BR2A 2J7PD 3MLGA 4D4NA 3M15A 2PP4A 3WAQA 4EKWA 1H6GA 2EINC 3I4UA 1AVOB 4G7OF 4AK9A 4QI0A 5BQIA 2IXPA 2PFDA 3WHNA 3DKAA 1IZMA 3H65A 2H7VC 1TWAA 2IXOA 3LLIA 3QVZA 4ANJA 3TOLA 4L6RA 4G7ZF 4UDVA 1JAFA 1Z3IX 1QZXA 2WVQA 2WZGA 3RIPA 2FGYA 2TMVP 4OIQF 2G62A 3CZ6A 1QLEC 1V54C 3CQZA 4ULWA 2L7AA 2KSFA 2XLDA 4I1OB 4O6YA 3ZVRA 1D1AA 3MFNA 2XRHA 1HW2A 1Y6DA 3GM1A 2DB4A 2P61A 3JSEO 4OIOF 3E9VA 3FAPB 2CNWA 2PX0A 3QMKA 4J30B 4YT2A 5A6BD 3L0IA 4PJMA 3IQ5A 1NFOA 4MVSA 3O55A 1ZHYA 2HV6A 2B0HA 1SMYF 1Z7Qc 2R7RA 1KNYA 1QKRA 2YL0A 3NG1A 2R7OA 4CS9C 2HUJA 3M4CA 3ZG1A 3LESA 4C3BA 1ZHZA 2YL1A 1LI5A 1BDJB 4K0DA 5AGFA 2OEVA 1R4TA 1RXQA 4MTFA 3EH2A 1EI7A 1T9KA 2LIGA 1Q0DA 2Q9CA 4JE9A 3RW0A 3T6BA 2GWWA 4IWBA 3HNLA 1U0BB 3U3BA 1K05A 2Q7RA 1WWPA 4N6CA 4DBQA 5DS4A 1A7DA 1NSGB 1OXBA 3AGTA 2XM4A 3GWNA 4YJWA 3LNMB 5DVWA 2FFHA 3LLKA 1Y4CA 2QUPA 2VCBA 3T6JA 4E7ZA 2OJQA 1GM5A 4QI2A 2XS1A 3MBGA 3KPHA 4HFFB 3CAXA 4CJOA 4DJ9A 4AL1A 2LSEA 3CEXA 2I8BA 4NY3A 4N4WA 2UUHA 2NUTB 3W8HA 4EWCA 4IRUA 5KYYB 4CSAA 5D91A 3FMSA 1LM3B 4G0HA 3V5YA 1GGQA 3LUTB 2ZXPA 4BG0A 5CIVA 1SYQA 1H7IA 1YAUO 1DOVA 5F5FA 3IQTA 2X0CA 3U2MA 3VRCA 2YL7A 2AP3A 1YVIA 1MNDA 2LFDA 3HTKC 1YARO 2HMZA 4IB4A 3HKKA 4KC9A 4U5HA 4XQ1A 1V55C 1ZHTA 3C8GA 4CS7A 2RD9A 2NG1A 3HLZA 3FOPA 3K1IC 1YDIA 1OR2A 3PCVA 4Q7CA 1ZU4A 2XLVA 2XXAB 2VCCA 3W8IA 3EFOB 2EPLX 3TULA 4KI2A 2Q3TA 4KBLA 5L0JA 2OCCC 2J9VA 3CSKA 4IARA 2J7PA 4JTCB 1YJGA 4KNWA 5K0IA 5DS5A 2P0NA 2NSFA 4CDYA 4N06A 1LPEA 5KYXB 1B68A 3W2WA 2W4BA
chains in the Genus database with same CATH topology
3RYLA 1NU9C 3EGXB 4YT5A 3NKDA 3S0XA 2DYRC 1Z63A 2Y3DA 4OD5A 2IXNA 3WODF 3Q6MA 1NU7D 1S7ZA 3FVYA 1FFHA 4OD4A 3ITFA 1FTSA 1ST6A 1LKXA 3UMKA 1KU2A 2EIJC 3K7DA 5F5HA 3EZIA 4PJJA 1FMWA 3LJBA 2CW0F 4IAOA 4O6NA 3B9QA 4C3DA 2KJGA 2IOQA 2R7WA 2QTVA 2J0XA 5L3QA 3KMIA 4OINF 4ZLDA 4JZAA 2KW3C 1RJ9B 1PD1A 3DAFA 4CS8C 4M63A 3POVA 2ZXOA 3VYWA 2Y3BA 1D0XA 2Y39A 2R7TA 1OKKD 1M57C 2C04A 2IYLD 4BJTA 1VYIA 2OG2A 1Z5ZA 3KH2A 2BE5F 3DMDA 3VAYA 2P7VA 3JSZA 3V7OA 3EGDA 4FWVA 2EIKC 5CI8A 1BR1A 1J8YF 4O79A 5T3TA 1MMGA 3DZAA 2M4EA 3I5QA 4FX5A 1M56C 2W4MA 4KNVA 2XL4A 1M2VB 2L81A 1OCOC 3SZRA 3QZCA 1BR4A 2D5RB 4CSAC 4HFKB 4AE4B 3DM9B 2J9WA 4W8KA 3GODA 1SZIA 3DD7A 4X0RA 3DM5A 1TKNA 4C7OA 4I3MA 3DAGA 2NUPB 1LVKA 3PHF2 2HV7A 2WZFA 3AQBA 3ECSA 3SP1A 1NZEA 3I5PA 5KYNA 3HJCA 1D0ZA 1MMDA 3B0PA 4E7SA 1W2WA 1D1CA 2J0WA 2VASA 3ZIBA 2DYSC 2WVOA 4QDLA 3K33A 4LACB 3LAYA 1ZHXA 2R7XA 2G3VA 4ZLCA 2C03A 2MYSA 5D92A 2V26A 5HSWA 3TD7A 5E33A 2H7OA 1O87A 1OCRC 3SYNA 4I44A 5EHHA 3JYHA 3ABMC 3JCUQ 5E2QA 1NG1A 3WG7C 4BJ5C 3EG9B 4AX2A 1MNEA 5KYUA 3B0UX 3S28A 2V3CC 2R7UA 5T3WA 5E3CA 3ASNC 3ABLC 1VK5A 2KGOA 4EBBA 2W45A 1TWGA 3N24A 2J46A 3FHDA 1G8XA 2ZXRA 5KYWB 3X1OA 1TWCA 1JPJA 1Z6AA 3RFYA 4DBRA 4JW1A 3EHMA 2DGJA 2YZSA 3ZSUA 2L9JA 1J8MF 4B6IA 2VB6A 4J32B 3DJNB 5DLJA 1MMNA 4A2NB 2YHSA 4JJFA 5KYWA 3UGPA 4DVZA 2R7SA 3UMHA 4BJ6C 5DQTA 2Q9BA 2Z15A 3EHNA 4XWJA 5E3AA 4CBEA 5KYXA 2JD3A 3F46A 3SNHA 1N1CA 1FFTC 3K66A 4JCHA 3JRTA 5KYUB 4YWQA 1OCCC 1O5HA 3EFOA 1PD0A 4Q4ZF 4U5EE 2Y3GA 4RDAA 4OIRF 4GEHA 3EGXA 4C7OB 2G3KA 2Y3HA 2J45A 4G7HF 4YN0B 2CGEA 1M2OA 4JVSA 3KL4A 1Z23A 1ZHWA 3JT1A 1ZU5A 1VYKA 3RH3A 4GYTA 4MNDA 2A1DD 5L3VA 3K6BA 4RBNA 2GFHA 1MMAA 2QY9A 4O7GA 5FCLA 3Q6NA 3B0VC 2WL8A 2X51A 4BJ1A 2A69F 4F4BA 2PF4E 4U5DE 2CNWD 4BJ5A 2PX3A 3AQCA 2P6VA 3T4RA 3W2VA 4JURI 2Q9AA 3DXJF 3E70C 3NRHA 2ZXWC 2H7BA 3K1HA 3UGOA 3O6XA 2Y69C 4DOZA 3AG1C 4HEAJ 1OCZC 1ZYRF 3S27A 4O6MA 1VOMA 4IJJA 5DQZA 3NDBB 4OIPF 4U5CE 1JPNA 5CI9A 4BJ6A 3UR3C 5B3SC 5BUOA 4PJLA 4Q5SF 3ABKC 3SEOA 2J9UA 3EH1A 4XTKA 3AG4C 3AG3C 3Q7LA 3IEEA 2A6EF 2KNHA 3LS0A 4PFPA 4YT4A 5B1BC 1IW7F 3UNGC 2O9XA 2YEVA 3X2QC 3M1CB 3EG9A 2VH3A 4FESA 2XXAA 4I1MA 4U5FE 4WJ0A 1TR2A 1LS1A 3LS1A 3NYMA 1FMVA 3OEOA 4MQ9F 1D0YA 3FDQA 5DS6A 3GANA 3NYJA 4JJGA 4CS9A 5KYYA 1VMAA 4RD9A 3MX3A 5T1DB 2CDQA 3EPVA 2MWQA 3S29A 3NKEA 2EILC 2R7VA 3Q7GA 4CS8A 5EGYA 2A6HF 4PK4A 2NUPA 2R7QA 2XSEA 2WZLA 3EZHA 4K7BA 3UMIA 3ASOC 4H4KC 4U5BE 3ZC4A 3EQLF 2A68F 2KQ9A 3LNRA 1M2VA 3FAJA 3RKOF 3OWTA 4LERA 2IXMA 1OKKA 5IY5C 1WGWA 5B1AC 3LEVA 3OA1A 3EJNA 3F47A 4P6IC 4AE4A 3L34A 3O39A 2NUTA 3N2ZB 3DJUB 1SF8A 4U5GA 3KKBA 4HE8D 4C3EA 1TWHA 3AG2C 4CIHA 3PMRA 4YT8A 1D1BA 4LLCA 4PJNA 4PFOA 4LLEA 2W9YA 4BEJA 3EGDB 4XLNF 2E87A 4DVYP 3N0TA 2WB7A 2ZPAA 1PCXA 1RJ9A 3NYLA 2EIMC 4XLPF 2B0JA 2WVNA 1BR2A 2J7PD 3MLGA 2PP4A 2EINC 3I4UA 4G7OF 4AK9A 4QI0A 2IXPA 2PFDA 1IZMA 3H65A 2H7VC 1TWAA 2IXOA 3LLIA 4ANJA 4G7ZF 1Z3IX 1QZXA 2WVQA 2WZGA 3RIPA 2FGYA 4OIQF 2G62A 3CZ6A 1QLEC 1V54C 3CQZA 4ULWA 4I1OB 4O6YA 3ZVRA 1D1AA 2XRHA 4OIOF 3E9VA 2CNWA 2PX0A 3QMKA 4J30B 4YT2A 3L0IA 4PJMA 1ZHYA 2HV6A 1SMYF 2R7RA 3NG1A 4CS9C 2R7OA 3ZG1A 3LESA 4C3BA 1ZHZA 4K0DA 3EH2A 2Q9CA 3T6BA 4IWBA 4DBQA 5DS4A 5DVWA 4YJWA 2FFHA 3LLKA 4E7ZA 3T6JA 4QI2A 4HFFB 2LSEA 2I8BA 4NY3A 3W8HA 2NUTB 5KYYB 4EWCA 4IRUA 4CSAA 5D91A 4G0HA 4BG0A 2ZXPA 5F5FA 1MNDA 3HTKC 4U5HA 4KC9A 1V55C 1ZHTA 4CS7A 2NG1A 3HLZA 3K1IC 2XXAB 4Q7CA 1ZU4A 3W8IA 3EFOB 4KI2A 2Q3TA 4KBLA 2OCCC 2J9VA 3CSKA 4KNWA 2J7PA 5DS5A 4N06A 5KYXB 3W2WA 2W4BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T4R A; 
#chains in the Genus database with same CATH topology
 3TJ6 A;  3RYL A;  2A0B A;  1NU9 C;  1ZVZ A;  3EGX B;  4YT5 A;  2HS5 A;  3NKD A;  4ER9 A;  2DYR C;  3A9C A;  3S0X A;  1Z63 A;  1H9T A;  2Y3D A;  2LQG A;  3JYY A;  2IXN A;  2GDC A;  3K1I A;  4OD5 A;  3GEI A;  4YL1 A;  3T9O A;  2L6F A;  3U5S A;  3WOD F;  1E83 A;  3TOM A;  2HFI A;  3Q6M A;  3O10 A;  1NU7 D;  1Q0K A;  5AC4 A;  1S7Z A;  4J7Y A;  1RCP A;  3L1M A;  5HV9 A;  3FVY A;  1MQV A;  3L8I A;  1FFH A;  4OD4 A;  2ICW G;  2OEX A;  3ITF A;  3HNK A;  1FTS A;  1ST6 A;  1LKX A;  3UMK A;  1KU2 A;  4E18 A;  1YLM A;  2YVK A;  2EIJ C;  4LDR A;  3RVZ A;  4DRJ B;  2YRF A;  3K7D A;  5F5H A;  3EZI A;  1ORJ A;  4PJJ A;  1YZC A;  3IQ6 A;  5FZT A;  3SXM A;  1FMW A;  3SXY A;  3LJB A;  2CW0 F;  4IAO A;  2AVK A;  4O6N A;  3DWW A;  1BBH A;  3B9Q A;  4C3D A;  2OJE D;  3H2V A;  2HSQ A;  2KJG A;  1WOL A;  1VTM P;  4NC3 A;  2IOQ A;  1K04 A;  3H2U A;  1QVX A;  2KYH A;  2R7W A;  3V5Z A;  2QTV A;  2AWC A;  2J0X A;  3PDM P;  1HE1 A;  5L3Q A;  4MS2 A;  3KMI A;  4OIN F;  1BZ4 A;  2YL3 A;  4JZA A;  4N6H A;  2KW3 C;  5BQH A;  1RJ9 B;  2L6H A;  4ZLD A;  2HMQ A;  1PD1 A;  2BC5 A;  3DAF A;  4M63 A;  4CS8 C;  3U9J A;  5COG A;  3POV A;  2HJ3 A;  2ZXO A;  3VYW A;  2Y3B A;  3V5X A;  1M6T A;  1D0X A;  3U3F A;  2Y39 A;  2R7T A;  1OKK D;  1M57 C;  2C04 A;  2IYL D;  3FOO A;  1VYI A;  2OG2 A;  4XEF A;  4BJT A;  5JRA A;  1O3U A;  1Z5Z A;  3S84 A;  3KH2 A;  2BE5 F;  2XM0 A;  3DI5 A;  3DMD A;  3VAY A;  1E85 A;  1RMV A;  2IBF A;  2P7V A;  3JSZ A;  4NTA A;  3ZDL A;  2P1A A;  3V7O A;  5JT4 A;  3EGD A;  4FWV A;  2EIK C;  5CI8 A;  4CDA A;  5L0C A;  1BR1 A;  1J8Y F;  3KYI A;  4O79 A;  1MMG A;  3DZA A;  1XWJ A;  2M4E A;  3I5Q A;  4FX5 A;  1M56 C;  2W4M A;  4PR9 A;  4YL0 A;  4WAB A;  2L6G A;  4KNV A;  2AU5 A;  3HNI A;  2EPN A;  1M2V B;  2XL4 A;  4NTF A;  2L81 A;  1OCO C;  3GM3 A;  3SZR A;  3QZC A;  1BR4 A;  2D5R B;  4CSA C;  1CPQ A;  4HFK B;  4AE4 B;  3DM9 B;  1WN0 A;  2J9W A;  4W8K A;  3GOD A;  1SZI A;  3DD7 A;  4X0R A;  4MVO A;  3DM5 A;  3TQO A;  1XZP A;  4XEK A;  1TKN A;  2F22 A;  4C7O A;  4I3M A;  4EBJ A;  3DAG A;  2Q4F A;  2XLM A;  4JEA A;  1GQA A;  3TK0 A;  1SR2 A;  2BL2 A;  2NSG A;  3FXH A;  2NUP B;  1LVK A;  4JTD B;  4Z9I A;  3PHF 2;  1E84 A;  1FR0 A;  2KK1 A;  2HV7 A;  3R7C A;  1JMW A;  2WZF A;  3AQB A;  3ECS A;  3SP1 A;  1NZE A;  3I5P A;  4JTA B;  3IQC A;  3VF0 A;  4J7T A;  5BQG A;  3AJM A;  5KYN A;  2Q00 A;  2LCH A;  2EPK X;  3HJC A;  4P9F A;  1D0Z A;  1MMD A;  2A0U A;  4E17 A;  1A41 A;  3B0P A;  4G78 A;  1FAP B;  4E7S A;  1D1C A;  1W2W A;  2J0W A;  2VAS A;  3GEE A;  2GA0 A;  3JZ0 A;  3B71 A;  3ZIB A;  1Q0F A;  1T6I A;  2PBE A;  2DYS C;  2WVO A;  2XLH A;  3C8G B;  1DOW A;  4IAQ A;  3K33 A;  4MW3 A;  4QDL A;  4JEB A;  4LAC B;  1XZQ A;  4BPM A;  4XPX A;  3LAY A;  1ZHX A;  2R02 A;  2R7X A;  2G3V A;  4U9D A;  4ZLC A;  1K40 A;  2J9B A;  2C03 A;  1HW1 A;  1HY5 A;  2MYS A;  3G4Z A;  2V26 A;  5D92 A;  3ZQV A;  5HSW A;  2ETS A;  3TD7 A;  5E33 A;  3ZWI A;  1QSP A;  2H7O A;  3C8Z A;  1O87 A;  1OCR C;  1I5N A;  3SYN A;  4I44 A;  5EHH A;  1QPU A;  1NFN A;  5JSL A;  5JS5 A;  3JYH A;  3SXK A;  3JRM O;  3ABM C;  3JCU Q;  5T3T A;  1RKC A;  1NG1 A;  5E2Q A;  2HKV A;  3WG7 C;  2YKZ A;  4BJ5 C;  3EG9 B;  4AX2 A;  1MNE A;  1G4W R;  5JUA A;  5KYU A;  1GS9 A;  1YA9 A;  3B0U X;  3S28 A;  2V3C C;  1EA8 A;  2JX0 A;  2GAQ A;  4WGZ A;  5T3W A;  5E3C A;  3ASN C;  4EUK B;  4CIP A;  2R7U A;  2EPO A;  1Q0M A;  5A69 A;  3RVY A;  3ABL C;  4EIY A;  4MVQ A;  1VK5 A;  2KC3 A;  3MYF A;  2KGO A;  4EBB A;  3IPM O;  2W45 A;  4GQH A;  3W4Y A;  1TWG A;  3N24 A;  5COF A;  5L0D A;  3NMK A;  2J46 A;  3FHD A;  4DXW A;  1G8X A;  2ZXR A;  4P9T A;  3US6 A;  5KYW B;  3X1O A;  3C8G D;  1KTM A;  1TWC A;  1YZA A;  1JPJ A;  1Z6A A;  3RFY A;  3RQE A;  4DBR A;  4JW1 A;  3EHM A;  3QVY A;  4WGY A;  1I4Z A;  2R25 A;  2QE9 A;  2DGJ A;  2YZS A;  3M4B A;  3ZTZ A;  3ZSU A;  2L9J A;  2LFF A;  1J8M F;  2QNL A;  4JKV A;  1LI7 A;  4B6I A;  2VB6 A;  1L7C A;  4J32 B;  3DJN B;  5DLJ A;  1MMN A;  1T6Q A;  1A0B A;  1U89 A;  4A2N B;  2YHS A;  4JJF A;  4ONS A;  5KYW A;  1I4Y A;  3C18 A;  3UGP A;  4DVZ A;  2R7S A;  3UMH A;  5A6A A;  4BJ6 C;  2OQM A;  5DQT A;  1OW6 A;  2PNO A;  1HE9 A;  3R2P A;  1R5I D;  2XLW A;  2Q9B A;  2R9R B;  4XEV A;  2Z15 A;  3EHN A;  1ZZP A;  2I15 A;  4XWJ A;  1U6H A;  5E3A A;  2JD3 A;  3GOR A;  4CBE A;  3F46 A;  3SNH A;  1N1C A;  2XL6 A;  1FFT C;  3K66 A;  1FNT c;  256B A;  1HMD A;  4JCH A;  4Z9J A;  3JRT A;  5KYU B;  4YWQ A;  1OCC C;  2CCY A;  1LS4 A;  1O5H A;  5L0H A;  3EFO A;  1PD0 A;  3ATP A;  3C7J A;  4D4X A;  3KYJ A;  4YK5 A;  1T6U A;  4Q4Z F;  2YLI A;  4U9E A;  4U5E E;  1VB5 A;  2Y3G A;  4RDA A;  4OIR F;  4GEH A;  3EGX A;  3NMJ A;  4E0I A;  3S90 A;  1AEP A;  3S9O A;  1CPR A;  4JIO A;  4C7O B;  2G3K A;  1LIH A;  2AWY A;  2Y3H A;  5AC5 A;  2J45 A;  1EKY A;  4XPY A;  4G7H F;  4YN0 B;  2CGE A;  1S05 A;  4PAC A;  5GPG B;  3TJ5 A;  1M2O A;  4JVS A;  3QW1 A;  3KL4 A;  1Z23 A;  1ZHW A;  1A7E A;  2IM8 A;  1WAT A;  1VYK A;  1JRA A;  1ZU5 A;  3JT1 A;  5COM A;  3RH3 A;  2HZ8 A;  4GYT A;  4DRI B;  4JCZ A;  4MND A;  2A1D D;  4MTG A;  3K6B A;  5L3V A;  4RBN A;  1VLT A;  2GFH A;  1MMA A;  2OU6 A;  2QY9 A;  1EQ1 A;  3U8P A;  4O7G A;  5FCL A;  2YQY A;  3QW0 A;  5L0F A;  3Q6N A;  1T01 A;  2HSB A;  2EPM X;  3B0V C;  2WL8 A;  2DI3 A;  2R03 A;  2H8A A;  2X51 A;  4IGG A;  4BJ1 A;  1AUE A;  1PV3 A;  1Q0G A;  2A69 F;  4E0H A;  4F4B A;  2PF4 E;  4U5D E;  3U0C A;  3G4X A;  1C17 M;  2CNW D;  4CJG A;  4BJ5 A;  2PX3 A;  3AQC A;  2P6V A;  3AGU A;  3T4R A;  3W2V A;  4AL0 A;  4JUR I;  2Q9A A;  4Z9H A;  3DXJ F;  3E70 C;  3NRH A;  3SXZ A;  5KYX A;  1QQ3 A;  2ZXW C;  1WAS A;  2H7B A;  3K1H A;  4MVU A;  3UGO A;  3O6X A;  5L0I A;  3T6G B;  2JPU A;  2Y69 C;  3DE8 A;  2XS8 A;  1CGM E;  2YWA A;  5A6J A;  4DOZ A;  3BRJ A;  2LK4 A;  3AG1 C;  4HEA J;  1OCZ C;  1ZYR F;  1ORS C;  3S27 A;  2CYD A;  4O6M A;  1VOM A;  4IJJ A;  5DQZ A;  3NDB B;  5TJ5 E;  1E86 A;  4OIP F;  4U5C E;  4CX9 A;  1JPN A;  2J8W A;  5CI9 A;  5F28 E;  3UR3 C;  4BJ6 A;  5B3S C;  5BUO A;  4W8P A;  1G4U S;  2M64 A;  2XL8 A;  4PJL A;  4Q5S F;  1TQG A;  3ABK C;  3SEO A;  2NPU A;  1YYJ A;  2J9U A;  1OXK A;  3EH1 A;  2R05 A;  5B3I A;  4K1O A;  1NBB A;  4YL3 A;  1F1M A;  4XTK A;  2D4U A;  3AG4 C;  3AG3 C;  3Q7L A;  4XPW A;  3IEE A;  4MVM A;  2A6E F;  1A7V A;  4CDV A;  3VM6 A;  2YLD A;  2KNH A;  1YYX A;  1LE4 A;  4FAP B;  3LEO A;  3LS0 A;  4MW8 A;  1RKE B;  2XLE A;  3GWL A;  1CGN A;  2LD6 A;  4PFP A;  1IW7 F;  5B1B C;  4YT4 A;  5JLI A;  4MTO A;  3QTH A;  3UNG C;  2O9X A;  2YEV A;  1CGO A;  3NMI A;  3X2Q C;  4MVR A;  3M1C B;  3GM2 A;  3EG9 A;  3DE9 A;  4JC7 A;  5L0G A;  2VH3 A;  4FES A;  4LDQ A;  2XXA A;  1ZW3 A;  4I1M A;  1T5O A;  3U2L A;  4U5F E;  1OW8 A;  3L8J A;  4NCQ A;  3RQF A;  2ZD9 A;  2MHR A;  4WJ0 A;  5EK0 A;  1LS1 A;  1TR2 A;  2XLO A;  3LS1 A;  1FMV A;  3NYM A;  3IHU A;  3OEO A;  1L3P A;  3A11 A;  4MQ9 F;  1D0Y A;  1NLX A;  3FDQ A;  5DS6 A;  1WTY A;  1JR8 A;  3GAN A;  3NYJ A;  4JJG A;  4LDK A;  4CS9 A;  1VMA A;  4EBK A;  4RD9 A;  5A6B A;  5KYY A;  3MX3 A;  5T1D B;  1C03 A;  2CDQ A;  3C62 A;  4R32 A;  1TFO B;  3EPV A;  2MWQ A;  2VCA A;  3NKE A;  2EIL C;  3S29 A;  2R7V A;  3B29 A;  3Q7G A;  4CS8 A;  1G5Z A;  1V74 B;  1UG7 A;  2A6H F;  4PK4 A;  5EGY A;  2NUP A;  4JRZ A;  2R7Q A;  1V4A A;  4EHP A;  2XSE A;  3RF3 A;  2WZL A;  3AOU A;  3GEH A;  4H54 A;  3RQG A;  3EZH A;  1HMO A;  4BEM J;  4K7B A;  3UMI A;  3ASO C;  4H4K C;  2LP4 A;  4DRH B;  4U5B E;  3J06 A;  2VC9 A;  2ASR A;  1JOG A;  1YA7 O;  2QLA A;  3ZC4 A;  3EQL F;  2A68 F;  2KQ9 A;  2YLG A;  1M2V A;  3FAJ A;  2FAP B;  3LNR A;  3OWT A;  3RKO F;  4LER A;  2IXM A;  1OKK A;  2OKU A;  5IY5 C;  1WGW A;  4A4A A;  5B1A C;  3LEV A;  1H9G A;  3OA1 A;  2RSE B;  4MVZ A;  1ORY A;  1OQC A;  3EJN A;  5JVE A;  1OR3 A;  3F47 A;  2OOC A;  4P6I C;  3HNJ A;  4AE4 A;  3L34 A;  3M79 A;  3O39 A;  2NUT A;  3N2Z B;  3U8V A;  3DJU B;  1SF8 A;  3MYI A;  3KKB A;  4HE8 D;  4U5G A;  4C3E A;  5A6K A;  1TWH A;  3ZQY A;  3AG2 C;  5JP7 A;  1ZW2 A;  1OW7 A;  3U9M A;  2HJM A;  1RKE A;  3PMR A;  4NQF A;  4CIH A;  2UUI A;  1D1B A;  4LLC A;  4YT8 A;  4PJN A;  1VLS A;  4PFO A;  4LLE A;  2W9Y A;  3ZTM A;  4BEJ A;  3EGD B;  4XLN F;  2E87 A;  4DVY P;  3N0T A;  2WB7 A;  2ZPA A;  4ULV A;  1LE2 A;  1PCX A;  1RJ9 A;  2EIM C;  3NYL A;  4XLP F;  1UFB A;  4NTB A;  1TFK B;  3C63 A;  3JTL O;  3BEH A;  3G50 A;  2B0J A;  1APC A;  1C02 A;  1E2X A;  2WVN A;  1BR2 A;  2J7P D;  3MLG A;  4D4N A;  3M15 A;  2PP4 A;  3WAQ A;  4EKW A;  1H6G A;  2EIN C;  3I4U A;  1AVO B;  4G7O F;  4AK9 A;  4QI0 A;  5BQI A;  2IXP A;  2PFD A;  3WHN A;  3DKA A;  1IZM A;  3H65 A;  2H7V C;  1TWA A;  2IXO A;  3LLI A;  3QVZ A;  4ANJ A;  3TOL A;  4L6R A;  4G7Z F;  4UDV A;  1JAF A;  1Z3I X;  1QZX A;  2WVQ A;  2WZG A;  3RIP A;  2FGY A;  2TMV P;  4OIQ F;  2G62 A;  3CZ6 A;  1QLE C;  1V54 C;  3CQZ A;  4ULW A;  2L7A A;  2KSF A;  2XLD A;  4I1O B;  4O6Y A;  3ZVR A;  1D1A A;  3MFN A;  2XRH A;  1HW2 A;  1Y6D A;  3GM1 A;  2DB4 A;  2P61 A;  3JSE O;  4OIO F;  3E9V A;  3FAP B;  2CNW A;  2PX0 A;  3QMK A;  4J30 B;  4YT2 A;  5A6B D;  3L0I A;  4PJM A;  3IQ5 A;  1NFO A;  4MVS A;  3O55 A;  1ZHY A;  2HV6 A;  2B0H A;  1SMY F;  1Z7Q c;  2R7R A;  1KNY A;  1QKR A;  2YL0 A;  3NG1 A;  2R7O A;  4CS9 C;  2HUJ A;  3M4C A;  3ZG1 A;  3LES A;  4C3B A;  1ZHZ A;  2YL1 A;  1LI5 A;  1BDJ B;  4K0D A;  5AGF A;  2OEV A;  1R4T A;  1RXQ A;  4MTF A;  3EH2 A;  1EI7 A;  1T9K A;  2LIG A;  1Q0D A;  2Q9C A;  4JE9 A;  3RW0 A;  3T6B A;  2GWW A;  4IWB A;  3HNL A;  1U0B B;  3U3B A;  1K05 A;  2Q7R A;  1WWP A;  4N6C A;  4DBQ A;  5DS4 A;  1A7D A;  1NSG B;  1OXB A;  3AGT A;  2XM4 A;  3GWN A;  4YJW A;  3LNM B;  5DVW A;  2FFH A;  3LLK A;  1Y4C A;  2QUP A;  2VCB A;  3T6J A;  4E7Z A;  2OJQ A;  1GM5 A;  4QI2 A;  2XS1 A;  3MBG A;  3KPH A;  4HFF B;  3CAX A;  4CJO A;  4DJ9 A;  4AL1 A;  2LSE A;  3CEX A;  2I8B A;  4NY3 A;  4N4W A;  2UUH A;  2NUT B;  3W8H A;  4EWC A;  4IRU A;  5KYY B;  4CSA A;  5D91 A;  3FMS A;  1LM3 B;  4G0H A;  3V5Y A;  1GGQ A;  3LUT B;  2ZXP A;  4BG0 A;  5CIV A;  1SYQ A;  1H7I A;  1YAU O;  1DOV A;  5F5F A;  3IQT A;  2X0C A;  3U2M A;  3VRC A;  2YL7 A;  2AP3 A;  1YVI A;  1MND A;  2LFD A;  3HTK C;  1YAR O;  2HMZ A;  4IB4 A;  3HKK A;  4KC9 A;  4U5H A;  4XQ1 A;  1V55 C;  1ZHT A;  3C8G A;  4CS7 A;  2RD9 A;  2NG1 A;  3HLZ A;  3FOP A;  3K1I C;  1YDI A;  1OR2 A;  3PCV A;  4Q7C A;  1ZU4 A;  2XLV A;  2XXA B;  2VCC A;  3W8I A;  3EFO B;  2EPL X;  3TUL A;  4KI2 A;  2Q3T A;  4KBL A;  5L0J A;  2OCC C;  2J9V A;  3CSK A;  4IAR A;  2J7P A;  4JTC B;  1YJG A;  4KNW A;  5K0I A;  5DS5 A;  2P0N A;  2NSF A;  4CDY A;  4N06 A;  1LPE A;  5KYX B;  1B68 A;  3W2W A;  2W4B A; 
#chains in the Genus database with same CATH homology
 3RYL A;  1NU9 C;  3EGX B;  4YT5 A;  3NKD A;  3S0X A;  2DYR C;  1Z63 A;  2Y3D A;  4OD5 A;  2IXN A;  3WOD F;  3Q6M A;  1NU7 D;  1S7Z A;  3FVY A;  1FFH A;  4OD4 A;  3ITF A;  1FTS A;  1ST6 A;  1LKX A;  3UMK A;  1KU2 A;  2EIJ C;  3K7D A;  5F5H A;  3EZI A;  4PJJ A;  1FMW A;  3LJB A;  2CW0 F;  4IAO A;  4O6N A;  3B9Q A;  4C3D A;  2KJG A;  2IOQ A;  2R7W A;  2QTV A;  2J0X A;  5L3Q A;  3KMI A;  4OIN F;  4ZLD A;  4JZA A;  2KW3 C;  1RJ9 B;  1PD1 A;  3DAF A;  4CS8 C;  4M63 A;  3POV A;  2ZXO A;  3VYW A;  2Y3B A;  1D0X A;  2Y39 A;  2R7T A;  1OKK D;  1M57 C;  2C04 A;  2IYL D;  4BJT A;  1VYI A;  2OG2 A;  1Z5Z A;  3KH2 A;  2BE5 F;  3DMD A;  3VAY A;  2P7V A;  3JSZ A;  3V7O A;  3EGD A;  4FWV A;  2EIK C;  5CI8 A;  1BR1 A;  1J8Y F;  4O79 A;  5T3T A;  1MMG A;  3DZA A;  2M4E A;  3I5Q A;  4FX5 A;  1M56 C;  2W4M A;  4KNV A;  2XL4 A;  1M2V B;  2L81 A;  1OCO C;  3SZR A;  3QZC A;  1BR4 A;  2D5R B;  4CSA C;  4HFK B;  4AE4 B;  3DM9 B;  2J9W A;  4W8K A;  3GOD A;  1SZI A;  3DD7 A;  4X0R A;  3DM5 A;  1TKN A;  4C7O A;  4I3M A;  3DAG A;  2NUP B;  1LVK A;  3PHF 2;  2HV7 A;  2WZF A;  3AQB A;  3ECS A;  3SP1 A;  1NZE A;  3I5P A;  5KYN A;  3HJC A;  1D0Z A;  1MMD A;  3B0P A;  4E7S A;  1W2W A;  1D1C A;  2J0W A;  2VAS A;  3ZIB A;  2DYS C;  2WVO A;  4QDL A;  3K33 A;  4LAC B;  3LAY A;  1ZHX A;  2R7X A;  2G3V A;  4ZLC A;  2C03 A;  2MYS A;  5D92 A;  2V26 A;  5HSW A;  3TD7 A;  5E33 A;  2H7O A;  1O87 A;  1OCR C;  3SYN A;  4I44 A;  5EHH A;  3JYH A;  3ABM C;  3JCU Q;  5E2Q A;  1NG1 A;  3WG7 C;  4BJ5 C;  3EG9 B;  4AX2 A;  1MNE A;  5KYU A;  3B0U X;  3S28 A;  2V3C C;  2R7U A;  5T3W A;  5E3C A;  3ASN C;  3ABL C;  1VK5 A;  2KGO A;  4EBB A;  2W45 A;  1TWG A;  3N24 A;  2J46 A;  3FHD A;  1G8X A;  2ZXR A;  5KYW B;  3X1O A;  1TWC A;  1JPJ A;  1Z6A A;  3RFY A;  4DBR A;  4JW1 A;  3EHM A;  2DGJ A;  2YZS A;  3ZSU A;  2L9J A;  1J8M F;  4B6I A;  2VB6 A;  4J32 B;  3DJN B;  5DLJ A;  1MMN A;  4A2N B;  2YHS A;  4JJF A;  5KYW A;  3UGP A;  4DVZ A;  2R7S A;  3UMH A;  4BJ6 C;  5DQT A;  2Q9B A;  2Z15 A;  3EHN A;  4XWJ A;  5E3A A;  4CBE A;  5KYX A;  2JD3 A;  3F46 A;  3SNH A;  1N1C A;  1FFT C;  3K66 A;  4JCH A;  3JRT A;  5KYU B;  4YWQ A;  1OCC C;  1O5H A;  3EFO A;  1PD0 A;  4Q4Z F;  4U5E E;  2Y3G A;  4RDA A;  4OIR F;  4GEH A;  3EGX A;  4C7O B;  2G3K A;  2Y3H A;  2J45 A;  4G7H F;  4YN0 B;  2CGE A;  1M2O A;  4JVS A;  3KL4 A;  1Z23 A;  1ZHW A;  3JT1 A;  1ZU5 A;  1VYK A;  3RH3 A;  4GYT A;  4MND A;  2A1D D;  5L3V A;  3K6B A;  4RBN A;  2GFH A;  1MMA A;  2QY9 A;  4O7G A;  5FCL A;  3Q6N A;  3B0V C;  2WL8 A;  2X51 A;  4BJ1 A;  2A69 F;  4F4B A;  2PF4 E;  4U5D E;  2CNW D;  4BJ5 A;  2PX3 A;  3AQC A;  2P6V A;  3T4R A;  3W2V A;  4JUR I;  2Q9A A;  3DXJ F;  3E70 C;  3NRH A;  2ZXW C;  2H7B A;  3K1H A;  3UGO A;  3O6X A;  2Y69 C;  4DOZ A;  3AG1 C;  4HEA J;  1OCZ C;  1ZYR F;  3S27 A;  4O6M A;  1VOM A;  4IJJ A;  5DQZ A;  3NDB B;  4OIP F;  4U5C E;  1JPN A;  5CI9 A;  4BJ6 A;  3UR3 C;  5B3S C;  5BUO A;  4PJL A;  4Q5S F;  3ABK C;  3SEO A;  2J9U A;  3EH1 A;  4XTK A;  3AG4 C;  3AG3 C;  3Q7L A;  3IEE A;  2A6E F;  2KNH A;  3LS0 A;  4PFP A;  4YT4 A;  5B1B C;  1IW7 F;  3UNG C;  2O9X A;  2YEV A;  3X2Q C;  3M1C B;  3EG9 A;  2VH3 A;  4FES A;  2XXA A;  4I1M A;  4U5F E;  4WJ0 A;  1TR2 A;  1LS1 A;  3LS1 A;  3NYM A;  1FMV A;  3OEO A;  4MQ9 F;  1D0Y A;  3FDQ A;  5DS6 A;  3GAN A;  3NYJ A;  4JJG A;  4CS9 A;  5KYY A;  1VMA A;  4RD9 A;  3MX3 A;  5T1D B;  2CDQ A;  3EPV A;  2MWQ A;  3S29 A;  3NKE A;  2EIL C;  2R7V A;  3Q7G A;  4CS8 A;  5EGY A;  2A6H F;  4PK4 A;  2NUP A;  2R7Q A;  2XSE A;  2WZL A;  3EZH A;  4K7B A;  3UMI A;  3ASO C;  4H4K C;  4U5B E;  3ZC4 A;  3EQL F;  2A68 F;  2KQ9 A;  3LNR A;  1M2V A;  3FAJ A;  3RKO F;  3OWT A;  4LER A;  2IXM A;  1OKK A;  5IY5 C;  1WGW A;  5B1A C;  3LEV A;  3OA1 A;  3EJN A;  3F47 A;  4P6I C;  4AE4 A;  3L34 A;  3O39 A;  2NUT A;  3N2Z B;  3DJU B;  1SF8 A;  4U5G A;  3KKB A;  4HE8 D;  4C3E A;  1TWH A;  3AG2 C;  4CIH A;  3PMR A;  4YT8 A;  1D1B A;  4LLC A;  4PJN A;  4PFO A;  4LLE A;  2W9Y A;  4BEJ A;  3EGD B;  4XLN F;  2E87 A;  4DVY P;  3N0T A;  2WB7 A;  2ZPA A;  1PCX A;  1RJ9 A;  3NYL A;  2EIM C;  4XLP F;  2B0J A;  2WVN A;  1BR2 A;  2J7P D;  3MLG A;  2PP4 A;  2EIN C;  3I4U A;  4G7O F;  4AK9 A;  4QI0 A;  2IXP A;  2PFD A;  1IZM A;  3H65 A;  2H7V C;  1TWA A;  2IXO A;  3LLI A;  4ANJ A;  4G7Z F;  1Z3I X;  1QZX A;  2WVQ A;  2WZG A;  3RIP A;  2FGY A;  4OIQ F;  2G62 A;  3CZ6 A;  1QLE C;  1V54 C;  3CQZ A;  4ULW A;  4I1O B;  4O6Y A;  3ZVR A;  1D1A A;  2XRH A;  4OIO F;  3E9V A;  2CNW A;  2PX0 A;  3QMK A;  4J30 B;  4YT2 A;  3L0I A;  4PJM A;  1ZHY A;  2HV6 A;  1SMY F;  2R7R A;  3NG1 A;  4CS9 C;  2R7O A;  3ZG1 A;  3LES A;  4C3B A;  1ZHZ A;  4K0D A;  3EH2 A;  2Q9C A;  3T6B A;  4IWB A;  4DBQ A;  5DS4 A;  5DVW A;  4YJW A;  2FFH A;  3LLK A;  4E7Z A;  3T6J A;  4QI2 A;  4HFF B;  2LSE A;  2I8B A;  4NY3 A;  3W8H A;  2NUT B;  5KYY B;  4EWC A;  4IRU A;  4CSA A;  5D91 A;  4G0H A;  4BG0 A;  2ZXP A;  5F5F A;  1MND A;  3HTK C;  4U5H A;  4KC9 A;  1V55 C;  1ZHT A;  4CS7 A;  2NG1 A;  3HLZ A;  3K1I C;  2XXA B;  4Q7C A;  1ZU4 A;  3W8I A;  3EFO B;  4KI2 A;  2Q3T A;  4KBL A;  2OCC C;  2J9V A;  3CSK A;  4KNW A;  2J7P A;  5DS5 A;  4N06 A;  5KYX B;  3W2W A;  2W4B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...