2I15A

Crystal structure of mpn423 from mycoplasma pneumoniae
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
129
structure length
122
Chain Sequence
MKPQLLALKQFVQTEFEKVDFETFRQNFNRCLEREQSTLLIYEDDDYDDQSFFLKPMLSDAFFISSEVVKQLDLPKGDVKSCCQSFYEALTLFISALAITKGVDVGRYHQQLGKRFGVLTVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical protein MG296 homolog
publication title Crystal structure of MPN423 from Mycoplasma pneumoniae
rcsb
source organism Mycoplasma pneumoniae
total genus 39
structure length 122
sequence length 129
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2006-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09644 Mg296 Mg296 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.510 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) mg296 homolog like 2i15A02
1.20.890.20 Mainly Alpha Up-down Bundle cAMP-dependent Protein Kinase, Chain A mpn423 like domain 2i15A01
2I15A 3ACTA 2CQTA 3ACSA 3QFZA 3QG0A 3RSYA 3S4AA 2CQSA 3S4CA 3S4DA 3AFJA 3QDEA 3RRSA 3QFYA 3S4BA
chains in the Genus database with same CATH superfamily
2P0NA 4E0IA 1NBBA 4E18A 1LVKA 2Q9CA 3QVYA 4AE4B 3GEIA 3TK0A 1PD1A 5KYYA 3K33A 4CS9C 1R5ID 4U9DA 3UGOA 2GAQA 1WOLA 2OG2A 4EUKB 3O39A 1HE9A 4GQHA 4CSAA 1ORYA 1IW7F 3ZG1A 1MMNA 1TWCA 1CPQA 2AWYA 3ECSA 5D91A 3M1CB 4CX9A 2J0XA 2QNLA 4NTFA 2XLEA 3W8HA 3OA1A 1ST6A 1VLSA 2EILC 5L0JA 2CYDA 5EHHA 3PDMP 3NMJA 4MVMA 3S28A 4YN0B 4BJTA 2ZD9A 4MW8A 2H9RA 2LCHA 3KKBA 4NQFA 5L3VA 2VH3A 5T3WA 1K40A 3FMSA 3RRSA 3RSYA 3UMKA 3JRMO 4D4NA 2L6HA 1U89A 4JEAA 2KYGA 3GORA 2YLDA 3QTHA 4YJWA 2IOQA 2J7PD 2A6EF 2LP4A 5L0HA 2GDCA 5E3AA 4W8KA 3UR3C 4C3EA 4CDYA 3U2LA 2XXAA 1AVOB 1B68A 1RCPA 3LEVA 3S29A 3Q6NA 1TWHA 4O6MA 2KGOA 2HV7A 2YVKA 2F22A 1O3UA 2BC5A 1Q0GA 4K0DA 1Z7Qc 4CS8A 2UUIA 3L8JA 1BR1A 1D1AA 4J7YA 4Z9HA 2G62A 1OXKA 1SZIA 3N0TA 3O10A 2J9WA 2RSEB 2H7OA 2H7BA 1ZW3A 2MHRA 2NUPA 4IAOA 2LSEA 1MQVA 2KSFA 3GWLA 3KH2A 3NMKA 2DRNA 1A41A 3FHDA 4CS9A 1SR2A 1Z23A 2Y3DA 4LLCA 1Y6DA 2M4EA 4Q7CA 4XEVA 3RQEA 5BQIA 2VB6A 1G4WR 3DZAA 5T3TA 2DI3A 2X51A 3L8IA 1APCA 3QFZA 1D0ZA 2J45A 4K7BA 1JOGA 4LLEA 3B9QA 5EGYA 4YWQA 4I1MA 3CZ6A 4O6YA 3HLZA 5FZTA 2W45A 2EPNA 2A0BA 1L7CA 4E0HA 3ITFA 4NTBA 3F47A 4IJJA 4FAPB 2KNGA 1GM5A 2ASRA 2LQGA 1J8YF 3CEXA 3ZIBA 5A6AA 2FAPB 3VM6A 4W8PA 4OIRF 2QTVA 3EFOB 2PF4E 2J7PA 2EINC 1D1CA 1WWPA 2J9UA 2FGYA 2KYHA 1RKCA 1GS9A 2XLHA 2WVNA 3HJCA 3LNMB 2IYLD 4JTDB 5T1DB 3NDBB 1HW1A 2W4MA 1K04A 2Y3GA 2PNOA 4MNDA 1LE2A 3M15A 3PCVA 4CDAA 1YARO 4JZAA 3Q6MA 2NUPB 1VLTA 4MTGA 5D92A 2I8BA 4JIOA 1SYQA 1PCXA 2G3VA 1C02A 1N1CA 3FAPB 3M4BA 1G8XA 2XS8A 4DVZA 2XL8A 4ONSA 1ZYRF 4YL0A 2OQMA 4U5GA 4G0HA 1Y4CA 4PR9A 4XPWA 4ZLCA 3FXHA 3EQLF 4JVSA 1CGNA 1U0BB 1FMWA 4E17A 4FESA 4XLNF 3CAXA 2DB4A 1EI7A 4YT5A 1MNDA 1M6TA 1MMGA 1G5ZA 2NG1A 3ZVRA 1YZAA 3PMRA 2D4UA 1E83A 4IAQA 3G36A 2KK1A 4L6RA 1BR4A 3UMIA 2HV6A 2L9JA 4AL1A 5DQTA 5B3SC 1KTMA 3RVYA 2KQ9A 3AGUA 1ZVZA 2KC3A 4MQ9F 4N6HA 2E87A 5GPGB 5L0FA 2R7QA 3MFNA 1TKNA 3IM3A 3I4UA 2QLAA 3W8IA 4ZLDA 1IZMA 1OW8A 1QQ3A 5AC5A 1EKYA 4U5BE 3SXMA 4G7ZF 3T4RA 5JUAA 2CQTA 1T6QA 2H8AA 4Z9JA 4JTCB 2ZXRA 2DYSC 3JCUQ 3KL4A 3EH1A 3NYMA 3B29A 4WGYA 4YT8A 4RTAA 2XS1A 2UUHA 4PJJA 2GA0A 4XQ1A 3SZRA 1ZW2A 1L3PA 2XLWA 3KMIA 1JR8A 3DM5A 4N6CA 3IEEA 1E2XA 3B0PA 3K1HA 1FR0A 2EPMX 4RT4A 3V5ZA 1MNEA 2R7VA 1EQ1A 5IY5C 1K05A 1MMAA 2J0WA 2EPOA 5L0GA 1A7EA 1FNTc 3DMDA 1T5OA 3ASNC 3Q7GA 4BJ5A 1D1BA 2YQYA 4C3DA 4YT4A 5BUOA 1GGQA 3AOUA 3TQOA 3R7CA 1TQGA 2CGEA 2Y39A 4J32B 2XLOA 3HNKA 3HNLA 3S4AA 2R25A 4DVYP 3IM4A 5DS6A 3UFEA 5HV9A 2MYSA 4DRIB 1OR3A 1EA8A 1XWJA 1Q0KA 2OCCC 1RXQA 2XM4A 2V3CC 3LEOA 1YAUO 1YA7O 1D0XA 2OJQA 3ZWIA 1RKEB 2HMZA 2C04A 2LD6A 4EWCA 5A6BA 1E85A 3S0XA 1HMOA 2C03A 3NMIA 3KYIA 1F1MA 2OUTA 2A68F 3ATPA 3I5PA 4DRJB 3L1MA 5E33A 1A0BA 2J46A 4U5DE 1JMWA 1QVXA 2XSEA 1J8MF 1TWAA 4I1OB 4MW3A 4XLPF 4KI2A 2R7TA 1Z3IX 2HZ8A 1KNYA 1ZHTA 3RQGA 3US6A 3G4ZA 4HE8D 1FFHA 1ZHZA 3POVA 2XLMA 1RJ9A 4Q4ZF 4ZP3A 3NRHA 1GQAA 3NYLA 3EG9A 3EH2A 4AL0A 4A4AA 1OW7A 2YLGA 4O6NA 1BZ4A 2YRFA 4AK9A 2CQSA 1LI7A 3RVZA 3EFOA 4JCHA 3X2QC 3ZQYA 3IQTA 4H4KC 4JE9A 4QI0A 4QDLA 3RW0A 4BJ6C 5F5HA 4BEJA 4EBBA 1R2AA 1Z63A 1XZQA 3JT1A 1QZXA 2IZYA 5JP7A 4U5EE 3C8GD 4ANJA 1PV3A 5JRAA 3OWTA 4I44A 2VCBA 4CS7A 4OIQF 2HJ3A 1H9GA 3DJUB 3M79A 2TMVP 3FOOA 1QKRA 1ORJA 2L81A 4N06A 2HMQA 2Y69C 1A7DA 1HY5A 1WGWA 2GFHA 1YZCA 2IXNA 2R9RB 2V26A 2VCAA 3GM1A 3JZ0A 1OCRC 4K1OA 1A7VA 1V54C 3EZHA 2PX0A 2Q00A 3CQZA 4EHPA 5B1BC 1YJGA 3S4CA 3GWNA 3DAGA 1PD0A 4LDKA 2XL6A 1HE1A 2OOCA 5E3CA 1C03A 4MVUA 4RD9A 3C18A 5JT4A 1QLEC 4QI2A 1I5NA 1NFOA 1OCCC 2VC9A 4Q5SF 3ACSA 1WASA 3E70C 3ASOC 2EPLX 4IARA 1W2WA 3R2PA 3DM9B 3UNGC 1RJ9B 2CDQA 2Y3HA 1BDJB 3MYFA 4JTAB 3EG9B 2P1AA 3LNRA 5CIVA 1T01A 1MMDA 1WTYA 2ZXWC 1ZHWA 1CGOA 1LKXA 2CNWD 5B3IA 3AFJA 4H54A 3RKOF 3M4CA 1VK5A 1XZPA 4LDQA 4C3BA 3W2VA 3RF3A 3X1OA 4PJMA 3W2WA 4F4BA 1H9TA 2Z15A 1TR2A 3FAJA 1V4AA 4DXWA 3L0IA 1CPRA 4P9FA 4KNVA 1H7IA 5L3QA 3TJ5A 1ZU4A 2QY9A 3A11A 4LERA 4BEMJ 1E84A 1DOWA 4F9KA 4EBKA 1LE4A 2EIKC 2LFDA 4OIOF 3RQFA 4EKWA 2R7UA 3ACTA 3B71A 3JYHA 4I3MA 1V55C 3C8ZA 4JRZA 5AGFA 4BJ6A 2IBFA 1QSPA 4BPMA 2IXMA 1O5HA 4A2NB 1NU9C 1WN0A 1DOVA 2Q4FA 3LLKA 4ULVA 3SYNA 3AGTA 3MYIA 2R7XA 4PJNA 2VCCA 1FFTC 4HEAJ 4IGGA 1ORSC 1LIHA 4YK5A 4NCQA 4MTFA 2XL4A 2HUJA 2I15A 2NPUA 3GWHA 4WJ0A 4ULWA 3NYJA 4LDRA 3DE8A 3A9CA 3DE9A 3SNHA 1YLMA 5KYUA 3B0VC 1M57C 5A6KA 2Y3BA 5COFA 3V5XA 4CBEA 5TJ5E 2EPKX 5B1AC 2YL1A 4XPYA 1JAFA 1TFOB 2BE5F 1SF8A 2YHSA 2P6VA 4MVRA 4OD4A 4MTOA 4U5CE 5JSLA 1TFKB 3SXYA 3PHF2 5HVZA 2ZXPA 1VYIA 4CSAC 2AWCA 4U9EA 2HSQA 1RKEA 3ABLC 3GEEA 3T6BA 1Q0FA 3K1IC 4YL1A 3TOLA 3ZTZA 5COMA 1H6GA 4JURI 2CNWA 3WHNA 4JW1A 1OW6A 3DAFA 3HNJA 2LIGA 3RIPA 4CIPA 2NSFA 2J9VA 3S90A 1ZZPA 3C8GB 3KYJA 1T6IA 2XLVA 3DXJF 2HFIA 3IQCA 1Z5ZA 3LS0A 4M63A 1S05A 3TOMA 5E2QA 2X0CA 1CGME 4PK4A 1JRAA 2D5RB 2YEVA 2EIMC 1I4ZA 2M64A 2WZGA 3JSEO 2RD9A 3HNIA 3LJBA 2KW3C 3E9VA 3U9JA 3MX3A 1ZHYA 1BBHA 1YVIA 3MLGA 3BEHA 2CB9A 3SXZA 3U9MA 2YKZA 4OIPF 4MS2A 5CI8A 2A69F 2YL7A 5KYUB 4JEBA 1YDIA 5KYWA 2WVOA 3J06A 2L7AA 3AQCA 2GWWA 4U5HA 2BL2A 3AG2C 1LS4A 1M2VA 2ZXOA 4EBJA 1M2OA 4N4WA 4CS8C 1T6UA 2WVQA 3ZDLA 3EHNA 4J7TA 3HKKA 2NUTB 1NZEA 3NKEA 3RFYA 3ZSUA 2JX0A 2XRHA 4KBLA 3DD7A 2YL0A 3S4DA 3FVYA 3W4YA 4DRHB 1OXBA 1E86A 3S4BA 1UFBA 3K7DA 2JD3A 5KYNA 3DJNB 3DKAA 5DS4A 2AVKA 1U6HA 4GYTA 5DLJA 3H2UA 4MVOA 1KU2A 1R4TA 2B0JA 2PFDA 3GM3A 4DBQA 1YYXA 4G78A 4U5FE 3SP1A 2R03A 3EGXB 3DWWA 1HMDA 4B6IA 2EIJC 3JYYA 1JPNA 2KNHA 2P7VA 4RBNA 2A1DD 3C63A 3K1IA 3U2MA 5JVEA 3WODF 4IRUA 5KYYB 2YZSA 2VASA 3TJ6A 2PBEA 2ETSA 5HSWA 2J9BA 2HS5A 3ZTMA 4O7GA 4MVQA 2Q9BA 4PJLA 2LFFA 3G4XA 1NU7D 3AJMA 4CDVA 5KYWB 1YA9A 4YL3A 5KYXA 2WZLA 3QVZA 3RYLA 3FDQA 2R7SA 2K9QA 5BQGA 3ABMC 1Z6AA 3SXKA 1AEPA 3ZC4A 4LACB 4XTKA 3TULA 1M2VB 1NLXA 3UGPA 3QW0A 3N24A 3FOPA 3V7OA 1OR2A 3K66A 1TWGA 3EJNA 5EK0A 3VAYA 2YL3A 4JJGA 1VYKA 3LESA 3T9OA 4XEKA 4PACA 5JS5A 1OCOC 3NKDA 1NSGB 1OKKD 1Q0DA 1S7ZA 1V74B 5FCLA 1VMAA 2MWQA 3GEHA 1OQCA 4D4XA 2R7OA 3WG7C 4ER9A 1G4US 1AUEA 3QW1A 3Q7LA 3PMIA 2DYRC 3KPHA 3OEOA 3GANA 5F5FA 1I4YA 1D0YA 3LUTB 2Q9AA 4P9TA 2O9XA 3JSZA 2A6HF 4XEFA 2H7VC 4MVSA 2Q3TA 2W9YA 4E7ZA 1VTMP 2WZFA 2L6FA 2RQYA 3B0UX 3N2ZB 3O55A 1QPUA 5JLIA 4JKVA 2QUPA 1FAPB 3S9OA 3LLIA 4UDVA 5KYXB 2L6GA 3RH3A 3S27A 2P61A 2R7RA 3SEOA 4NY3A 3U8PA 5BQHA 2OEXA 4P6IC 2QE9A 5COGA 4WABA 5CI9A 1WATA 3UMHA 1BR2A 4BJ1A 3ABKC 1UG7A 5F28E 5L0IA 1ZHXA 4DOZA 5DS5A 5A69A 2XXAB 2PP4A 2W4BA 3GM2A 4Z9IA 1HW2A 2OJED 1FMVA 2EZWA 2J8WA 4RIQA 5AC4A 2XLDA 3C8GA 2Q7RA 4G7OF 2OEVA 4G7HF 3AG3C 4R32A 3QZCA 3O6XA 1SMYF 3QG0A 3ZQVA 4WGZA 3H65A 5DQZA 1L6EA 2G3KA 3EHMA 4IWBA 3QMKA 1OKKA 1LM3B 3AG1C 3IPMO 2HJMA 4JC7A 4O79A 3EGDA 3H2VA 3TD7A 3AG4C 3U3BA 3S84A 3QDEA 1RMVA 3NG1A 4OD5A 4CJGA 5K0IA 2ZPAA 2NSGA 3EZIA 4JJFA 3U3FA 1YYJA 4XWJA 4BJ5C 4HFKB 2AP3A 4CIHA 3G50A 2XM0A 3U8VA 1O87A 2OU6A 4EIYA 4C7OA 3LAYA 2IM8A 4YT2A 5A6JA 2WB7A 1ZU5A 2B0HA 2CW0F 3CSKA 2R7WA 1LPEA 3VF0A 2NUTA 2ICWG 4E7SA 5L0DA 3T6JA 2PX3A 3QFYA 4AX2A 2HSBA 4KC9A 4X0RA 3LS1A 4AE4A 4RDAA 4BG0A 1LI5A 1VOMA 1FTSA 1OCZC 3IQ5A 3MBGA 3C62A 1M56C 4PFOA 5A6BD 256BA 2CBGA 2CCYA 1C17M 2A0UA 3K6BA 4NTAA 3EGXA 1JPJA 3IQ6A 4J30B 5DVWA 1Q0MA 3EGDB 4OINF 3U5SA 2JPUA 2LK4A 2HKVA 1NFNA 2R05A 3IHUA 2IXPA 3AQBA 3L34A 2OKUA 3I5QA 2FFHA 4FX5A 4MVZA 3T6GB 2YWAA 3HTKC 3WAQA 2YLIA 3JTLO 4IB4A 4NC3A 4XPXA 3U0CA 2AU5A 4C7OB 2DGJA 4HFFB 1VB5A 4DBRA 2WL8A 3VRCA 2IXOA 5L0CA 2R02A 4JCZA 3VYWA 3BRJA 4GEHA 1LS1A 1NG1A 3DI5A 3EPVA 4CJOA 4PFPA 3C7JA 3F46A 4DJ9A 2KJGA 4KNWA 1T9KA 3V5YA 4FWVA 3GODA 3JRTA
chains in the Genus database with same CATH topology
2I15A 3ACTA 2CQTA 3ACSA 3QFZA 3QG0A 3RSYA 3S4AA 2CQSA 3S4CA 3S4DA 3AFJA 3QDEA 3RRSA 3QFYA 3S4BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2I15 A;  3ACT A;  2CQT A;  3ACS A;  3QFZ A;  3QG0 A;  3RSY A;  3S4A A;  2CQS A;  3S4C A;  3S4D A;  3AFJ A;  3QDE A;  3RRS A;  3QFY A;  3S4B A; 
#chains in the Genus database with same CATH topology
 2P0N A;  4E0I A;  1NBB A;  4E18 A;  1LVK A;  2Q9C A;  3QVY A;  4AE4 B;  3GEI A;  3TK0 A;  1PD1 A;  5KYY A;  3K33 A;  4CS9 C;  1R5I D;  4U9D A;  3UGO A;  2GAQ A;  1WOL A;  2OG2 A;  4EUK B;  3O39 A;  1HE9 A;  4GQH A;  4CSA A;  1ORY A;  1IW7 F;  3ZG1 A;  1MMN A;  1TWC A;  1CPQ A;  2AWY A;  3ECS A;  5D91 A;  3M1C B;  4CX9 A;  2J0X A;  2QNL A;  4NTF A;  2XLE A;  3W8H A;  3OA1 A;  1ST6 A;  1VLS A;  2EIL C;  5L0J A;  2CYD A;  5EHH A;  3PDM P;  3NMJ A;  4MVM A;  3S28 A;  4YN0 B;  4BJT A;  2ZD9 A;  4MW8 A;  2H9R A;  2LCH A;  3KKB A;  4NQF A;  5L3V A;  2VH3 A;  5T3W A;  1K40 A;  3FMS A;  3RRS A;  3RSY A;  3UMK A;  3JRM O;  4D4N A;  2L6H A;  1U89 A;  4JEA A;  2KYG A;  3GOR A;  2YLD A;  3QTH A;  4YJW A;  2IOQ A;  2J7P D;  2A6E F;  2LP4 A;  5L0H A;  2GDC A;  5E3A A;  4W8K A;  3UR3 C;  4C3E A;  4CDY A;  3U2L A;  2XXA A;  1AVO B;  1B68 A;  1RCP A;  3LEV A;  3S29 A;  3Q6N A;  1TWH A;  4O6M A;  2KGO A;  2HV7 A;  2YVK A;  2F22 A;  1O3U A;  2BC5 A;  1Q0G A;  4K0D A;  1Z7Q c;  4CS8 A;  2UUI A;  3L8J A;  1BR1 A;  1D1A A;  4J7Y A;  4Z9H A;  2G62 A;  1OXK A;  1SZI A;  3N0T A;  3O10 A;  2J9W A;  2RSE B;  2H7O A;  2H7B A;  1ZW3 A;  2MHR A;  2NUP A;  4IAO A;  2LSE A;  1MQV A;  2KSF A;  3GWL A;  3KH2 A;  3NMK A;  2DRN A;  1A41 A;  3FHD A;  4CS9 A;  1SR2 A;  1Z23 A;  2Y3D A;  4LLC A;  1Y6D A;  2M4E A;  4Q7C A;  4XEV A;  3RQE A;  5BQI A;  2VB6 A;  1G4W R;  3DZA A;  5T3T A;  2DI3 A;  2X51 A;  3L8I A;  1APC A;  3QFZ A;  1D0Z A;  2J45 A;  4K7B A;  1JOG A;  4LLE A;  3B9Q A;  5EGY A;  4YWQ A;  4I1M A;  3CZ6 A;  4O6Y A;  3HLZ A;  5FZT A;  2W45 A;  2EPN A;  2A0B A;  1L7C A;  4E0H A;  3ITF A;  4NTB A;  3F47 A;  4IJJ A;  4FAP B;  2KNG A;  1GM5 A;  2ASR A;  2LQG A;  1J8Y F;  3CEX A;  3ZIB A;  5A6A A;  2FAP B;  3VM6 A;  4W8P A;  4OIR F;  2QTV A;  3EFO B;  2PF4 E;  2J7P A;  2EIN C;  1D1C A;  1WWP A;  2J9U A;  2FGY A;  2KYH A;  1RKC A;  1GS9 A;  2XLH A;  2WVN A;  3HJC A;  3LNM B;  2IYL D;  4JTD B;  5T1D B;  3NDB B;  1HW1 A;  2W4M A;  1K04 A;  2Y3G A;  2PNO A;  4MND A;  1LE2 A;  3M15 A;  3PCV A;  4CDA A;  1YAR O;  4JZA A;  3Q6M A;  2NUP B;  1VLT A;  4MTG A;  5D92 A;  2I8B A;  4JIO A;  1SYQ A;  1PCX A;  2G3V A;  1C02 A;  1N1C A;  3FAP B;  3M4B A;  1G8X A;  2XS8 A;  4DVZ A;  2XL8 A;  4ONS A;  1ZYR F;  4YL0 A;  2OQM A;  4U5G A;  4G0H A;  1Y4C A;  4PR9 A;  4XPW A;  4ZLC A;  3FXH A;  3EQL F;  4JVS A;  1CGN A;  1U0B B;  1FMW A;  4E17 A;  4FES A;  4XLN F;  3CAX A;  2DB4 A;  1EI7 A;  4YT5 A;  1MND A;  1M6T A;  1MMG A;  1G5Z A;  2NG1 A;  3ZVR A;  1YZA A;  3PMR A;  2D4U A;  1E83 A;  4IAQ A;  3G36 A;  2KK1 A;  4L6R A;  1BR4 A;  3UMI A;  2HV6 A;  2L9J A;  4AL1 A;  5DQT A;  5B3S C;  1KTM A;  3RVY A;  2KQ9 A;  3AGU A;  1ZVZ A;  2KC3 A;  4MQ9 F;  4N6H A;  2E87 A;  5GPG B;  5L0F A;  2R7Q A;  3MFN A;  1TKN A;  3IM3 A;  3I4U A;  2QLA A;  3W8I A;  4ZLD A;  1IZM A;  1OW8 A;  1QQ3 A;  5AC5 A;  1EKY A;  4U5B E;  3SXM A;  4G7Z F;  3T4R A;  5JUA A;  2CQT A;  1T6Q A;  2H8A A;  4Z9J A;  4JTC B;  2ZXR A;  2DYS C;  3JCU Q;  3KL4 A;  3EH1 A;  3NYM A;  3B29 A;  4WGY A;  4YT8 A;  4RTA A;  2XS1 A;  2UUH A;  4PJJ A;  2GA0 A;  4XQ1 A;  3SZR A;  1ZW2 A;  1L3P A;  2XLW A;  3KMI A;  1JR8 A;  3DM5 A;  4N6C A;  3IEE A;  1E2X A;  3B0P A;  3K1H A;  1FR0 A;  2EPM X;  4RT4 A;  3V5Z A;  1MNE A;  2R7V A;  1EQ1 A;  5IY5 C;  1K05 A;  1MMA A;  2J0W A;  2EPO A;  5L0G A;  1A7E A;  1FNT c;  3DMD A;  1T5O A;  3ASN C;  3Q7G A;  4BJ5 A;  1D1B A;  2YQY A;  4C3D A;  4YT4 A;  5BUO A;  1GGQ A;  3AOU A;  3TQO A;  3R7C A;  1TQG A;  2CGE A;  2Y39 A;  4J32 B;  2XLO A;  3HNK A;  3HNL A;  3S4A A;  2R25 A;  4DVY P;  3IM4 A;  5DS6 A;  3UFE A;  5HV9 A;  2MYS A;  4DRI B;  1OR3 A;  1EA8 A;  1XWJ A;  1Q0K A;  2OCC C;  1RXQ A;  2XM4 A;  2V3C C;  3LEO A;  1YAU O;  1YA7 O;  1D0X A;  2OJQ A;  3ZWI A;  1RKE B;  2HMZ A;  2C04 A;  2LD6 A;  4EWC A;  5A6B A;  1E85 A;  3S0X A;  1HMO A;  2C03 A;  3NMI A;  3KYI A;  1F1M A;  2OUT A;  2A68 F;  3ATP A;  3I5P A;  4DRJ B;  3L1M A;  5E33 A;  1A0B A;  2J46 A;  4U5D E;  1JMW A;  1QVX A;  2XSE A;  1J8M F;  1TWA A;  4I1O B;  4MW3 A;  4XLP F;  4KI2 A;  2R7T A;  1Z3I X;  2HZ8 A;  1KNY A;  1ZHT A;  3RQG A;  3US6 A;  3G4Z A;  4HE8 D;  1FFH A;  1ZHZ A;  3POV A;  2XLM A;  1RJ9 A;  4Q4Z F;  4ZP3 A;  3NRH A;  1GQA A;  3NYL A;  3EG9 A;  3EH2 A;  4AL0 A;  4A4A A;  1OW7 A;  2YLG A;  4O6N A;  1BZ4 A;  2YRF A;  4AK9 A;  2CQS A;  1LI7 A;  3RVZ A;  3EFO A;  4JCH A;  3X2Q C;  3ZQY A;  3IQT A;  4H4K C;  4JE9 A;  4QI0 A;  4QDL A;  3RW0 A;  4BJ6 C;  5F5H A;  4BEJ A;  4EBB A;  1R2A A;  1Z63 A;  1XZQ A;  3JT1 A;  1QZX A;  2IZY A;  5JP7 A;  4U5E E;  3C8G D;  4ANJ A;  1PV3 A;  5JRA A;  3OWT A;  4I44 A;  2VCB A;  4CS7 A;  4OIQ F;  2HJ3 A;  1H9G A;  3DJU B;  3M79 A;  2TMV P;  3FOO A;  1QKR A;  1ORJ A;  2L81 A;  4N06 A;  2HMQ A;  2Y69 C;  1A7D A;  1HY5 A;  1WGW A;  2GFH A;  1YZC A;  2IXN A;  2R9R B;  2V26 A;  2VCA A;  3GM1 A;  3JZ0 A;  1OCR C;  4K1O A;  1A7V A;  1V54 C;  3EZH A;  2PX0 A;  2Q00 A;  3CQZ A;  4EHP A;  5B1B C;  1YJG A;  3S4C A;  3GWN A;  3DAG A;  1PD0 A;  4LDK A;  2XL6 A;  1HE1 A;  2OOC A;  5E3C A;  1C03 A;  4MVU A;  4RD9 A;  3C18 A;  5JT4 A;  1QLE C;  4QI2 A;  1I5N A;  1NFO A;  1OCC C;  2VC9 A;  4Q5S F;  3ACS A;  1WAS A;  3E70 C;  3ASO C;  2EPL X;  4IAR A;  1W2W A;  3R2P A;  3DM9 B;  3UNG C;  1RJ9 B;  2CDQ A;  2Y3H A;  1BDJ B;  3MYF A;  4JTA B;  3EG9 B;  2P1A A;  3LNR A;  5CIV A;  1T01 A;  1MMD A;  1WTY A;  2ZXW C;  1ZHW A;  1CGO A;  1LKX A;  2CNW D;  5B3I A;  3AFJ A;  4H54 A;  3RKO F;  3M4C A;  1VK5 A;  1XZP A;  4LDQ A;  4C3B A;  3W2V A;  3RF3 A;  3X1O A;  4PJM A;  3W2W A;  4F4B A;  1H9T A;  2Z15 A;  1TR2 A;  3FAJ A;  1V4A A;  4DXW A;  3L0I A;  1CPR A;  4P9F A;  4KNV A;  1H7I A;  5L3Q A;  3TJ5 A;  1ZU4 A;  2QY9 A;  3A11 A;  4LER A;  4BEM J;  1E84 A;  1DOW A;  4F9K A;  4EBK A;  1LE4 A;  2EIK C;  2LFD A;  4OIO F;  3RQF A;  4EKW A;  2R7U A;  3ACT A;  3B71 A;  3JYH A;  4I3M A;  1V55 C;  3C8Z A;  4JRZ A;  5AGF A;  4BJ6 A;  2IBF A;  1QSP A;  4BPM A;  2IXM A;  1O5H A;  4A2N B;  1NU9 C;  1WN0 A;  1DOV A;  2Q4F A;  3LLK A;  4ULV A;  3SYN A;  3AGT A;  3MYI A;  2R7X A;  4PJN A;  2VCC A;  1FFT C;  4HEA J;  4IGG A;  1ORS C;  1LIH A;  4YK5 A;  4NCQ A;  4MTF A;  2XL4 A;  2HUJ A;  2I15 A;  2NPU A;  3GWH A;  4WJ0 A;  4ULW A;  3NYJ A;  4LDR A;  3DE8 A;  3A9C A;  3DE9 A;  3SNH A;  1YLM A;  5KYU A;  3B0V C;  1M57 C;  5A6K A;  2Y3B A;  5COF A;  3V5X A;  4CBE A;  5TJ5 E;  2EPK X;  5B1A C;  2YL1 A;  4XPY A;  1JAF A;  1TFO B;  2BE5 F;  1SF8 A;  2YHS A;  2P6V A;  4MVR A;  4OD4 A;  4MTO A;  4U5C E;  5JSL A;  1TFK B;  3SXY A;  3PHF 2;  5HVZ A;  2ZXP A;  1VYI A;  4CSA C;  2AWC A;  4U9E A;  2HSQ A;  1RKE A;  3ABL C;  3GEE A;  3T6B A;  1Q0F A;  3K1I C;  4YL1 A;  3TOL A;  3ZTZ A;  5COM A;  1H6G A;  4JUR I;  2CNW A;  3WHN A;  4JW1 A;  1OW6 A;  3DAF A;  3HNJ A;  2LIG A;  3RIP A;  4CIP A;  2NSF A;  2J9V A;  3S90 A;  1ZZP A;  3C8G B;  3KYJ A;  1T6I A;  2XLV A;  3DXJ F;  2HFI A;  3IQC A;  1Z5Z A;  3LS0 A;  4M63 A;  1S05 A;  3TOM A;  5E2Q A;  2X0C A;  1CGM E;  4PK4 A;  1JRA A;  2D5R B;  2YEV A;  2EIM C;  1I4Z A;  2M64 A;  2WZG A;  3JSE O;  2RD9 A;  3HNI A;  3LJB A;  2KW3 C;  3E9V A;  3U9J A;  3MX3 A;  1ZHY A;  1BBH A;  1YVI A;  3MLG A;  3BEH A;  2CB9 A;  3SXZ A;  3U9M A;  2YKZ A;  4OIP F;  4MS2 A;  5CI8 A;  2A69 F;  2YL7 A;  5KYU B;  4JEB A;  1YDI A;  5KYW A;  2WVO A;  3J06 A;  2L7A A;  3AQC A;  2GWW A;  4U5H A;  2BL2 A;  3AG2 C;  1LS4 A;  1M2V A;  2ZXO A;  4EBJ A;  1M2O A;  4N4W A;  4CS8 C;  1T6U A;  2WVQ A;  3ZDL A;  3EHN A;  4J7T A;  3HKK A;  2NUT B;  1NZE A;  3NKE A;  3RFY A;  3ZSU A;  2JX0 A;  2XRH A;  4KBL A;  3DD7 A;  2YL0 A;  3S4D A;  3FVY A;  3W4Y A;  4DRH B;  1OXB A;  1E86 A;  3S4B A;  1UFB A;  3K7D A;  2JD3 A;  5KYN A;  3DJN B;  3DKA A;  5DS4 A;  2AVK A;  1U6H A;  4GYT A;  5DLJ A;  3H2U A;  4MVO A;  1KU2 A;  1R4T A;  2B0J A;  2PFD A;  3GM3 A;  4DBQ A;  1YYX A;  4G78 A;  4U5F E;  3SP1 A;  2R03 A;  3EGX B;  3DWW A;  1HMD A;  4B6I A;  2EIJ C;  3JYY A;  1JPN A;  2KNH A;  2P7V A;  4RBN A;  2A1D D;  3C63 A;  3K1I A;  3U2M A;  5JVE A;  3WOD F;  4IRU A;  5KYY B;  2YZS A;  2VAS A;  3TJ6 A;  2PBE A;  2ETS A;  5HSW A;  2J9B A;  2HS5 A;  3ZTM A;  4O7G A;  4MVQ A;  2Q9B A;  4PJL A;  2LFF A;  3G4X A;  1NU7 D;  3AJM A;  4CDV A;  5KYW B;  1YA9 A;  4YL3 A;  5KYX A;  2WZL A;  3QVZ A;  3RYL A;  3FDQ A;  2R7S A;  2K9Q A;  5BQG A;  3ABM C;  1Z6A A;  3SXK A;  1AEP A;  3ZC4 A;  4LAC B;  4XTK A;  3TUL A;  1M2V B;  1NLX A;  3UGP A;  3QW0 A;  3N24 A;  3FOP A;  3V7O A;  1OR2 A;  3K66 A;  1TWG A;  3EJN A;  5EK0 A;  3VAY A;  2YL3 A;  4JJG A;  1VYK A;  3LES A;  3T9O A;  4XEK A;  4PAC A;  5JS5 A;  1OCO C;  3NKD A;  1NSG B;  1OKK D;  1Q0D A;  1S7Z A;  1V74 B;  5FCL A;  1VMA A;  2MWQ A;  3GEH A;  1OQC A;  4D4X A;  2R7O A;  3WG7 C;  4ER9 A;  1G4U S;  1AUE A;  3QW1 A;  3Q7L A;  3PMI A;  2DYR C;  3KPH A;  3OEO A;  3GAN A;  5F5F A;  1I4Y A;  1D0Y A;  3LUT B;  2Q9A A;  4P9T A;  2O9X A;  3JSZ A;  2A6H F;  4XEF A;  2H7V C;  4MVS A;  2Q3T A;  2W9Y A;  4E7Z A;  1VTM P;  2WZF A;  2L6F A;  2RQY A;  3B0U X;  3N2Z B;  3O55 A;  1QPU A;  5JLI A;  4JKV A;  2QUP A;  1FAP B;  3S9O A;  3LLI A;  4UDV A;  5KYX B;  2L6G A;  3RH3 A;  3S27 A;  2P61 A;  2R7R A;  3SEO A;  4NY3 A;  3U8P A;  5BQH A;  2OEX A;  4P6I C;  2QE9 A;  5COG A;  4WAB A;  5CI9 A;  1WAT A;  3UMH A;  1BR2 A;  4BJ1 A;  3ABK C;  1UG7 A;  5F28 E;  5L0I A;  1ZHX A;  4DOZ A;  5DS5 A;  5A69 A;  2XXA B;  2PP4 A;  2W4B A;  3GM2 A;  4Z9I A;  1HW2 A;  2OJE D;  1FMV A;  2EZW A;  2J8W A;  4RIQ A;  5AC4 A;  2XLD A;  3C8G A;  2Q7R A;  4G7O F;  2OEV A;  4G7H F;  3AG3 C;  4R32 A;  3QZC A;  3O6X A;  1SMY F;  3QG0 A;  3ZQV A;  4WGZ A;  3H65 A;  5DQZ A;  1L6E A;  2G3K A;  3EHM A;  4IWB A;  3QMK A;  1OKK A;  1LM3 B;  3AG1 C;  3IPM O;  2HJM A;  4JC7 A;  4O79 A;  3EGD A;  3H2V A;  3TD7 A;  3AG4 C;  3U3B A;  3S84 A;  3QDE A;  1RMV A;  3NG1 A;  4OD5 A;  4CJG A;  5K0I A;  2ZPA A;  2NSG A;  3EZI A;  4JJF A;  3U3F A;  1YYJ A;  4XWJ A;  4BJ5 C;  4HFK B;  2AP3 A;  4CIH A;  3G50 A;  2XM0 A;  3U8V A;  1O87 A;  2OU6 A;  4EIY A;  4C7O A;  3LAY A;  2IM8 A;  4YT2 A;  5A6J A;  2WB7 A;  1ZU5 A;  2B0H A;  2CW0 F;  3CSK A;  2R7W A;  1LPE A;  3VF0 A;  2NUT A;  2ICW G;  4E7S A;  5L0D A;  3T6J A;  2PX3 A;  3QFY A;  4AX2 A;  2HSB A;  4KC9 A;  4X0R A;  3LS1 A;  4AE4 A;  4RDA A;  4BG0 A;  1LI5 A;  1VOM A;  1FTS A;  1OCZ C;  3IQ5 A;  3MBG A;  3C62 A;  1M56 C;  4PFO A;  5A6B D;  256B A;  2CBG A;  2CCY A;  1C17 M;  2A0U A;  3K6B A;  4NTA A;  3EGX A;  1JPJ A;  3IQ6 A;  4J30 B;  5DVW A;  1Q0M A;  3EGD B;  4OIN F;  3U5S A;  2JPU A;  2LK4 A;  2HKV A;  1NFN A;  2R05 A;  3IHU A;  2IXP A;  3AQB A;  3L34 A;  2OKU A;  3I5Q A;  2FFH A;  4FX5 A;  4MVZ A;  3T6G B;  2YWA A;  3HTK C;  3WAQ A;  2YLI A;  3JTL O;  4IB4 A;  4NC3 A;  4XPX A;  3U0C A;  2AU5 A;  4C7O B;  2DGJ A;  4HFF B;  1VB5 A;  4DBR A;  2WL8 A;  3VRC A;  2IXO A;  5L0C A;  2R02 A;  4JCZ A;  3VYW A;  3BRJ A;  4GEH A;  1LS1 A;  1NG1 A;  3DI5 A;  3EPV A;  4CJO A;  4PFP A;  3C7J A;  3F46 A;  4DJ9 A;  2KJG A;  4KNW A;  1T9K A;  3V5Y A;  4FWV A;  3GOD A;  3JRT A; 
#chains in the Genus database with same CATH homology
 2I15 A;  3ACT A;  2CQT A;  3ACS A;  3QFZ A;  3QG0 A;  3RSY A;  3S4A A;  2CQS A;  3S4C A;  3S4D A;  3AFJ A;  3QDE A;  3RRS A;  3QFY A;  3S4B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...