1ORJA

Flagellar export chaperone
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
126
structure length
126
Chain Sequence
b'RNIAEAYFQNMVETATPLEQIILLYDKAIECLERAIEIYDQVNELEKRKEFVENIDRVYDIISALKSFLDHEKGKEIAKNLDTIYTIILNTLVKVDKTKEELQKILEILKDLREAWEEVKKKVHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords flagellar protein FliS
publication title Similar modes of polypeptide recognition by export chaperones in flagellar biosynthesis and type III secretion
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Chaperone
total genus 57
structure length 126
sequence length 126
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2003-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02561 FliS Flagellar protein FliS
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.340 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Flagellar protein FliS 1orjA00
3K1IA 3IQCA 1SZIA 1ORYA 1ORJA
chains in the Genus database with same CATH superfamily
3GEIA 2XM0A 1NSGB 1OW8A 1APCA 2VC9A 1FAPB 1T6QA 3G4XA 3RYLA 2KW3C 4O6YA 3EFOB 3Q6MA 4XWJA 2MWQA 4CDYA 5DS6A 5JLIA 4KNVA 5JSLA 3DE9A 1ZYRF 1XZQA 5B1BC 3C7JA 2LFFA 4J32B 1M56C 3EGDB 2GA0A 1ZU5A 2XL6A 2Y3DA 4I44A 5DQZA 3U2MA 4U9DA 5DS5A 3IQ6A 3W2VA 3ZDLA 3B0VC 1IZMA 2VCCA 5JT4A 2WVQA 2H7VC 1TKNA 2A1DD 2EPNA 1T9KA 3K1IA 3IPMO 3U8PA 1SYQA 4J30B 4I1OB 3LAYA 4XPYA 3S90A 1GQAA 1QKRA 2CNWD 2Y69C 1MNDA 2BE5F 4BJ5C 1OCZC 4O7GA 4P9TA 2PX3A 4GEHA 3KH2A 2OU6A 4CDVA 3A11A 1LM3B 3EZHA 1NBBA 4U5GA 2Q9AA 5CIVA 3FAJA 4MVMA 3LS0A 2QY9A 3M79A 1RMVA 2HJ3A 3ABLC 4XLNF 3RVZA 1HW1A 3CSKA 4LDKA 4P6IC 5JS5A 5KYWB 1Z7Qc 3FMSA 4K0DA 4B6IA 2UUIA 5FCLA 2HFIA 2YL3A 5L0HA 1SZIA 5A6JA 4HEAJ 3NYJA 3O10A 4F4BA 5DS4A 2F22A 5T3WA 5E2QA 1A7EA 3DXJF 4K1OA 3DWWA 1EA8A 4WABA 3N0TA 4IGGA 3TOMA 1NG1A 3RIPA 1LE2A 1KNYA 3GM3A 1MQVA 2W4BA 2KK1A 1V55C 4J7TA 4CS9C 2JX0A 1A0BA 3HKKA 1WN0A 1BR2A 2EIMC 2WVOA 3BRJA 1NU9C 4NTAA 4XPXA 3U8VA 1O5HA 3NYLA 3NYMA 1E84A 3EFOA 4JZAA 4CS8C 2EPOA 2KSFA 2H7OA 3TD7A 3GEEA 1N1CA 2AWCA 1M57C 4Z9JA 2IBFA 3SYNA 3ZTMA 3EGDA 2P0NA 1AEPA 4U5EE 1WWPA 4DOZA 2H7BA 2IOQA 2J45A 2AP3A 4FX5A 1PD1A 4MW8A 4YJWA 2R7SA 1T6UA 3RH3A 1RXQA 1TQGA 1ZW3A 1NU7D 1VYIA 4PFOA 1H9GA 2L6GA 4BJ6C 3NMIA 4DJ9A 2XLEA 2XLMA 4G7OF 3HJCA 3SXKA 2R7VA 1LS4A 4MTGA 1H9TA 4MVUA 1E86A 4Q4ZF 4OD5A 4MNDA 2XLWA 3L8JA 4WJ0A 3KPHA 3EGXB 4PACA 4FAPB 2TMVP 3TULA 2PF4E 4U5DE 4DVYP 4BJTA 5KYWA 5F5FA 1OXBA 3R2PA 3LJBA 3EJNA 1AUEA 3IHUA 5D91A 1KTMA 2R25A 1HW2A 1O3UA 3LEVA 3ZSUA 3UMIA 3EHMA 2OG2A 4JEAA 2KNHA 1A7VA 2LD6A 4YT4A 1ZHXA 2YL7A 1NZEA 3FXHA 4RDAA 2A0BA 2P6VA 1SF8A 4MTOA 5CI9A 5COGA 3HNKA 4C3BA 2GFHA 2XS8A 3QVZA 3QW0A 2YL1A 2LCHA 3ZG1A 1HMOA 4N4WA 4CIHA 1UFBA 3JSEO 4DXWA 4DRIB 3U3FA 2P7VA 3DM9B 4JIOA 5A6AA 2R7RA 3ITFA 1Z6AA 2WZFA 4NC3A 5HV9A 1M6TA 4JE9A 3W2WA 4KBLA 3K6BA 4XEVA 2Q7RA 2QUPA 3ZQYA 2R7WA 3UGPA 4YL3A 2IXMA 3GODA 4DVZA 4EHPA 3UMKA 2XSEA 2A6HF 4MVQA 3DKAA 2QE9A 4E18A 4CBEA 2VB6A 3S0XA 3B9QA 1FNTc 1ZHZA 3W8HA 2R7TA 2R05A 3RQFA 5BQIA 2VASA 2ETSA 2KYHA 3C8ZA 4IAQA 1OQCA 5L3VA 2J7PA 1Y4CA 2J8WA 3LNRA 2IXOA 3LLKA 5FZTA 1Q0MA 1YZCA 4JC7A 3AQCA 1V54C 1OKKD 4HE8D 3RF3A 3U3BA 4JTAB 3HLZA 1VLSA 1ZHWA 1CPQA 4EBBA 2OJED 4QI2A 2KJGA 2L6FA 1CPRA 2J46A 2Y39A 1YA7O 2YHSA 4MVSA 2OQMA 3HNJA 3KKBA 4LACB 1TFKB 3EQLF 5CI8A 3VYWA 1EI7A 1OW6A 1LPEA 1ZVZA 2HJMA 2HS5A 2XLDA 3S9OA 3T6JA 3JTLO 3H65A 1L3PA 4AL1A 1LS1A 3HNLA 4ANJA 2AU5A 5JRAA 1RCPA 1TFOB 3DM5A 5COMA 1L7CA 3EGXA 2PFDA 4I3MA 2I15A 2VH3A 3C63A 4HFFB 2GAQA 1Z63A 1E85A 2R9RB 5KYYB 2GWWA 3RQEA 2E87A 2EPMX 1RKCA 2YRFA 3DJUB 1DOVA 3EZIA 4O6MA 3I4UA 1F1MA 2MYSA 4G0HA 1G8XA 2QNLA 3PMRA 4CSAC 3C18A 3MBGA 4PJJA 3B71A 1XWJA 1Z5ZA 4BPMA 4DBQA 3PDMP 4EWCA 2KC3A 1PV3A 2XXAB 4C3DA 1WTYA 3L1MA 2Z15A 4MQ9F 3L34A 4ONSA 2YL0A 2X0CA 1JOGA 2V26A 3AG4C 2PP4A 5T3TA 3M4CA 5T1DB 4YT8A 1J8YF 3R7CA 3DZAA 1CGOA 2NUTB 3CZ6A 1TWHA 1HY5A 1MMAA 3NMKA 1FMVA 3QZCA 2BC5A 3B0PA 3RKOF 3F47A 3ZIBA 4YL1A 2Q3TA 2LK4A 1HE9A 3GM2A 3X2QC 1QSPA 2R7QA 4HFKB 3JYYA 4D4NA 2YLDA 3WG7C 2LP4A 2DB4A 2ZXOA 4LDQA 4BJ1A 5B3SC 4OD4A 1LVKA 3OWTA 3NRHA 2NSGA 3NKEA 4CX9A 2ZXRA 3W8IA 2YZSA 4GQHA 5D92A 2R02A 2HV6A 3C62A 1Q0GA 4U9EA 4EUKB 3CQZA 4E0IA 3X1OA 4IAOA 2Q9BA 5B3IA 4KI2A 3LNMB 2YKZA 2DYSC 2HMZA 2QTVA 2R03A 3Q6NA 2HSBA 2ZXPA 3QW1A 3JT1A 2MHRA 2ZD9A 4K7BA 4BEJA 1M2OA 3L8IA 4U5CE 3IQCA 3JCUQ 4LLCA 3RW0A 1MMGA 3HNIA 1YVIA 5K0IA 1Z23A 2ICWG 2GDCA 3GWNA 1G4US 4JCHA 1I4YA 2RSEB 4YT5A 3M15A 4IRUA 3V5XA 4E7ZA 4XLPF 5KYXB 1WGWA 4L6RA 5AC4A 5IY5C 3QVYA 3S27A 1BR4A 4EIYA 2P61A 2A6EF 3NKDA 4IJJA 1QZXA 1J8MF 2B0JA 3EHNA 3GM1A 1EKYA 2W4MA 3ASNC 3S84A 2J9BA 1C02A 2JPUA 3T9OA 1OW7A 4BG0A 3J06A 5JUAA 3T6GB 3DD7A 1LKXA 3K1IC 1LI5A 3T4RA 4A2NB 5KYYA 4FWVA 1RJ9B 3HTKC 4IARA 3GORA 3TJ5A 1TWGA 2C03A 3VAYA 1NFNA 4FESA 5L0FA 1QQ3A 1BBHA 4W8PA 3T6BA 4E7SA 3SP1A 4N6HA 2EILC 3K7DA 4AX2A 2YLGA 3JYHA 4NY3A 3VM6A 2LFDA 1BDJB 5L0JA 4R32A 3AGUA 2B0HA 2FFHA 3AG1C 3M1CB 2HZ8A 2Y3BA 4JJFA 2XXAA 2HMQA 3E70C 1PCXA 1TR2A 1GS9A 1OCCC 4KNWA 2EIJC 3UNGC 1JAFA 4EBKA 1ORYA 3FOOA 4M63A 2OCCC 3ZWIA 1KU2A 5GPGB 2NG1A 1OXKA 3F46A 2NUTA 1OR3A 2HKVA 5B1AC 3LEOA 3ZVRA 3C8GD 2VCBA 2J0WA 4EBJA 4MVOA 2A0UA 4CJGA 3DE8A 1Y6DA 4NCQA 4XQ1A 1D0XA 2LIGA 1V74B 1T01A 2NUPB 2QLAA 3NDBB 1LE4A 4X0RA 2OOCA 4AE4B 2EPKX 2JD3A 3QTHA 4Z9HA 2XLOA 4Q5SF 1TWCA 4BJ5A 3DAGA 2PX0A 4MVRA 3FHDA 1RKEB 4AL0A 1U89A 3IEEA 3K66A 2AWYA 3TQOA 4JCZA 3TK0A 5KYUB 1Q0KA 2M4EA 5E3AA 2CGEA 1DOWA 2C04A 3OA1A 4JURI 1T6IA 2YVKA 1ST6A 1UG7A 3I5QA 1H6GA 1C17M 1YLMA 3AGTA 3KYJA 2KGOA 5F28E 1BR1A 2H8AA 2OEVA 3N24A 5COFA 5KYXA 5DQTA 2V3CC 2IXNA 1IW7F 4YN0B 3CAXA 1G4WR 4C7OB 4J7YA 4QDLA 4DRHB 4DRJB 3US6A 3AQBA 5JP7A 1VOMA 2VCAA 5DLJA 5L0DA 4XPWA 1MMNA 5DVWA 2CDQA 4PR9A 4MVZA 1RJ9A 4JJGA 1A7DA 2J9UA 4WGZA 1LIHA 5A6KA 4GYTA 4N6CA 2G62A 1K04A 5E33A 1FMWA 4CS9A 1CGME 2RD9A 1EQ1A 2OEXA 2YEVA 4H4KC 5A6BA 3GEHA 3K33A 2YQYA 3O39A 3SXMA 3ZQVA 2G3VA 4N06A 3SNHA 4CS8A 5HSWA 3B29A 2PBEA 3EG9B 1BZ4A 3OEOA 5L0GA 5AC5A 3L0IA 4PJMA 3U0CA 1A41A 2ASRA 2R7UA 1NLXA 1YA9A 3K1HA 3DMDA 4YL0A 5BQGA 2A69F 2BL2A 2DI3A 4W8KA 2NSFA 3ATPA 2HV7A 2LSEA 3Q7LA 3H2UA 1OKKA 3KL4A 3TOLA 4XEFA 4ULWA 3JZ0A 4Z9IA 3JRMO 4G7ZF 4YWQA 1ZU4A 4QI0A 4ULVA 1QLEC 1OCRC 4KC9A 2NUPA 2A68F 1SR2A 1ORSC 1TWAA 3GANA 3H2VA 4JRZA 4BJ6A 3A9CA 4H54A 5TJ5E 4AE4A 2YWAA 4CDAA 3RVYA 4UDVA 4E0HA 4O6NA 1MMDA 1D0YA 4JW1A 4CS7A 4LLEA 3CEXA 4RD9A 1JR8A 1RKEA 1VLTA 2FAPB 4YK5A 4OIQF 1MNEA 4WGYA 4PK4A 1K40A 2WB7A 2WL8A 2L81A 2PNOA 2FGYA 5KYUA 1FR0A 4MW3A 3AJMA 4LDRA 1FFTC 2CNWA 1Q0DA 4U5HA 3UMHA 2G3KA 3FVYA 1M2VB 2YLIA 3UGOA 2Y3HA 3GWLA 4AK9A 2R7XA 3U9JA 4PJNA 3I5PA 3G4ZA 1ORJA 1W2WA 1JRAA 1VB5A 5L0IA 3FAPB 3E9VA 3U9MA 2W9YA 4ZLCA 4C7OA 3MYIA 2D5RB 2WVNA 2ZXWC 4A4AA 3LLIA 1YDIA 3PHF2 3AG3C 3SXZA 5A69A 4Q7CA 4NQFA 3SZRA 1Z3IX 2J0XA 3DI5A 4JKVA 3ECSA 3V7OA 3VRCA 1V4AA 4JTDB 3SEOA 1K05A 1YARO 1JPNA 1FTSA 1C03A 2KQ9A 2CW0F 2XM4A 3C8GB 2IYLD 1D1CA 256BA 3TJ6A 1QVXA 3DJNB 3B0UX 3ASOC 3N2ZB 3AOUA 2WZLA 3ABKC 4YT2A 2J9VA 2W45A 1WASA 4D4XA 3UR3C 4JEBA 3ZC4A 4EKWA 1QPUA 1U6HA 3EG9A 3MX3A 3RFYA 4E17A 2R7OA 3W4YA 1B68A 2OJQA 1XZPA 1ZW2A 4NTFA 1S05A 1ZZPA 2O9XA 5EK0A 4MTFA 3O6XA 3WAQA 1WOLA 3V5ZA 1D1BA 4IWBA 2L7AA 2EIKC 1D0ZA 3M4BA 4LERA 4DBRA 1S7ZA 2DGJA 1PD0A 3KMIA 1VK5A 1VTMP 1JMWA 4U5FE 3NG1A 1R4TA 2LQGA 4G7HF 1JPJA 3DAFA 3ZTZA 1VMAA 5AGFA 3FOPA 1YZAA 4PJLA 3QMKA 1YYJA 5BQHA 1LI7A 4MS2A 3RQGA 3V5YA 4CIPA 1U0BB 2EPLX 1FFHA 4XEKA 1YJGA 2HUJA 3PCVA 5KYNA 2L6HA 3EPVA 4ZLDA 1G5ZA 1ZHYA 3JSZA 4P9FA 5EGYA 3S28A 3Q7GA 5EHHA 4G78A 1NFOA 2XRHA 1H7IA 3LS1A 2CYDA 4RBNA 2WZGA 3JRTA 3VF0A 2XL8A 2DYRC 5L3QA 1M2VA 1GM5A 1HE1A 1I5NA 1E2XA 4OIOF 4PFPA 3S29A 4BEMJ 1AVOB 3ABMC 2HSQA 2D4UA 1E83A 3LESA 4CSAA 2IXPA 2AVKA 1I4ZA 3KYIA 2CCYA 2M64A 4I1MA 5E3CA 1SMYF 5JVEA 2Q9CA 2J9WA 1CGNA 3LUTB 2J7PD 2P1AA 2Y3GA 2OKUA 3MLGA 4OINF 3FDQA 3POVA 4XTKA 3MYFA 1R5ID 4C3EA 1D1AA 1OCOC 1VYKA 4JTCB 1T5OA 3BEHA 2ZPAA 3WODF 3G50A 2L9JA 4NTBA 4OIRF 3IQ5A 5F5HA 3C8GA 3U5SA 1O87A 2IM8A 3IQTA 1WATA 3MFNA 4JVSA 1YYXA 3SXYA 3EH2A 4OIPF 2X51A 2XL4A 1HMDA 3WHNA 1Q0FA 3U2LA 2XLVA 4U5BE 5A6BD 1YAUO 2Q4FA 5L0CA 5BUOA 3NMJA 3EH1A 1OR2A 2I8BA 2Q00A 2XLHA 1ZHTA 2EINC 2NPUA 2UUHA 3O55A 4CJOA 1GGQA 3AG2C 4ER9A 4IB4A 4O79A 2XS1A
chains in the Genus database with same CATH topology
3K1IA 3IQCA 1SZIA 1ORYA 1ORJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K1I A;  3IQC A;  1SZI A;  1ORY A;  1ORJ A; 
#chains in the Genus database with same CATH topology
 3GEI A;  2XM0 A;  1NSG B;  1OW8 A;  1APC A;  2VC9 A;  1FAP B;  1T6Q A;  3G4X A;  3RYL A;  2KW3 C;  4O6Y A;  3EFO B;  3Q6M A;  4XWJ A;  2MWQ A;  4CDY A;  5DS6 A;  5JLI A;  4KNV A;  5JSL A;  3DE9 A;  1ZYR F;  1XZQ A;  5B1B C;  3C7J A;  2LFF A;  4J32 B;  1M56 C;  3EGD B;  2GA0 A;  1ZU5 A;  2XL6 A;  2Y3D A;  4I44 A;  5DQZ A;  3U2M A;  4U9D A;  5DS5 A;  3IQ6 A;  3W2V A;  3ZDL A;  3B0V C;  1IZM A;  2VCC A;  5JT4 A;  2WVQ A;  2H7V C;  1TKN A;  2A1D D;  2EPN A;  1T9K A;  3K1I A;  3IPM O;  3U8P A;  1SYQ A;  4J30 B;  4I1O B;  3LAY A;  4XPY A;  3S90 A;  1GQA A;  1QKR A;  2CNW D;  2Y69 C;  1MND A;  2BE5 F;  4BJ5 C;  1OCZ C;  4O7G A;  4P9T A;  2PX3 A;  4GEH A;  3KH2 A;  2OU6 A;  4CDV A;  3A11 A;  1LM3 B;  3EZH A;  1NBB A;  4U5G A;  2Q9A A;  5CIV A;  3FAJ A;  4MVM A;  3LS0 A;  2QY9 A;  3M79 A;  1RMV A;  2HJ3 A;  3ABL C;  4XLN F;  3RVZ A;  1HW1 A;  3CSK A;  4LDK A;  4P6I C;  5JS5 A;  5KYW B;  1Z7Q c;  3FMS A;  4K0D A;  4B6I A;  2UUI A;  5FCL A;  2HFI A;  2YL3 A;  5L0H A;  1SZI A;  5A6J A;  4HEA J;  3NYJ A;  3O10 A;  4F4B A;  5DS4 A;  2F22 A;  5T3W A;  5E2Q A;  1A7E A;  3DXJ F;  4K1O A;  3DWW A;  1EA8 A;  4WAB A;  3N0T A;  4IGG A;  3TOM A;  1NG1 A;  3RIP A;  1LE2 A;  1KNY A;  3GM3 A;  1MQV A;  2W4B A;  2KK1 A;  1V55 C;  4J7T A;  4CS9 C;  2JX0 A;  1A0B A;  3HKK A;  1WN0 A;  1BR2 A;  2EIM C;  2WVO A;  3BRJ A;  1NU9 C;  4NTA A;  4XPX A;  3U8V A;  1O5H A;  3NYL A;  3NYM A;  1E84 A;  3EFO A;  4JZA A;  4CS8 C;  2EPO A;  2KSF A;  2H7O A;  3TD7 A;  3GEE A;  1N1C A;  2AWC A;  1M57 C;  4Z9J A;  2IBF A;  3SYN A;  3ZTM A;  3EGD A;  2P0N A;  1AEP A;  4U5E E;  1WWP A;  4DOZ A;  2H7B A;  2IOQ A;  2J45 A;  2AP3 A;  4FX5 A;  1PD1 A;  4MW8 A;  4YJW A;  2R7S A;  1T6U A;  3RH3 A;  1RXQ A;  1TQG A;  1ZW3 A;  1NU7 D;  1VYI A;  4PFO A;  1H9G A;  2L6G A;  4BJ6 C;  3NMI A;  4DJ9 A;  2XLE A;  2XLM A;  4G7O F;  3HJC A;  3SXK A;  2R7V A;  1LS4 A;  4MTG A;  1H9T A;  4MVU A;  1E86 A;  4Q4Z F;  4OD5 A;  4MND A;  2XLW A;  3L8J A;  4WJ0 A;  3KPH A;  3EGX B;  4PAC A;  4FAP B;  2TMV P;  3TUL A;  2PF4 E;  4U5D E;  4DVY P;  4BJT A;  5KYW A;  5F5F A;  1OXB A;  3R2P A;  3LJB A;  3EJN A;  1AUE A;  3IHU A;  5D91 A;  1KTM A;  2R25 A;  1HW2 A;  1O3U A;  3LEV A;  3ZSU A;  3UMI A;  3EHM A;  2OG2 A;  4JEA A;  2KNH A;  1A7V A;  2LD6 A;  4YT4 A;  1ZHX A;  2YL7 A;  1NZE A;  3FXH A;  4RDA A;  2A0B A;  2P6V A;  1SF8 A;  4MTO A;  5CI9 A;  5COG A;  3HNK A;  4C3B A;  2GFH A;  2XS8 A;  3QVZ A;  3QW0 A;  2YL1 A;  2LCH A;  3ZG1 A;  1HMO A;  4N4W A;  4CIH A;  1UFB A;  3JSE O;  4DXW A;  4DRI B;  3U3F A;  2P7V A;  3DM9 B;  4JIO A;  5A6A A;  2R7R A;  3ITF A;  1Z6A A;  2WZF A;  4NC3 A;  5HV9 A;  1M6T A;  4JE9 A;  3W2W A;  4KBL A;  3K6B A;  4XEV A;  2Q7R A;  2QUP A;  3ZQY A;  2R7W A;  3UGP A;  4YL3 A;  2IXM A;  3GOD A;  4DVZ A;  4EHP A;  3UMK A;  2XSE A;  2A6H F;  4MVQ A;  3DKA A;  2QE9 A;  4E18 A;  4CBE A;  2VB6 A;  3S0X A;  3B9Q A;  1FNT c;  1ZHZ A;  3W8H A;  2R7T A;  2R05 A;  3RQF A;  5BQI A;  2VAS A;  2ETS A;  2KYH A;  3C8Z A;  4IAQ A;  1OQC A;  5L3V A;  2J7P A;  1Y4C A;  2J8W A;  3LNR A;  2IXO A;  3LLK A;  5FZT A;  1Q0M A;  1YZC A;  4JC7 A;  3AQC A;  1V54 C;  1OKK D;  4HE8 D;  3RF3 A;  3U3B A;  4JTA B;  3HLZ A;  1VLS A;  1ZHW A;  1CPQ A;  4EBB A;  2OJE D;  4QI2 A;  2KJG A;  2L6F A;  1CPR A;  2J46 A;  2Y39 A;  1YA7 O;  2YHS A;  4MVS A;  2OQM A;  3HNJ A;  3KKB A;  4LAC B;  1TFK B;  3EQL F;  5CI8 A;  3VYW A;  1EI7 A;  1OW6 A;  1LPE A;  1ZVZ A;  2HJM A;  2HS5 A;  2XLD A;  3S9O A;  3T6J A;  3JTL O;  3H65 A;  1L3P A;  4AL1 A;  1LS1 A;  3HNL A;  4ANJ A;  2AU5 A;  5JRA A;  1RCP A;  1TFO B;  3DM5 A;  5COM A;  1L7C A;  3EGX A;  2PFD A;  4I3M A;  2I15 A;  2VH3 A;  3C63 A;  4HFF B;  2GAQ A;  1Z63 A;  1E85 A;  2R9R B;  5KYY B;  2GWW A;  3RQE A;  2E87 A;  2EPM X;  1RKC A;  2YRF A;  3DJU B;  1DOV A;  3EZI A;  4O6M A;  3I4U A;  1F1M A;  2MYS A;  4G0H A;  1G8X A;  2QNL A;  3PMR A;  4CSA C;  3C18 A;  3MBG A;  4PJJ A;  3B71 A;  1XWJ A;  1Z5Z A;  4BPM A;  4DBQ A;  3PDM P;  4EWC A;  2KC3 A;  1PV3 A;  2XXA B;  4C3D A;  1WTY A;  3L1M A;  2Z15 A;  4MQ9 F;  3L34 A;  4ONS A;  2YL0 A;  2X0C A;  1JOG A;  2V26 A;  3AG4 C;  2PP4 A;  5T3T A;  3M4C A;  5T1D B;  4YT8 A;  1J8Y F;  3R7C A;  3DZA A;  1CGO A;  2NUT B;  3CZ6 A;  1TWH A;  1HY5 A;  1MMA A;  3NMK A;  1FMV A;  3QZC A;  2BC5 A;  3B0P A;  3RKO F;  3F47 A;  3ZIB A;  4YL1 A;  2Q3T A;  2LK4 A;  1HE9 A;  3GM2 A;  3X2Q C;  1QSP A;  2R7Q A;  4HFK B;  3JYY A;  4D4N A;  2YLD A;  3WG7 C;  2LP4 A;  2DB4 A;  2ZXO A;  4LDQ A;  4BJ1 A;  5B3S C;  4OD4 A;  1LVK A;  3OWT A;  3NRH A;  2NSG A;  3NKE A;  4CX9 A;  2ZXR A;  3W8I A;  2YZS A;  4GQH A;  5D92 A;  2R02 A;  2HV6 A;  3C62 A;  1Q0G A;  4U9E A;  4EUK B;  3CQZ A;  4E0I A;  3X1O A;  4IAO A;  2Q9B A;  5B3I A;  4KI2 A;  3LNM B;  2YKZ A;  2DYS C;  2HMZ A;  2QTV A;  2R03 A;  3Q6N A;  2HSB A;  2ZXP A;  3QW1 A;  3JT1 A;  2MHR A;  2ZD9 A;  4K7B A;  4BEJ A;  1M2O A;  3L8I A;  4U5C E;  3IQC A;  3JCU Q;  4LLC A;  3RW0 A;  1MMG A;  3HNI A;  1YVI A;  5K0I A;  1Z23 A;  2ICW G;  2GDC A;  3GWN A;  1G4U S;  4JCH A;  1I4Y A;  2RSE B;  4YT5 A;  3M15 A;  4IRU A;  3V5X A;  4E7Z A;  4XLP F;  5KYX B;  1WGW A;  4L6R A;  5AC4 A;  5IY5 C;  3QVY A;  3S27 A;  1BR4 A;  4EIY A;  2P61 A;  2A6E F;  3NKD A;  4IJJ A;  1QZX A;  1J8M F;  2B0J A;  3EHN A;  3GM1 A;  1EKY A;  2W4M A;  3ASN C;  3S84 A;  2J9B A;  1C02 A;  2JPU A;  3T9O A;  1OW7 A;  4BG0 A;  3J06 A;  5JUA A;  3T6G B;  3DD7 A;  1LKX A;  3K1I C;  1LI5 A;  3T4R A;  4A2N B;  5KYY A;  4FWV A;  1RJ9 B;  3HTK C;  4IAR A;  3GOR A;  3TJ5 A;  1TWG A;  2C03 A;  3VAY A;  1NFN A;  4FES A;  5L0F A;  1QQ3 A;  1BBH A;  4W8P A;  3T6B A;  4E7S A;  3SP1 A;  4N6H A;  2EIL C;  3K7D A;  4AX2 A;  2YLG A;  3JYH A;  4NY3 A;  3VM6 A;  2LFD A;  1BDJ B;  5L0J A;  4R32 A;  3AGU A;  2B0H A;  2FFH A;  3AG1 C;  3M1C B;  2HZ8 A;  2Y3B A;  4JJF A;  2XXA A;  2HMQ A;  3E70 C;  1PCX A;  1TR2 A;  1GS9 A;  1OCC C;  4KNW A;  2EIJ C;  3UNG C;  1JAF A;  4EBK A;  1ORY A;  3FOO A;  4M63 A;  2OCC C;  3ZWI A;  1KU2 A;  5GPG B;  2NG1 A;  1OXK A;  3F46 A;  2NUT A;  1OR3 A;  2HKV A;  5B1A C;  3LEO A;  3ZVR A;  3C8G D;  2VCB A;  2J0W A;  4EBJ A;  4MVO A;  2A0U A;  4CJG A;  3DE8 A;  1Y6D A;  4NCQ A;  4XQ1 A;  1D0X A;  2LIG A;  1V74 B;  1T01 A;  2NUP B;  2QLA A;  3NDB B;  1LE4 A;  4X0R A;  2OOC A;  4AE4 B;  2EPK X;  2JD3 A;  3QTH A;  4Z9H A;  2XLO A;  4Q5S F;  1TWC A;  4BJ5 A;  3DAG A;  2PX0 A;  4MVR A;  3FHD A;  1RKE B;  4AL0 A;  1U89 A;  3IEE A;  3K66 A;  2AWY A;  3TQO A;  4JCZ A;  3TK0 A;  5KYU B;  1Q0K A;  2M4E A;  5E3A A;  2CGE A;  1DOW A;  2C04 A;  3OA1 A;  4JUR I;  1T6I A;  2YVK A;  1ST6 A;  1UG7 A;  3I5Q A;  1H6G A;  1C17 M;  1YLM A;  3AGT A;  3KYJ A;  2KGO A;  5F28 E;  1BR1 A;  2H8A A;  2OEV A;  3N24 A;  5COF A;  5KYX A;  5DQT A;  2V3C C;  2IXN A;  1IW7 F;  4YN0 B;  3CAX A;  1G4W R;  4C7O B;  4J7Y A;  4QDL A;  4DRH B;  4DRJ B;  3US6 A;  3AQB A;  5JP7 A;  1VOM A;  2VCA A;  5DLJ A;  5L0D A;  4XPW A;  1MMN A;  5DVW A;  2CDQ A;  4PR9 A;  4MVZ A;  1RJ9 A;  4JJG A;  1A7D A;  2J9U A;  4WGZ A;  1LIH A;  5A6K A;  4GYT A;  4N6C A;  2G62 A;  1K04 A;  5E33 A;  1FMW A;  4CS9 A;  1CGM E;  2RD9 A;  1EQ1 A;  2OEX A;  2YEV A;  4H4K C;  5A6B A;  3GEH A;  3K33 A;  2YQY A;  3O39 A;  3SXM A;  3ZQV A;  2G3V A;  4N06 A;  3SNH A;  4CS8 A;  5HSW A;  3B29 A;  2PBE A;  3EG9 B;  1BZ4 A;  3OEO A;  5L0G A;  5AC5 A;  3L0I A;  4PJM A;  3U0C A;  1A41 A;  2ASR A;  2R7U A;  1NLX A;  1YA9 A;  3K1H A;  3DMD A;  4YL0 A;  5BQG A;  2A69 F;  2BL2 A;  2DI3 A;  4W8K A;  2NSF A;  3ATP A;  2HV7 A;  2LSE A;  3Q7L A;  3H2U A;  1OKK A;  3KL4 A;  3TOL A;  4XEF A;  4ULW A;  3JZ0 A;  4Z9I A;  3JRM O;  4G7Z F;  4YWQ A;  1ZU4 A;  4QI0 A;  4ULV A;  1QLE C;  1OCR C;  4KC9 A;  2NUP A;  2A68 F;  1SR2 A;  1ORS C;  1TWA A;  3GAN A;  3H2V A;  4JRZ A;  4BJ6 A;  3A9C A;  4H54 A;  5TJ5 E;  4AE4 A;  2YWA A;  4CDA A;  3RVY A;  4UDV A;  4E0H A;  4O6N A;  1MMD A;  1D0Y A;  4JW1 A;  4CS7 A;  4LLE A;  3CEX A;  4RD9 A;  1JR8 A;  1RKE A;  1VLT A;  2FAP B;  4YK5 A;  4OIQ F;  1MNE A;  4WGY A;  4PK4 A;  1K40 A;  2WB7 A;  2WL8 A;  2L81 A;  2PNO A;  2FGY A;  5KYU A;  1FR0 A;  4MW3 A;  3AJM A;  4LDR A;  1FFT C;  2CNW A;  1Q0D A;  4U5H A;  3UMH A;  2G3K A;  3FVY A;  1M2V B;  2YLI A;  3UGO A;  2Y3H A;  3GWL A;  4AK9 A;  2R7X A;  3U9J A;  4PJN A;  3I5P A;  3G4Z A;  1ORJ A;  1W2W A;  1JRA A;  1VB5 A;  5L0I A;  3FAP B;  3E9V A;  3U9M A;  2W9Y A;  4ZLC A;  4C7O A;  3MYI A;  2D5R B;  2WVN A;  2ZXW C;  4A4A A;  3LLI A;  1YDI A;  3PHF 2;  3AG3 C;  3SXZ A;  5A69 A;  4Q7C A;  4NQF A;  3SZR A;  1Z3I X;  2J0X A;  3DI5 A;  4JKV A;  3ECS A;  3V7O A;  3VRC A;  1V4A A;  4JTD B;  3SEO A;  1K05 A;  1YAR O;  1JPN A;  1FTS A;  1C03 A;  2KQ9 A;  2CW0 F;  2XM4 A;  3C8G B;  2IYL D;  1D1C A;  256B A;  3TJ6 A;  1QVX A;  3DJN B;  3B0U X;  3ASO C;  3N2Z B;  3AOU A;  2WZL A;  3ABK C;  4YT2 A;  2J9V A;  2W45 A;  1WAS A;  4D4X A;  3UR3 C;  4JEB A;  3ZC4 A;  4EKW A;  1QPU A;  1U6H A;  3EG9 A;  3MX3 A;  3RFY A;  4E17 A;  2R7O A;  3W4Y A;  1B68 A;  2OJQ A;  1XZP A;  1ZW2 A;  4NTF A;  1S05 A;  1ZZP A;  2O9X A;  5EK0 A;  4MTF A;  3O6X A;  3WAQ A;  1WOL A;  3V5Z A;  1D1B A;  4IWB A;  2L7A A;  2EIK C;  1D0Z A;  3M4B A;  4LER A;  4DBR A;  1S7Z A;  2DGJ A;  1PD0 A;  3KMI A;  1VK5 A;  1VTM P;  1JMW A;  4U5F E;  3NG1 A;  1R4T A;  2LQG A;  4G7H F;  1JPJ A;  3DAF A;  3ZTZ A;  1VMA A;  5AGF A;  3FOP A;  1YZA A;  4PJL A;  3QMK A;  1YYJ A;  5BQH A;  1LI7 A;  4MS2 A;  3RQG A;  3V5Y A;  4CIP A;  1U0B B;  2EPL X;  1FFH A;  4XEK A;  1YJG A;  2HUJ A;  3PCV A;  5KYN A;  2L6H A;  3EPV A;  4ZLD A;  1G5Z A;  1ZHY A;  3JSZ A;  4P9F A;  5EGY A;  3S28 A;  3Q7G A;  5EHH A;  4G78 A;  1NFO A;  2XRH A;  1H7I A;  3LS1 A;  2CYD A;  4RBN A;  2WZG A;  3JRT A;  3VF0 A;  2XL8 A;  2DYR C;  5L3Q A;  1M2V A;  1GM5 A;  1HE1 A;  1I5N A;  1E2X A;  4OIO F;  4PFP A;  3S29 A;  4BEM J;  1AVO B;  3ABM C;  2HSQ A;  2D4U A;  1E83 A;  3LES A;  4CSA A;  2IXP A;  2AVK A;  1I4Z A;  3KYI A;  2CCY A;  2M64 A;  4I1M A;  5E3C A;  1SMY F;  5JVE A;  2Q9C A;  2J9W A;  1CGN A;  3LUT B;  2J7P D;  2P1A A;  2Y3G A;  2OKU A;  3MLG A;  4OIN F;  3FDQ A;  3POV A;  4XTK A;  3MYF A;  1R5I D;  4C3E A;  1D1A A;  1OCO C;  1VYK A;  4JTC B;  1T5O A;  3BEH A;  2ZPA A;  3WOD F;  3G50 A;  2L9J A;  4NTB A;  4OIR F;  3IQ5 A;  5F5H A;  3C8G A;  3U5S A;  1O87 A;  2IM8 A;  3IQT A;  1WAT A;  3MFN A;  4JVS A;  1YYX A;  3SXY A;  3EH2 A;  4OIP F;  2X51 A;  2XL4 A;  1HMD A;  3WHN A;  1Q0F A;  3U2L A;  2XLV A;  4U5B E;  5A6B D;  1YAU O;  2Q4F A;  5L0C A;  5BUO A;  3NMJ A;  3EH1 A;  1OR2 A;  2I8B A;  2Q00 A;  2XLH A;  1ZHT A;  2EIN C;  2NPU A;  2UUH A;  3O55 A;  4CJO A;  1GGQ A;  3AG2 C;  4ER9 A;  4IB4 A;  4O79 A;  2XS1 A; 
#chains in the Genus database with same CATH homology
 3K1I A;  3IQC A;  1SZI A;  1ORY A;  1ORJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...