1ORJA

Flagellar export chaperone
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
126
structure length
126
Chain Sequence
RNIAEAYFQNMVETATPLEQIILLYDKAIECLERAIEIYDQVNELEKRKEFVENIDRVYDIISALKSFLDHEKGKEIAKNLDTIYTIILNTLVKVDKTKEELQKILEILKDLREAWEEVKKKVHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Similar modes of polypeptide recognition by export chaperones in flagellar biosynthesis and type III secretion
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Chaperone
molecule keywords flagellar protein FliS
total genus 57
structure length 126
sequence length 126
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2003-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02561 FliS Flagellar protein FliS
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.340 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Flagellar protein FliS 1orjA00
1ORYA 1ORJA 3K1IA 3IQCA 1SZIA
chains in the Genus database with same CATH superfamily
3QZCA 1VK5A 2FAPB 4O6MA 1VOMA 3ZIBA 5A6JA 5L0JA 3POVA 2XRHA 3KYJA 4MW8A 4XWJA 1TR2A 1LKXA 1OCRC 3SXZA 2XLEA 2XLVA 1Q0KA 4WJ0A 4U9DA 2QE9A 2WVQA 2C04A 2WZFA 5KYUA 3V5YA 3L8IA 2IXPA 3RVYA 3WHNA 1YZCA 2YZSA 4CS8A 3E70C 3O10A 4YL1A 1T6IA 1YJGA 4PJJA 2AVKA 5D92A 1JPNA 5COFA 1E2XA 4JIOA 4CS7A 2OJED 1H7IA 1IZMA 2XL6A 5DQZA 1JOGA 4FESA 3EJNA 1ZU5A 1MNEA 2KSFA 5T1DB 3QVYA 4P9FA 1Z5ZA 4FWVA 2IOQA 2L6GA 4J30B 2JPUA 4H4KC 1HE9A 1RMVA 2H7BA 1D0XA 1HMDA 1QSPA 2CCYA 2J8WA 3B29A 3EFOB 3LESA 1ZYRF 2KJGA 3GM3A 2BC5A 2YEVA 4G7HF 4E17A 1J8YF 3O6XA 1U6HA 1OW6A 4PJLA 1VLTA 2YWAA 5GPGB 3ABMC 2R7UA 3M15A 1ZHZA 4CDVA 2A0UA 4CJOA 1C02A 2QUPA 1R4TA 1ST6A 1LI7A 1WATA 3DJUB 4QI0A 1FNTc 3V7OA 4U5HA 4O6NA 4E7SA 5E33A 1L7CA 5B1AC 3X1OA 4G0HA 2DYRC 3TJ6A 4JTCB 1TWHA 4C3BA 1R5ID 2NUPB 4I1OB 2H7OA 3JRMO 1EQ1A 3DZAA 1M2OA 2IM8A 4C7OB 3EG9A 5COMA 3ATPA 3R7CA 4KI2A 5L0GA 3Q6NA 3EGDA 1T01A 2JD3A 2VCCA 4MVZA 4LLEA 1MMNA 1WN0A 3HNLA 5E3AA 2IBFA 2EILC 3B71A 3W8IA 1L3PA 2WB7A 4Z9JA 2G3VA 3UGPA 2R7TA 4HFKB 1WASA 1LI5A 5BQIA 1YZAA 3HKKA 4J7YA 4YK5A 1SZIA 1PV3A 3S84A 3HNKA 3J06A 2XM0A 4RDAA 3QTHA 1WGWA 4NTBA 2NSFA 2JX0A 3C8ZA 3LNRA 1FFHA 1K40A 1V55C 1HY5A 1Y6DA 2R7QA 3BRJA 2EPLX 3C62A 1YAUO 1A7DA 2ZXRA 3ASOC 4DRIB 1E85A 3TJ5A 4MTGA 3AOUA 1NG1A 3DXJF 2YL3A 3JZ0A 1WTYA 4MVMA 2P61A 2CNWD 2H7VC 1RKCA 2XLOA 2Y3DA 2ZXPA 3ECSA 4K1OA 4Z9HA 4XLNF 5JT4A 3O55A 3RQEA 4DOZA 1FMVA 2J45A 4DBQA 5L3QA 2R7OA 3UGOA 2HS5A 3C7JA 4JCHA 3M1CB 5E2QA 3UMKA 3V5ZA 4BJ1A 4A4AA 3RVZA 3S28A 3ZVRA 4CSAC 4OIPF 2R05A 4CSAA 4QDLA 2I15A 2KGOA 1NFOA 2QY9A 2XS8A 2MHRA 4MVSA 5TJ5E 3O39A 2F22A 3FAJA 2P6VA 4P9TA 1PD0A 1AEPA 2HZ8A 4PACA 3ZSUA 2Y69C 2ICWG 3CZ6A 4IGGA 2HFIA 4C3DA 4MNDA 2J9UA 3BEHA 1DOVA 1UFBA 3ZDLA 3U5SA 2I8BA 2X0CA 4KNVA 2V3CC 1CGNA 1ZW2A 2R25A 1B68A 4YWQA 5L0DA 1Y4CA 1A41A 1LE2A 2WVNA 3IQ6A 4XTKA 2XXAA 1Z63A 3SP1A 1Z23A 2HMQA 3GEHA 2YL1A 2P1AA 3OEOA 1NFNA 2UUIA 1TWGA 2YRFA 3K7DA 4EHPA 3GWNA 1QKRA 4JW1A 3SYNA 1HE1A 1QQ3A 2HSBA 3TULA 4FX5A 3U3BA 3KMIA 5F5FA 3NYLA 3DI5A 4ONSA 4PJMA 1RXQA 4YT4A 1T9KA 3JCUQ 3EHNA 2WZLA 3T4RA 3FDQA 1H6GA 3CEXA 4KC9A 3M4BA 2P0NA 3S9OA 1OCCC 2AWYA 4PR9A 1T6QA 4AK9A 1XWJA 2EINC 4CX9A 3RQGA 4YT8A 1U0BB 1G5ZA 4MS2A 1KTMA 1HW2A 3S0XA 4PFOA 2LSEA 2Y39A 1O87A 5L0CA 1EKYA 4AE4A 1JRAA 1BR4A 1M56C 2A6EF 4N06A 1XZPA 3NYMA 1JPJA 5B3SC 2AU5A 1MMAA 1AUEA 1V54C 1SR2A 5JP7A 1LS1A 3UNGC 4MQ9F 3MLGA 3WAQA 1OKKD 1PD1A 1K04A 3EGDB 1BR2A 3ZG1A 4B6IA 5K0IA 4CS8C 2R7RA 3G50A 2OG2A 1TWCA 3U0CA 4Q5SF 1M2VB 3AQCA 4H54A 3RF3A 3VRCA 2XLHA 2GA0A 2OCCC 1M57C 2G3KA 1G8XA 3IQCA 4EBKA 2LD6A 4YT2A 3PHF2 2GFHA 3KL4A 1SMYF 2XLWA 4WGZA 2ASRA 3DD7A 3LS1A 3PMRA 3T6GB 1EA8A 2VASA 3GM1A 1JR8A 3RH3A 3SNHA 4CS9C 2E87A 1LS4A 3VAYA 5EHHA 1T5OA 5A6BA 3G4ZA 1JAFA 1HW1A 2XSEA 2OKUA 3JYYA 3CAXA 4ZLDA 3NMIA 2Y3GA 3CSKA 3Q7LA 1SF8A 5L0FA 1VLSA 4OINF 4DRJB 1TKNA 2J0XA 2W9YA 3LEVA 1NBBA 5JVEA 2EIMC 4BJ6C 3SXMA 2J7PD 3DE9A 1E86A 5A6BD 1ZVZA 5D91A 4MW3A 2A69F 1I4ZA 1ZU4A 3ABKC 3EHMA 1BR1A 2RSEB 2XLMA 3GORA 1Z3IX 3H2UA 4NQFA 2HJ3A 1Z7Qc 4Z9IA 3US6A 1T6UA 2QNLA 2PF4E 3MFNA 3L0IA 2J0WA 2WZGA 3JSEO 4YL3A 4DBRA 1VTMP 3EZHA 1FR0A 2W4MA 2A1DD 3AGUA 5T3TA 2QLAA 5L0HA 3GODA 5KYUB 3I4UA 4G78A 3T9OA 4EBJA 2L6FA 3HLZA 4HE8D 3NG1A 5KYYA 4IAOA 1BBHA 1OXKA 2GDCA 1OCZC 1KNYA 1Q0MA 4EWCA 2LFDA 4U5FE 1D0YA 3U9MA 1C17M 3AG1C 4JURI 4E0HA 3U8PA 5BUOA 4MTOA 1ZHXA 4JEBA 4PFPA 1U89A 4IARA 3V5XA 3RIPA 3RQFA 4X0RA 4NTFA 3NYJA 5FCLA 2W45A 5JS5A 4ZLCA 3C8GA 3EGXB 4IAQA 4EIYA 2IYLD 2W4BA 5A6KA 2HSQA 3MYIA 3ZC4A 1W2WA 4IB4A 1ZHTA 3M4CA 1CGOA 2IXOA 2KC3A 1LVKA 1GQAA 3U8VA 3WG7C 3N0TA 4BEJA 3EFOA 4RD9A 1APCA 1D1CA 3DAFA 2LQGA 4NCQA 3S27A 4Q4ZF 1FFTC 4AE4B 1FMWA 1D1BA 3DJNB 2LIGA 2AWCA 4U9EA 1M6TA 2G62A 1Q0FA 5DS4A 2LK4A 3UR3C 2EIJC 1H9GA 1OW7A 2VC9A 2Z15A 3HNJA 3LJBA 4XLPF 3FAPB 2MYSA 3G4XA 1OQCA 3U3FA 4BEMJ 1O5HA 3B0UX 5B3IA 1MNDA 3LUTB 3DE8A 3SXYA 3FMSA 1GGQA 3H2VA 4JEAA 1OCOC 1QZXA 3OA1A 3FHDA 1D1AA 2HV7A 2YLIA 2YKZA 3MBGA 3U2LA 4BJ5C 2EPOA 4C3EA 3I5QA 4BJ5A 2R03A 4BPMA 3A11A 2B0JA 3GWLA 3R2PA 1S7ZA 2D4UA 3UMHA 2Q7RA 3SEOA 1UG7A 4JTDB 1YLMA 2J9WA 2YL7A 3QVZA 3Q6MA 1CGME 3AG4C 2Q4FA 3IEEA 3U2MA 4EBBA 2A0BA 2J9VA 4NY3A 4FAPB 3EQLF 3IQTA 4Q7CA 4WGYA 1YVIA 1NU7D 4HFFB 3W2WA 5AC5A 1IW7F 4U5DE 1D0ZA 4P6IC 2FFHA 1TFKB 4OD4A 2KW3C 2HV6A 2J7PA 2YHSA 2EIKC 4LDRA 4U5EE 3KPHA 3TK0A 5EGYA 3RYLA 5CI9A 3VYWA 1S05A 3K66A 3FVYA 2A68F 1I4YA 1K05A 2AP3A 1EI7A 2WVOA 3M79A 2M4EA 4ULWA 2M64A 4XEFA 4NC3A 2V26A 2L7AA 3TQOA 4G7ZF 2R9RB 1OR2A 2X51A 2YQYA 4J32B 5L3VA 1Z6AA 3KKBA 4GEHA 4D4NA 3AQBA 4ULVA 3L1MA 3F46A 4IJJA 1H9TA 4XEVA 2OOCA 2UUHA 3HNIA 4MTFA 2J46A 5B1BC 5JUAA 5KYYB 4G7OF 2DB4A 3N2ZB 5AGFA 1O3UA 3FXHA 4ER9A 5DS6A 2R7XA 4NTAA 2Q00A 2ZXWC 3DM9B 3S90A 2CYDA 2EPNA 1QLEC 2PX0A 2Y3BA 1Q0DA 1ZZPA 4F4BA 1ZHYA 4AL1A 3VM6A 4JE9A 3JT1A 4GQHA 2R7WA 2R7SA 4E18A 1A7EA 1NZEA 2XL8A 3NMKA 1ORJA 256BA 5BQGA 2ZD9A 1SYQA 1QVXA 3B0PA 3AJMA 2KQ9A 1RKEA 3B9QA 3Q7GA 4U5GA 2QTVA 3JRTA 1VYIA 4XQ1A 1LE4A 4JKVA 4PJNA 1OR3A 4EKWA 3QMKA 5E3CA 1CPRA 4JC7A 4LDQA 2PX3A 5DLJA 3DKAA 3JTLO 3L8JA 4KNWA 5JRAA 5DQTA 4YJWA 4I3MA 2MWQA 4JCZA 1YA7O 4U5BE 1MQVA 2OU6A 2PP4A 2OQMA 3KYIA 3LNMB 5F28E 2GWWA 1FTSA 4RBNA 3OWTA 4W8PA 4CIPA 4N4WA 3LS0A 2OEXA 4ANJA 5DS5A 1NSGB 1YDIA 2PNOA 4L6RA 2ZPAA 1OXBA 1Q0GA 3QW0A 1TQGA 3T6BA 5A6AA 3PDMP 4MVRA 1HMOA 3MX3A 2J9BA 2DI3A 2BE5F 1OW8A 1VB5A 2NG1A 5L0IA 2NPUA 3LAYA 2CGEA 4JRZA 5F5HA 2HUJA 3H65A 4LDKA 3WODF 1C03A 2CW0F 3U9JA 3GEIA 3UMIA 1RCPA 4W8KA 2LFFA 1OKKA 2BL2A 1V4AA 4OIQF 4GYTA 3IHUA 2KK1A 5JLIA 1J8MF 3EGXA 3S29A 4IWBA 4OIOF 1WOLA 2XXAB 5EK0A 1ORYA 1I5NA 1RJ9B 1WWPA 5KYXA 3VF0A 3ASNC 2HKVA 1VYKA 1LPEA 3DWWA 3W4YA 4QI2A 3C8GB 3K1IA 1A0BA 1MMGA 3DMDA 1LM3B 2YVKA 3GANA 3K1IC 3F47A 5KYWB 4MVUA 4BG0A 4E7ZA 3LLKA 2YLDA 2YLGA 3C8GD 3ZTZA 4O6YA 3GM2A 1KU2A 4U5CE 3DM5A 5FZTA 1NU9C 2B0HA 4YL0A 3KH2A 3SZRA 3EG9B 3K6BA 3NRHA 5AC4A 5CI8A 3E9VA 3NKEA 2IXNA 2L9JA 5CIVA 5KYWA 3C18A 4WABA 3RKOF 3ZQYA 4DVYP 2Q3TA 3K33A 4PK4A 4YN0B 2VH3A 4CDAA 3LLIA 3W8HA 2OEVA 3LEOA 3IQ5A 3W2VA 4XEKA 1QPUA 3IPMO 4DRHB 3SXKA 1YA9A 2Q9BA 4UDVA 1G4US 1A7VA 1GM5A 3AG2C 1MMDA 3EZIA 3RW0A 4O79A 3L34A 2A6HF 4M63A 4BJ6A 2H8AA 2CDQA 2XM4A 3TOLA 2PBEA 3MYFA 3EH2A 2NUTB 2VB6A 4CIHA 4R32A 2Q9AA 3X2QC 1M2VA 1XZQA 3ZTMA 4CDYA 4I44A 5KYNA 1ORSC 1RKEB 4JTAB 2L6HA 4XPYA 2HMZA 3T6JA 1E84A 3A9CA 4MVOA 2C03A 1CPQA 4KBLA 4OIRF 1GS9A 1ZHWA 4YT5A 4AX2A 3EH1A 3FOOA 3ITFA 4JZAA 2NUTA 3NMJA 3ZQVA 3NDBB 1N1CA 4HEAJ 3I5PA 4K7BA 5T3WA 2ETSA 1G4WR 2IXMA 1DOWA 3TOMA 4OD5A 1FAPB 1NLXA 2XL4A 2ZXOA 2CNWA 3HTKC 3HJCA 4I1MA 1F1MA 2LP4A 4LACB 2R7VA 1LIHA 1AVOB 3NKDA 1RJ9A 3EPVA 4J7TA 4N6HA 3ZWIA 3K1HA 5KYXB 5COGA 4CBEA 1BZ4A 2DYSC 1E83A 2L81A 2LCHA 2D5RB 2XLDA 3AGTA 3C63A 3FOPA 2P7VA 2VCAA 3QW1A 5JSLA 4EUKB 2KYHA 3CQZA 5HSWA 4JJFA 4DVZA 4C7OA 1PCXA 4LERA 4XPWA 2HJMA 2Y3HA 3JSZA 1YARO 3ABLC 4AL0A 3DAGA 2XS1A 3AG3C 4DJ9A 5A69A 4JVSA 3JYHA 1YYJA 2DGJA 2OJQA 3GEEA 2Q9CA 4D4XA 2RD9A 2GAQA 4BJTA 4DXWA 4E0IA 2EPMX 2PFDA 2FGYA 2NUPA 4JJGA 3B0VC 2EPKX 2YL0A 4N6CA 5BQHA 4IRUA 3RFYA 2TMVP 2NSGA 4LLCA 1TWAA 4K0DA 5IY5C 4MVQA 4A2NB 5HV9A 4O7GA 4CS9A 1JMWA 3N24A 4XPXA 1VMAA 2VCBA 3PCVA 1V74B 1YYXA 1TFOB 1BDJB 1ZW3A 2R02A 5DVWA 4CJGA 2KNHA 2WL8A 2O9XA 3TD7A
chains in the Genus database with same CATH topology
1ORYA 1ORJA 3K1IA 3IQCA 1SZIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ORY A;  1ORJ A;  3K1I A;  3IQC A;  1SZI A; 
#chains in the Genus database with same CATH topology
 3QZC A;  1VK5 A;  2FAP B;  4O6M A;  1VOM A;  3ZIB A;  5A6J A;  5L0J A;  3POV A;  2XRH A;  3KYJ A;  4MW8 A;  4XWJ A;  1TR2 A;  1LKX A;  1OCR C;  3SXZ A;  2XLE A;  2XLV A;  1Q0K A;  4WJ0 A;  4U9D A;  2QE9 A;  2WVQ A;  2C04 A;  2WZF A;  5KYU A;  3V5Y A;  3L8I A;  2IXP A;  3RVY A;  3WHN A;  1YZC A;  2YZS A;  4CS8 A;  3E70 C;  3O10 A;  4YL1 A;  1T6I A;  1YJG A;  4PJJ A;  2AVK A;  5D92 A;  1JPN A;  5COF A;  1E2X A;  4JIO A;  4CS7 A;  2OJE D;  1H7I A;  1IZM A;  2XL6 A;  5DQZ A;  1JOG A;  4FES A;  3EJN A;  1ZU5 A;  1MNE A;  2KSF A;  5T1D B;  3QVY A;  4P9F A;  1Z5Z A;  4FWV A;  2IOQ A;  2L6G A;  4J30 B;  2JPU A;  4H4K C;  1HE9 A;  1RMV A;  2H7B A;  1D0X A;  1HMD A;  1QSP A;  2CCY A;  2J8W A;  3B29 A;  3EFO B;  3LES A;  1ZYR F;  2KJG A;  3GM3 A;  2BC5 A;  2YEV A;  4G7H F;  4E17 A;  1J8Y F;  3O6X A;  1U6H A;  1OW6 A;  4PJL A;  1VLT A;  2YWA A;  5GPG B;  3ABM C;  2R7U A;  3M15 A;  1ZHZ A;  4CDV A;  2A0U A;  4CJO A;  1C02 A;  2QUP A;  1R4T A;  1ST6 A;  1LI7 A;  1WAT A;  3DJU B;  4QI0 A;  1FNT c;  3V7O A;  4U5H A;  4O6N A;  4E7S A;  5E33 A;  1L7C A;  5B1A C;  3X1O A;  4G0H A;  2DYR C;  3TJ6 A;  4JTC B;  1TWH A;  4C3B A;  1R5I D;  2NUP B;  4I1O B;  2H7O A;  3JRM O;  1EQ1 A;  3DZA A;  1M2O A;  2IM8 A;  4C7O B;  3EG9 A;  5COM A;  3ATP A;  3R7C A;  4KI2 A;  5L0G A;  3Q6N A;  3EGD A;  1T01 A;  2JD3 A;  2VCC A;  4MVZ A;  4LLE A;  1MMN A;  1WN0 A;  3HNL A;  5E3A A;  2IBF A;  2EIL C;  3B71 A;  3W8I A;  1L3P A;  2WB7 A;  4Z9J A;  2G3V A;  3UGP A;  2R7T A;  4HFK B;  1WAS A;  1LI5 A;  5BQI A;  1YZA A;  3HKK A;  4J7Y A;  4YK5 A;  1SZI A;  1PV3 A;  3S84 A;  3HNK A;  3J06 A;  2XM0 A;  4RDA A;  3QTH A;  1WGW A;  4NTB A;  2NSF A;  2JX0 A;  3C8Z A;  3LNR A;  1FFH A;  1K40 A;  1V55 C;  1HY5 A;  1Y6D A;  2R7Q A;  3BRJ A;  2EPL X;  3C62 A;  1YAU O;  1A7D A;  2ZXR A;  3ASO C;  4DRI B;  1E85 A;  3TJ5 A;  4MTG A;  3AOU A;  1NG1 A;  3DXJ F;  2YL3 A;  3JZ0 A;  1WTY A;  4MVM A;  2P61 A;  2CNW D;  2H7V C;  1RKC A;  2XLO A;  2Y3D A;  2ZXP A;  3ECS A;  4K1O A;  4Z9H A;  4XLN F;  5JT4 A;  3O55 A;  3RQE A;  4DOZ A;  1FMV A;  2J45 A;  4DBQ A;  5L3Q A;  2R7O A;  3UGO A;  2HS5 A;  3C7J A;  4JCH A;  3M1C B;  5E2Q A;  3UMK A;  3V5Z A;  4BJ1 A;  4A4A A;  3RVZ A;  3S28 A;  3ZVR A;  4CSA C;  4OIP F;  2R05 A;  4CSA A;  4QDL A;  2I15 A;  2KGO A;  1NFO A;  2QY9 A;  2XS8 A;  2MHR A;  4MVS A;  5TJ5 E;  3O39 A;  2F22 A;  3FAJ A;  2P6V A;  4P9T A;  1PD0 A;  1AEP A;  2HZ8 A;  4PAC A;  3ZSU A;  2Y69 C;  2ICW G;  3CZ6 A;  4IGG A;  2HFI A;  4C3D A;  4MND A;  2J9U A;  3BEH A;  1DOV A;  1UFB A;  3ZDL A;  3U5S A;  2I8B A;  2X0C A;  4KNV A;  2V3C C;  1CGN A;  1ZW2 A;  2R25 A;  1B68 A;  4YWQ A;  5L0D A;  1Y4C A;  1A41 A;  1LE2 A;  2WVN A;  3IQ6 A;  4XTK A;  2XXA A;  1Z63 A;  3SP1 A;  1Z23 A;  2HMQ A;  3GEH A;  2YL1 A;  2P1A A;  3OEO A;  1NFN A;  2UUI A;  1TWG A;  2YRF A;  3K7D A;  4EHP A;  3GWN A;  1QKR A;  4JW1 A;  3SYN A;  1HE1 A;  1QQ3 A;  2HSB A;  3TUL A;  4FX5 A;  3U3B A;  3KMI A;  5F5F A;  3NYL A;  3DI5 A;  4ONS A;  4PJM A;  1RXQ A;  4YT4 A;  1T9K A;  3JCU Q;  3EHN A;  2WZL A;  3T4R A;  3FDQ A;  1H6G A;  3CEX A;  4KC9 A;  3M4B A;  2P0N A;  3S9O A;  1OCC C;  2AWY A;  4PR9 A;  1T6Q A;  4AK9 A;  1XWJ A;  2EIN C;  4CX9 A;  3RQG A;  4YT8 A;  1U0B B;  1G5Z A;  4MS2 A;  1KTM A;  1HW2 A;  3S0X A;  4PFO A;  2LSE A;  2Y39 A;  1O87 A;  5L0C A;  1EKY A;  4AE4 A;  1JRA A;  1BR4 A;  1M56 C;  2A6E F;  4N06 A;  1XZP A;  3NYM A;  1JPJ A;  5B3S C;  2AU5 A;  1MMA A;  1AUE A;  1V54 C;  1SR2 A;  5JP7 A;  1LS1 A;  3UNG C;  4MQ9 F;  3MLG A;  3WAQ A;  1OKK D;  1PD1 A;  1K04 A;  3EGD B;  1BR2 A;  3ZG1 A;  4B6I A;  5K0I A;  4CS8 C;  2R7R A;  3G50 A;  2OG2 A;  1TWC A;  3U0C A;  4Q5S F;  1M2V B;  3AQC A;  4H54 A;  3RF3 A;  3VRC A;  2XLH A;  2GA0 A;  2OCC C;  1M57 C;  2G3K A;  1G8X A;  3IQC A;  4EBK A;  2LD6 A;  4YT2 A;  3PHF 2;  2GFH A;  3KL4 A;  1SMY F;  2XLW A;  4WGZ A;  2ASR A;  3DD7 A;  3LS1 A;  3PMR A;  3T6G B;  1EA8 A;  2VAS A;  3GM1 A;  1JR8 A;  3RH3 A;  3SNH A;  4CS9 C;  2E87 A;  1LS4 A;  3VAY A;  5EHH A;  1T5O A;  5A6B A;  3G4Z A;  1JAF A;  1HW1 A;  2XSE A;  2OKU A;  3JYY A;  3CAX A;  4ZLD A;  3NMI A;  2Y3G A;  3CSK A;  3Q7L A;  1SF8 A;  5L0F A;  1VLS A;  4OIN F;  4DRJ B;  1TKN A;  2J0X A;  2W9Y A;  3LEV A;  1NBB A;  5JVE A;  2EIM C;  4BJ6 C;  3SXM A;  2J7P D;  3DE9 A;  1E86 A;  5A6B D;  1ZVZ A;  5D91 A;  4MW3 A;  2A69 F;  1I4Z A;  1ZU4 A;  3ABK C;  3EHM A;  1BR1 A;  2RSE B;  2XLM A;  3GOR A;  1Z3I X;  3H2U A;  4NQF A;  2HJ3 A;  1Z7Q c;  4Z9I A;  3US6 A;  1T6U A;  2QNL A;  2PF4 E;  3MFN A;  3L0I A;  2J0W A;  2WZG A;  3JSE O;  4YL3 A;  4DBR A;  1VTM P;  3EZH A;  1FR0 A;  2W4M A;  2A1D D;  3AGU A;  5T3T A;  2QLA A;  5L0H A;  3GOD A;  5KYU B;  3I4U A;  4G78 A;  3T9O A;  4EBJ A;  2L6F A;  3HLZ A;  4HE8 D;  3NG1 A;  5KYY A;  4IAO A;  1BBH A;  1OXK A;  2GDC A;  1OCZ C;  1KNY A;  1Q0M A;  4EWC A;  2LFD A;  4U5F E;  1D0Y A;  3U9M A;  1C17 M;  3AG1 C;  4JUR I;  4E0H A;  3U8P A;  5BUO A;  4MTO A;  1ZHX A;  4JEB A;  4PFP A;  1U89 A;  4IAR A;  3V5X A;  3RIP A;  3RQF A;  4X0R A;  4NTF A;  3NYJ A;  5FCL A;  2W45 A;  5JS5 A;  4ZLC A;  3C8G A;  3EGX B;  4IAQ A;  4EIY A;  2IYL D;  2W4B A;  5A6K A;  2HSQ A;  3MYI A;  3ZC4 A;  1W2W A;  4IB4 A;  1ZHT A;  3M4C A;  1CGO A;  2IXO A;  2KC3 A;  1LVK A;  1GQA A;  3U8V A;  3WG7 C;  3N0T A;  4BEJ A;  3EFO A;  4RD9 A;  1APC A;  1D1C A;  3DAF A;  2LQG A;  4NCQ A;  3S27 A;  4Q4Z F;  1FFT C;  4AE4 B;  1FMW A;  1D1B A;  3DJN B;  2LIG A;  2AWC A;  4U9E A;  1M6T A;  2G62 A;  1Q0F A;  5DS4 A;  2LK4 A;  3UR3 C;  2EIJ C;  1H9G A;  1OW7 A;  2VC9 A;  2Z15 A;  3HNJ A;  3LJB A;  4XLP F;  3FAP B;  2MYS A;  3G4X A;  1OQC A;  3U3F A;  4BEM J;  1O5H A;  3B0U X;  5B3I A;  1MND A;  3LUT B;  3DE8 A;  3SXY A;  3FMS A;  1GGQ A;  3H2V A;  4JEA A;  1OCO C;  1QZX A;  3OA1 A;  3FHD A;  1D1A A;  2HV7 A;  2YLI A;  2YKZ A;  3MBG A;  3U2L A;  4BJ5 C;  2EPO A;  4C3E A;  3I5Q A;  4BJ5 A;  2R03 A;  4BPM A;  3A11 A;  2B0J A;  3GWL A;  3R2P A;  1S7Z A;  2D4U A;  3UMH A;  2Q7R A;  3SEO A;  1UG7 A;  4JTD B;  1YLM A;  2J9W A;  2YL7 A;  3QVZ A;  3Q6M A;  1CGM E;  3AG4 C;  2Q4F A;  3IEE A;  3U2M A;  4EBB A;  2A0B A;  2J9V A;  4NY3 A;  4FAP B;  3EQL F;  3IQT A;  4Q7C A;  4WGY A;  1YVI A;  1NU7 D;  4HFF B;  3W2W A;  5AC5 A;  1IW7 F;  4U5D E;  1D0Z A;  4P6I C;  2FFH A;  1TFK B;  4OD4 A;  2KW3 C;  2HV6 A;  2J7P A;  2YHS A;  2EIK C;  4LDR A;  4U5E E;  3KPH A;  3TK0 A;  5EGY A;  3RYL A;  5CI9 A;  3VYW A;  1S05 A;  3K66 A;  3FVY A;  2A68 F;  1I4Y A;  1K05 A;  2AP3 A;  1EI7 A;  2WVO A;  3M79 A;  2M4E A;  4ULW A;  2M64 A;  4XEF A;  4NC3 A;  2V26 A;  2L7A A;  3TQO A;  4G7Z F;  2R9R B;  1OR2 A;  2X51 A;  2YQY A;  4J32 B;  5L3V A;  1Z6A A;  3KKB A;  4GEH A;  4D4N A;  3AQB A;  4ULV A;  3L1M A;  3F46 A;  4IJJ A;  1H9T A;  4XEV A;  2OOC A;  2UUH A;  3HNI A;  4MTF A;  2J46 A;  5B1B C;  5JUA A;  5KYY B;  4G7O F;  2DB4 A;  3N2Z B;  5AGF A;  1O3U A;  3FXH A;  4ER9 A;  5DS6 A;  2R7X A;  4NTA A;  2Q00 A;  2ZXW C;  3DM9 B;  3S90 A;  2CYD A;  2EPN A;  1QLE C;  2PX0 A;  2Y3B A;  1Q0D A;  1ZZP A;  4F4B A;  1ZHY A;  4AL1 A;  3VM6 A;  4JE9 A;  3JT1 A;  4GQH A;  2R7W A;  2R7S A;  4E18 A;  1A7E A;  1NZE A;  2XL8 A;  3NMK A;  1ORJ A;  256B A;  5BQG A;  2ZD9 A;  1SYQ A;  1QVX A;  3B0P A;  3AJM A;  2KQ9 A;  1RKE A;  3B9Q A;  3Q7G A;  4U5G A;  2QTV A;  3JRT A;  1VYI A;  4XQ1 A;  1LE4 A;  4JKV A;  4PJN A;  1OR3 A;  4EKW A;  3QMK A;  5E3C A;  1CPR A;  4JC7 A;  4LDQ A;  2PX3 A;  5DLJ A;  3DKA A;  3JTL O;  3L8J A;  4KNW A;  5JRA A;  5DQT A;  4YJW A;  4I3M A;  2MWQ A;  4JCZ A;  1YA7 O;  4U5B E;  1MQV A;  2OU6 A;  2PP4 A;  2OQM A;  3KYI A;  3LNM B;  5F28 E;  2GWW A;  1FTS A;  4RBN A;  3OWT A;  4W8P A;  4CIP A;  4N4W A;  3LS0 A;  2OEX A;  4ANJ A;  5DS5 A;  1NSG B;  1YDI A;  2PNO A;  4L6R A;  2ZPA A;  1OXB A;  1Q0G A;  3QW0 A;  1TQG A;  3T6B A;  5A6A A;  3PDM P;  4MVR A;  1HMO A;  3MX3 A;  2J9B A;  2DI3 A;  2BE5 F;  1OW8 A;  1VB5 A;  2NG1 A;  5L0I A;  2NPU A;  3LAY A;  2CGE A;  4JRZ A;  5F5H A;  2HUJ A;  3H65 A;  4LDK A;  3WOD F;  1C03 A;  2CW0 F;  3U9J A;  3GEI A;  3UMI A;  1RCP A;  4W8K A;  2LFF A;  1OKK A;  2BL2 A;  1V4A A;  4OIQ F;  4GYT A;  3IHU A;  2KK1 A;  5JLI A;  1J8M F;  3EGX A;  3S29 A;  4IWB A;  4OIO F;  1WOL A;  2XXA B;  5EK0 A;  1ORY A;  1I5N A;  1RJ9 B;  1WWP A;  5KYX A;  3VF0 A;  3ASN C;  2HKV A;  1VYK A;  1LPE A;  3DWW A;  3W4Y A;  4QI2 A;  3C8G B;  3K1I A;  1A0B A;  1MMG A;  3DMD A;  1LM3 B;  2YVK A;  3GAN A;  3K1I C;  3F47 A;  5KYW B;  4MVU A;  4BG0 A;  4E7Z A;  3LLK A;  2YLD A;  2YLG A;  3C8G D;  3ZTZ A;  4O6Y A;  3GM2 A;  1KU2 A;  4U5C E;  3DM5 A;  5FZT A;  1NU9 C;  2B0H A;  4YL0 A;  3KH2 A;  3SZR A;  3EG9 B;  3K6B A;  3NRH A;  5AC4 A;  5CI8 A;  3E9V A;  3NKE A;  2IXN A;  2L9J A;  5CIV A;  5KYW A;  3C18 A;  4WAB A;  3RKO F;  3ZQY A;  4DVY P;  2Q3T A;  3K33 A;  4PK4 A;  4YN0 B;  2VH3 A;  4CDA A;  3LLI A;  3W8H A;  2OEV A;  3LEO A;  3IQ5 A;  3W2V A;  4XEK A;  1QPU A;  3IPM O;  4DRH B;  3SXK A;  1YA9 A;  2Q9B A;  4UDV A;  1G4U S;  1A7V A;  1GM5 A;  3AG2 C;  1MMD A;  3EZI A;  3RW0 A;  4O79 A;  3L34 A;  2A6H F;  4M63 A;  4BJ6 A;  2H8A A;  2CDQ A;  2XM4 A;  3TOL A;  2PBE A;  3MYF A;  3EH2 A;  2NUT B;  2VB6 A;  4CIH A;  4R32 A;  2Q9A A;  3X2Q C;  1M2V A;  1XZQ A;  3ZTM A;  4CDY A;  4I44 A;  5KYN A;  1ORS C;  1RKE B;  4JTA B;  2L6H A;  4XPY A;  2HMZ A;  3T6J A;  1E84 A;  3A9C A;  4MVO A;  2C03 A;  1CPQ A;  4KBL A;  4OIR F;  1GS9 A;  1ZHW A;  4YT5 A;  4AX2 A;  3EH1 A;  3FOO A;  3ITF A;  4JZA A;  2NUT A;  3NMJ A;  3ZQV A;  3NDB B;  1N1C A;  4HEA J;  3I5P A;  4K7B A;  5T3W A;  2ETS A;  1G4W R;  2IXM A;  1DOW A;  3TOM A;  4OD5 A;  1FAP B;  1NLX A;  2XL4 A;  2ZXO A;  2CNW A;  3HTK C;  3HJC A;  4I1M A;  1F1M A;  2LP4 A;  4LAC B;  2R7V A;  1LIH A;  1AVO B;  3NKD A;  1RJ9 A;  3EPV A;  4J7T A;  4N6H A;  3ZWI A;  3K1H A;  5KYX B;  5COG A;  4CBE A;  1BZ4 A;  2DYS C;  1E83 A;  2L81 A;  2LCH A;  2D5R B;  2XLD A;  3AGT A;  3C63 A;  3FOP A;  2P7V A;  2VCA A;  3QW1 A;  5JSL A;  4EUK B;  2KYH A;  3CQZ A;  5HSW A;  4JJF A;  4DVZ A;  4C7O A;  1PCX A;  4LER A;  4XPW A;  2HJM A;  2Y3H A;  3JSZ A;  1YAR O;  3ABL C;  4AL0 A;  3DAG A;  2XS1 A;  3AG3 C;  4DJ9 A;  5A69 A;  4JVS A;  3JYH A;  1YYJ A;  2DGJ A;  2OJQ A;  3GEE A;  2Q9C A;  4D4X A;  2RD9 A;  2GAQ A;  4BJT A;  4DXW A;  4E0I A;  2EPM X;  2PFD A;  2FGY A;  2NUP A;  4JJG A;  3B0V C;  2EPK X;  2YL0 A;  4N6C A;  5BQH A;  4IRU A;  3RFY A;  2TMV P;  2NSG A;  4LLC A;  1TWA A;  4K0D A;  5IY5 C;  4MVQ A;  4A2N B;  5HV9 A;  4O7G A;  4CS9 A;  1JMW A;  3N24 A;  4XPX A;  1VMA A;  2VCB A;  3PCV A;  1V74 B;  1YYX A;  1TFO B;  1BDJ B;  1ZW3 A;  2R02 A;  5DVW A;  4CJG A;  2KNH A;  2WL8 A;  2O9X A;  3TD7 A; 
#chains in the Genus database with same CATH homology
 1ORY A;  1ORJ A;  3K1I A;  3IQC A;  1SZI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...