1ORJA

Flagellar export chaperone
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
126
structure length
126
Chain Sequence
RNIAEAYFQNMVETATPLEQIILLYDKAIECLERAIEIYDQVNELEKRKEFVENIDRVYDIISALKSFLDHEKGKEIAKNLDTIYTIILNTLVKVDKTKEELQKILEILKDLREAWEEVKKKVHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords flagellar protein FliS
publication title Similar modes of polypeptide recognition by export chaperones in flagellar biosynthesis and type III secretion
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Chaperone
total genus 57
structure length 126
sequence length 126
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2003-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02561 FliS Flagellar protein FliS
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.340 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Flagellar protein FliS 1orjA00
1SZIA 1ORJA 1ORYA 3IQCA 3K1IA
chains in the Genus database with same CATH superfamily
3E9VA 4PK4A 1CPQA 4JCZA 1ZHZA 1E85A 4LACB 1QSPA 3UR3C 1WOLA 4IARA 5GPGB 3ZTZA 4D4XA 3V7OA 3RFYA 3L8JA 4HEAJ 1AEPA 3VM6A 1RKEA 2IXNA 4HFFB 2C04A 2CCYA 5JSLA 3DJUB 1NBBA 3SXKA 3SYNA 1GM5A 2WZGA 4E17A 1WASA 1VLTA 2H7OA 1LPEA 2KYHA 3LESA 4CS8A 5AC4A 4IRUA 1I5NA 3W8IA 4XEVA 4JIOA 2FFHA 5E3CA 3V5XA 3ZC4A 4YL0A 2P1AA 4OINF 1FAPB 4JTDB 4XPXA 3GM2A 3SXZA 1V55C 2LP4A 3K33A 2YKZA 1H6GA 1PD0A 1VLSA 1WN0A 2OOCA 4MW3A 3FAPB 2ZXPA 1TR2A 2W45A 2X0CA 1YDIA 5KYXA 2WVNA 1OR3A 3QW1A 2PFDA 3QTHA 2HMQA 2A1DD 5COFA 3NKEA 4MTFA 3ZDLA 3ZVRA 2V3CC 4MVRA 4N6HA 4K7BA 3EGDB 4YT5A 5KYUB 2LSEA 1J8MF 1ZU5A 3Q7LA 4MVSA 4YWQA 4G7OF 4CDVA 2HV6A 2YLDA 3JYYA 3RH3A 5DS5A 3CEXA 4BPMA 5JP7A 4FESA 2MHRA 3C7JA 5A6BA 4U9DA 3JRTA 4DRJB 2XL8A 4MNDA 4LDKA 4U5GA 1QKRA 3V5YA 2WL8A 1RJ9A 2B0HA 2PP4A 1NU9C 4QI2A 4GEHA 1LI5A 4XPYA 3ZIBA 1K40A 3LS1A 1JRAA 1BR4A 4MVOA 2C03A 4I1OB 4DBQA 2CNWD 1LE4A 3FXHA 3PMRA 2IXMA 2R7VA 3M4CA 2EPMX 3H65A 1GQAA 3HJCA 5B1BC 3RF3A 5E3AA 2L6GA 1Z5ZA 5IY5C 4JEAA 4J32B 1Z7Qc 2YL3A 2A69F 4J30B 2VH3A 1C17M 3DI5A 1Z3IX 4G78A 2GWWA 2YL0A 4OD5A 4CS9C 1TFOB 1TQGA 1NFNA 4A2NB 4E7ZA 4XWJA 1OCZC 4O6YA 2EIJC 3EGXA 2CW0F 3T9OA 3AG2C 3PDMP 2R7QA 2WZLA 4WABA 4JURI 4A4AA 2R7XA 3EQLF 3MX3A 3B0PA 4PJJA 4CIHA 1FFTC 2B0JA 4JRZA 2VC9A 1B68A 2NUPB 3MBGA 5CIVA 1E86A 3LEOA 4UDVA 4MQ9F 3QW0A 1E84A 3GORA 4W8KA 2ICWG 1YA9A 2L9JA 2PX3A 2J9UA 1U89A 3ASNC 4Q4ZF 1EQ1A 4OD4A 1FMVA 1F1MA 1D0YA 3LEVA 2EPOA 4R32A 3EG9A 5F5HA 4U9EA 3OEOA 3T4RA 4NC3A 2OU6A 1TWHA 1Q0MA 2Y3BA 4LLEA 4RBNA 3FAJA 2EIMC 3LJBA 4HFKB 1MQVA 1OCRC 2H7VC 3HNJA 1JPJA 2UUIA 4YK5A 3U9JA 4BEMJ 1JAFA 1ZU4A 2LD6A 2J45A 1V74B 2XS8A 2ZPAA 2J46A 3A11A 2UUHA 1MNDA 4JTAB 1KNYA 4FX5A 2WVOA 4YL3A 5BQIA 5HSWA 2BE5F 2H8AA 3SP1A 2KW3C 3M15A 1WWPA 4ZLDA 4U5BE 2HUJA 3JZ0A 4WGYA 2HMZA 5KYNA 2R02A 2W9YA 3AGTA 1OW7A 2AWYA 3NG1A 1YVIA 2XLMA 1LE2A 1SR2A 2A6EF 3WAQA 3K6BA 3ABLC 1RXQA 4U5EE 3B0UX 3N24A 3C8GD 1OKKD 2P0NA 3PCVA 4IWBA 1MMNA 3NMJA 3BRJA 1ZHYA 1YJGA 2R03A 3ABMC 2J9VA 2ZXRA 2ZXOA 3DAGA 3CQZA 3MFNA 3U8PA 3H2UA 4OIPF 3TD7A 3NDBB 2ETSA 3L8IA 3EJNA 2J9WA 1OR2A 1SMYF 3ZQYA 1RKEB 2A0BA 2NUTA 1JR8A 2IXOA 1XZQA 2XSEA 3AG1C 4IB4A 2FGYA 2QE9A 1TKNA 3GANA 3S29A 4C3BA 1T6IA 3CSKA 4IAQA 1VYKA 1DOVA 1OXKA 4ULVA 1ZHXA 3DE9A 4I3MA 3IQ6A 4PJMA 3TOMA 4EBBA 2YLGA 2MWQA 2WVQA 2VCAA 1MMAA 3GEEA 4IGGA 2LQGA 3AG3C 1Q0FA 1Q0GA 5COGA 2LCHA 1Y4CA 4H4KC 4KNVA 3US6A 5DQTA 1M6TA 4XLNF 4WJ0A 1FTSA 4DBRA 3KH2A 3DJNB 2E87A 3NRHA 4AX2A 4PACA 3QZCA 1ORJA 3DMDA 4XLPF 1HE1A 3U3FA 3LUTB 2XLHA 1YAUO 4OIQF 3I5PA 5BQGA 1D0XA 2J0WA 1ZW3A 1IW7F 3EH2A 1M56C 4JVSA 2EINC 3NYMA 3JYHA 4DXWA 3AQBA 4YL1A 3Q6MA 3TJ6A 2XLWA 3S0XA 2LFDA 3MYIA 3JSEO 2Y3GA 4HE8D 3U9MA 5BUOA 1U6HA 1FFHA 4N06A 3DZAA 3JTLO 2D5RB 3SXMA 3TOLA 5BQHA 2NG1A 3RVYA 3B0VC 1YYXA 1LS4A 3GM1A 4O6NA 2I8BA 2JX0A 3DM9B 1SZIA 1SYQA 4JW1A 5COMA 4YT4A 3LAYA 1YLMA 2TMVP 3EH1A 5EHHA 4MVZA 4BJ6C 2YQYA 1NFOA 4F4BA 3LLKA 4AE4A 1LI7A 2VB6A 3LNRA 4MTGA 1RMVA 3C8GA 1OKKA 4N4WA 4NTFA 4DVZA 1Y6DA 4W8PA 3LNMB 4BJTA 4CSAC 1NU7D 5L3QA 3E70C 1T01A 1BDJB 2W4BA 3AG4C 2Q4FA 1JPNA 1CPRA 2J0XA 4XEFA 1PD1A 3TK0A 3X1OA 4EBKA 4OIOF 1OXBA 2I15A 1CGNA 3DD7A 4G0HA 5L0FA 3R2PA 4P6IC 2PBEA 1E83A 4DOZA 5B3SC 3FDQA 4I1MA 4QDLA 1Q0DA 1R4TA 3AJMA 2XXAA 1UG7A 1VMAA 3DE8A 3SEOA 3VYWA 2HKVA 4C7OB 1KTMA 4EBJA 3IQTA 3EGXB 1DOWA 3KL4A 4ZLCA 5A6AA 5L3VA 4E18A 4LDRA 2PNOA 1OQCA 3C62A 4JCHA 4YJWA 3UMKA 5KYWB 1OW8A 1WATA 2OQMA 3DWWA 3K1IC 4XQ1A 5FCLA 4PJNA 2KJGA 3AQCA 1YZCA 4PJLA 3C8ZA 3HNLA 3S90A 2G3VA 4KI2A 4Z9JA 5FZTA 4LDQA 1PV3A 4CS9A 1O87A 2CGEA 3KYJA 3FHDA 3ZSUA 1CGME 2PX0A 3DM5A 1C02A 1JMWA 2O9XA 4BJ5C 2LK4A 3JRMO 4MVQA 3Q6NA 3EG9B 3ZWIA 2HSQA 2KC3A 1LKXA 1NSGB 4JEBA 3U8VA 2YL7A 2OJED 2RD9A 2IXPA 1Z6AA 2JD3A 2XL6A 3FMSA 1O3UA 1L7CA 1S05A 1W2WA 2OJQA 3MLGA 2XLDA 4GQHA 2P61A 4IJJA 3G50A 1I4YA 1T6QA 1V4AA 3AOUA 4IAOA 5F28E 4DJ9A 3S9OA 2BL2A 3C63A 3F46A 1XZPA 1YYJA 3IHUA 1CGOA 1A41A 2J7PD 2XRHA 1TWGA 3K7DA 4X0RA 2FAPB 3JT1A 2L7AA 2R7SA 1A7VA 4DVYP 5TJ5E 1GGQA 4U5HA 3L34A 1FNTc 5D91A 3Q7GA 1HE9A 1LIHA 2IYLD 3T6JA 1A7DA 4WGZA 3O6XA 5KYYA 4N6CA 2R7UA 2KSFA 2QNLA 2R7TA 3WODF 2VASA 4LLCA 1G4WR 4JJGA 1ORSC 1LM3B 1EA8A 2XLEA 3N0TA 2LFFA 4YT8A 5L0IA 2HSBA 1APCA 2YVKA 3EZHA 4Q5SF 1G8XA 2ASRA 2NUTB 2OEVA 1HMDA 3ITFA 2GFHA 2EPKX 2IOQA 4ER9A 2Q7RA 3HTKC 3K1HA 1VYIA 3SXYA 5A6JA 5JRAA 1D1CA 1K05A 1QLEC 1VOMA 5HV9A 1TFKB 4EUKB 3G4XA 3RVZA 1QZXA 1M2VA 1ZVZA 2A6HF 3UMHA 3UMIA 5JT4A 2Q9BA 3EFOA 3HNKA 4Q7CA 3H2VA 1ZW2A 1A7EA 4O79A 5T3WA 2J9BA 3PHF2 2WZFA 3VF0A 3B71A 3RYLA 3K66A 2A0UA 3DKAA 3C18A 4BJ1A 1RKCA 4CBEA 1D0ZA 5K0IA 3NYJA 5JVEA 3N2ZB 2RSEB 4MVUA 2YHSA 4B6IA 1VTMP 2CYDA 2QTVA 4RDAA 1HY5A 3RQEA 3FOPA 4AL1A 5A69A 1OW6A 1QQ3A 1OCCC 4MTOA 5DQZA 3GEHA 2V26A 1GS9A 3GODA 4PFPA 1NLXA 2ZD9A 256BA 1D1AA 1YZAA 4MVMA 4RD9A 4EIYA 3JSZA 3V5ZA 3EZIA 1HW2A 2AU5A 1C03A 2J7PA 2Y3DA 2YL1A 3T6BA 3WG7C 4Z9IA 2X51A 1Z63A 1XWJA 2MYSA 1JOGA 1G4US 3G4ZA 4JJFA 1M2OA 1LVKA 1YA7O 4ANJA 5KYXB 2L6FA 2OCCC 1BZ4A 2Y3HA 4CX9A 2IBFA 3UNGC 2QY9A 3W4YA 2HS5A 1VB5A 1N1CA 3HLZA 2Q3TA 3C8GB 3GEIA 5JS5A 1ZZPA 3KYIA 4NTAA 3NKDA 4P9TA 1TWCA 5CI9A 2YRFA 1R5ID 1TWAA 3O10A 4CS7A 2M4EA 2KQ9A 5EGYA 1AUEA 1HMOA 2Q00A 1S7ZA 3OA1A 4FWVA 3IQ5A 3JCUQ 5L0CA 2JPUA 3POVA 1RJ9B 3I5QA 1YARO 1ORYA 2NPUA 4O7GA 4BJ6A 4CIPA 2XL4A 2DI3A 2H7BA 4M63A 4CS8C 3EHNA 2XXAB 2Z15A 2XLOA 3ABKC 4D4NA 4CDYA 4EWCA 2OEXA 2HZ8A 3CAXA 4CSAA 5E33A 1V54C 4JC7A 4NQFA 4H54A 2R25A 3FVYA 3I4UA 2DB4A 1QVXA 3UGPA 5L0JA 1K04A 4EKWA 3S27A 5T1DB 3IEEA 3U2LA 4E0IA 3CZ6A 3FOOA 5B1AC 3VRCA 4I44A 1T5OA 4ONSA 3NYLA 3LLIA 2ZXWC 2CDQA 4PR9A 2Y39A 2W4MA 4NY3A 1NG1A 2YLIA 2NSGA 3T6GB 5JLIA 3IQCA 3K1IA 1WTYA 1EI7A 2XM4A 3ECSA 4LERA 3M79A 2XM0A 2F22A 2KK1A 5F5FA 4JTCB 3TQOA 1ST6A 1VK5A 2EPLX 4MW8A 2IM8A 3RQFA 4MS2A 2A68F 5T3TA 4G7HF 2HV7A 3KKBA 2AP3A 3QMKA 4OIRF 4BJ5A 1OCOC 5AGFA 2KNHA 4U5DE 1ZYRF 4U5CE 2DYRC 1BR2A 1WGWA 4BEJA 4CJGA 2DGJA 2P7VA 2M64A 3EGDA 4JE9A 1KU2A 5KYUA 3GM3A 2XLVA 3A9CA 1SF8A 2R7OA 1J8YF 5B3IA 3UGOA 1M57C 4KNWA 3L0IA 2R05A 4KBLA 3HNIA 2Q9AA 3B9QA 2NSFA 3S28A 5KYYB 2AWCA 3J06A 2R9RB 4QI0A 1FMWA 2G3KA 2Y69C 3SZRA 4E0HA 5AC5A 3BEHA 4XEKA 4JZAA 1H9TA 3RW0A 4CJOA 2J8WA 3W8HA 4L6RA 3SNHA 3IPMO 2GDCA 2GAQA 4G7ZF 5A6KA 5EK0A 2OKUA 3AGUA 3X2QC 4C7OA 1U0BB 3HKKA 4XTKA 5L0HA 3VAYA 2VCCA 2EIKC 2L6HA 4J7TA 1BBHA 5KYWA 3ZTMA 3O55A 1D1BA 5DLJA 5L0DA 2QUPA 2HJMA 1M2VB 4CDAA 4YN0B 4EHPA 4U5FE 3EFOB 3R7CA 2G62A 3KPHA 1EKYA 2YEVA 1T6UA 2YZSA 1MNEA 3MYFA 4NCQA 3EPVA 2D4UA 3B29A 3U5SA 3M1CB 4KC9A 3U2MA 1UFBA 1QPUA 2VCBA 2YWAA 4BG0A 1L3PA 5L0GA 4P9FA 5JUAA 5D92A 1PCXA 1RCPA 2AVKA 3EHMA 3ASOC 3DAFA 1IZMA 1LS1A 3NMIA 2QLAA 4GYTA 3ZQVA 5E2QA 4C3EA 4YT2A 1T9KA 4K0DA 3U3BA 1BR1A 1NZEA 2XS1A 2HJ3A 4DRHB 1Q0KA 2NUPA 5DVWA 3QVYA 3W2VA 1H9GA 1I4ZA 3L1MA 2R7RA 5CI8A 3QVZA 4K1OA 3F47A 2OG2A 4C3DA 1ZHWA 3LS0A 2PF4E 3RKOF 1G5ZA 1MMDA 4NTBA 3WHNA 3U0CA 1E2XA 2CNWA 2BC5A 2WB7A 3ZG1A 3S84A 2EILC 2R7WA 1MMGA 4JKVA 4AK9A 2EPNA 4XPWA 2Q9CA 3GWLA 4FAPB 2DYSC 5DS6A 1FR0A 1Z23A 3TULA 4PFOA 1ZHTA 4Z9HA 4ULWA 1HW1A 2KGOA 1AVOB 2LIGA 2GA0A 3TJ5A 2L81A 4E7SA 3KMIA 5DS4A 2HFIA 5A6BD 3DXJF 3O39A 4J7YA 3RIPA 4DRIB 3M4BA 3GWNA 2P6VA 3OWTA 3ATPA 4O6MA 3W2WA 1H7IA 4AL0A 1A0BA 3NMKA 1O5HA 3RQGA 4AE4B
chains in the Genus database with same CATH topology
1SZIA 1ORJA 1ORYA 3IQCA 3K1IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SZI A;  1ORJ A;  1ORY A;  3IQC A;  3K1I A; 
#chains in the Genus database with same CATH topology
 3E9V A;  4PK4 A;  1CPQ A;  4JCZ A;  1ZHZ A;  1E85 A;  4LAC B;  1QSP A;  3UR3 C;  1WOL A;  4IAR A;  5GPG B;  3ZTZ A;  4D4X A;  3V7O A;  3RFY A;  3L8J A;  4HEA J;  1AEP A;  3VM6 A;  1RKE A;  2IXN A;  4HFF B;  2C04 A;  2CCY A;  5JSL A;  3DJU B;  1NBB A;  3SXK A;  3SYN A;  1GM5 A;  2WZG A;  4E17 A;  1WAS A;  1VLT A;  2H7O A;  1LPE A;  2KYH A;  3LES A;  4CS8 A;  5AC4 A;  4IRU A;  1I5N A;  3W8I A;  4XEV A;  4JIO A;  2FFH A;  5E3C A;  3V5X A;  3ZC4 A;  4YL0 A;  2P1A A;  4OIN F;  1FAP B;  4JTD B;  4XPX A;  3GM2 A;  3SXZ A;  1V55 C;  2LP4 A;  3K33 A;  2YKZ A;  1H6G A;  1PD0 A;  1VLS A;  1WN0 A;  2OOC A;  4MW3 A;  3FAP B;  2ZXP A;  1TR2 A;  2W45 A;  2X0C A;  1YDI A;  5KYX A;  2WVN A;  1OR3 A;  3QW1 A;  2PFD A;  3QTH A;  2HMQ A;  2A1D D;  5COF A;  3NKE A;  4MTF A;  3ZDL A;  3ZVR A;  2V3C C;  4MVR A;  4N6H A;  4K7B A;  3EGD B;  4YT5 A;  5KYU B;  2LSE A;  1J8M F;  1ZU5 A;  3Q7L A;  4MVS A;  4YWQ A;  4G7O F;  4CDV A;  2HV6 A;  2YLD A;  3JYY A;  3RH3 A;  5DS5 A;  3CEX A;  4BPM A;  5JP7 A;  4FES A;  2MHR A;  3C7J A;  5A6B A;  4U9D A;  3JRT A;  4DRJ B;  2XL8 A;  4MND A;  4LDK A;  4U5G A;  1QKR A;  3V5Y A;  2WL8 A;  1RJ9 A;  2B0H A;  2PP4 A;  1NU9 C;  4QI2 A;  4GEH A;  1LI5 A;  4XPY A;  3ZIB A;  1K40 A;  3LS1 A;  1JRA A;  1BR4 A;  4MVO A;  2C03 A;  4I1O B;  4DBQ A;  2CNW D;  1LE4 A;  3FXH A;  3PMR A;  2IXM A;  2R7V A;  3M4C A;  2EPM X;  3H65 A;  1GQA A;  3HJC A;  5B1B C;  3RF3 A;  5E3A A;  2L6G A;  1Z5Z A;  5IY5 C;  4JEA A;  4J32 B;  1Z7Q c;  2YL3 A;  2A69 F;  4J30 B;  2VH3 A;  1C17 M;  3DI5 A;  1Z3I X;  4G78 A;  2GWW A;  2YL0 A;  4OD5 A;  4CS9 C;  1TFO B;  1TQG A;  1NFN A;  4A2N B;  4E7Z A;  4XWJ A;  1OCZ C;  4O6Y A;  2EIJ C;  3EGX A;  2CW0 F;  3T9O A;  3AG2 C;  3PDM P;  2R7Q A;  2WZL A;  4WAB A;  4JUR I;  4A4A A;  2R7X A;  3EQL F;  3MX3 A;  3B0P A;  4PJJ A;  4CIH A;  1FFT C;  2B0J A;  4JRZ A;  2VC9 A;  1B68 A;  2NUP B;  3MBG A;  5CIV A;  1E86 A;  3LEO A;  4UDV A;  4MQ9 F;  3QW0 A;  1E84 A;  3GOR A;  4W8K A;  2ICW G;  1YA9 A;  2L9J A;  2PX3 A;  2J9U A;  1U89 A;  3ASN C;  4Q4Z F;  1EQ1 A;  4OD4 A;  1FMV A;  1F1M A;  1D0Y A;  3LEV A;  2EPO A;  4R32 A;  3EG9 A;  5F5H A;  4U9E A;  3OEO A;  3T4R A;  4NC3 A;  2OU6 A;  1TWH A;  1Q0M A;  2Y3B A;  4LLE A;  4RBN A;  3FAJ A;  2EIM C;  3LJB A;  4HFK B;  1MQV A;  1OCR C;  2H7V C;  3HNJ A;  1JPJ A;  2UUI A;  4YK5 A;  3U9J A;  4BEM J;  1JAF A;  1ZU4 A;  2LD6 A;  2J45 A;  1V74 B;  2XS8 A;  2ZPA A;  2J46 A;  3A11 A;  2UUH A;  1MND A;  4JTA B;  1KNY A;  4FX5 A;  2WVO A;  4YL3 A;  5BQI A;  5HSW A;  2BE5 F;  2H8A A;  3SP1 A;  2KW3 C;  3M15 A;  1WWP A;  4ZLD A;  4U5B E;  2HUJ A;  3JZ0 A;  4WGY A;  2HMZ A;  5KYN A;  2R02 A;  2W9Y A;  3AGT A;  1OW7 A;  2AWY A;  3NG1 A;  1YVI A;  2XLM A;  1LE2 A;  1SR2 A;  2A6E F;  3WAQ A;  3K6B A;  3ABL C;  1RXQ A;  4U5E E;  3B0U X;  3N24 A;  3C8G D;  1OKK D;  2P0N A;  3PCV A;  4IWB A;  1MMN A;  3NMJ A;  3BRJ A;  1ZHY A;  1YJG A;  2R03 A;  3ABM C;  2J9V A;  2ZXR A;  2ZXO A;  3DAG A;  3CQZ A;  3MFN A;  3U8P A;  3H2U A;  4OIP F;  3TD7 A;  3NDB B;  2ETS A;  3L8I A;  3EJN A;  2J9W A;  1OR2 A;  1SMY F;  3ZQY A;  1RKE B;  2A0B A;  2NUT A;  1JR8 A;  2IXO A;  1XZQ A;  2XSE A;  3AG1 C;  4IB4 A;  2FGY A;  2QE9 A;  1TKN A;  3GAN A;  3S29 A;  4C3B A;  1T6I A;  3CSK A;  4IAQ A;  1VYK A;  1DOV A;  1OXK A;  4ULV A;  1ZHX A;  3DE9 A;  4I3M A;  3IQ6 A;  4PJM A;  3TOM A;  4EBB A;  2YLG A;  2MWQ A;  2WVQ A;  2VCA A;  1MMA A;  3GEE A;  4IGG A;  2LQG A;  3AG3 C;  1Q0F A;  1Q0G A;  5COG A;  2LCH A;  1Y4C A;  4H4K C;  4KNV A;  3US6 A;  5DQT A;  1M6T A;  4XLN F;  4WJ0 A;  1FTS A;  4DBR A;  3KH2 A;  3DJN B;  2E87 A;  3NRH A;  4AX2 A;  4PAC A;  3QZC A;  1ORJ A;  3DMD A;  4XLP F;  1HE1 A;  3U3F A;  3LUT B;  2XLH A;  1YAU O;  4OIQ F;  3I5P A;  5BQG A;  1D0X A;  2J0W A;  1ZW3 A;  1IW7 F;  3EH2 A;  1M56 C;  4JVS A;  2EIN C;  3NYM A;  3JYH A;  4DXW A;  3AQB A;  4YL1 A;  3Q6M A;  3TJ6 A;  2XLW A;  3S0X A;  2LFD A;  3MYI A;  3JSE O;  2Y3G A;  4HE8 D;  3U9M A;  5BUO A;  1U6H A;  1FFH A;  4N06 A;  3DZA A;  3JTL O;  2D5R B;  3SXM A;  3TOL A;  5BQH A;  2NG1 A;  3RVY A;  3B0V C;  1YYX A;  1LS4 A;  3GM1 A;  4O6N A;  2I8B A;  2JX0 A;  3DM9 B;  1SZI A;  1SYQ A;  4JW1 A;  5COM A;  4YT4 A;  3LAY A;  1YLM A;  2TMV P;  3EH1 A;  5EHH A;  4MVZ A;  4BJ6 C;  2YQY A;  1NFO A;  4F4B A;  3LLK A;  4AE4 A;  1LI7 A;  2VB6 A;  3LNR A;  4MTG A;  1RMV A;  3C8G A;  1OKK A;  4N4W A;  4NTF A;  4DVZ A;  1Y6D A;  4W8P A;  3LNM B;  4BJT A;  4CSA C;  1NU7 D;  5L3Q A;  3E70 C;  1T01 A;  1BDJ B;  2W4B A;  3AG4 C;  2Q4F A;  1JPN A;  1CPR A;  2J0X A;  4XEF A;  1PD1 A;  3TK0 A;  3X1O A;  4EBK A;  4OIO F;  1OXB A;  2I15 A;  1CGN A;  3DD7 A;  4G0H A;  5L0F A;  3R2P A;  4P6I C;  2PBE A;  1E83 A;  4DOZ A;  5B3S C;  3FDQ A;  4I1M A;  4QDL A;  1Q0D A;  1R4T A;  3AJM A;  2XXA A;  1UG7 A;  1VMA A;  3DE8 A;  3SEO A;  3VYW A;  2HKV A;  4C7O B;  1KTM A;  4EBJ A;  3IQT A;  3EGX B;  1DOW A;  3KL4 A;  4ZLC A;  5A6A A;  5L3V A;  4E18 A;  4LDR A;  2PNO A;  1OQC A;  3C62 A;  4JCH A;  4YJW A;  3UMK A;  5KYW B;  1OW8 A;  1WAT A;  2OQM A;  3DWW A;  3K1I C;  4XQ1 A;  5FCL A;  4PJN A;  2KJG A;  3AQC A;  1YZC A;  4PJL A;  3C8Z A;  3HNL A;  3S90 A;  2G3V A;  4KI2 A;  4Z9J A;  5FZT A;  4LDQ A;  1PV3 A;  4CS9 A;  1O87 A;  2CGE A;  3KYJ A;  3FHD A;  3ZSU A;  1CGM E;  2PX0 A;  3DM5 A;  1C02 A;  1JMW A;  2O9X A;  4BJ5 C;  2LK4 A;  3JRM O;  4MVQ A;  3Q6N A;  3EG9 B;  3ZWI A;  2HSQ A;  2KC3 A;  1LKX A;  1NSG B;  4JEB A;  3U8V A;  2YL7 A;  2OJE D;  2RD9 A;  2IXP A;  1Z6A A;  2JD3 A;  2XL6 A;  3FMS A;  1O3U A;  1L7C A;  1S05 A;  1W2W A;  2OJQ A;  3MLG A;  2XLD A;  4GQH A;  2P61 A;  4IJJ A;  3G50 A;  1I4Y A;  1T6Q A;  1V4A A;  3AOU A;  4IAO A;  5F28 E;  4DJ9 A;  3S9O A;  2BL2 A;  3C63 A;  3F46 A;  1XZP A;  1YYJ A;  3IHU A;  1CGO A;  1A41 A;  2J7P D;  2XRH A;  1TWG A;  3K7D A;  4X0R A;  2FAP B;  3JT1 A;  2L7A A;  2R7S A;  1A7V A;  4DVY P;  5TJ5 E;  1GGQ A;  4U5H A;  3L34 A;  1FNT c;  5D91 A;  3Q7G A;  1HE9 A;  1LIH A;  2IYL D;  3T6J A;  1A7D A;  4WGZ A;  3O6X A;  5KYY A;  4N6C A;  2R7U A;  2KSF A;  2QNL A;  2R7T A;  3WOD F;  2VAS A;  4LLC A;  1G4W R;  4JJG A;  1ORS C;  1LM3 B;  1EA8 A;  2XLE A;  3N0T A;  2LFF A;  4YT8 A;  5L0I A;  2HSB A;  1APC A;  2YVK A;  3EZH A;  4Q5S F;  1G8X A;  2ASR A;  2NUT B;  2OEV A;  1HMD A;  3ITF A;  2GFH A;  2EPK X;  2IOQ A;  4ER9 A;  2Q7R A;  3HTK C;  3K1H A;  1VYI A;  3SXY A;  5A6J A;  5JRA A;  1D1C A;  1K05 A;  1QLE C;  1VOM A;  5HV9 A;  1TFK B;  4EUK B;  3G4X A;  3RVZ A;  1QZX A;  1M2V A;  1ZVZ A;  2A6H F;  3UMH A;  3UMI A;  5JT4 A;  2Q9B A;  3EFO A;  3HNK A;  4Q7C A;  3H2V A;  1ZW2 A;  1A7E A;  4O79 A;  5T3W A;  2J9B A;  3PHF 2;  2WZF A;  3VF0 A;  3B71 A;  3RYL A;  3K66 A;  2A0U A;  3DKA A;  3C18 A;  4BJ1 A;  1RKC A;  4CBE A;  1D0Z A;  5K0I A;  3NYJ A;  5JVE A;  3N2Z B;  2RSE B;  4MVU A;  2YHS A;  4B6I A;  1VTM P;  2CYD A;  2QTV A;  4RDA A;  1HY5 A;  3RQE A;  3FOP A;  4AL1 A;  5A69 A;  1OW6 A;  1QQ3 A;  1OCC C;  4MTO A;  5DQZ A;  3GEH A;  2V26 A;  1GS9 A;  3GOD A;  4PFP A;  1NLX A;  2ZD9 A;  256B A;  1D1A A;  1YZA A;  4MVM A;  4RD9 A;  4EIY A;  3JSZ A;  3V5Z A;  3EZI A;  1HW2 A;  2AU5 A;  1C03 A;  2J7P A;  2Y3D A;  2YL1 A;  3T6B A;  3WG7 C;  4Z9I A;  2X51 A;  1Z63 A;  1XWJ A;  2MYS A;  1JOG A;  1G4U S;  3G4Z A;  4JJF A;  1M2O A;  1LVK A;  1YA7 O;  4ANJ A;  5KYX B;  2L6F A;  2OCC C;  1BZ4 A;  2Y3H A;  4CX9 A;  2IBF A;  3UNG C;  2QY9 A;  3W4Y A;  2HS5 A;  1VB5 A;  1N1C A;  3HLZ A;  2Q3T A;  3C8G B;  3GEI A;  5JS5 A;  1ZZP A;  3KYI A;  4NTA A;  3NKD A;  4P9T A;  1TWC A;  5CI9 A;  2YRF A;  1R5I D;  1TWA A;  3O10 A;  4CS7 A;  2M4E A;  2KQ9 A;  5EGY A;  1AUE A;  1HMO A;  2Q00 A;  1S7Z A;  3OA1 A;  4FWV A;  3IQ5 A;  3JCU Q;  5L0C A;  2JPU A;  3POV A;  1RJ9 B;  3I5Q A;  1YAR O;  1ORY A;  2NPU A;  4O7G A;  4BJ6 A;  4CIP A;  2XL4 A;  2DI3 A;  2H7B A;  4M63 A;  4CS8 C;  3EHN A;  2XXA B;  2Z15 A;  2XLO A;  3ABK C;  4D4N A;  4CDY A;  4EWC A;  2OEX A;  2HZ8 A;  3CAX A;  4CSA A;  5E33 A;  1V54 C;  4JC7 A;  4NQF A;  4H54 A;  2R25 A;  3FVY A;  3I4U A;  2DB4 A;  1QVX A;  3UGP A;  5L0J A;  1K04 A;  4EKW A;  3S27 A;  5T1D B;  3IEE A;  3U2L A;  4E0I A;  3CZ6 A;  3FOO A;  5B1A C;  3VRC A;  4I44 A;  1T5O A;  4ONS A;  3NYL A;  3LLI A;  2ZXW C;  2CDQ A;  4PR9 A;  2Y39 A;  2W4M A;  4NY3 A;  1NG1 A;  2YLI A;  2NSG A;  3T6G B;  5JLI A;  3IQC A;  3K1I A;  1WTY A;  1EI7 A;  2XM4 A;  3ECS A;  4LER A;  3M79 A;  2XM0 A;  2F22 A;  2KK1 A;  5F5F A;  4JTC B;  3TQO A;  1ST6 A;  1VK5 A;  2EPL X;  4MW8 A;  2IM8 A;  3RQF A;  4MS2 A;  2A68 F;  5T3T A;  4G7H F;  2HV7 A;  3KKB A;  2AP3 A;  3QMK A;  4OIR F;  4BJ5 A;  1OCO C;  5AGF A;  2KNH A;  4U5D E;  1ZYR F;  4U5C E;  2DYR C;  1BR2 A;  1WGW A;  4BEJ A;  4CJG A;  2DGJ A;  2P7V A;  2M64 A;  3EGD A;  4JE9 A;  1KU2 A;  5KYU A;  3GM3 A;  2XLV A;  3A9C A;  1SF8 A;  2R7O A;  1J8Y F;  5B3I A;  3UGO A;  1M57 C;  4KNW A;  3L0I A;  2R05 A;  4KBL A;  3HNI A;  2Q9A A;  3B9Q A;  2NSF A;  3S28 A;  5KYY B;  2AWC A;  3J06 A;  2R9R B;  4QI0 A;  1FMW A;  2G3K A;  2Y69 C;  3SZR A;  4E0H A;  5AC5 A;  3BEH A;  4XEK A;  4JZA A;  1H9T A;  3RW0 A;  4CJO A;  2J8W A;  3W8H A;  4L6R A;  3SNH A;  3IPM O;  2GDC A;  2GAQ A;  4G7Z F;  5A6K A;  5EK0 A;  2OKU A;  3AGU A;  3X2Q C;  4C7O A;  1U0B B;  3HKK A;  4XTK A;  5L0H A;  3VAY A;  2VCC A;  2EIK C;  2L6H A;  4J7T A;  1BBH A;  5KYW A;  3ZTM A;  3O55 A;  1D1B A;  5DLJ A;  5L0D A;  2QUP A;  2HJM A;  1M2V B;  4CDA A;  4YN0 B;  4EHP A;  4U5F E;  3EFO B;  3R7C A;  2G62 A;  3KPH A;  1EKY A;  2YEV A;  1T6U A;  2YZS A;  1MNE A;  3MYF A;  4NCQ A;  3EPV A;  2D4U A;  3B29 A;  3U5S A;  3M1C B;  4KC9 A;  3U2M A;  1UFB A;  1QPU A;  2VCB A;  2YWA A;  4BG0 A;  1L3P A;  5L0G A;  4P9F A;  5JUA A;  5D92 A;  1PCX A;  1RCP A;  2AVK A;  3EHM A;  3ASO C;  3DAF A;  1IZM A;  1LS1 A;  3NMI A;  2QLA A;  4GYT A;  3ZQV A;  5E2Q A;  4C3E A;  4YT2 A;  1T9K A;  4K0D A;  3U3B A;  1BR1 A;  1NZE A;  2XS1 A;  2HJ3 A;  4DRH B;  1Q0K A;  2NUP A;  5DVW A;  3QVY A;  3W2V A;  1H9G A;  1I4Z A;  3L1M A;  2R7R A;  5CI8 A;  3QVZ A;  4K1O A;  3F47 A;  2OG2 A;  4C3D A;  1ZHW A;  3LS0 A;  2PF4 E;  3RKO F;  1G5Z A;  1MMD A;  4NTB A;  3WHN A;  3U0C A;  1E2X A;  2CNW A;  2BC5 A;  2WB7 A;  3ZG1 A;  3S84 A;  2EIL C;  2R7W A;  1MMG A;  4JKV A;  4AK9 A;  2EPN A;  4XPW A;  2Q9C A;  3GWL A;  4FAP B;  2DYS C;  5DS6 A;  1FR0 A;  1Z23 A;  3TUL A;  4PFO A;  1ZHT A;  4Z9H A;  4ULW A;  1HW1 A;  2KGO A;  1AVO B;  2LIG A;  2GA0 A;  3TJ5 A;  2L81 A;  4E7S A;  3KMI A;  5DS4 A;  2HFI A;  5A6B D;  3DXJ F;  3O39 A;  4J7Y A;  3RIP A;  4DRI B;  3M4B A;  3GWN A;  2P6V A;  3OWT A;  3ATP A;  4O6M A;  3W2W A;  1H7I A;  4AL0 A;  1A0B A;  3NMK A;  1O5H A;  3RQG A;  4AE4 B; 
#chains in the Genus database with same CATH homology
 1SZI A;  1ORJ A;  1ORY A;  3IQC A;  3K1I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...