1ORJA

Flagellar export chaperone
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
126
structure length
126
Chain Sequence
RNIAEAYFQNMVETATPLEQIILLYDKAIECLERAIEIYDQVNELEKRKEFVENIDRVYDIISALKSFLDHEKGKEIAKNLDTIYTIILNTLVKVDKTKEELQKILEILKDLREAWEEVKKKVHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Chaperone
molecule keywords flagellar protein FliS
publication title Similar modes of polypeptide recognition by export chaperones in flagellar biosynthesis and type III secretion
pubmed doi rcsb
source organism Aquifex aeolicus
total genus 57
structure length 126
sequence length 126
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2003-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02561 FliS Flagellar protein FliS
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.340 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Flagellar protein FliS 1orjA00
1SZIA 1ORJA 3IQCA 3K1IA 1ORYA
chains in the Genus database with same CATH superfamily
4YWQA 1CPQA 4LLCA 3RQEA 4MVRA 4BJ6A 1BBHA 2J7PD 3M4CA 3NKDA 4GQHA 3ZVRA 5KYUB 3V5ZA 1E2XA 1YYXA 2CNWD 2Z15A 3AQBA 1GM5A 1LS1A 1L7CA 1T5OA 2CNWA 4XLPF 3NKEA 3DJNB 4EBBA 1YYJA 3TOMA 2VC9A 2EINC 4BJTA 4ANJA 1Q0FA 3V5XA 1MMDA 2Q9BA 5L0HA 4Q7CA 4CS8C 3EH1A 2AWYA 3R7CA 4E18A 5DS5A 1FTSA 2J9BA 1O5HA 1OCOC 3CAXA 3WAQA 2WZGA 1NBBA 3EPVA 2HS5A 2LFFA 4QDLA 3UGPA 2OCCC 4DRHB 1I4ZA 2JPUA 3NMIA 2QTVA 3MX3A 4LACB 2IXMA 3L8IA 1LVKA 1N1CA 3C7JA 4JTDB 3U2LA 1M6TA 2J9VA 2Q00A 2BL2A 2PP4A 3JRTA 1LPEA 5AGFA 3SXYA 3DI5A 2R7RA 2LQGA 3B0VC 3BEHA 4AE4A 2R7VA 2YEVA 2ZXOA 4YT4A 1ZU4A 2HMZA 5CIVA 2D4UA 3HKKA 2CW0F 3LLKA 1K05A 5A69A 1MNEA 3C18A 4XLNF 3L1MA 1CGNA 5DQZA 2PBEA 2YLDA 1T9KA 1OCZC 1J8MF 4HFKB 3U3FA 5A6BD 2LCHA 4XPYA 2R7TA 2XLHA 1YDIA 1ZVZA 2KW3C 1ZHXA 2HKVA 4BPMA 3A9CA 1FNTc 1HY5A 3PMRA 3U8PA 2J9WA 2R03A 2RD9A 2W4MA 1XWJA 3G4ZA 3KKBA 3NRHA 3NYJA 4U5DE 4JKVA 4PK4A 4CDAA 5DS4A 1OXBA 4EWCA 3U9MA 5L0CA 3B0UX 3E70C 2L7AA 4XPWA 3POVA 4AE4B 3CSKA 1SZIA 2CGEA 3HLZA 3EHMA 2WVQA 5BQIA 4OD4A 3ASOC 3JYHA 1Z23A 2YKZA 2DB4A 4JW1A 1AUEA 4QI0A 2X0CA 1ZW3A 2L6HA 1NZEA 1IW7F 4E7ZA 2J9UA 1V4AA 2MWQA 2BE5F 4I3MA 1LI7A 3S29A 1O3UA 5BQHA 3GM2A 4C3DA 2A1DD 1RKEA 3AOUA 2HJMA 2KGOA 4U5CE 4Z9IA 3UMKA 2AP3A 4JEBA 3JZ0A 1A41A 1Q0DA 3EHNA 1EI7A 4YT2A 2DI3A 3F47A 3DAGA 2P6VA 2KJGA 4CBEA 1EQ1A 2M64A 4JCHA 3TQOA 4CJGA 4CDVA 3FVYA 3I4UA 2E87A 4KI2A 2OEXA 3N24A 1MQVA 2F22A 3DE8A 3K1IC 2OJQA 2YL7A 3DE9A 1UG7A 3VM6A 1DOVA 2XM0A 2WZFA 1VYKA 4RBNA 1G4WR 2Q4FA 3RIPA 3FHDA 4DBQA 1A7DA 4CSAA 1SMYF 1YVIA 3FAPB 2HSBA 1ZW2A 4MVOA 4OIRF 4NY3A 4HFFB 4IB4A 1HE1A 2YL1A 4MTFA 3EZHA 2XXAA 1TFOB 2VCCA 3QW1A 1RCPA 1K04A 3M1CB 1QPUA 5AC4A 1WWPA 2IM8A 1K40A 2P1AA 4OD5A 4PACA 2EILC 3OA1A 3U0CA 2C03A 1OQCA 4J7YA 4K1OA 2FAPB 3SXKA 3W8HA 4CS8A 3PHF2 1YAUO 4ZLDA 1FMWA 3IQ5A 3CEXA 4I1MA 4Z9HA 1GQAA 5BUOA 1OW7A 1TKNA 4FWVA 2XLWA 4IWBA 4DBRA 1EA8A 4N4WA 4EBKA 3V7OA 1VK5A 4LDKA 1BR2A 5B1BC 2WL8A 5EHHA 3QVYA 4ZLCA 1U89A 5COFA 4KNVA 5JUAA 2EIJC 4BEJA 1JOGA 1RXQA 2CYDA 3ABMC 4NQFA 4K0DA 3W2VA 2VCBA 5E3AA 5JP7A 1JPJA 4XPXA 4P9TA 4BJ5C 2XXAB 3UGOA 2Q9CA 3V5YA 3GODA 1FFTC 1MMNA 2WB7A 2WZLA 2X51A 2QLAA 3HNIA 3I5QA 3RYLA 3VRCA 2OEVA 3Q6MA 5GPGB 2YL3A 4FX5A 3S9OA 3M15A 2V3CC 1NFOA 3AG3C 5HV9A 2ASRA 3NYMA 4N6HA 5L3VA 3CQZA 1OCRC 3K1HA 4DJ9A 3MLGA 3FDQA 1T01A 4MQ9F 1ORJA 2G3KA 1ZHWA 1OXKA 5IY5C 3GEEA 1TWGA 1QVXA 3GM3A 2NPUA 3SXZA 3U2MA 4DVYP 3RQFA 4E0HA 3VF0A 2TMVP 1SR2A 5D91A 4L6RA 4CDYA 2QUPA 4U5FE 2J0WA 3ZDLA 4CSAC 2GWWA 2A68F 1H6GA 1U0BB 1T6IA 3AQCA 2IXPA 3ASNC 1TR2A 1Y4CA 3TD7A 4CIPA 4CX9A 3DKAA 1OR3A 3HNJA 1SYQA 1D0YA 1ZZPA 2AVKA 2LP4A 2VH3A 3CZ6A 4PJLA 4WABA 3EG9A 3KYIA 3ZC4A 2BC5A 1RKCA 1R5ID 2H8AA 3GWLA 3RVYA 4E0IA 5K0IA 3EQLF 3B9QA 4HEAJ 4DRIB 1F1MA 1AVOB 3FOPA 2XS1A 3EGXA 5EGYA 3ATPA 4JZAA 3K1IA 1M57C 4Z9JA 3T6JA 3W8IA 5KYYB 2H7VC 3KL4A 4ULWA 4G7OF 1TWHA 4JC7A 1D0XA 1VLTA 3DXJF 3IPMO 3QTHA 5COGA 2NSGA 4G7ZF 1OW6A 3KMIA 2R05A 3LEVA 4YL0A 3ZWIA 4CS9C 5A6AA 2UUIA 1LM3B 3TK0A 1TWAA 2PF4E 1LKXA 3B71A 3GM1A 3RVZA 3EG9B 4MVZA 1GS9A 4KBLA 3NMJA 3ZQVA 1H9TA 3N2ZB 2Y3HA 4MW3A 5L0GA 1M56C 4YT5A 3LEOA 2R9RB 2CDQA 2YRFA 4EKWA 2ZXRA 3EGXB 4C7OB 1Q0KA 2XL8A 2FGYA 3W2WA 2M4EA 4A4AA 3SZRA 5JVEA 3U8VA 5CI8A 2Y3DA 2HUJA 2XM4A 1QZXA 1ST6A 2A0UA 3LUTB 1JRAA 3GORA 3PCVA 5T3TA 2OG2A 3NYLA 1A0BA 2Q3TA 2R7QA 3C63A 1C17M 3H65A 1WN0A 4JTCB 3HNKA 4BJ5A 3UNGC 2WVNA 3DZAA 3JT1A 2GA0A 1XZQA 3G4XA 1YZCA 2J8WA 5L3QA 2A69F 2W45A 2YHSA 2I8BA 2Y3GA 3C8GA 5FCLA 2HSQA 4IARA 5L0IA 2JD3A 4MTOA 1PD0A 3ZTMA 1T6UA 2A6HF 3OEOA 2NSFA 4J32B 3SNHA 1V55C 3SEOA 3SP1A 1LI5A 4LDRA 4U5GA 4C3BA 4D4XA 2HZ8A 1NLXA 3EGDB 1VOMA 4KC9A 2CCYA 4ER9A 1OR2A 2NUTA 3JSZA 2R02A 3BRJA 5E2QA 5KYWB 1Z63A 4MVMA 1FMVA 3WODF 2GDCA 2YWAA 5DS6A 2XLDA 2GAQA 1VTMP 4JEAA 3C8GB 3MYFA 5DVWA 2LFDA 3ZG1A 2WVOA 3T9OA 3ABLC 2HMQA 4D4NA 2EPLX 4GYTA 4JJFA 3JYYA 3TOLA 5JT4A 1CGME 1PV3A 1PD1A 2J45A 4OIQF 1R4TA 3ZSUA 1A7EA 3VYWA 1E85A 2AWCA 1APCA 4I1OB 3HTKC 4IJJA 4H54A 4NC3A 3EFOA 3S28A 1Q0GA 2IXOA 2NUPA 2ETSA 2W4BA 3DWWA 3VAYA 3QVZA 2YL0A 4I44A 2NUTB 3AGUA 3L34A 2QY9A 4O6NA 3S90A 1V54C 4RDAA 2W9YA 4CIHA 3S0XA 2XLEA 5E3CA 2PX3A 1D1AA 3UMIA 2LD6A 4JVSA 1Z3IX 2L9JA 2YZSA 4J7TA 2XL4A 2KQ9A 2Y39A 4K7BA 4YJWA 5EK0A 1Z7Qc 3U3BA 3O6XA 3LNRA 2P0NA 3HJCA 3Q7LA 4OIPF 3H2VA 1NG1A 1QQ3A 3LAYA 4WJ0A 4CS9A 3EH2A 1MMGA 3A11A 3EFOB 1EKYA 4MS2A 4NTFA 2NUPB 1D0ZA 3RQGA 4P6IC 3K66A 4EHPA 2R7XA 4XEKA 1NU9C 2YLGA 3OWTA 2KSFA 3EJNA 4MVUA 3DMDA 1QSPA 3SXMA 1VLSA 4U9EA 2IYLD 2EPMX 3F46A 4MNDA 4ULVA 3RFYA 2A0BA 1AEPA 5FZTA 1WOLA 2XRHA 2YQYA 1OCCC 1HMOA 2IBFA 2DYSC 4LERA 4QI2A 2KK1A 3L0IA 256BA 2LIGA 3QZCA 5KYYA 1TWCA 2XS8A 3FMSA 4PJMA 3PDMP 3KPHA 1OKKD 2J46A 2L6GA 2XLVA 3GEIA 1BR4A 1OKKA 1S7ZA 1C02A 3G50A 5T3WA 4E17A 3ABKC 3O39A 1TFKB 4N6CA 1C03A 1O87A 2PX0A 4XEFA 4Q5SF 3TJ6A 1Z5ZA 1U6HA 2VCAA 3IEEA 3FOOA 3FXHA 3NMKA 1E86A 2OJED 1J8YF 1NFNA 1ZYRF 2DYRC 5E33A 4DVZA 2PNOA 2VB6A 4NTAA 2C04A 2ZPAA 1YARO 2ZD9A 2EPOA 4NTBA 3T6BA 4JTAB 4C7OA 1M2OA 4X0RA 2KYHA 3B29A 1GGQA 2R7WA 3DM9B 1G5ZA 5CI9A 5F5FA 2LSEA 4MTGA 4A2NB 1SF8A 5D92A 2Q7RA 1MMAA 2J7PA 1FAPB 5BQGA 4EIYA 3LLIA 3MBGA 4JCZA 1WGWA 4JE9A 1KNYA 2R25A 3X2QC 1LS4A 4DOZA 3JTLO 1ZU5A 1ZHTA 4O6YA 5COMA 4W8PA 4YK5A 3C62A 1YA9A 2Y3BA 2V26A 1VMAA 1D1BA 2EIKC 2OOCA 3C8ZA 4OINF 4PJJA 4E7SA 1HW1A 4AL0A 3AG2C 4B6IA 1VB5A 1KU2A 4C3EA 4BG0A 3ECSA 5TJ5E 1CGOA 4YL1A 1ORSC 3LS1A 4OIOF 4G7HF 3FAJA 1M2VA 2HJ3A 4UDVA 2GFHA 2JX0A 1JAFA 1Y6DA 3EGDA 1XZPA 3H2UA 1ZHZA 5L0JA 3GWNA 1CPRA 2R7UA 2IOQA 3TULA 4N06A 2R7OA 2XSEA 3US6A 3X1OA 3B0PA 5F28E 4WGYA 1HE9A 5B1AC 5A6JA 1BDJB 3EZIA 3QMKA 5KYWA 3R2PA 5DLJA 2IXNA 1G8XA 3C8GD 3LNMB 4JJGA 1G4US 2B0JA 4M63A 3RH3A 1L3PA 5KYXA 1QKRA 3LJBA 3IQ6A 4LDQA 5A6BA 2OU6A 2Y69C 1M2VB 4XQ1A 3WHNA 4DRJB 5A6KA 1FR0A 1V74B 4IRUA 2Q9AA 2HV6A 4MVQA 1QLEC 4O6MA 1E83A 3UR3C 4O79A 5L0DA 3L8JA 3N0TA 2MHRA 1LE4A 4JIOA 4EBJA 1S05A 1JMWA 3AG4C 2UUHA 3IQTA 4IAOA 3TJ5A 4AL1A 3K6BA 4BJ6C 3O55A 3T4RA 1JR8A 2YLIA 3K33A 3M4BA 4YT8A 1UFBA 3I5PA 1HMDA 3ZTZA 1ZHYA 4JRZA 4RD9A 1Q0MA 3GANA 2QE9A 4MW8A 4IGGA 2I15A 2G62A 2KNHA 5KYXB 3Q7GA 3DAFA 4BJ1A 3UMHA 2EIMC 4F4BA 3NG1A 3E9VA 5F5HA 2XLMA 2QNLA 2A6EF 4WGZA 4FESA 1H9GA 3NDBB 1OW8A 3HNLA 5B3SC 4U5EE 3LS0A 2FFHA 1BZ4A 2KC3A 3ITFA 1H7IA 3ZQYA 1WTYA 1YZAA 1VYIA 3IHUA 5T1DB 4JURI 3KH2A 2MYSA 4J30B 2PFDA 4PJNA 2D5RB 4W8KA 5JLIA 4AX2A 3JCUQ 4G0HA 5JRAA 2H7OA 2ZXWC 3LESA 1BR1A 1PCXA 2DGJA 4XEVA 2YVKA 5HSWA 4PFOA 3RF3A 1FFHA 1I4YA 1KTMA 3QW0A 1RKEB 3T6GB 1WASA 2O9XA 2H7BA 5DQTA 1A7VA 4LLEA 3ZIBA 3S84A 3JSEO 4XWJA 2L6FA 1MNDA 1YA7O 2HFIA 4U5HA 3W4YA 2G3VA 2RSEB 1YLMA 3U9JA 3DM5A 2NG1A 5JSLA 1TQGA 3GEHA 3K7DA 3IQCA 2R7SA 5AC5A 2J0XA 4G78A 4O7GA 4P9FA 4YL3A 3KYJA 4R32A 1DOWA 3U5SA 2OKUA 4BEMJ 4U9DA 5JS5A 4EUKB 1Z6AA 3AGTA 1JPNA 4GEHA 1NSGB 1ORYA 1LE2A 2L81A 4HE8D 4ONSA 4CJOA 2EPKX 4KNWA 1RJ9A 1B68A 2HV7A 4PR9A 4IAQA 1T6QA 4AK9A 4CS7A 1D1CA 1RMVA 2XLOA 3MYIA 3S27A 5KYNA 1E84A 1HW2A 2ZXPA 2VASA 3J06A 1WATA 1YJGA 3RW0A 5KYUA 2ICWG 3SYNA 2P61A 4H4KC 1IZMA 1W2WA 2EPNA 3AJMA 3MFNA 4U5BE 2B0HA 3RKOF 4MVSA 3M79A 2AU5A 2OQMA 4NCQA 1I5NA 3WG7C 2LK4A 3DJUB 2XL6A 2P7VA 4XTKA 1LIHA 1NU7D 1RJ9B 3DD7A 3O10A 3AG1C 4PFPA 4FAPB 5B3IA 5L0FA 4Q4ZF 4YN0B 4DXWA 3JRMO 3Q6NA
chains in the Genus database with same CATH topology
1SZIA 1ORJA 3IQCA 3K1IA 1ORYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SZI A;  1ORJ A;  3IQC A;  3K1I A;  1ORY A; 
#chains in the Genus database with same CATH topology
 4YWQ A;  1CPQ A;  4LLC A;  3RQE A;  4MVR A;  4BJ6 A;  1BBH A;  2J7P D;  3M4C A;  3NKD A;  4GQH A;  3ZVR A;  5KYU B;  3V5Z A;  1E2X A;  1YYX A;  2CNW D;  2Z15 A;  3AQB A;  1GM5 A;  1LS1 A;  1L7C A;  1T5O A;  2CNW A;  4XLP F;  3NKE A;  3DJN B;  4EBB A;  1YYJ A;  3TOM A;  2VC9 A;  2EIN C;  4BJT A;  4ANJ A;  1Q0F A;  3V5X A;  1MMD A;  2Q9B A;  5L0H A;  4Q7C A;  4CS8 C;  3EH1 A;  2AWY A;  3R7C A;  4E18 A;  5DS5 A;  1FTS A;  2J9B A;  1O5H A;  1OCO C;  3CAX A;  3WAQ A;  2WZG A;  1NBB A;  3EPV A;  2HS5 A;  2LFF A;  4QDL A;  3UGP A;  2OCC C;  4DRH B;  1I4Z A;  2JPU A;  3NMI A;  2QTV A;  3MX3 A;  4LAC B;  2IXM A;  3L8I A;  1LVK A;  1N1C A;  3C7J A;  4JTD B;  3U2L A;  1M6T A;  2J9V A;  2Q00 A;  2BL2 A;  2PP4 A;  3JRT A;  1LPE A;  5AGF A;  3SXY A;  3DI5 A;  2R7R A;  2LQG A;  3B0V C;  3BEH A;  4AE4 A;  2R7V A;  2YEV A;  2ZXO A;  4YT4 A;  1ZU4 A;  2HMZ A;  5CIV A;  2D4U A;  3HKK A;  2CW0 F;  3LLK A;  1K05 A;  5A69 A;  1MNE A;  3C18 A;  4XLN F;  3L1M A;  1CGN A;  5DQZ A;  2PBE A;  2YLD A;  1T9K A;  1OCZ C;  1J8M F;  4HFK B;  3U3F A;  5A6B D;  2LCH A;  4XPY A;  2R7T A;  2XLH A;  1YDI A;  1ZVZ A;  2KW3 C;  1ZHX A;  2HKV A;  4BPM A;  3A9C A;  1FNT c;  1HY5 A;  3PMR A;  3U8P A;  2J9W A;  2R03 A;  2RD9 A;  2W4M A;  1XWJ A;  3G4Z A;  3KKB A;  3NRH A;  3NYJ A;  4U5D E;  4JKV A;  4PK4 A;  4CDA A;  5DS4 A;  1OXB A;  4EWC A;  3U9M A;  5L0C A;  3B0U X;  3E70 C;  2L7A A;  4XPW A;  3POV A;  4AE4 B;  3CSK A;  1SZI A;  2CGE A;  3HLZ A;  3EHM A;  2WVQ A;  5BQI A;  4OD4 A;  3ASO C;  3JYH A;  1Z23 A;  2YKZ A;  2DB4 A;  4JW1 A;  1AUE A;  4QI0 A;  2X0C A;  1ZW3 A;  2L6H A;  1NZE A;  1IW7 F;  4E7Z A;  2J9U A;  1V4A A;  2MWQ A;  2BE5 F;  4I3M A;  1LI7 A;  3S29 A;  1O3U A;  5BQH A;  3GM2 A;  4C3D A;  2A1D D;  1RKE A;  3AOU A;  2HJM A;  2KGO A;  4U5C E;  4Z9I A;  3UMK A;  2AP3 A;  4JEB A;  3JZ0 A;  1A41 A;  1Q0D A;  3EHN A;  1EI7 A;  4YT2 A;  2DI3 A;  3F47 A;  3DAG A;  2P6V A;  2KJG A;  4CBE A;  1EQ1 A;  2M64 A;  4JCH A;  3TQO A;  4CJG A;  4CDV A;  3FVY A;  3I4U A;  2E87 A;  4KI2 A;  2OEX A;  3N24 A;  1MQV A;  2F22 A;  3DE8 A;  3K1I C;  2OJQ A;  2YL7 A;  3DE9 A;  1UG7 A;  3VM6 A;  1DOV A;  2XM0 A;  2WZF A;  1VYK A;  4RBN A;  1G4W R;  2Q4F A;  3RIP A;  3FHD A;  4DBQ A;  1A7D A;  4CSA A;  1SMY F;  1YVI A;  3FAP B;  2HSB A;  1ZW2 A;  4MVO A;  4OIR F;  4NY3 A;  4HFF B;  4IB4 A;  1HE1 A;  2YL1 A;  4MTF A;  3EZH A;  2XXA A;  1TFO B;  2VCC A;  3QW1 A;  1RCP A;  1K04 A;  3M1C B;  1QPU A;  5AC4 A;  1WWP A;  2IM8 A;  1K40 A;  2P1A A;  4OD5 A;  4PAC A;  2EIL C;  3OA1 A;  3U0C A;  2C03 A;  1OQC A;  4J7Y A;  4K1O A;  2FAP B;  3SXK A;  3W8H A;  4CS8 A;  3PHF 2;  1YAU O;  4ZLD A;  1FMW A;  3IQ5 A;  3CEX A;  4I1M A;  4Z9H A;  1GQA A;  5BUO A;  1OW7 A;  1TKN A;  4FWV A;  2XLW A;  4IWB A;  4DBR A;  1EA8 A;  4N4W A;  4EBK A;  3V7O A;  1VK5 A;  4LDK A;  1BR2 A;  5B1B C;  2WL8 A;  5EHH A;  3QVY A;  4ZLC A;  1U89 A;  5COF A;  4KNV A;  5JUA A;  2EIJ C;  4BEJ A;  1JOG A;  1RXQ A;  2CYD A;  3ABM C;  4NQF A;  4K0D A;  3W2V A;  2VCB A;  5E3A A;  5JP7 A;  1JPJ A;  4XPX A;  4P9T A;  4BJ5 C;  2XXA B;  3UGO A;  2Q9C A;  3V5Y A;  3GOD A;  1FFT C;  1MMN A;  2WB7 A;  2WZL A;  2X51 A;  2QLA A;  3HNI A;  3I5Q A;  3RYL A;  3VRC A;  2OEV A;  3Q6M A;  5GPG B;  2YL3 A;  4FX5 A;  3S9O A;  3M15 A;  2V3C C;  1NFO A;  3AG3 C;  5HV9 A;  2ASR A;  3NYM A;  4N6H A;  5L3V A;  3CQZ A;  1OCR C;  3K1H A;  4DJ9 A;  3MLG A;  3FDQ A;  1T01 A;  4MQ9 F;  1ORJ A;  2G3K A;  1ZHW A;  1OXK A;  5IY5 C;  3GEE A;  1TWG A;  1QVX A;  3GM3 A;  2NPU A;  3SXZ A;  3U2M A;  4DVY P;  3RQF A;  4E0H A;  3VF0 A;  2TMV P;  1SR2 A;  5D91 A;  4L6R A;  4CDY A;  2QUP A;  4U5F E;  2J0W A;  3ZDL A;  4CSA C;  2GWW A;  2A68 F;  1H6G A;  1U0B B;  1T6I A;  3AQC A;  2IXP A;  3ASN C;  1TR2 A;  1Y4C A;  3TD7 A;  4CIP A;  4CX9 A;  3DKA A;  1OR3 A;  3HNJ A;  1SYQ A;  1D0Y A;  1ZZP A;  2AVK A;  2LP4 A;  2VH3 A;  3CZ6 A;  4PJL A;  4WAB A;  3EG9 A;  3KYI A;  3ZC4 A;  2BC5 A;  1RKC A;  1R5I D;  2H8A A;  3GWL A;  3RVY A;  4E0I A;  5K0I A;  3EQL F;  3B9Q A;  4HEA J;  4DRI B;  1F1M A;  1AVO B;  3FOP A;  2XS1 A;  3EGX A;  5EGY A;  3ATP A;  4JZA A;  3K1I A;  1M57 C;  4Z9J A;  3T6J A;  3W8I A;  5KYY B;  2H7V C;  3KL4 A;  4ULW A;  4G7O F;  1TWH A;  4JC7 A;  1D0X A;  1VLT A;  3DXJ F;  3IPM O;  3QTH A;  5COG A;  2NSG A;  4G7Z F;  1OW6 A;  3KMI A;  2R05 A;  3LEV A;  4YL0 A;  3ZWI A;  4CS9 C;  5A6A A;  2UUI A;  1LM3 B;  3TK0 A;  1TWA A;  2PF4 E;  1LKX A;  3B71 A;  3GM1 A;  3RVZ A;  3EG9 B;  4MVZ A;  1GS9 A;  4KBL A;  3NMJ A;  3ZQV A;  1H9T A;  3N2Z B;  2Y3H A;  4MW3 A;  5L0G A;  1M56 C;  4YT5 A;  3LEO A;  2R9R B;  2CDQ A;  2YRF A;  4EKW A;  2ZXR A;  3EGX B;  4C7O B;  1Q0K A;  2XL8 A;  2FGY A;  3W2W A;  2M4E A;  4A4A A;  3SZR A;  5JVE A;  3U8V A;  5CI8 A;  2Y3D A;  2HUJ A;  2XM4 A;  1QZX A;  1ST6 A;  2A0U A;  3LUT B;  1JRA A;  3GOR A;  3PCV A;  5T3T A;  2OG2 A;  3NYL A;  1A0B A;  2Q3T A;  2R7Q A;  3C63 A;  1C17 M;  3H65 A;  1WN0 A;  4JTC B;  3HNK A;  4BJ5 A;  3UNG C;  2WVN A;  3DZA A;  3JT1 A;  2GA0 A;  1XZQ A;  3G4X A;  1YZC A;  2J8W A;  5L3Q A;  2A69 F;  2W45 A;  2YHS A;  2I8B A;  2Y3G A;  3C8G A;  5FCL A;  2HSQ A;  4IAR A;  5L0I A;  2JD3 A;  4MTO A;  1PD0 A;  3ZTM A;  1T6U A;  2A6H F;  3OEO A;  2NSF A;  4J32 B;  3SNH A;  1V55 C;  3SEO A;  3SP1 A;  1LI5 A;  4LDR A;  4U5G A;  4C3B A;  4D4X A;  2HZ8 A;  1NLX A;  3EGD B;  1VOM A;  4KC9 A;  2CCY A;  4ER9 A;  1OR2 A;  2NUT A;  3JSZ A;  2R02 A;  3BRJ A;  5E2Q A;  5KYW B;  1Z63 A;  4MVM A;  1FMV A;  3WOD F;  2GDC A;  2YWA A;  5DS6 A;  2XLD A;  2GAQ A;  1VTM P;  4JEA A;  3C8G B;  3MYF A;  5DVW A;  2LFD A;  3ZG1 A;  2WVO A;  3T9O A;  3ABL C;  2HMQ A;  4D4N A;  2EPL X;  4GYT A;  4JJF A;  3JYY A;  3TOL A;  5JT4 A;  1CGM E;  1PV3 A;  1PD1 A;  2J45 A;  4OIQ F;  1R4T A;  3ZSU A;  1A7E A;  3VYW A;  1E85 A;  2AWC A;  1APC A;  4I1O B;  3HTK C;  4IJJ A;  4H54 A;  4NC3 A;  3EFO A;  3S28 A;  1Q0G A;  2IXO A;  2NUP A;  2ETS A;  2W4B A;  3DWW A;  3VAY A;  3QVZ A;  2YL0 A;  4I44 A;  2NUT B;  3AGU A;  3L34 A;  2QY9 A;  4O6N A;  3S90 A;  1V54 C;  4RDA A;  2W9Y A;  4CIH A;  3S0X A;  2XLE A;  5E3C A;  2PX3 A;  1D1A A;  3UMI A;  2LD6 A;  4JVS A;  1Z3I X;  2L9J A;  2YZS A;  4J7T A;  2XL4 A;  2KQ9 A;  2Y39 A;  4K7B A;  4YJW A;  5EK0 A;  1Z7Q c;  3U3B A;  3O6X A;  3LNR A;  2P0N A;  3HJC A;  3Q7L A;  4OIP F;  3H2V A;  1NG1 A;  1QQ3 A;  3LAY A;  4WJ0 A;  4CS9 A;  3EH2 A;  1MMG A;  3A11 A;  3EFO B;  1EKY A;  4MS2 A;  4NTF A;  2NUP B;  1D0Z A;  3RQG A;  4P6I C;  3K66 A;  4EHP A;  2R7X A;  4XEK A;  1NU9 C;  2YLG A;  3OWT A;  2KSF A;  3EJN A;  4MVU A;  3DMD A;  1QSP A;  3SXM A;  1VLS A;  4U9E A;  2IYL D;  2EPM X;  3F46 A;  4MND A;  4ULV A;  3RFY A;  2A0B A;  1AEP A;  5FZT A;  1WOL A;  2XRH A;  2YQY A;  1OCC C;  1HMO A;  2IBF A;  2DYS C;  4LER A;  4QI2 A;  2KK1 A;  3L0I A;  256B A;  2LIG A;  3QZC A;  5KYY A;  1TWC A;  2XS8 A;  3FMS A;  4PJM A;  3PDM P;  3KPH A;  1OKK D;  2J46 A;  2L6G A;  2XLV A;  3GEI A;  1BR4 A;  1OKK A;  1S7Z A;  1C02 A;  3G50 A;  5T3W A;  4E17 A;  3ABK C;  3O39 A;  1TFK B;  4N6C A;  1C03 A;  1O87 A;  2PX0 A;  4XEF A;  4Q5S F;  3TJ6 A;  1Z5Z A;  1U6H A;  2VCA A;  3IEE A;  3FOO A;  3FXH A;  3NMK A;  1E86 A;  2OJE D;  1J8Y F;  1NFN A;  1ZYR F;  2DYR C;  5E33 A;  4DVZ A;  2PNO A;  2VB6 A;  4NTA A;  2C04 A;  2ZPA A;  1YAR O;  2ZD9 A;  2EPO A;  4NTB A;  3T6B A;  4JTA B;  4C7O A;  1M2O A;  4X0R A;  2KYH A;  3B29 A;  1GGQ A;  2R7W A;  3DM9 B;  1G5Z A;  5CI9 A;  5F5F A;  2LSE A;  4MTG A;  4A2N B;  1SF8 A;  5D92 A;  2Q7R A;  1MMA A;  2J7P A;  1FAP B;  5BQG A;  4EIY A;  3LLI A;  3MBG A;  4JCZ A;  1WGW A;  4JE9 A;  1KNY A;  2R25 A;  3X2Q C;  1LS4 A;  4DOZ A;  3JTL O;  1ZU5 A;  1ZHT A;  4O6Y A;  5COM A;  4W8P A;  4YK5 A;  3C62 A;  1YA9 A;  2Y3B A;  2V26 A;  1VMA A;  1D1B A;  2EIK C;  2OOC A;  3C8Z A;  4OIN F;  4PJJ A;  4E7S A;  1HW1 A;  4AL0 A;  3AG2 C;  4B6I A;  1VB5 A;  1KU2 A;  4C3E A;  4BG0 A;  3ECS A;  5TJ5 E;  1CGO A;  4YL1 A;  1ORS C;  3LS1 A;  4OIO F;  4G7H F;  3FAJ A;  1M2V A;  2HJ3 A;  4UDV A;  2GFH A;  2JX0 A;  1JAF A;  1Y6D A;  3EGD A;  1XZP A;  3H2U A;  1ZHZ A;  5L0J A;  3GWN A;  1CPR A;  2R7U A;  2IOQ A;  3TUL A;  4N06 A;  2R7O A;  2XSE A;  3US6 A;  3X1O A;  3B0P A;  5F28 E;  4WGY A;  1HE9 A;  5B1A C;  5A6J A;  1BDJ B;  3EZI A;  3QMK A;  5KYW A;  3R2P A;  5DLJ A;  2IXN A;  1G8X A;  3C8G D;  3LNM B;  4JJG A;  1G4U S;  2B0J A;  4M63 A;  3RH3 A;  1L3P A;  5KYX A;  1QKR A;  3LJB A;  3IQ6 A;  4LDQ A;  5A6B A;  2OU6 A;  2Y69 C;  1M2V B;  4XQ1 A;  3WHN A;  4DRJ B;  5A6K A;  1FR0 A;  1V74 B;  4IRU A;  2Q9A A;  2HV6 A;  4MVQ A;  1QLE C;  4O6M A;  1E83 A;  3UR3 C;  4O79 A;  5L0D A;  3L8J A;  3N0T A;  2MHR A;  1LE4 A;  4JIO A;  4EBJ A;  1S05 A;  1JMW A;  3AG4 C;  2UUH A;  3IQT A;  4IAO A;  3TJ5 A;  4AL1 A;  3K6B A;  4BJ6 C;  3O55 A;  3T4R A;  1JR8 A;  2YLI A;  3K33 A;  3M4B A;  4YT8 A;  1UFB A;  3I5P A;  1HMD A;  3ZTZ A;  1ZHY A;  4JRZ A;  4RD9 A;  1Q0M A;  3GAN A;  2QE9 A;  4MW8 A;  4IGG A;  2I15 A;  2G62 A;  2KNH A;  5KYX B;  3Q7G A;  3DAF A;  4BJ1 A;  3UMH A;  2EIM C;  4F4B A;  3NG1 A;  3E9V A;  5F5H A;  2XLM A;  2QNL A;  2A6E F;  4WGZ A;  4FES A;  1H9G A;  3NDB B;  1OW8 A;  3HNL A;  5B3S C;  4U5E E;  3LS0 A;  2FFH A;  1BZ4 A;  2KC3 A;  3ITF A;  1H7I A;  3ZQY A;  1WTY A;  1YZA A;  1VYI A;  3IHU A;  5T1D B;  4JUR I;  3KH2 A;  2MYS A;  4J30 B;  2PFD A;  4PJN A;  2D5R B;  4W8K A;  5JLI A;  4AX2 A;  3JCU Q;  4G0H A;  5JRA A;  2H7O A;  2ZXW C;  3LES A;  1BR1 A;  1PCX A;  2DGJ A;  4XEV A;  2YVK A;  5HSW A;  4PFO A;  3RF3 A;  1FFH A;  1I4Y A;  1KTM A;  3QW0 A;  1RKE B;  3T6G B;  1WAS A;  2O9X A;  2H7B A;  5DQT A;  1A7V A;  4LLE A;  3ZIB A;  3S84 A;  3JSE O;  4XWJ A;  2L6F A;  1MND A;  1YA7 O;  2HFI A;  4U5H A;  3W4Y A;  2G3V A;  2RSE B;  1YLM A;  3U9J A;  3DM5 A;  2NG1 A;  5JSL A;  1TQG A;  3GEH A;  3K7D A;  3IQC A;  2R7S A;  5AC5 A;  2J0X A;  4G78 A;  4O7G A;  4P9F A;  4YL3 A;  3KYJ A;  4R32 A;  1DOW A;  3U5S A;  2OKU A;  4BEM J;  4U9D A;  5JS5 A;  4EUK B;  1Z6A A;  3AGT A;  1JPN A;  4GEH A;  1NSG B;  1ORY A;  1LE2 A;  2L81 A;  4HE8 D;  4ONS A;  4CJO A;  2EPK X;  4KNW A;  1RJ9 A;  1B68 A;  2HV7 A;  4PR9 A;  4IAQ A;  1T6Q A;  4AK9 A;  4CS7 A;  1D1C A;  1RMV A;  2XLO A;  3MYI A;  3S27 A;  5KYN A;  1E84 A;  1HW2 A;  2ZXP A;  2VAS A;  3J06 A;  1WAT A;  1YJG A;  3RW0 A;  5KYU A;  2ICW G;  3SYN A;  2P61 A;  4H4K C;  1IZM A;  1W2W A;  2EPN A;  3AJM A;  3MFN A;  4U5B E;  2B0H A;  3RKO F;  4MVS A;  3M79 A;  2AU5 A;  2OQM A;  4NCQ A;  1I5N A;  3WG7 C;  2LK4 A;  3DJU B;  2XL6 A;  2P7V A;  4XTK A;  1LIH A;  1NU7 D;  1RJ9 B;  3DD7 A;  3O10 A;  3AG1 C;  4PFP A;  4FAP B;  5B3I A;  5L0F A;  4Q4Z F;  4YN0 B;  4DXW A;  3JRM O;  3Q6N A; 
#chains in the Genus database with same CATH homology
 1SZI A;  1ORJ A;  3IQC A;  3K1I A;  1ORY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...