5JS5A

Nitric oxide complex of the l16f mutant of cytochrome c prime from alcaligenes xylosoxidans
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
125
structure length
125
Chain Sequence
EFAKPEDAVKYRQSAFTLMASHFGRMTPVVKGQAPYDAAQIKANVEVLKTLSALPWAAFGPGTEGGDARPEIWSDAASFKQKQQAFQDNIVKLSAAADAGDLDKLRAAFGDVGASCKACHDAYRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c'
publication title Engineering proximal vs. distal heme-NO coordination via dinitrosyl dynamics: implications for NO sensor design.
pubmed doi rcsb
source organism Alcaligenes xylosoxydans xylosoxydans
molecule tags Electron transport
total genus 48
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2016-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01322 Cytochrom_C_2 Cytochrome C'
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 5js5A00
1BBHA 3IQ6A 4ER9A 2XM0A 2YKZA 3TOLA 3QW1A 5JT4A 3U8PA 4IARA 3ZQYA 2XLMA 3ZTZA 3L1MA 2XLHA 4JE9A 3C63A 2XL6A 4L6RA 1S05A 1EKYA 2XM4A 5AGFA 1A7VA 3FOPA 3NMJA 1NBBA 2XL8A 5JP7A 4CJOA 3DE8A 4IB4A 4CIPA 3HNKA 1CGNA 1CPQA 3ZTMA 2XLDA 1GQAA 3M15A 4JEAA 1YYXA 3ZWIA 5JS5A 3HNJA 3QVYA 1M6TA 2YLIA 3M4BA 1QQ3A 5JLIA 1YZAA 4WGZA 4EIYA 4CDAA 4CX9A 2J8WA 3NMIA 1JAFA 3NMKA 3ZQVA 1CPRA 2YL0A 3QVZA 3HNLA 1YYJA 2XLVA 4IAQA 1E86A 3C62A 2XLWA 3QW0A 4JEBA 2J9BA 1E85A 3HNIA 4U9DA 4NC3A 1E83A 1RCPA 3DE9A 1E84A 3M4CA 4WGYA 5JSLA 2YL7A 1APCA 2YL1A 5JRAA 5B3IA 2XLOA 1QPUA 2YL3A 4N6HA 3IQ5A 4N4WA 2YLDA 4ULVA 5JVEA 5JUAA 2CCYA 3TOMA 4D4NA 1LM3B 1YZCA 2XLEA 4CDYA 3VRCA 256BA 4JKVA 2YLGA 1CGOA 4D4XA 4U9EA 4CJGA 4CDVA 2QLAA 3FOOA 3M79A 1MQVA 2BC5A
chains in the Genus database with same CATH superfamily
3GODA 3IQ6A 1LPEA 3TOLA 3GORA 3QW1A 1A0BA 2AWYA 2I8BA 2J7PA 3OWTA 5DQTA 4IARA 2LD6A 4EBBA 1V55C 1D1CA 3EGXB 3H2UA 2RD9A 3VAYA 2XLMA 3RQEA 1ZHZA 5L3VA 2VB6A 1FAPB 2HKVA 3DMDA 3H2VA 3JTLO 4OIRF 1NFNA 3BRJA 1C03A 2GFHA 2D5RB 3KYIA 4LLEA 2XLHA 4MVSA 3BEHA 3I5PA 1B68A 1Q0GA 2R7WA 2XL6A 3DAFA 1VYIA 2HV6A 2OOCA 1EKYA 4KNWA 3AG1C 2XM4A 1QZXA 3EG9A 4O6NA 1V54C 1RKEA 2AU5A 2OEVA 1A7VA 1C17M 4BJ5A 4JJFA 4P9FA 4U5DE 5E3AA 4C3DA 1FNTc 2M64A 1YA7O 2V3CC 2EILC 3GM2A 2GAQA 3JT1A 1OKKD 2CNWA 5JP7A 3U2MA 5DLJA 4BEMJ 4KI2A 4OIQF 4OIPF 1FR0A 1T5OA 3ZC4A 4YL0A 2X51A 3NYLA 2W4BA 4CIPA 3JRTA 1SR2A 3HNKA 2NSGA 1CGNA 2OKUA 2YWAA 2MHRA 3AOUA 1F1MA 3HJCA 3LESA 2Y3HA 4ONSA 5COFA 5T3WA 3UMIA 3ZTMA 1R5ID 5DQZA 2EIJC 1M2VA 4JIOA 1GQAA 4QI0A 4XTKA 3H65A 1ORJA 3JYHA 5L0IA 2M4EA 4G7OF 1SMYF 3LS0A 3RW0A 2C04A 2DGJA 4MVMA 2A0BA 3O10A 4O7GA 2R03A 2NPUA 1YZAA 1R4TA 3SP1A 5KYYA 3W8HA 4UDVA 2OJED 3AG4C 4YT5A 4PFOA 3Q6NA 1U89A 4PR9A 2Y39A 1JAFA 1A7EA 2L6FA 3SEOA 3EJNA 3SYNA 2HV7A 4NY3A 1MNDA 4QDLA 5GPGB 3EHMA 2Y3BA 1XZQA 3R7CA 2LIGA 4C7OB 2EPOA 1D1AA 2P6VA 3IHUA 5E2QA 2L9JA 2HSQA 4IAQA 2NG1A 4PFPA 1OXBA 3NYMA 1VLTA 2HFIA 3QW0A 3L8JA 4FAPB 3HNIA 3O6XA 4U9DA 3UMHA 2LFFA 3KPHA 3ZG1A 1ZYRF 3ASOC 4MW8A 2YEVA 2DYSC 3K1HA 1JPNA 1NFOA 1OR2A 2Z15A 1ZVZA 2Q3TA 4LDKA 4X0RA 4YK5A 4E7ZA 1E84A 4YT4A 1I4YA 3TD7A 1NG1A 2P61A 3PCVA 1ZU4A 2YL7A 4O79A 1QKRA 1D1BA 2QTVA 4XLNF 2A6EF 2ICWG 1QPUA 3W2WA 1ZW2A 3LNRA 4BJ5C 1T6QA 1HE9A 1A41A 4ULVA 4P9TA 3FVYA 1JOGA 3AG3C 1MMDA 3Q7LA 3K66A 2EPMX 3OA1A 3FMSA 2R7OA 4J30B 3ZDLA 2GA0A 1Y6DA 4MW3A 4M63A 3U3FA 1PCXA 1ZW3A 2BL2A 5KYUA 1NU9C 3EFOA 3AQBA 1LVKA 2KQ9A 4JURI 5KYNA 2EPKX 2J0WA 2PF4E 1VLSA 2H7VC 4JRZA 3T6BA 1ZHYA 4F4BA 3DJNB 4I1OB 4BEJA 3MYIA 2QLAA 3RH3A 5KYXB 2ZD9A 3EGDA 3NG1A 3W4YA 1OW7A 5DS4A 1BBHA 4XEFA 3KKBA 1GGQA 2LP4A 3MLGA 3S90A 3G4ZA 3KH2A 5A6BD 1OXKA 1J8YF 2J45A 4YJWA 3U8VA 2YQYA 4J7YA 2ZXPA 3LLKA 1Q0FA 4NTBA 1QVXA 2NUPA 3ATPA 4CS8C 4BPMA 1T01A 1VOMA 3UGPA 1FFHA 3T6JA 3EH2A 1SF8A 1NLXA 1SYQA 2B0JA 1HW2A 4DBQA 5L0CA 3JSZA 2NSFA 3G4XA 1D0XA 3PDMP 4JE9A 2KYHA 2R7RA 2G3VA 3LEOA 3UMKA 1FMWA 3OEOA 1KU2A 1S05A 4L6RA 3TJ5A 4U5HA 5T3TA 4AK9A 3DZAA 2Q9CA 4FESA 2OJQA 2UUIA 3FHDA 3DI5A 1M2OA 3HTKC 1HW1A 1TKNA 2R02A 1FFTC 5A6AA 1KNYA 1IZMA 2WVNA 1QLEC 3A11A 2R05A 5DS6A 3G50A 2XL8A 4CJOA 3QZCA 4A2NB 2HJ3A 3C8GA 3X1OA 5KYWB 2YRFA 1ZHWA 2A69F 1G4WR 4XLPF 2WL8A 1I5NA 4A4AA 3POVA 2EPNA 1O87A 1OW8A 4OD5A 3U9MA 1AEPA 1AUEA 1TFKB 3B71A 3ZWIA 4BJ6A 4E17A 2J0XA 3WG7C 4W8KA 5TJ5E 2L7AA 1A7DA 3O55A 1KTMA 1BR4A 4G78A 5FZTA 1JR8A 1ZU5A 3E70C 4EUKB 4YT2A 4AE4B 4HEAJ 4JC7A 3RFYA 1GS9A 4XPXA 4H4KC 4EIYA 1NZEA 4XEVA 5A6JA 4CX9A 2ZXOA 2J8WA 4U5GA 5COGA 2PBEA 1YVIA 3MYFA 3NMKA 4G0HA 4GQHA 2JX0A 2KC3A 3QVZA 2Q00A 3UNGC 2KW3C 3HNLA 4MVQA 1LKXA 4XWJA 2XS8A 1V74B 4DVYP 5DS5A 2E87A 4MVRA 3ASNC 5T1DB 5AC4A 3RIPA 3JCUQ 2Q7RA 4EHPA 3CQZA 3JZ0A 4MVZA 3UR3C 2J9BA 1LS1A 2TMVP 3ZIBA 3LLIA 3S29A 2AP3A 4QI2A 4EBKA 1PD0A 1OR3A 3EGXA 1FMVA 2KGOA 2W4MA 3HLZA 5B1AC 2WZLA 3SXZA 2O9XA 4CS8A 4IGGA 3AQCA 5F5HA 5BUOA 2P1AA 3DAGA 4DVZA 5B3IA 1OW6A 5CI8A 3JSEO 3NKDA 1BR1A 4NCQA 2PNOA 3IQ5A 2ETSA 3PMRA 5L3QA 3S0XA 5JUAA 3DKAA 2CCYA 4HFFB 3TOMA 1Q0DA 4JW1A 4MS2A 2XSEA 3GEHA 4MQ9F 3RQGA 4D4NA 3S27A 2LSEA 4E0HA 1G8XA 1ZHTA 2XLEA 3SNHA 1Z3IX 2KSFA 3QMKA 4MNDA 2Y3GA 3UGOA 2CGEA 256BA 2C03A 2YLGA 3A9CA 4N06A 4D4XA 2P0NA 3LJBA 1H7IA 3AG2C 1MMGA 2L81A 4U9EA 4E0IA 3MX3A 5F5FA 5EHHA 4O6MA 2EINC 1ORYA 3RVZA 4AX2A 3FOOA 3F46A 2Q4FA 1W2WA 1T6IA 2WZGA 4MTOA 5E33A 1Z7Qc 2J7PD 1O5HA 3RQFA 4ER9A 5EGYA 4BJ6C 4CBEA 2YKZA 3X2QC 2P7VA 3B29A 5JT4A 4U5BE 4U5EE 3EHNA 5D92A 2WB7A 3ZQYA 3EZIA 2IYLD 1LE4A 4O6YA 4XEKA 4J32B 2AVKA 3SXMA 3J06A 1LS4A 1M56C 1RJ9B 2LK4A 3U0CA 4KBLA 3L1MA 4JCHA 1XZPA 3GEEA 5HV9A 3C18A 4MTFA 1G4US 4DXWA 3C63A 3F47A 2X0CA 3C7JA 4P6IC 1RKCA 3E9VA 1ZZPA 2XXAB 2OEXA 3C8ZA 4IAOA 4BJ1A 3EH1A 1TWHA 3ITFA 4ULWA 2H8AA 3W2VA 1HMDA 1VB5A 1BDJB 3K7DA 3KYJA 4EWCA 1PD1A 2I15A 2VCCA 1Z23A 4HE8D 1Z63A 2CNWD 3FOPA 2PP4A 4EKWA 2IM8A 3DXJF 1NBBA 1K40A 2LFDA 3DE8A 4K0DA 1VYKA 4IB4A 4OD4A 4U5CE 4U5FE 1OKKA 2HMQA 3LUTB 2MWQA 4DJ9A 4YWQA 4G7ZF 4GEHA 3CSKA 4K7BA 4PJMA 2FFHA 2JD3A 2BE5F 4C3EA 5L0FA 4CSAA 1AVOB 1YAUO 4DRHB 2LQGA 2VCAA 3M15A 4JEAA 1L3PA 1YYXA 1DOWA 3LS1A 4WABA 4MTGA 4WJ0A 4XPWA 3DD7A 5JS5A 1GM5A 4Q5SF 3QTHA 2CDQA 3QVYA 4PACA 1M6TA 1QSPA 5D91A 5JLIA 1E2XA 3V7OA 1WOLA 1FTSA 2ASRA 4E18A 3ABKC 4MVUA 2B0HA 3NMIA 4W8PA 3EG9B 4ZLCA 3CAXA 1CPRA 3N0TA 3B0VC 1RKEB 2CW0F 2DB4A 2XL4A 2W45A 5CI9A 3W8IA 3NRHA 4YT8A 3ECSA 3FAPB 3S84A 4I1MA 1Q0MA 1ORSC 4LLCA 5DVWA 4BG0A 1HY5A 1RMVA 3AGTA 1ZHXA 2KK1A 4XPYA 5L0DA 2LCHA 2G3KA 1H9TA 5K0IA 5E3CA 1SZIA 4Q7CA 1BR2A 1DOVA 3FAJA 3IQTA 5B1BC 5KYXA 2KJGA 2F22A 1G5ZA 4H54A 1E85A 3TK0A 3JYYA 1TFOB 5IY5C 1E83A 1YLMA 2QY9A 3SXYA 3L0IA 3GM3A 3B0UX 1RCPA 2EPLX 3DE9A 3N2ZB 4KC9A 1OCZC 1S7ZA 2A6HF 1L7CA 1M2VB 1WATA 2HSBA 2Y69C 2YHSA 3LAYA 4I3MA 4B6IA 2CYDA 3O39A 1U6HA 3EQLF 1JRAA 1UFBA 2IXPA 3EZHA 4IJJA 4PJLA 4XQ1A 4YL3A 3S28A 1APCA 1TWCA 2YL1A 4DOZA 5A6KA 1N1CA 1YARO 3FDQA 2NUTA 2MYSA 1RXQA 1XWJA 2PX0A 2XLOA 2HMZA 2V26A 2R25A 3HKKA 4Q4ZF 3CEXA 4N6HA 5KYYB 2VC9A 1CGME 1WGWA 3GANA 4N4WA 4DBRA 4LDQA 2OCCC 1YDIA 2YLDA 1VTMP 3T6GB 4DRIB 4AL0A 4CS9A 2J9UA 4JCZA 2IOQA 1YZCA 1ST6A 4CDYA 1T6UA 3I5QA 4FWVA 2YZSA 3IQCA 1MMNA 1CGOA 1UG7A 3MFNA 4JKVA 3M1CB 1Z6AA 2Q9AA 2WVQA 4AL1A 1K04A 4JZAA 4YL1A 4PK4A 5HSWA 2GWWA 4CSAC 3Q7GA 3ABMC 1OCCC 2IBFA 1MQVA 2BC5A 2XM0A 5KYWA 3ZSUA 2Y3DA 2R7VA 2D4UA 2JPUA 3K1IC 1OCRC 3U8PA 4MVOA 4YN0B 4RBNA 5A6BA 3LNMB 3B9QA 3ZTZA 3GWNA 2H7OA 1HE1A 3V5YA 2R7QA 2WVOA 2Q9BA 1EI7A 2G62A 3S9OA 3U9JA 3DWWA 4I44A 4NQFA 3WAQA 4AE4A 3L8IA 3PHF2 2W9YA 2VASA 3AJMA 1EQ1A 1WWPA 1WASA 1MNEA 2R9RB 3NKEA 5A69A 1OCOC 3RYLA 5AGFA 3RKOF 4GYTA 3L34A 2WZFA 3N24A 2J46A 3DM9B 4E7SA 1YJGA 1HMOA 2DYRC 3ZVRA 5KYUB 3EFOB 3CZ6A 3JRMO 2HS5A 3DM5A 1D0ZA 1WN0A 3NMJA 4HFKB 3VYWA 3V5XA 2A68F 2R7TA 4LACB 4RD9A 4Z9HA 3TULA 3B0PA 2GDCA 3C8GD 4Z9IA 1T9KA 2RSEB 4KNVA 3EGDB 5F28E 1NSGB 5L0JA 1H9GA 4NTFA 2HJMA 1U0BB 1CPQA 2HZ8A 4PJNA 2DI3A 2XLDA 4ANJA 5B3SC 5L0HA 3GEIA 2OU6A 4OINF 5BQIA 2NUPB 3U5SA 1LE2A 4LDRA 1VK5A 1H6GA 3WHNA 3DJUB 3HNJA 1Q0KA 1V4AA 2YLIA 3M4BA 1QQ3A 2R7SA 4CS9C 1TWAA 4EBJA 1JPJA 2ZPAA 2A1DD 4WGZA 3WODF 1IW7F 2L6GA 4G7HF 3NDBB 4FX5A 2H7BA 4JJGA 3SZRA 4JTAB 4CDAA 3KMIA 4DRJB 4C7OA 1O3UA 2ZXWC 3T4RA 3GWLA 3ZQVA 4OIOF 4ZLDA 2HUJA 2YL0A 2OG2A 2KNHA 1LI7A 1J8MF 2AWCA 4IRUA 2XRHA 5EK0A 5L0GA 3LEVA 1Y4CA 1TR2A 1JMWA 1LI5A 1MMAA 1C02A 1VMAA 1YYJA 2XLVA 1E86A 4JTDB 2PFDA 2R7UA 3C62A 4N6CA 2XLWA 2VH3A 3US6A 3Q6MA 2FGYA 3IEEA 4JEBA 4CIHA 3VF0A 4CS7A 3ABLC 3C8GB 2L6HA 4NC3A 1YA9A 3VM6A 4NTAA 2EIKC 2J9WA 2QNLA 1I4ZA 1TQGA 3K1IA 3V5ZA 3K33A 4BJTA 2UUHA 2XS1A 4J7TA 3M4CA 3R2PA 4C3BA 1WTYA 4Z9JA 4WGYA 3U3BA 4IWBA 2A0UA 3FXHA 2IXMA 1OQCA 5JSLA 3NYJA 1RJ9A 5CIVA 2ZXRA 1K05A 4PJJA 2R7XA 2QUPA 5JRAA 4JVSA 3RVYA 5BQGA 2IXOA 3IPMO 5FCLA 1D0YA 2VCBA 2YL3A 2QE9A 3T9OA 3TJ6A 2XXAA 2FAPB 5JVEA 2YVKA 1M57C 1BZ4A 3I4UA 3K6BA 2NUTB 4JTCB 1LM3B 3GM1A 2OQMA 2PX3A 2EIMC 3RF3A 5COMA 1NU7D 2J9VA 1LIHA 3VRCA 1PV3A 1TWGA 3AGUA 3KL4A 3MBGA 1Z5ZA 3TQOA 3EPVA 4K1OA 4R32A 4CJGA 5BQHA 1EA8A 4CDVA 3SXKA 3U2LA 5AC5A 2IXNA 3M79A 4LERA 4RDAA
chains in the Genus database with same CATH topology
1BBHA 3IQ6A 4ER9A 2XM0A 2YKZA 3TOLA 3QW1A 5JT4A 3U8PA 4IARA 3ZQYA 2XLMA 3ZTZA 3L1MA 2XLHA 4JE9A 3C63A 2XL6A 4L6RA 1S05A 1EKYA 2XM4A 5AGFA 1A7VA 3FOPA 3NMJA 1NBBA 2XL8A 5JP7A 4CJOA 3DE8A 4IB4A 4CIPA 3HNKA 1CGNA 1CPQA 3ZTMA 2XLDA 1GQAA 3M15A 4JEAA 1YYXA 3ZWIA 5JS5A 3HNJA 3QVYA 1M6TA 2YLIA 3M4BA 1QQ3A 5JLIA 1YZAA 4WGZA 4EIYA 4CDAA 4CX9A 2J8WA 3NMIA 1JAFA 3NMKA 3ZQVA 1CPRA 2YL0A 3QVZA 3HNLA 1YYJA 2XLVA 4IAQA 1E86A 3C62A 2XLWA 3QW0A 4JEBA 2J9BA 1E85A 3HNIA 4U9DA 4NC3A 1E83A 1RCPA 3DE9A 1E84A 3M4CA 4WGYA 5JSLA 2YL7A 1APCA 2YL1A 5JRAA 5B3IA 2XLOA 1QPUA 2YL3A 4N6HA 3IQ5A 4N4WA 2YLDA 4ULVA 5JVEA 5JUAA 2CCYA 3TOMA 4D4NA 1LM3B 1YZCA 2XLEA 4CDYA 3VRCA 256BA 4JKVA 2YLGA 1CGOA 4D4XA 4U9EA 4CJGA 4CDVA 2QLAA 3FOOA 3M79A 1MQVA 2BC5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BBH A;  3IQ6 A;  4ER9 A;  2XM0 A;  2YKZ A;  3TOL A;  3QW1 A;  5JT4 A;  3U8P A;  4IAR A;  3ZQY A;  2XLM A;  3ZTZ A;  3L1M A;  2XLH A;  4JE9 A;  3C63 A;  2XL6 A;  4L6R A;  1S05 A;  1EKY A;  2XM4 A;  5AGF A;  1A7V A;  3FOP A;  3NMJ A;  1NBB A;  2XL8 A;  5JP7 A;  4CJO A;  3DE8 A;  4IB4 A;  4CIP A;  3HNK A;  1CGN A;  1CPQ A;  3ZTM A;  2XLD A;  1GQA A;  3M15 A;  4JEA A;  1YYX A;  3ZWI A;  5JS5 A;  3HNJ A;  3QVY A;  1M6T A;  2YLI A;  3M4B A;  1QQ3 A;  5JLI A;  1YZA A;  4WGZ A;  4EIY A;  4CDA A;  4CX9 A;  2J8W A;  3NMI A;  1JAF A;  3NMK A;  3ZQV A;  1CPR A;  2YL0 A;  3QVZ A;  3HNL A;  1YYJ A;  2XLV A;  4IAQ A;  1E86 A;  3C62 A;  2XLW A;  3QW0 A;  4JEB A;  2J9B A;  1E85 A;  3HNI A;  4U9D A;  4NC3 A;  1E83 A;  1RCP A;  3DE9 A;  1E84 A;  3M4C A;  4WGY A;  5JSL A;  2YL7 A;  1APC A;  2YL1 A;  5JRA A;  5B3I A;  2XLO A;  1QPU A;  2YL3 A;  4N6H A;  3IQ5 A;  4N4W A;  2YLD A;  4ULV A;  5JVE A;  5JUA A;  2CCY A;  3TOM A;  4D4N A;  1LM3 B;  1YZC A;  2XLE A;  4CDY A;  3VRC A;  256B A;  4JKV A;  2YLG A;  1CGO A;  4D4X A;  4U9E A;  4CJG A;  4CDV A;  2QLA A;  3FOO A;  3M79 A;  1MQV A;  2BC5 A; 
#chains in the Genus database with same CATH topology
 3GOD A;  3IQ6 A;  1LPE A;  3TOL A;  3GOR A;  3QW1 A;  1A0B A;  2AWY A;  2I8B A;  2J7P A;  3OWT A;  5DQT A;  4IAR A;  2LD6 A;  4EBB A;  1V55 C;  1D1C A;  3EGX B;  3H2U A;  2RD9 A;  3VAY A;  2XLM A;  3RQE A;  1ZHZ A;  5L3V A;  2VB6 A;  1FAP B;  2HKV A;  3DMD A;  3H2V A;  3JTL O;  4OIR F;  1NFN A;  3BRJ A;  1C03 A;  2GFH A;  2D5R B;  3KYI A;  4LLE A;  2XLH A;  4MVS A;  3BEH A;  3I5P A;  1B68 A;  1Q0G A;  2R7W A;  2XL6 A;  3DAF A;  1VYI A;  2HV6 A;  2OOC A;  1EKY A;  4KNW A;  3AG1 C;  2XM4 A;  1QZX A;  3EG9 A;  4O6N A;  1V54 C;  1RKE A;  2AU5 A;  2OEV A;  1A7V A;  1C17 M;  4BJ5 A;  4JJF A;  4P9F A;  4U5D E;  5E3A A;  4C3D A;  1FNT c;  2M64 A;  1YA7 O;  2V3C C;  2EIL C;  3GM2 A;  2GAQ A;  3JT1 A;  1OKK D;  2CNW A;  5JP7 A;  3U2M A;  5DLJ A;  4BEM J;  4KI2 A;  4OIQ F;  4OIP F;  1FR0 A;  1T5O A;  3ZC4 A;  4YL0 A;  2X51 A;  3NYL A;  2W4B A;  4CIP A;  3JRT A;  1SR2 A;  3HNK A;  2NSG A;  1CGN A;  2OKU A;  2YWA A;  2MHR A;  3AOU A;  1F1M A;  3HJC A;  3LES A;  2Y3H A;  4ONS A;  5COF A;  5T3W A;  3UMI A;  3ZTM A;  1R5I D;  5DQZ A;  2EIJ C;  1M2V A;  4JIO A;  1GQA A;  4QI0 A;  4XTK A;  3H65 A;  1ORJ A;  3JYH A;  5L0I A;  2M4E A;  4G7O F;  1SMY F;  3LS0 A;  3RW0 A;  2C04 A;  2DGJ A;  4MVM A;  2A0B A;  3O10 A;  4O7G A;  2R03 A;  2NPU A;  1YZA A;  1R4T A;  3SP1 A;  5KYY A;  3W8H A;  4UDV A;  2OJE D;  3AG4 C;  4YT5 A;  4PFO A;  3Q6N A;  1U89 A;  4PR9 A;  2Y39 A;  1JAF A;  1A7E A;  2L6F A;  3SEO A;  3EJN A;  3SYN A;  2HV7 A;  4NY3 A;  1MND A;  4QDL A;  5GPG B;  3EHM A;  2Y3B A;  1XZQ A;  3R7C A;  2LIG A;  4C7O B;  2EPO A;  1D1A A;  2P6V A;  3IHU A;  5E2Q A;  2L9J A;  2HSQ A;  4IAQ A;  2NG1 A;  4PFP A;  1OXB A;  3NYM A;  1VLT A;  2HFI A;  3QW0 A;  3L8J A;  4FAP B;  3HNI A;  3O6X A;  4U9D A;  3UMH A;  2LFF A;  3KPH A;  3ZG1 A;  1ZYR F;  3ASO C;  4MW8 A;  2YEV A;  2DYS C;  3K1H A;  1JPN A;  1NFO A;  1OR2 A;  2Z15 A;  1ZVZ A;  2Q3T A;  4LDK A;  4X0R A;  4YK5 A;  4E7Z A;  1E84 A;  4YT4 A;  1I4Y A;  3TD7 A;  1NG1 A;  2P61 A;  3PCV A;  1ZU4 A;  2YL7 A;  4O79 A;  1QKR A;  1D1B A;  2QTV A;  4XLN F;  2A6E F;  2ICW G;  1QPU A;  3W2W A;  1ZW2 A;  3LNR A;  4BJ5 C;  1T6Q A;  1HE9 A;  1A41 A;  4ULV A;  4P9T A;  3FVY A;  1JOG A;  3AG3 C;  1MMD A;  3Q7L A;  3K66 A;  2EPM X;  3OA1 A;  3FMS A;  2R7O A;  4J30 B;  3ZDL A;  2GA0 A;  1Y6D A;  4MW3 A;  4M63 A;  3U3F A;  1PCX A;  1ZW3 A;  2BL2 A;  5KYU A;  1NU9 C;  3EFO A;  3AQB A;  1LVK A;  2KQ9 A;  4JUR I;  5KYN A;  2EPK X;  2J0W A;  2PF4 E;  1VLS A;  2H7V C;  4JRZ A;  3T6B A;  1ZHY A;  4F4B A;  3DJN B;  4I1O B;  4BEJ A;  3MYI A;  2QLA A;  3RH3 A;  5KYX B;  2ZD9 A;  3EGD A;  3NG1 A;  3W4Y A;  1OW7 A;  5DS4 A;  1BBH A;  4XEF A;  3KKB A;  1GGQ A;  2LP4 A;  3MLG A;  3S90 A;  3G4Z A;  3KH2 A;  5A6B D;  1OXK A;  1J8Y F;  2J45 A;  4YJW A;  3U8V A;  2YQY A;  4J7Y A;  2ZXP A;  3LLK A;  1Q0F A;  4NTB A;  1QVX A;  2NUP A;  3ATP A;  4CS8 C;  4BPM A;  1T01 A;  1VOM A;  3UGP A;  1FFH A;  3T6J A;  3EH2 A;  1SF8 A;  1NLX A;  1SYQ A;  2B0J A;  1HW2 A;  4DBQ A;  5L0C A;  3JSZ A;  2NSF A;  3G4X A;  1D0X A;  3PDM P;  4JE9 A;  2KYH A;  2R7R A;  2G3V A;  3LEO A;  3UMK A;  1FMW A;  3OEO A;  1KU2 A;  1S05 A;  4L6R A;  3TJ5 A;  4U5H A;  5T3T A;  4AK9 A;  3DZA A;  2Q9C A;  4FES A;  2OJQ A;  2UUI A;  3FHD A;  3DI5 A;  1M2O A;  3HTK C;  1HW1 A;  1TKN A;  2R02 A;  1FFT C;  5A6A A;  1KNY A;  1IZM A;  2WVN A;  1QLE C;  3A11 A;  2R05 A;  5DS6 A;  3G50 A;  2XL8 A;  4CJO A;  3QZC A;  4A2N B;  2HJ3 A;  3C8G A;  3X1O A;  5KYW B;  2YRF A;  1ZHW A;  2A69 F;  1G4W R;  4XLP F;  2WL8 A;  1I5N A;  4A4A A;  3POV A;  2EPN A;  1O87 A;  1OW8 A;  4OD5 A;  3U9M A;  1AEP A;  1AUE A;  1TFK B;  3B71 A;  3ZWI A;  4BJ6 A;  4E17 A;  2J0X A;  3WG7 C;  4W8K A;  5TJ5 E;  2L7A A;  1A7D A;  3O55 A;  1KTM A;  1BR4 A;  4G78 A;  5FZT A;  1JR8 A;  1ZU5 A;  3E70 C;  4EUK B;  4YT2 A;  4AE4 B;  4HEA J;  4JC7 A;  3RFY A;  1GS9 A;  4XPX A;  4H4K C;  4EIY A;  1NZE A;  4XEV A;  5A6J A;  4CX9 A;  2ZXO A;  2J8W A;  4U5G A;  5COG A;  2PBE A;  1YVI A;  3MYF A;  3NMK A;  4G0H A;  4GQH A;  2JX0 A;  2KC3 A;  3QVZ A;  2Q00 A;  3UNG C;  2KW3 C;  3HNL A;  4MVQ A;  1LKX A;  4XWJ A;  2XS8 A;  1V74 B;  4DVY P;  5DS5 A;  2E87 A;  4MVR A;  3ASN C;  5T1D B;  5AC4 A;  3RIP A;  3JCU Q;  2Q7R A;  4EHP A;  3CQZ A;  3JZ0 A;  4MVZ A;  3UR3 C;  2J9B A;  1LS1 A;  2TMV P;  3ZIB A;  3LLI A;  3S29 A;  2AP3 A;  4QI2 A;  4EBK A;  1PD0 A;  1OR3 A;  3EGX A;  1FMV A;  2KGO A;  2W4M A;  3HLZ A;  5B1A C;  2WZL A;  3SXZ A;  2O9X A;  4CS8 A;  4IGG A;  3AQC A;  5F5H A;  5BUO A;  2P1A A;  3DAG A;  4DVZ A;  5B3I A;  1OW6 A;  5CI8 A;  3JSE O;  3NKD A;  1BR1 A;  4NCQ A;  2PNO A;  3IQ5 A;  2ETS A;  3PMR A;  5L3Q A;  3S0X A;  5JUA A;  3DKA A;  2CCY A;  4HFF B;  3TOM A;  1Q0D A;  4JW1 A;  4MS2 A;  2XSE A;  3GEH A;  4MQ9 F;  3RQG A;  4D4N A;  3S27 A;  2LSE A;  4E0H A;  1G8X A;  1ZHT A;  2XLE A;  3SNH A;  1Z3I X;  2KSF A;  3QMK A;  4MND A;  2Y3G A;  3UGO A;  2CGE A;  256B A;  2C03 A;  2YLG A;  3A9C A;  4N06 A;  4D4X A;  2P0N A;  3LJB A;  1H7I A;  3AG2 C;  1MMG A;  2L81 A;  4U9E A;  4E0I A;  3MX3 A;  5F5F A;  5EHH A;  4O6M A;  2EIN C;  1ORY A;  3RVZ A;  4AX2 A;  3FOO A;  3F46 A;  2Q4F A;  1W2W A;  1T6I A;  2WZG A;  4MTO A;  5E33 A;  1Z7Q c;  2J7P D;  1O5H A;  3RQF A;  4ER9 A;  5EGY A;  4BJ6 C;  4CBE A;  2YKZ A;  3X2Q C;  2P7V A;  3B29 A;  5JT4 A;  4U5B E;  4U5E E;  3EHN A;  5D92 A;  2WB7 A;  3ZQY A;  3EZI A;  2IYL D;  1LE4 A;  4O6Y A;  4XEK A;  4J32 B;  2AVK A;  3SXM A;  3J06 A;  1LS4 A;  1M56 C;  1RJ9 B;  2LK4 A;  3U0C A;  4KBL A;  3L1M A;  4JCH A;  1XZP A;  3GEE A;  5HV9 A;  3C18 A;  4MTF A;  1G4U S;  4DXW A;  3C63 A;  3F47 A;  2X0C A;  3C7J A;  4P6I C;  1RKC A;  3E9V A;  1ZZP A;  2XXA B;  2OEX A;  3C8Z A;  4IAO A;  4BJ1 A;  3EH1 A;  1TWH A;  3ITF A;  4ULW A;  2H8A A;  3W2V A;  1HMD A;  1VB5 A;  1BDJ B;  3K7D A;  3KYJ A;  4EWC A;  1PD1 A;  2I15 A;  2VCC A;  1Z23 A;  4HE8 D;  1Z63 A;  2CNW D;  3FOP A;  2PP4 A;  4EKW A;  2IM8 A;  3DXJ F;  1NBB A;  1K40 A;  2LFD A;  3DE8 A;  4K0D A;  1VYK A;  4IB4 A;  4OD4 A;  4U5C E;  4U5F E;  1OKK A;  2HMQ A;  3LUT B;  2MWQ A;  4DJ9 A;  4YWQ A;  4G7Z F;  4GEH A;  3CSK A;  4K7B A;  4PJM A;  2FFH A;  2JD3 A;  2BE5 F;  4C3E A;  5L0F A;  4CSA A;  1AVO B;  1YAU O;  4DRH B;  2LQG A;  2VCA A;  3M15 A;  4JEA A;  1L3P A;  1YYX A;  1DOW A;  3LS1 A;  4WAB A;  4MTG A;  4WJ0 A;  4XPW A;  3DD7 A;  5JS5 A;  1GM5 A;  4Q5S F;  3QTH A;  2CDQ A;  3QVY A;  4PAC A;  1M6T A;  1QSP A;  5D91 A;  5JLI A;  1E2X A;  3V7O A;  1WOL A;  1FTS A;  2ASR A;  4E18 A;  3ABK C;  4MVU A;  2B0H A;  3NMI A;  4W8P A;  3EG9 B;  4ZLC A;  3CAX A;  1CPR A;  3N0T A;  3B0V C;  1RKE B;  2CW0 F;  2DB4 A;  2XL4 A;  2W45 A;  5CI9 A;  3W8I A;  3NRH A;  4YT8 A;  3ECS A;  3FAP B;  3S84 A;  4I1M A;  1Q0M A;  1ORS C;  4LLC A;  5DVW A;  4BG0 A;  1HY5 A;  1RMV A;  3AGT A;  1ZHX A;  2KK1 A;  4XPY A;  5L0D A;  2LCH A;  2G3K A;  1H9T A;  5K0I A;  5E3C A;  1SZI A;  4Q7C A;  1BR2 A;  1DOV A;  3FAJ A;  3IQT A;  5B1B C;  5KYX A;  2KJG A;  2F22 A;  1G5Z A;  4H54 A;  1E85 A;  3TK0 A;  3JYY A;  1TFO B;  5IY5 C;  1E83 A;  1YLM A;  2QY9 A;  3SXY A;  3L0I A;  3GM3 A;  3B0U X;  1RCP A;  2EPL X;  3DE9 A;  3N2Z B;  4KC9 A;  1OCZ C;  1S7Z A;  2A6H F;  1L7C A;  1M2V B;  1WAT A;  2HSB A;  2Y69 C;  2YHS A;  3LAY A;  4I3M A;  4B6I A;  2CYD A;  3O39 A;  1U6H A;  3EQL F;  1JRA A;  1UFB A;  2IXP A;  3EZH A;  4IJJ A;  4PJL A;  4XQ1 A;  4YL3 A;  3S28 A;  1APC A;  1TWC A;  2YL1 A;  4DOZ A;  5A6K A;  1N1C A;  1YAR O;  3FDQ A;  2NUT A;  2MYS A;  1RXQ A;  1XWJ A;  2PX0 A;  2XLO A;  2HMZ A;  2V26 A;  2R25 A;  3HKK A;  4Q4Z F;  3CEX A;  4N6H A;  5KYY B;  2VC9 A;  1CGM E;  1WGW A;  3GAN A;  4N4W A;  4DBR A;  4LDQ A;  2OCC C;  1YDI A;  2YLD A;  1VTM P;  3T6G B;  4DRI B;  4AL0 A;  4CS9 A;  2J9U A;  4JCZ A;  2IOQ A;  1YZC A;  1ST6 A;  4CDY A;  1T6U A;  3I5Q A;  4FWV A;  2YZS A;  3IQC A;  1MMN A;  1CGO A;  1UG7 A;  3MFN A;  4JKV A;  3M1C B;  1Z6A A;  2Q9A A;  2WVQ A;  4AL1 A;  1K04 A;  4JZA A;  4YL1 A;  4PK4 A;  5HSW A;  2GWW A;  4CSA C;  3Q7G A;  3ABM C;  1OCC C;  2IBF A;  1MQV A;  2BC5 A;  2XM0 A;  5KYW A;  3ZSU A;  2Y3D A;  2R7V A;  2D4U A;  2JPU A;  3K1I C;  1OCR C;  3U8P A;  4MVO A;  4YN0 B;  4RBN A;  5A6B A;  3LNM B;  3B9Q A;  3ZTZ A;  3GWN A;  2H7O A;  1HE1 A;  3V5Y A;  2R7Q A;  2WVO A;  2Q9B A;  1EI7 A;  2G62 A;  3S9O A;  3U9J A;  3DWW A;  4I44 A;  4NQF A;  3WAQ A;  4AE4 A;  3L8I A;  3PHF 2;  2W9Y A;  2VAS A;  3AJM A;  1EQ1 A;  1WWP A;  1WAS A;  1MNE A;  2R9R B;  3NKE A;  5A69 A;  1OCO C;  3RYL A;  5AGF A;  3RKO F;  4GYT A;  3L34 A;  2WZF A;  3N24 A;  2J46 A;  3DM9 B;  4E7S A;  1YJG A;  1HMO A;  2DYR C;  3ZVR A;  5KYU B;  3EFO B;  3CZ6 A;  3JRM O;  2HS5 A;  3DM5 A;  1D0Z A;  1WN0 A;  3NMJ A;  4HFK B;  3VYW A;  3V5X A;  2A68 F;  2R7T A;  4LAC B;  4RD9 A;  4Z9H A;  3TUL A;  3B0P A;  2GDC A;  3C8G D;  4Z9I A;  1T9K A;  2RSE B;  4KNV A;  3EGD B;  5F28 E;  1NSG B;  5L0J A;  1H9G A;  4NTF A;  2HJM A;  1U0B B;  1CPQ A;  2HZ8 A;  4PJN A;  2DI3 A;  2XLD A;  4ANJ A;  5B3S C;  5L0H A;  3GEI A;  2OU6 A;  4OIN F;  5BQI A;  2NUP B;  3U5S A;  1LE2 A;  4LDR A;  1VK5 A;  1H6G A;  3WHN A;  3DJU B;  3HNJ A;  1Q0K A;  1V4A A;  2YLI A;  3M4B A;  1QQ3 A;  2R7S A;  4CS9 C;  1TWA A;  4EBJ A;  1JPJ A;  2ZPA A;  2A1D D;  4WGZ A;  3WOD F;  1IW7 F;  2L6G A;  4G7H F;  3NDB B;  4FX5 A;  2H7B A;  4JJG A;  3SZR A;  4JTA B;  4CDA A;  3KMI A;  4DRJ B;  4C7O A;  1O3U A;  2ZXW C;  3T4R A;  3GWL A;  3ZQV A;  4OIO F;  4ZLD A;  2HUJ A;  2YL0 A;  2OG2 A;  2KNH A;  1LI7 A;  1J8M F;  2AWC A;  4IRU A;  2XRH A;  5EK0 A;  5L0G A;  3LEV A;  1Y4C A;  1TR2 A;  1JMW A;  1LI5 A;  1MMA A;  1C02 A;  1VMA A;  1YYJ A;  2XLV A;  1E86 A;  4JTD B;  2PFD A;  2R7U A;  3C62 A;  4N6C A;  2XLW A;  2VH3 A;  3US6 A;  3Q6M A;  2FGY A;  3IEE A;  4JEB A;  4CIH A;  3VF0 A;  4CS7 A;  3ABL C;  3C8G B;  2L6H A;  4NC3 A;  1YA9 A;  3VM6 A;  4NTA A;  2EIK C;  2J9W A;  2QNL A;  1I4Z A;  1TQG A;  3K1I A;  3V5Z A;  3K33 A;  4BJT A;  2UUH A;  2XS1 A;  4J7T A;  3M4C A;  3R2P A;  4C3B A;  1WTY A;  4Z9J A;  4WGY A;  3U3B A;  4IWB A;  2A0U A;  3FXH A;  2IXM A;  1OQC A;  5JSL A;  3NYJ A;  1RJ9 A;  5CIV A;  2ZXR A;  1K05 A;  4PJJ A;  2R7X A;  2QUP A;  5JRA A;  4JVS A;  3RVY A;  5BQG A;  2IXO A;  3IPM O;  5FCL A;  1D0Y A;  2VCB A;  2YL3 A;  2QE9 A;  3T9O A;  3TJ6 A;  2XXA A;  2FAP B;  5JVE A;  2YVK A;  1M57 C;  1BZ4 A;  3I4U A;  3K6B A;  2NUT B;  4JTC B;  1LM3 B;  3GM1 A;  2OQM A;  2PX3 A;  2EIM C;  3RF3 A;  5COM A;  1NU7 D;  2J9V A;  1LIH A;  3VRC A;  1PV3 A;  1TWG A;  3AGU A;  3KL4 A;  3MBG A;  1Z5Z A;  3TQO A;  3EPV A;  4K1O A;  4R32 A;  4CJG A;  5BQH A;  1EA8 A;  4CDV A;  3SXK A;  3U2L A;  5AC5 A;  2IXN A;  3M79 A;  4LER A;  4RDA A; 
#chains in the Genus database with same CATH homology
 1BBH A;  3IQ6 A;  4ER9 A;  2XM0 A;  2YKZ A;  3TOL A;  3QW1 A;  5JT4 A;  3U8P A;  4IAR A;  3ZQY A;  2XLM A;  3ZTZ A;  3L1M A;  2XLH A;  4JE9 A;  3C63 A;  2XL6 A;  4L6R A;  1S05 A;  1EKY A;  2XM4 A;  5AGF A;  1A7V A;  3FOP A;  3NMJ A;  1NBB A;  2XL8 A;  5JP7 A;  4CJO A;  3DE8 A;  4IB4 A;  4CIP A;  3HNK A;  1CGN A;  1CPQ A;  3ZTM A;  2XLD A;  1GQA A;  3M15 A;  4JEA A;  1YYX A;  3ZWI A;  5JS5 A;  3HNJ A;  3QVY A;  1M6T A;  2YLI A;  3M4B A;  1QQ3 A;  5JLI A;  1YZA A;  4WGZ A;  4EIY A;  4CDA A;  4CX9 A;  2J8W A;  3NMI A;  1JAF A;  3NMK A;  3ZQV A;  1CPR A;  2YL0 A;  3QVZ A;  3HNL A;  1YYJ A;  2XLV A;  4IAQ A;  1E86 A;  3C62 A;  2XLW A;  3QW0 A;  4JEB A;  2J9B A;  1E85 A;  3HNI A;  4U9D A;  4NC3 A;  1E83 A;  1RCP A;  3DE9 A;  1E84 A;  3M4C A;  4WGY A;  5JSL A;  2YL7 A;  1APC A;  2YL1 A;  5JRA A;  5B3I A;  2XLO A;  1QPU A;  2YL3 A;  4N6H A;  3IQ5 A;  4N4W A;  2YLD A;  4ULV A;  5JVE A;  5JUA A;  2CCY A;  3TOM A;  4D4N A;  1LM3 B;  1YZC A;  2XLE A;  4CDY A;  3VRC A;  256B A;  4JKV A;  2YLG A;  1CGO A;  4D4X A;  4U9E A;  4CJG A;  4CDV A;  2QLA A;  3FOO A;  3M79 A;  1MQV A;  2BC5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...