5JS5A

Nitric oxide complex of the l16f mutant of cytochrome c prime from alcaligenes xylosoxidans
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
125
structure length
125
Chain Sequence
EFAKPEDAVKYRQSAFTLMASHFGRMTPVVKGQAPYDAAQIKANVEVLKTLSALPWAAFGPGTEGGDARPEIWSDAASFKQKQQAFQDNIVKLSAAADAGDLDKLRAAFGDVGASCKACHDAYRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords Cytochrome c'
publication title Engineering proximal vs. distal heme-NO coordination via dinitrosyl dynamics: implications for NO sensor design.
pubmed doi rcsb
source organism Alcaligenes xylosoxydans xylosoxydans
total genus 48
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2016-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01322 Cytochrom_C_2 Cytochrome C'
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 5js5A00
2XM0A 5JRAA 4CIPA 2XLEA 5JSLA 3QW1A 2YL3A 4WGYA 3ZTMA 2XLOA 5JUAA 4CJOA 3DE9A 3C63A 2QLAA 4N6HA 1E86A 2YL0A 2XLHA 4JEAA 3ZTZA 3ZWIA 4CJGA 1EKYA 5JLIA 2YLDA 4ER9A 1YYXA 3VRCA 1E85A 1LM3B 3ZQVA 3FOOA 3NMJA 2XLWA 1E83A 1E84A 3M79A 3QVYA 4NC3A 3TOLA 4CDYA 4CDAA 3M15A 1QPUA 1YZAA 1S05A 2XLMA 4L6RA 2YL7A 1CGNA 2XM4A 4WGZA 5JT4A 3HNIA 2J9BA 3QVZA 4CX9A 4ULVA 3IQ5A 4N4WA 1CGOA 2YLIA 5JVEA 1GQAA 4U9EA 2XLVA 5JS5A 4JE9A 1MQVA 3DE8A 3ZQYA 4JKVA 4D4NA 1CPQA 2YL1A 3IQ6A 1BBHA 4IARA 1QQ3A 2CCYA 3HNKA 1M6TA 3TOMA 2YLGA 3U8PA 1CPRA 4JEBA 3FOPA 1NBBA 3NMIA 3C62A 4D4XA 3M4CA 3M4BA 3HNJA 1YYJA 3HNLA 4U9DA 2XLDA 1RCPA 2XL6A 5B3IA 3QW0A 4IAQA 1JAFA 2BC5A 1YZCA 2XL8A 2YKZA 4EIYA 4CDVA 2J8WA 256BA 5JP7A 1APCA 5AGFA 3NMKA 3L1MA 1A7VA 4IB4A
chains in the Genus database with same CATH superfamily
2HSQA 4U5EE 2D4UA 5HSWA 2R7XA 2IXMA 2P61A 2XLEA 4YL1A 5BQGA 2R7UA 5A6KA 2WZGA 4MS2A 1TWAA 1FAPB 1HE9A 4XLNF 4KI2A 1NU7D 2O9XA 3JTLO 5HV9A 4BJ6C 4Q4ZF 3KKBA 4WGYA 3ZTMA 3DKAA 4E7ZA 1Q0FA 5JUAA 1V55C 2J9WA 3MYFA 1OQCA 3T6BA 5IY5C 2XSEA 1FTSA 1D0ZA 2KQ9A 4C7OA 3C63A 4W8KA 3LS1A 2Y3BA 4CBEA 1FMWA 3JZ0A 4G7OF 5KYXB 2YL0A 1EKYA 4EKWA 1MNEA 1K40A 2CDQA 2ZXOA 3DXJF 3GWNA 5JLIA 2MYSA 3I5QA 4ZLDA 3CEXA 4XWJA 1YYXA 3EG9B 4O6NA 5KYYA 4DVZA 2J0WA 3KL4A 4JZAA 1E83A 4BJ6A 1RMVA 1FFTC 2PX3A 4YJWA 2IM8A 3MFNA 4YL0A 3SYNA 2C03A 4CSAA 4CIHA 4DRJB 3QVYA 3TOLA 4C3EA 5T1DB 4CDYA 4ONSA 1WOLA 1QPUA 1L7CA 2HMZA 2OU6A 2Q9AA 3KMIA 3M15A 4MW3A 4MW8A 5L0CA 5TJ5E 1WWPA 1S05A 1RJ9B 1VYKA 2HV7A 4U5BE 1LS1A 2Y39A 4K1OA 4PJJA 3DAFA 3NYJA 5CI8A 5FZTA 2XM4A 2VASA 4XEFA 1AVOB 2YWAA 3H2VA 1EA8A 3L8IA 3WODF 1A7EA 1GS9A 3IPMO 2YVKA 3QVZA 4LDRA 4XEVA 3DJNB 2KGOA 2WVQA 3IQ5A 4J32B 3WAQA 4CX9A 3ASOC 2AU5A 4ULWA 3RKOF 3ZDLA 1IZMA 2NG1A 1ZZPA 3QMKA 1XWJA 3A9CA 4C3DA 5L0GA 2G3KA 4MTFA 2OCCC 1Z3IX 2IXNA 4YT8A 2LCHA 2P1AA 1M2OA 5DS6A 2XRHA 1WATA 5F5HA 2YRFA 2M4EA 1ZHTA 3B9QA 2OJED 3LNMB 2H7VC 2R7WA 2PF4E 4D4NA 2JX0A 1CPQA 1K04A 3S9OA 1RKEA 1D0XA 2CNWA 1BBHA 5L0IA 2J9VA 1D1BA 2LFDA 1K05A 1H6GA 3FMSA 1M6TA 1MMDA 3C8GD 4A4AA 5A6BA 1T5OA 2RSEB 4JC7A 1KNYA 4G78A 4HE8D 1JMWA 5F28E 4Z9HA 2Q7RA 3US6A 5EGYA 3B71A 1CPRA 3NRHA 4LLEA 3KH2A 2GDCA 4DVYP 1U6HA 2IXPA 1NBBA 4U5FE 1KU2A 1QZXA 3NMIA 3C62A 1BR2A 1OCOC 2CW0F 3M4CA 4OIQF 4A2NB 4DBQA 4JIOA 4QI2A 1T6QA 3E9VA 2HV6A 4I3MA 5DQZA 1O87A 4BPMA 3GEIA 1B68A 2GAQA 1RKCA 3F46A 1O3UA 2UUIA 3HNLA 4EUKB 2R03A 2ZPAA 4Z9IA 2LK4A 2PFDA 1RCPA 1Z23A 3S27A 4DRIB 4X0RA 2B0JA 2LFFA 4MVMA 1D0YA 4JVSA 4IAQA 3TULA 3UGOA 1HW2A 2E87A 1G5ZA 2YKZA 1JPNA 1Q0DA 1YAUO 2QNLA 3GWLA 3AGTA 3O10A 3SEOA 2J8WA 2EIKC 2M64A 1FFHA 1YARO 4E7SA 3AOUA 1W2WA 2HJMA 2ICWG 3NMKA 3JSEO 4OIPF 1OXKA 4J7YA 3UMHA 1OKKD 3ECSA 2XM0A 3NKEA 3U5SA 1ZHWA 1IW7F 2Q9CA 1BZ4A 2W4MA 3SXZA 3V5YA 4DJ9A 5JRAA 1HY5A 2A6EF 4JTDB 3E70C 4MVUA 2HFIA 1BDJB 2L7AA 2LSEA 4MVQA 3WG7C 1FMVA 2YL3A 5CI9A 4BJTA 3ZG1A 2DYRC 3O55A 5COMA 4XLPF 4IRUA 5COGA 2AWCA 5D92A 4CJOA 1YDIA 3TQOA 4JJGA 5AC4A 3M1CB 3TD7A 4N6HA 2VCAA 3GM3A 5A69A 2PBEA 1OW6A 4O6MA 4OINF 3DZAA 3U3FA 3RH3A 1Z6AA 1HMDA 3VAYA 2NSFA 4KNWA 1CGME 2J7PA 4NTBA 3VRCA 1O5HA 1LM3B 5D91A 2CYDA 3AG2C 1H7IA 2XLWA 1N1CA 3ASNC 3O6XA 2VCCA 5L0HA 4DOZA 4XQ1A 4HFFB 4P9TA 3ZVRA 1C17M 2VB6A 3RIPA 3M79A 3OA1A 3GM1A 3DI5A 4XTKA 2ZXWC 1RKEB 5E2QA 3LLKA 3V7OA 1OCZC 4DRHB 4J7TA 1A41A 1DOWA 3Q6MA 2LD6A 3R7CA 5EK0A 1OCRC 3LLIA 4W8PA 3T6JA 3GANA 2WL8A 1HE1A 3NG1A 2IXOA 3A11A 1JRAA 3GEEA 5JT4A 4J30B 2Q9BA 2W45A 4IAOA 3K1HA 4JCHA 4LDKA 4EBJA 2Z15A 1YVIA 2EINC 2Y69C 3SZRA 2GA0A 2P0NA 4FWVA 4ULVA 3UNGC 3VYWA 4GEHA 4CS8A 3EHNA 2YLIA 4BJ1A 2DI3A 4BEMJ 1LPEA 1VB5A 2XLVA 2R7VA 2WVOA 1MQVA 3EZHA 1Y6DA 3DE8A 4PJNA 5DQTA 5A6AA 1UFBA 2XXAA 3CQZA 1VYIA 1ZW3A 1TR2A 2AVKA 1NFNA 2WZLA 2ZD9A 4YT4A 1QQ3A 2R25A 2NUPB 3F47A 2AWYA 2KC3A 1VLTA 1G4US 1TFKB 4MQ9F 2OJQA 4MVSA 4Z9JA 3U8VA 1ZU5A 1BR1A 3HNKA 5A6JA 5EHHA 1YA7O 1T9KA 3ABLC 3TOMA 1VOMA 3S0XA 2YLGA 1JR8A 4CS7A 4HFKB 4JEBA 1R5ID 1BR4A 3FOPA 1ZVZA 1RXQA 2A69F 3AJMA 3PCVA 1WN0A 2H7OA 3DWWA 4D4XA 4RD9A 2AP3A 5B1BC 3UMKA 3MLGA 2H8AA 2ETSA 3PMRA 4WABA 2GWWA 3U2MA 1F1MA 2IBFA 2Q4FA 3HJCA 4PFPA 1G8XA 1TWHA 2XLDA 3IQTA 2XL6A 3BRJA 4YN0B 3U9JA 2GFHA 1J8MF 4YWQA 3ZSUA 5B3IA 4I44A 3HLZA 4O6YA 4AX2A 2MHRA 2OG2A 2XL8A 5K0IA 3N2ZB 4CDVA 1NU9C 4NTAA 5KYWA 1MMNA 3MX3A 3IHUA 4K7BA 3SNHA 1WASA 1Z7Qc 1QVXA 1V74B 3U0CA 1JOGA 2YEVA 5AGFA 3L1MA 1R4TA 1M56C 2ZXRA 3EPVA 2J45A 4IB4A 1OXBA 1PD1A 5B1AC 1LS4A 1YLMA 4F4BA 1M2VA 5KYYB 5B3SC 2KK1A 1DOVA 1ZU4A 2KJGA 3DAGA 5JSLA 4EBKA 4XEKA 1E2XA 3AQBA 1LKXA 3QW1A 1KTMA 1SZIA 3QTHA 5F5FA 3V5XA 2QE9A 1UG7A 2PX0A 3W8IA 4O79A 2XLOA 3LEOA 3T6GB 1LIHA 2DGJA 1OR2A 3LS0A 3Q7LA 2R7RA 1LVKA 3PHF2 1V4AA 1T6UA 2NUPA 3DE9A 4OIOF 2QLAA 3C8GA 3X2QC 3N0TA 4RBNA 3CSKA 3RQEA 2I15A 3EZIA 3Q7GA 2HSBA 3TJ5A 4Q7CA 3GM2A 4MVRA 1XZPA 4DXWA 2G62A 3ZTZA 3L8JA 2WZFA 4LLCA 1PCXA 3ZWIA 2YLDA 4CJGA 3W2VA 4C3BA 1U0BB 4ER9A 3VF0A 2NPUA 3IQCA 4YK5A 3ZQVA 1A0BA 3ABKC 5DS5A 2RD9A 3K66A 4AL1A 4UDVA 5AC5A 2R7TA 3V5ZA 3EFOA 5E3CA 4PR9A 3VM6A 2XXAB 1T01A 2HJ3A 2UUHA 3B0VC 3B0PA 4CDAA 2HUJA 2QTVA 3S28A 1YZAA 2NSGA 1VMAA 4AE4A 1A7DA 1V54C 3GEHA 1LE4A 1OW8A 4PJMA 3EJNA 5L0JA 3PDMP 4L6RA 4FX5A 3DMDA 2JD3A 1QLEC 1QKRA 4WGZA 3HNIA 5BQHA 1SR2A 4MTOA 4MTGA 4IJJA 4OD5A 3LAYA 2EPMX 1CGOA 1C03A 2NUTA 4NQFA 3S90A 1OKKA 2L6GA 2PNOA 2Q00A 3C8ZA 1I5NA 3RQGA 3RW0A 5JVEA 2MWQA 1VTMP 1GQAA 2EPKX 2L6HA 2A1DD 4YT5A 4U9EA 1YJGA 2DYSC 2HZ8A 3WHNA 4G0HA 4N6CA 5JS5A 3DD7A 4XPWA 3UGPA 4LDQA 4JE9A 2VCBA 4E0IA 2JPUA 3C18A 3EH1A 4JW1A 2R7SA 2A0BA 1XZQA 2YL1A 3IQ6A 3EGDA 3L34A 4EWCA 1SMYF 5L0FA 4JRZA 4IARA 1Y4CA 1EQ1A 3Q6NA 2CCYA 5KYWB 4U5DE 2VH3A 2ZXPA 1Q0KA 1NSGB 3R2PA 3SXYA 1TQGA 2OOCA 3RVYA 3HKKA 3EGXA 3U8PA 4B6IA 3QZCA 1I4ZA 1NLXA 3GORA 3S29A 1VK5A 4K0DA 4QDLA 2L81A 2OQMA 2YQYA 3EHMA 1OR3A 1M2VB 3S84A 4AL0A 3X1OA 3RF3A 1LI5A 3M4BA 3N24A 3I4UA 3HNJA 2P7VA 3K1IC 2R05A 4ANJA 3B0UX 3LESA 2OKUA 4HEAJ 4LACB 4CSAC 4U9DA 4BEJA 3AG3C 5L3VA 3GODA 5GPGB 5T3WA 4G7HF 4CS9A 1WGWA 4U5CE 2KYHA 1JAFA 3ZC4A 1YZCA 2LP4A 3FAJA 3RVZA 3C8GB 1WTYA 1SYQA 3I5PA 4KC9A 4E17A 4H4KC 256BA 3H2UA 5JP7A 4XPXA 1I4YA 1ST6A 4U5GA 1ZW2A 4ZLCA 3EH2A 1APCA 3FVYA 4YT2A 4CS9C 1QSPA 2HMQA 3G50A 3TJ6A 1NG1A 2EPOA 5T3TA 3U3BA 4PK4A 3U9MA 3FDQA 3ATPA 3MBGA 2I8BA 2L9JA 4CIPA 5L3QA 2Y3HA 3LNRA 3RYLA 4EBBA 2A6HF 3K1IA 4MVZA 5FCLA 2WVNA 1ZHYA 4LERA 3EFOB 4QI0A 1T6IA 2WB7A 3H65A 3FAPB 4P9FA 1ORYA 3DJUB 5CIVA 1G4WR 3POVA 1NZEA 2YZSA 2J0XA 2PP4A 3G4ZA 3KYJA 1Q0GA 2BL2A 3AG1C 3U2LA 2EILC 3K6BA 4AE4B 1PD0A 2CNWD 5KYUA 4NCQA 4M63A 4OD4A 4AK9A 1FNTc 1ORSC 2CGEA 4EHPA 1ORJA 2KW3C 2OEVA 3SP1A 4JURI 2F22A 4MVOA 3W2WA 4E0HA 2W9YA 2V3CC 4GQHA 1E86A 5A6BD 4JJFA 3ABMC 4O7GA 1Q0MA 2XLHA 3C7JA 4JEAA 2OEXA 4H54A 2NUTB 1ZHZA 3LEVA 3FHDA 2BE5F 3NKDA 1E85A 3AGUA 3BEHA 3FOOA 3NMJA 4N06A 1ZHXA 3L0IA 1D1AA 1GGQA 1Z5ZA 2H7BA 5BQIA 1L3PA 5BUOA 3UR3C 2FGYA 4KBLA 5DVWA 2V26A 5E33A 3JRTA 1E84A 2HKVA 4NC3A 3K7DA 4XPYA 3EGDB 4P6IC 3O39A 2P6VA 2B0HA 3K33A 1HMOA 1JPJA 1AUEA 4FESA 3RQFA 3RFYA 2XLMA 1OW7A 3W4YA 2VC9A 4IGGA 5DLJA 2YL7A 1EI7A 1CGNA 5KYNA 2QUPA 3EQLF 2J9BA 3EGXB 4JTCB 3CZ6A 1AEPA 5KYXA 4N4WA 1VLSA 2J46A 3JRMO 5COFA 4MNDA 4Q5SF 3SXMA 1C02A 3T9OA 3EG9A 2YHSA 5DS4A 1Z63A 2IOQA 1TFOB 2XL4A 3G4XA 1U89A 3ZQYA 3KYIA 1MMGA 4JKVA 4IWBA 2HS5A 4PFOA 3HTKC 3NDBB 1D1CA 3AQCA 1SF8A 2IYLD 4E18A 2XS8A 3W8HA 2R7OA 2KNHA 4I1OB 5E3AA 2L6FA 1H9TA 1RJ9A 2ASRA 1ZYRF 3UMIA 2TMVP 3SXKA 4PACA 1LE2A 4DBRA 1LI7A 1OCCC 1S7ZA 2LQGA 4RDAA 1TWGA 2DB4A 2R9RB 3JCUQ 4BJ5C 1TKNA 4R32A 3J06A 3LUTB 2X51A 1NFOA 2J9UA 2Q3TA 2R7QA 3JSZA 2C04A 3JT1A 3OEOA 1TWCA 2G3VA 3OWTA 4I1MA 4JCZA 4JTAB 3T4RA 1J8YF 3LJBA 1MMAA 2J7PD 4KNVA 2LIGA 4NTFA 2KSFA 3FXHA 1H9GA 2Y3GA 4C7OB 4GYTA 3B29A 1FR0A 1YYJA 2W4BA 1MNDA 1HW1A 2EIMC 4BG0A 2QY9A 2XS1A 3DM9B 3JYHA 4PJLA 3ZIBA 1M57C 4OIRF 3TK0A 3KPHA 2FFHA 5KYUB 4G7ZF 3QW0A 1GM5A 3JYYA 2BC5A 3CAXA 2EPLX 4EIYA 3NYMA 1YA9A 4BJ5A 4YL3A 2R02A 2A0UA 3DM5A 3ITFA 4U5HA 3AG4C 3IEEA 2Y3DA 5L0DA 1PV3A 4NY3A 2FAPB 2EPNA 3MYIA 4WJ0A 4FAPB 2D5RB 1A7VA 3NYLA 2X0CA 4CS8C 2EIJC 2A68F
chains in the Genus database with same CATH topology
2XM0A 5JRAA 4CIPA 2XLEA 5JSLA 3QW1A 2YL3A 4WGYA 3ZTMA 2XLOA 5JUAA 4CJOA 3DE9A 3C63A 2QLAA 4N6HA 1E86A 2YL0A 2XLHA 4JEAA 3ZTZA 3ZWIA 4CJGA 1EKYA 5JLIA 2YLDA 4ER9A 1YYXA 3VRCA 1E85A 1LM3B 3ZQVA 3FOOA 3NMJA 2XLWA 1E83A 1E84A 3M79A 3QVYA 4NC3A 3TOLA 4CDYA 4CDAA 3M15A 1QPUA 1YZAA 1S05A 2XLMA 4L6RA 2YL7A 1CGNA 2XM4A 4WGZA 5JT4A 3HNIA 2J9BA 3QVZA 4CX9A 4ULVA 3IQ5A 4N4WA 1CGOA 2YLIA 5JVEA 1GQAA 4U9EA 2XLVA 5JS5A 4JE9A 1MQVA 3DE8A 3ZQYA 4JKVA 4D4NA 1CPQA 2YL1A 3IQ6A 1BBHA 4IARA 1QQ3A 2CCYA 3HNKA 1M6TA 3TOMA 2YLGA 3U8PA 1CPRA 4JEBA 3FOPA 1NBBA 3NMIA 3C62A 4D4XA 3M4CA 3M4BA 3HNJA 1YYJA 3HNLA 4U9DA 2XLDA 1RCPA 2XL6A 5B3IA 3QW0A 4IAQA 1JAFA 2BC5A 1YZCA 2XL8A 2YKZA 4EIYA 4CDVA 2J8WA 256BA 5JP7A 1APCA 5AGFA 3NMKA 3L1MA 1A7VA 4IB4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XM0 A;  5JRA A;  4CIP A;  2XLE A;  5JSL A;  3QW1 A;  2YL3 A;  4WGY A;  3ZTM A;  2XLO A;  5JUA A;  4CJO A;  3DE9 A;  3C63 A;  2QLA A;  4N6H A;  1E86 A;  2YL0 A;  2XLH A;  4JEA A;  3ZTZ A;  3ZWI A;  4CJG A;  1EKY A;  5JLI A;  2YLD A;  4ER9 A;  1YYX A;  3VRC A;  1E85 A;  1LM3 B;  3ZQV A;  3FOO A;  3NMJ A;  2XLW A;  1E83 A;  1E84 A;  3M79 A;  3QVY A;  4NC3 A;  3TOL A;  4CDY A;  4CDA A;  3M15 A;  1QPU A;  1YZA A;  1S05 A;  2XLM A;  4L6R A;  2YL7 A;  1CGN A;  2XM4 A;  4WGZ A;  5JT4 A;  3HNI A;  2J9B A;  3QVZ A;  4CX9 A;  4ULV A;  3IQ5 A;  4N4W A;  1CGO A;  2YLI A;  5JVE A;  1GQA A;  4U9E A;  2XLV A;  5JS5 A;  4JE9 A;  1MQV A;  3DE8 A;  3ZQY A;  4JKV A;  4D4N A;  1CPQ A;  2YL1 A;  3IQ6 A;  1BBH A;  4IAR A;  1QQ3 A;  2CCY A;  3HNK A;  1M6T A;  3TOM A;  2YLG A;  3U8P A;  1CPR A;  4JEB A;  3FOP A;  1NBB A;  3NMI A;  3C62 A;  4D4X A;  3M4C A;  3M4B A;  3HNJ A;  1YYJ A;  3HNL A;  4U9D A;  2XLD A;  1RCP A;  2XL6 A;  5B3I A;  3QW0 A;  4IAQ A;  1JAF A;  2BC5 A;  1YZC A;  2XL8 A;  2YKZ A;  4EIY A;  4CDV A;  2J8W A;  256B A;  5JP7 A;  1APC A;  5AGF A;  3NMK A;  3L1M A;  1A7V A;  4IB4 A; 
#chains in the Genus database with same CATH topology
 2HSQ A;  4U5E E;  2D4U A;  5HSW A;  2R7X A;  2IXM A;  2P61 A;  2XLE A;  4YL1 A;  5BQG A;  2R7U A;  5A6K A;  2WZG A;  4MS2 A;  1TWA A;  1FAP B;  1HE9 A;  4XLN F;  4KI2 A;  1NU7 D;  2O9X A;  3JTL O;  5HV9 A;  4BJ6 C;  4Q4Z F;  3KKB A;  4WGY A;  3ZTM A;  3DKA A;  4E7Z A;  1Q0F A;  5JUA A;  1V55 C;  2J9W A;  3MYF A;  1OQC A;  3T6B A;  5IY5 C;  2XSE A;  1FTS A;  1D0Z A;  2KQ9 A;  4C7O A;  3C63 A;  4W8K A;  3LS1 A;  2Y3B A;  4CBE A;  1FMW A;  3JZ0 A;  4G7O F;  5KYX B;  2YL0 A;  1EKY A;  4EKW A;  1MNE A;  1K40 A;  2CDQ A;  2ZXO A;  3DXJ F;  3GWN A;  5JLI A;  2MYS A;  3I5Q A;  4ZLD A;  3CEX A;  4XWJ A;  1YYX A;  3EG9 B;  4O6N A;  5KYY A;  4DVZ A;  2J0W A;  3KL4 A;  4JZA A;  1E83 A;  4BJ6 A;  1RMV A;  1FFT C;  2PX3 A;  4YJW A;  2IM8 A;  3MFN A;  4YL0 A;  3SYN A;  2C03 A;  4CSA A;  4CIH A;  4DRJ B;  3QVY A;  3TOL A;  4C3E A;  5T1D B;  4CDY A;  4ONS A;  1WOL A;  1QPU A;  1L7C A;  2HMZ A;  2OU6 A;  2Q9A A;  3KMI A;  3M15 A;  4MW3 A;  4MW8 A;  5L0C A;  5TJ5 E;  1WWP A;  1S05 A;  1RJ9 B;  1VYK A;  2HV7 A;  4U5B E;  1LS1 A;  2Y39 A;  4K1O A;  4PJJ A;  3DAF A;  3NYJ A;  5CI8 A;  5FZT A;  2XM4 A;  2VAS A;  4XEF A;  1AVO B;  2YWA A;  3H2V A;  1EA8 A;  3L8I A;  3WOD F;  1A7E A;  1GS9 A;  3IPM O;  2YVK A;  3QVZ A;  4LDR A;  4XEV A;  3DJN B;  2KGO A;  2WVQ A;  3IQ5 A;  4J32 B;  3WAQ A;  4CX9 A;  3ASO C;  2AU5 A;  4ULW A;  3RKO F;  3ZDL A;  1IZM A;  2NG1 A;  1ZZP A;  3QMK A;  1XWJ A;  3A9C A;  4C3D A;  5L0G A;  2G3K A;  4MTF A;  2OCC C;  1Z3I X;  2IXN A;  4YT8 A;  2LCH A;  2P1A A;  1M2O A;  5DS6 A;  2XRH A;  1WAT A;  5F5H A;  2YRF A;  2M4E A;  1ZHT A;  3B9Q A;  2OJE D;  3LNM B;  2H7V C;  2R7W A;  2PF4 E;  4D4N A;  2JX0 A;  1CPQ A;  1K04 A;  3S9O A;  1RKE A;  1D0X A;  2CNW A;  1BBH A;  5L0I A;  2J9V A;  1D1B A;  2LFD A;  1K05 A;  1H6G A;  3FMS A;  1M6T A;  1MMD A;  3C8G D;  4A4A A;  5A6B A;  1T5O A;  2RSE B;  4JC7 A;  1KNY A;  4G78 A;  4HE8 D;  1JMW A;  5F28 E;  4Z9H A;  2Q7R A;  3US6 A;  5EGY A;  3B71 A;  1CPR A;  3NRH A;  4LLE A;  3KH2 A;  2GDC A;  4DVY P;  1U6H A;  2IXP A;  1NBB A;  4U5F E;  1KU2 A;  1QZX A;  3NMI A;  3C62 A;  1BR2 A;  1OCO C;  2CW0 F;  3M4C A;  4OIQ F;  4A2N B;  4DBQ A;  4JIO A;  4QI2 A;  1T6Q A;  3E9V A;  2HV6 A;  4I3M A;  5DQZ A;  1O87 A;  4BPM A;  3GEI A;  1B68 A;  2GAQ A;  1RKC A;  3F46 A;  1O3U A;  2UUI A;  3HNL A;  4EUK B;  2R03 A;  2ZPA A;  4Z9I A;  2LK4 A;  2PFD A;  1RCP A;  1Z23 A;  3S27 A;  4DRI B;  4X0R A;  2B0J A;  2LFF A;  4MVM A;  1D0Y A;  4JVS A;  4IAQ A;  3TUL A;  3UGO A;  1HW2 A;  2E87 A;  1G5Z A;  2YKZ A;  1JPN A;  1Q0D A;  1YAU O;  2QNL A;  3GWL A;  3AGT A;  3O10 A;  3SEO A;  2J8W A;  2EIK C;  2M64 A;  1FFH A;  1YAR O;  4E7S A;  3AOU A;  1W2W A;  2HJM A;  2ICW G;  3NMK A;  3JSE O;  4OIP F;  1OXK A;  4J7Y A;  3UMH A;  1OKK D;  3ECS A;  2XM0 A;  3NKE A;  3U5S A;  1ZHW A;  1IW7 F;  2Q9C A;  1BZ4 A;  2W4M A;  3SXZ A;  3V5Y A;  4DJ9 A;  5JRA A;  1HY5 A;  2A6E F;  4JTD B;  3E70 C;  4MVU A;  2HFI A;  1BDJ B;  2L7A A;  2LSE A;  4MVQ A;  3WG7 C;  1FMV A;  2YL3 A;  5CI9 A;  4BJT A;  3ZG1 A;  2DYR C;  3O55 A;  5COM A;  4XLP F;  4IRU A;  5COG A;  2AWC A;  5D92 A;  4CJO A;  1YDI A;  3TQO A;  4JJG A;  5AC4 A;  3M1C B;  3TD7 A;  4N6H A;  2VCA A;  3GM3 A;  5A69 A;  2PBE A;  1OW6 A;  4O6M A;  4OIN F;  3DZA A;  3U3F A;  3RH3 A;  1Z6A A;  1HMD A;  3VAY A;  2NSF A;  4KNW A;  1CGM E;  2J7P A;  4NTB A;  3VRC A;  1O5H A;  1LM3 B;  5D91 A;  2CYD A;  3AG2 C;  1H7I A;  2XLW A;  1N1C A;  3ASN C;  3O6X A;  2VCC A;  5L0H A;  4DOZ A;  4XQ1 A;  4HFF B;  4P9T A;  3ZVR A;  1C17 M;  2VB6 A;  3RIP A;  3M79 A;  3OA1 A;  3GM1 A;  3DI5 A;  4XTK A;  2ZXW C;  1RKE B;  5E2Q A;  3LLK A;  3V7O A;  1OCZ C;  4DRH B;  4J7T A;  1A41 A;  1DOW A;  3Q6M A;  2LD6 A;  3R7C A;  5EK0 A;  1OCR C;  3LLI A;  4W8P A;  3T6J A;  3GAN A;  2WL8 A;  1HE1 A;  3NG1 A;  2IXO A;  3A11 A;  1JRA A;  3GEE A;  5JT4 A;  4J30 B;  2Q9B A;  2W45 A;  4IAO A;  3K1H A;  4JCH A;  4LDK A;  4EBJ A;  2Z15 A;  1YVI A;  2EIN C;  2Y69 C;  3SZR A;  2GA0 A;  2P0N A;  4FWV A;  4ULV A;  3UNG C;  3VYW A;  4GEH A;  4CS8 A;  3EHN A;  2YLI A;  4BJ1 A;  2DI3 A;  4BEM J;  1LPE A;  1VB5 A;  2XLV A;  2R7V A;  2WVO A;  1MQV A;  3EZH A;  1Y6D A;  3DE8 A;  4PJN A;  5DQT A;  5A6A A;  1UFB A;  2XXA A;  3CQZ A;  1VYI A;  1ZW3 A;  1TR2 A;  2AVK A;  1NFN A;  2WZL A;  2ZD9 A;  4YT4 A;  1QQ3 A;  2R25 A;  2NUP B;  3F47 A;  2AWY A;  2KC3 A;  1VLT A;  1G4U S;  1TFK B;  4MQ9 F;  2OJQ A;  4MVS A;  4Z9J A;  3U8V A;  1ZU5 A;  1BR1 A;  3HNK A;  5A6J A;  5EHH A;  1YA7 O;  1T9K A;  3ABL C;  3TOM A;  1VOM A;  3S0X A;  2YLG A;  1JR8 A;  4CS7 A;  4HFK B;  4JEB A;  1R5I D;  1BR4 A;  3FOP A;  1ZVZ A;  1RXQ A;  2A69 F;  3AJM A;  3PCV A;  1WN0 A;  2H7O A;  3DWW A;  4D4X A;  4RD9 A;  2AP3 A;  5B1B C;  3UMK A;  3MLG A;  2H8A A;  2ETS A;  3PMR A;  4WAB A;  2GWW A;  3U2M A;  1F1M A;  2IBF A;  2Q4F A;  3HJC A;  4PFP A;  1G8X A;  1TWH A;  2XLD A;  3IQT A;  2XL6 A;  3BRJ A;  4YN0 B;  3U9J A;  2GFH A;  1J8M F;  4YWQ A;  3ZSU A;  5B3I A;  4I44 A;  3HLZ A;  4O6Y A;  4AX2 A;  2MHR A;  2OG2 A;  2XL8 A;  5K0I A;  3N2Z B;  4CDV A;  1NU9 C;  4NTA A;  5KYW A;  1MMN A;  3MX3 A;  3IHU A;  4K7B A;  3SNH A;  1WAS A;  1Z7Q c;  1QVX A;  1V74 B;  3U0C A;  1JOG A;  2YEV A;  5AGF A;  3L1M A;  1R4T A;  1M56 C;  2ZXR A;  3EPV A;  2J45 A;  4IB4 A;  1OXB A;  1PD1 A;  5B1A C;  1LS4 A;  1YLM A;  4F4B A;  1M2V A;  5KYY B;  5B3S C;  2KK1 A;  1DOV A;  1ZU4 A;  2KJG A;  3DAG A;  5JSL A;  4EBK A;  4XEK A;  1E2X A;  3AQB A;  1LKX A;  3QW1 A;  1KTM A;  1SZI A;  3QTH A;  5F5F A;  3V5X A;  2QE9 A;  1UG7 A;  2PX0 A;  3W8I A;  4O79 A;  2XLO A;  3LEO A;  3T6G B;  1LIH A;  2DGJ A;  1OR2 A;  3LS0 A;  3Q7L A;  2R7R A;  1LVK A;  3PHF 2;  1V4A A;  1T6U A;  2NUP A;  3DE9 A;  4OIO F;  2QLA A;  3C8G A;  3X2Q C;  3N0T A;  4RBN A;  3CSK A;  3RQE A;  2I15 A;  3EZI A;  3Q7G A;  2HSB A;  3TJ5 A;  4Q7C A;  3GM2 A;  4MVR A;  1XZP A;  4DXW A;  2G62 A;  3ZTZ A;  3L8J A;  2WZF A;  4LLC A;  1PCX A;  3ZWI A;  2YLD A;  4CJG A;  3W2V A;  4C3B A;  1U0B B;  4ER9 A;  3VF0 A;  2NPU A;  3IQC A;  4YK5 A;  3ZQV A;  1A0B A;  3ABK C;  5DS5 A;  2RD9 A;  3K66 A;  4AL1 A;  4UDV A;  5AC5 A;  2R7T A;  3V5Z A;  3EFO A;  5E3C A;  4PR9 A;  3VM6 A;  2XXA B;  1T01 A;  2HJ3 A;  2UUH A;  3B0V C;  3B0P A;  4CDA A;  2HUJ A;  2QTV A;  3S28 A;  1YZA A;  2NSG A;  1VMA A;  4AE4 A;  1A7D A;  1V54 C;  3GEH A;  1LE4 A;  1OW8 A;  4PJM A;  3EJN A;  5L0J A;  3PDM P;  4L6R A;  4FX5 A;  3DMD A;  2JD3 A;  1QLE C;  1QKR A;  4WGZ A;  3HNI A;  5BQH A;  1SR2 A;  4MTO A;  4MTG A;  4IJJ A;  4OD5 A;  3LAY A;  2EPM X;  1CGO A;  1C03 A;  2NUT A;  4NQF A;  3S90 A;  1OKK A;  2L6G A;  2PNO A;  2Q00 A;  3C8Z A;  1I5N A;  3RQG A;  3RW0 A;  5JVE A;  2MWQ A;  1VTM P;  1GQA A;  2EPK X;  2L6H A;  2A1D D;  4YT5 A;  4U9E A;  1YJG A;  2DYS C;  2HZ8 A;  3WHN A;  4G0H A;  4N6C A;  5JS5 A;  3DD7 A;  4XPW A;  3UGP A;  4LDQ A;  4JE9 A;  2VCB A;  4E0I A;  2JPU A;  3C18 A;  3EH1 A;  4JW1 A;  2R7S A;  2A0B A;  1XZQ A;  2YL1 A;  3IQ6 A;  3EGD A;  3L34 A;  4EWC A;  1SMY F;  5L0F A;  4JRZ A;  4IAR A;  1Y4C A;  1EQ1 A;  3Q6N A;  2CCY A;  5KYW B;  4U5D E;  2VH3 A;  2ZXP A;  1Q0K A;  1NSG B;  3R2P A;  3SXY A;  1TQG A;  2OOC A;  3RVY A;  3HKK A;  3EGX A;  3U8P A;  4B6I A;  3QZC A;  1I4Z A;  1NLX A;  3GOR A;  3S29 A;  1VK5 A;  4K0D A;  4QDL A;  2L81 A;  2OQM A;  2YQY A;  3EHM A;  1OR3 A;  1M2V B;  3S84 A;  4AL0 A;  3X1O A;  3RF3 A;  1LI5 A;  3M4B A;  3N24 A;  3I4U A;  3HNJ A;  2P7V A;  3K1I C;  2R05 A;  4ANJ A;  3B0U X;  3LES A;  2OKU A;  4HEA J;  4LAC B;  4CSA C;  4U9D A;  4BEJ A;  3AG3 C;  5L3V A;  3GOD A;  5GPG B;  5T3W A;  4G7H F;  4CS9 A;  1WGW A;  4U5C E;  2KYH A;  1JAF A;  3ZC4 A;  1YZC A;  2LP4 A;  3FAJ A;  3RVZ A;  3C8G B;  1WTY A;  1SYQ A;  3I5P A;  4KC9 A;  4E17 A;  4H4K C;  256B A;  3H2U A;  5JP7 A;  4XPX A;  1I4Y A;  1ST6 A;  4U5G A;  1ZW2 A;  4ZLC A;  3EH2 A;  1APC A;  3FVY A;  4YT2 A;  4CS9 C;  1QSP A;  2HMQ A;  3G50 A;  3TJ6 A;  1NG1 A;  2EPO A;  5T3T A;  3U3B A;  4PK4 A;  3U9M A;  3FDQ A;  3ATP A;  3MBG A;  2I8B A;  2L9J A;  4CIP A;  5L3Q A;  2Y3H A;  3LNR A;  3RYL A;  4EBB A;  2A6H F;  3K1I A;  4MVZ A;  5FCL A;  2WVN A;  1ZHY A;  4LER A;  3EFO B;  4QI0 A;  1T6I A;  2WB7 A;  3H65 A;  3FAP B;  4P9F A;  1ORY A;  3DJU B;  5CIV A;  1G4W R;  3POV A;  1NZE A;  2YZS A;  2J0X A;  2PP4 A;  3G4Z A;  3KYJ A;  1Q0G A;  2BL2 A;  3AG1 C;  3U2L A;  2EIL C;  3K6B A;  4AE4 B;  1PD0 A;  2CNW D;  5KYU A;  4NCQ A;  4M63 A;  4OD4 A;  4AK9 A;  1FNT c;  1ORS C;  2CGE A;  4EHP A;  1ORJ A;  2KW3 C;  2OEV A;  3SP1 A;  4JUR I;  2F22 A;  4MVO A;  3W2W A;  4E0H A;  2W9Y A;  2V3C C;  4GQH A;  1E86 A;  5A6B D;  4JJF A;  3ABM C;  4O7G A;  1Q0M A;  2XLH A;  3C7J A;  4JEA A;  2OEX A;  4H54 A;  2NUT B;  1ZHZ A;  3LEV A;  3FHD A;  2BE5 F;  3NKD A;  1E85 A;  3AGU A;  3BEH A;  3FOO A;  3NMJ A;  4N06 A;  1ZHX A;  3L0I A;  1D1A A;  1GGQ A;  1Z5Z A;  2H7B A;  5BQI A;  1L3P A;  5BUO A;  3UR3 C;  2FGY A;  4KBL A;  5DVW A;  2V26 A;  5E33 A;  3JRT A;  1E84 A;  2HKV A;  4NC3 A;  3K7D A;  4XPY A;  3EGD B;  4P6I C;  3O39 A;  2P6V A;  2B0H A;  3K33 A;  1HMO A;  1JPJ A;  1AUE A;  4FES A;  3RQF A;  3RFY A;  2XLM A;  1OW7 A;  3W4Y A;  2VC9 A;  4IGG A;  5DLJ A;  2YL7 A;  1EI7 A;  1CGN A;  5KYN A;  2QUP A;  3EQL F;  2J9B A;  3EGX B;  4JTC B;  3CZ6 A;  1AEP A;  5KYX A;  4N4W A;  1VLS A;  2J46 A;  3JRM O;  5COF A;  4MND A;  4Q5S F;  3SXM A;  1C02 A;  3T9O A;  3EG9 A;  2YHS A;  5DS4 A;  1Z63 A;  2IOQ A;  1TFO B;  2XL4 A;  3G4X A;  1U89 A;  3ZQY A;  3KYI A;  1MMG A;  4JKV A;  4IWB A;  2HS5 A;  4PFO A;  3HTK C;  3NDB B;  1D1C A;  3AQC A;  1SF8 A;  2IYL D;  4E18 A;  2XS8 A;  3W8H A;  2R7O A;  2KNH A;  4I1O B;  5E3A A;  2L6F A;  1H9T A;  1RJ9 A;  2ASR A;  1ZYR F;  3UMI A;  2TMV P;  3SXK A;  4PAC A;  1LE2 A;  4DBR A;  1LI7 A;  1OCC C;  1S7Z A;  2LQG A;  4RDA A;  1TWG A;  2DB4 A;  2R9R B;  3JCU Q;  4BJ5 C;  1TKN A;  4R32 A;  3J06 A;  3LUT B;  2X51 A;  1NFO A;  2J9U A;  2Q3T A;  2R7Q A;  3JSZ A;  2C04 A;  3JT1 A;  3OEO A;  1TWC A;  2G3V A;  3OWT A;  4I1M A;  4JCZ A;  4JTA B;  3T4R A;  1J8Y F;  3LJB A;  1MMA A;  2J7P D;  4KNV A;  2LIG A;  4NTF A;  2KSF A;  3FXH A;  1H9G A;  2Y3G A;  4C7O B;  4GYT A;  3B29 A;  1FR0 A;  1YYJ A;  2W4B A;  1MND A;  1HW1 A;  2EIM C;  4BG0 A;  2QY9 A;  2XS1 A;  3DM9 B;  3JYH A;  4PJL A;  3ZIB A;  1M57 C;  4OIR F;  3TK0 A;  3KPH A;  2FFH A;  5KYU B;  4G7Z F;  3QW0 A;  1GM5 A;  3JYY A;  2BC5 A;  3CAX A;  2EPL X;  4EIY A;  3NYM A;  1YA9 A;  4BJ5 A;  4YL3 A;  2R02 A;  2A0U A;  3DM5 A;  3ITF A;  4U5H A;  3AG4 C;  3IEE A;  2Y3D A;  5L0D A;  1PV3 A;  4NY3 A;  2FAP B;  2EPN A;  3MYI A;  4WJ0 A;  4FAP B;  2D5R B;  1A7V A;  3NYL A;  2X0C A;  4CS8 C;  2EIJ C;  2A68 F; 
#chains in the Genus database with same CATH homology
 2XM0 A;  5JRA A;  4CIP A;  2XLE A;  5JSL A;  3QW1 A;  2YL3 A;  4WGY A;  3ZTM A;  2XLO A;  5JUA A;  4CJO A;  3DE9 A;  3C63 A;  2QLA A;  4N6H A;  1E86 A;  2YL0 A;  2XLH A;  4JEA A;  3ZTZ A;  3ZWI A;  4CJG A;  1EKY A;  5JLI A;  2YLD A;  4ER9 A;  1YYX A;  3VRC A;  1E85 A;  1LM3 B;  3ZQV A;  3FOO A;  3NMJ A;  2XLW A;  1E83 A;  1E84 A;  3M79 A;  3QVY A;  4NC3 A;  3TOL A;  4CDY A;  4CDA A;  3M15 A;  1QPU A;  1YZA A;  1S05 A;  2XLM A;  4L6R A;  2YL7 A;  1CGN A;  2XM4 A;  4WGZ A;  5JT4 A;  3HNI A;  2J9B A;  3QVZ A;  4CX9 A;  4ULV A;  3IQ5 A;  4N4W A;  1CGO A;  2YLI A;  5JVE A;  1GQA A;  4U9E A;  2XLV A;  5JS5 A;  4JE9 A;  1MQV A;  3DE8 A;  3ZQY A;  4JKV A;  4D4N A;  1CPQ A;  2YL1 A;  3IQ6 A;  1BBH A;  4IAR A;  1QQ3 A;  2CCY A;  3HNK A;  1M6T A;  3TOM A;  2YLG A;  3U8P A;  1CPR A;  4JEB A;  3FOP A;  1NBB A;  3NMI A;  3C62 A;  4D4X A;  3M4C A;  3M4B A;  3HNJ A;  1YYJ A;  3HNL A;  4U9D A;  2XLD A;  1RCP A;  2XL6 A;  5B3I A;  3QW0 A;  4IAQ A;  1JAF A;  2BC5 A;  1YZC A;  2XL8 A;  2YKZ A;  4EIY A;  4CDV A;  2J8W A;  256B A;  5JP7 A;  1APC A;  5AGF A;  3NMK A;  3L1M A;  1A7V A;  4IB4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...