5JS5A

Nitric oxide complex of the l16f mutant of cytochrome c prime from alcaligenes xylosoxidans
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
125
structure length
125
Chain Sequence
EFAKPEDAVKYRQSAFTLMASHFGRMTPVVKGQAPYDAAQIKANVEVLKTLSALPWAAFGPGTEGGDARPEIWSDAASFKQKQQAFQDNIVKLSAAADAGDLDKLRAAFGDVGASCKACHDAYRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c'
publication title Engineering proximal vs. distal heme-NO coordination via dinitrosyl dynamics: implications for NO sensor design.
pubmed doi rcsb
source organism Alcaligenes xylosoxydans xylosoxydans
molecule tags Electron transport
total genus 48
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2016-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01322 Cytochrom_C_2 Cytochrome C'
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 5js5A00
2XM0A 3QW1A 4WGZA 3VRCA 1A7VA 5JRAA 3ZQYA 2QLAA 2XLHA 5JUAA 1QPUA 2XLEA 4CJOA 4D4NA 1CPQA 4D4XA 4U9DA 3L1MA 1EKYA 1BBHA 5JSLA 4CDYA 3U8PA 4CDVA 3DE8A 1E84A 1RCPA 1JAFA 2YLIA 5JP7A 1NBBA 3NMIA 2YLGA 2XLMA 4IAQA 4U9EA 3NMKA 2XLWA 1CGOA 1YZCA 3IQ6A 1E86A 3ZWIA 4CJGA 2BC5A 4ER9A 256BA 3NMJA 1YYXA 4IARA 1CGNA 1E83A 3C63A 2YLDA 3M4CA 3ZTMA 2CCYA 4IB4A 1LM3B 1GQAA 3FOOA 4EIYA 4JKVA 4CX9A 2YL0A 3QVZA 1S05A 1E85A 4ULVA 5JT4A 2XL6A 3TOLA 2XL8A 5JVEA 4JEBA 2YL3A 3M4BA 3QVYA 4CIPA 3M15A 4N6HA 2YL1A 5B3IA 4JEAA 1APCA 2XLDA 2XLOA 3M79A 2YKZA 1QQ3A 3ZQVA 4JE9A 2J8WA 2J9BA 1MQVA 4CDAA 1YZAA 1M6TA 5JLIA 3QW0A 2XM4A 3C62A 3ZTZA 3HNKA 3HNIA 3HNLA 3FOPA 1YYJA 5AGFA 2XLVA 3DE9A 4NC3A 4N4WA 2YL7A 1CPRA 4L6RA 3IQ5A 4WGYA 3TOMA 5JS5A 3HNJA
chains in the Genus database with same CATH superfamily
3QMKA 2AWYA 5EHHA 5F5FA 4CS9A 1JR8A 4DVZA 1O87A 2MYSA 2D5RB 2LD6A 3DAFA 1C03A 1OW7A 3JSZA 1K04A 2NPUA 3JYYA 4MVUA 2R7SA 2QLAA 2IM8A 3BRJA 4J32B 4G7OF 3JT1A 4MW8A 2XLEA 1T6UA 2P6VA 4EKWA 2LSEA 2P0NA 4FESA 4I44A 1H9GA 4C3DA 1CPQA 2XSEA 2KYHA 1O5HA 4D4XA 4XLPF 1C02A 1QKRA 1Q0GA 2R7TA 3TD7A 4U9DA 2AVKA 3EG9B 1F1MA 2V26A 3K33A 2Q7RA 4A4AA 1TWAA 3IQTA 4G78A 4MTGA 4X0RA 3F46A 1HMOA 1L3PA 3LS0A 3U8PA 2ZD9A 2R7WA 3JCUQ 1RCPA 4JTCB 1MNEA 1LPEA 5COFA 3TULA 3K7DA 2V3CC 1FMWA 2EIJC 2A69F 4U5CE 1A0BA 2YLGA 4U5BE 2XL4A 1HW1A 2VB6A 2XLMA 1LI5A 4DVYP 3NMKA 5BQGA 4ANJA 3LESA 1PD1A 3S90A 2IXNA 4DXWA 2DI3A 2QUPA 1A7DA 4WJ0A 4JJGA 4MVOA 2LFDA 3T6JA 2Q9CA 2XRHA 2CW0F 3K66A 4CJGA 2IBFA 1VTMP 3T6BA 1G4US 3U9MA 1R5ID 2BL2A 2EILC 2R7XA 3S28A 1E83A 1CGNA 3QZCA 2H7VC 5A69A 3C63A 2HJ3A 5DQTA 1BR2A 1T9KA 2XXAB 1FR0A 1MMDA 3EFOB 4OINF 1JPNA 2I15A 2PX0A 3AOUA 5A6BA 1T01A 4GYTA 3SXYA 1BZ4A 4P9TA 4R32A 1LS4A 2CCYA 2L6FA 3K1HA 3Q6NA 4XQ1A 2HFIA 3ECSA 4XTKA 2GFHA 2KK1A 4ULWA 1ZZPA 2J46A 2JPUA 3NKEA 4JKVA 1Z3IX 3MFNA 3GM1A 2VCCA 2VC9A 3W8IA 1E85A 3GEEA 3EG9A 1O3UA 4BJ6C 1WOLA 4NTAA 2LFFA 3GEIA 3C8ZA 4K1OA 3OEOA 4DOZA 2XL8A 3AG4C 1Y6DA 2HMQA 2LIGA 4JTAB 3MX3A 1RJ9B 1Z6AA 2IYLD 3AG3C 1ZW2A 1VK5A 4NTFA 3SXZA 2ZXWC 2YL1A 5B3IA 1LE4A 4AL0A 4H54A 3R7CA 2HMZA 1ORJA 2YKZA 1XZPA 3PCVA 4N6CA 4PJMA 2A6HF 4CDVA 2OJED 1MQVA 2RD9A 4BEJA 2Q9AA 2W9YA 5DLJA 1TQGA 3CQZA 2WZGA 1E84A 5E3CA 3EHNA 4ZLCA 1M6TA 5JLIA 1ZHWA 3FDQA 3QW0A 3G50A 5A6AA 2EIKC 3C62A 1TFOB 3CAXA 2EPOA 4JURI 2PF4E 3DXJF 3S84A 1HY5A 2XXAA 2EINC 3EFOA 1LIHA 1OXBA 3NYJA 4Z9IA 1Z5ZA 2KQ9A 3T6GB 3Q6MA 1VMAA 1FNTc 4BJ5C 3I4UA 4N4WA 5L0HA 2Q00A 3L8JA 4E0IA 1D1CA 2ZXOA 4BJ1A 4MTFA 2YL7A 1WN0A 1D0ZA 1OCRC 4MVMA 1DOVA 3IQ5A 1H6GA 2VCAA 5L0DA 3KL4A 4C3BA 2Z15A 3KKBA 3W4YA 2Q4FA 1OCZC 5COMA 2CGEA 5JS5A 4OIPF 3RIPA 1I4YA 2HJMA 1KTMA 2OEVA 5L0GA 2OEXA 2H7OA 4EHPA 4QI2A 3ABMC 1ZU5A 1NG1A 2L6GA 2XS1A 3QW1A 3VRCA 4J7YA 3W2WA 3ASNC 1HE1A 2A1DD 3BEHA 1HE9A 1LE2A 4OIOF 1RJ9A 2G3KA 2M64A 3EZHA 5BQIA 4P9FA 1OR2A 1YA9A 4WABA 4CSAC 2J0XA 5COGA 2NUPB 4JC7A 4DJ9A 3E70C 3IHUA 3R2PA 1V74B 3LUTB 3QTHA 1D0XA 1BR1A 3C7JA 1JOGA 2Y39A 2ZXPA 1J8MF 3EJNA 2PFDA 4CS8A 3L1MA 3AQCA 3DM5A 3FAJA 2J9VA 4O6NA 3S9OA 3SP1A 3U2MA 1MNDA 3K1IA 4EBJA 3GM3A 2OJQA 4KNWA 2QTVA 4CDYA 2F22A 2NUTB 3B9QA 2PP4A 3MLGA 3FXHA 3O39A 2J9WA 3L34A 4XPYA 5E3AA 1UFBA 4AK9A 4DBRA 2YLIA 2WL8A 1YVIA 1Q0KA 4BG0A 3WHNA 1M2VB 3U5SA 1K40A 3S0XA 1YAUO 1RKEB 4U9EA 1JPJA 2G3VA 3N0TA 4GEHA 1GGQA 3VYWA 4PJLA 1QZXA 2GA0A 3VM6A 4A2NB 1ZU4A 1H7IA 4OD4A 4YT5A 1XWJA 3RQEA 3ZWIA 3O10A 4W8KA 3AQBA 2RSEB 2W45A 3X1OA 1NFNA 1PCXA 2WVOA 2KJGA 3NYLA 3KYJA 2G62A 2H8AA 1HW2A 1QVXA 5EK0A 3M4CA 3Q7GA 3NG1A 1PD0A 3V5YA 4CIHA 5EGYA 1AVOB 1ZHZA 4YT2A 3E9VA 3ITFA 3EPVA 3J06A 3O6XA 4IB4A 4U5GA 3POVA 3TQOA 1GQAA 2NUPA 3EGXA 5A6BD 1GM5A 3RYLA 1OR3A 4PK4A 3SZRA 3FOOA 1V55C 4EBKA 3LEOA 1V54C 3EHMA 4YL1A 1NU7D 2O9XA 4XPXA 4ZLDA 4Q7CA 3TK0A 3U3BA 2J45A 5B1BC 4XLNF 4I1MA 4E17A 1Q0FA 3ASOC 3RQGA 3FAPB 5JT4A 4DRHB 2CDQA 1W2WA 1Q0DA 3FHDA 3AGTA 1FFTC 4Z9HA 4W8PA 1FAPB 3C8GB 3M4BA 4JEBA 3QVYA 3FVYA 4LERA 1ZW3A 2OOCA 3ZG1A 1M2VA 1SR2A 1TWGA 2HV6A 2NG1A 1VYIA 2WZLA 1WGWA 1EA8A 1OXKA 3M15A 3MYFA 4IRUA 4JEAA 4LDQA 4YK5A 1APCA 4PR9A 1QQ3A 3ZQVA 1FMVA 3UNGC 4K7BA 3AJMA 2J9BA 4MTOA 4CDAA 3JYHA 5KYYB 3HLZA 2W4BA 3B0PA 1U89A 2Y3HA 1TR2A 2L7AA 5B1AC 5DS4A 4MVRA 3ZC4A 2VCBA 3AG1C 4JJFA 2JX0A 3Q7LA 1E2XA 1OCOC 1UG7A 1RKCA 3ZVRA 5T3TA 5DS5A 2M4EA 4I1OB 5AGFA 4PJJA 3RW0A 3UGPA 1BR4A 3W2VA 3T9OA 3U9JA 1L7CA 1V4AA 2WVNA 1Z23A 2E87A 4U5DE 2D4UA 2GDCA 4LDKA 3GORA 1OKKD 3B71A 2FFHA 3DKAA 2A0BA 2IOQA 1SF8A 4OD5A 3TOMA 3CZ6A 1YDIA 3B0VC 3EH1A 2OCCC 4BJ6A 2PX3A 2R05A 3TJ6A 2XM0A 3G4ZA 4WGZA 2P7VA 3DZAA 3RVYA 1M56C 3U3FA 1G5ZA 3NYMA 1WASA 5JRAA 3ZQYA 3C8GA 3NDBB 1AEPA 2ZPAA 3LLIA 2ZXRA 1MMAA 5AC5A 1MMNA 4MQ9F 4XWJA 4U5FE 5TJ5E 2L81A 1Y4CA 3UR3C 2MHRA 4JTDB 1YJGA 3SYNA 4AX2A 5CIVA 5A6JA 3V5XA 5KYYA 3RF3A 1T6IA 4C3EA 5T1DB 1YARO 3HJCA 3IPMO 3RFYA 4KI2A 3LS1A 1ZVZA 2NSFA 1OKKA 2QY9A 4JVSA 1BBHA 4HFFB 1ZHXA 2HKVA 3JTLO 3JRMO 4PACA 4Z9JA 3ZDLA 3U2LA 1J8YF 4XPWA 4AL1A 3T4RA 5IY5C 1OCCC 3SXMA 1JAFA 3IQCA 1WWPA 1OW6A 2R25A 3N2ZB 3NMIA 4GQHA 5CI9A 3O55A 5KYXB 4MW3A 1XZQA 2R7VA 2KSFA 2XLWA 4I3MA 4BJ5A 3GEHA 4O6YA 1CGOA 1YZCA 3GM2A 4IWBA 4E0HA 3IQ6A 2JD3A 1ST6A 3G4XA 4J7TA 2CNWD 2BC5A 3JRTA 4PFOA 1VOMA 3JZ0A 256BA 3N24A 3NMJA 1YYXA 4BJTA 4OIQF 1ZHTA 4QDLA 2DYRC 3GWLA 3DJUB 1JRAA 2Y3BA 2OU6A 2QNLA 3ABKC 2VASA 2ETSA 4U5HA 3UGOA 5DQZA 4YL0A 3NKDA 3KH2A 1TWCA 3DJNB 4O7GA 3ZTMA 5L3VA 2YWAA 5DS6A 4PJNA 3UMKA 4E7SA 4NQFA 1C17M 3V5ZA 4CSAA 3NRHA 4DRJB 2QE9A 3V7OA 4XEVA 3W8HA 3VAYA 3PMRA 1LVKA 4JW1A 2LQGA 4CX9A 2YL0A 3QVZA 3I5PA 2CNWA 4YT8A 1M57C 1LI7A 1D1AA 2EIMC 4CS9C 3ZIBA 2XL6A 1WATA 3F47A 2C03A 1BDJB 3IEEA 4JZAA 3S27A 3TOLA 5L0CA 2OKUA 4FX5A 5GPGB 4CIPA 1LS1A 1MMGA 3UMHA 5KYXA 2Y3DA 2P1AA 3LJBA 4N6HA 4G7ZF 1HMDA 1N1CA 2YVKA 4YJWA 2XS8A 2XLOA 1M2OA 1QLEC 3M79A 4MVSA 4DRIB 4KBLA 2J8WA 2KNHA 4IGGA 2HZ8A 3EGDB 4JRZA 2C04A 3C18A 5L0IA 5B3SC 1T5OA 2HS5A 1D1BA 1FTSA 2BE5F 3EQLF 4IJJA 1RMVA 4N06A 3SNHA 2IXMA 2LCHA 1Q0MA 2WVQA 3DWWA 2MWQA 3RVZA 1OW8A 5HSWA 2DGJA 2GAQA 3GODA 5F5HA 1VLSA 1SYQA 2J7PD 3AGUA 1PV3A 2WZFA 3RH3A 3WG7C 3HNLA 2B0HA 3U8VA 3K6BA 4OIRF 3DMDA 2XLVA 3DE9A 1ZYRF 2NUTA 2GWWA 4NC3A 2FGYA 3CEXA 1ORYA 4KNVA 1A7EA 4J30B 1LKXA 4L6RA 3MYIA 2IXOA 1NFOA 4IAOA 1FFHA 2AU5A 3A9CA 2PNOA 1RKEA 5A6KA 3CSKA 3U0CA 4MVZA 4JIOA 3HNJA 1NLXA 4B6IA 4UDVA 2J7PA 1I5NA 4RDAA 3LNMB 1K05A 1A7VA 2L9JA 4FWVA 2CYDA 3HKKA 3L8IA 1SZIA 2J9UA 3EH2A 1IW7F 2XLHA 4CS7A 2Q3TA 2Y69C 5FCLA 1QPUA 4BPMA 5JUAA 5KYWB 4K0DA 3A11A 4KC9A 2HSQA 3LLKA 3LNRA 3C8GD 1ZHYA 2B0JA 4CJOA 4D4NA 4YT4A 5D91A 2YZSA 4G7HF 1SMYF 1OQCA 1VB5A 3EGDA 3TJ5A 1EKYA 4C7OB 1NU9C 1KNYA 1JMWA 5JSLA 1R4TA 4NCQA 5CI8A 3DE8A 2Y3GA 5E2QA 2IXPA 3B0UX 2X51A 5JP7A 2R7QA 1NBBA 5DVWA 3MBGA 3RQFA 1U6HA 2DB4A 3VF0A 3KMIA 2EPKX 4IAQA 2KW3C 3UMIA 3SXKA 4O79A 1U0BB 3DD7A 3RKOF 3H2UA 2VH3A 5FZTA 3US6A 2R7RA 1E86A 2PBEA 4XEFA 3KPHA 4FAPB 2UUHA 4ER9A 4NTBA 1T6QA 5HV9A 1S7ZA 1AUEA 2L6HA 1YLMA 2YEVA 5T3WA 3WODF 3FMSA 4IARA 4YWQA 2R7UA 1EQ1A 3HTKC 2YLDA 3B29A 2A6EF 5F28E 2LK4A 4DBQA 5K0IA 1Z63A 2TMVP 4AE4B 4Q5SF 2AWCA 4MVQA 1B68A 1D0YA 4MNDA 4JCHA 1Z7Qc 3WAQA 1TFKB 2R9RB 1TKNA 3DI5A 5E33A 5KYUB 5KYWA 1LM3B 2Q9BA 3PDMP 4M63A 3PHF2 3SEOA 4EIYA 3OWTA 1NZEA 4HE8D 4LDRA 1IZMA 4LLCA 2HSBA 4LACB 1H9TA 4LLEA 5D92A 1S05A 2YQYA 1NSGB 1GS9A 4JCZA 4EBBA 4ULVA 4Q4ZF 4C7OA 5BUOA 2EPNA 2R02A 1QSPA 2KC3A 4QI0A 4XEKA 2EPLX 3AG2C 5JVEA 3ZSUA 5AC4A 2YRFA 4RBNA 2YHSA 2YL3A 3L0IA 2HUJA 3H2VA 4MS2A 5L3QA 2A68F 2WB7A 4G0HA 4EWCA 4ONSA 1DOWA 2EPMX 4HEAJ 2XLDA 1G8XA 4PFPA 4P6IC 4JE9A 2ICWG 3DAGA 3GWNA 3S29A 4CS8C 5L0FA 1A41A 2FAPB 2H7BA 2P61A 1YZAA 2W4MA 3K1IC 4YL3A 3X2QC 1KU2A 2LP4A 1EI7A 2XM4A 3M1CB 4H4KC 3ZTZA 2R03A 3KYIA 3LAYA 3HNKA 5KYNA 1RXQA 3HNIA 3EGXB 5L0JA 1ORSC 2UUIA 2HV7A 3I5QA 1WTYA 2I8BA 1YYJA 3FOPA 4RD9A 4AE4A 2R7OA 4F4BA 1TWHA 4O6MA 3ATPA 3LEVA 2DYSC 2KGOA 3H65A 2A0UA 1VLTA 5KYUA 3DM9B 4U5EE 2X0CA 2AP3A 2OQMA 4CBEA 1YA7O 4E7ZA 1CPRA 1VYKA 4WGYA 2OG2A 3EZIA 4E18A 3GANA 1CGME 4NY3A 2ASRA 2NSGA 4YN0B 5BQHA 3ABLC 3JSEO 4BEMJ 2J0WA 4EUKB 1G4WR 4HFKB 1I4ZA 3OA1A
chains in the Genus database with same CATH topology
2XM0A 3QW1A 4WGZA 3VRCA 1A7VA 5JRAA 3ZQYA 2QLAA 2XLHA 5JUAA 1QPUA 2XLEA 4CJOA 4D4NA 1CPQA 4D4XA 4U9DA 3L1MA 1EKYA 1BBHA 5JSLA 4CDYA 3U8PA 4CDVA 3DE8A 1E84A 1RCPA 1JAFA 2YLIA 5JP7A 1NBBA 3NMIA 2YLGA 2XLMA 4IAQA 4U9EA 3NMKA 2XLWA 1CGOA 1YZCA 3IQ6A 1E86A 3ZWIA 4CJGA 2BC5A 4ER9A 256BA 3NMJA 1YYXA 4IARA 1CGNA 1E83A 3C63A 2YLDA 3M4CA 3ZTMA 2CCYA 4IB4A 1LM3B 1GQAA 3FOOA 4EIYA 4JKVA 4CX9A 2YL0A 3QVZA 1S05A 1E85A 4ULVA 5JT4A 2XL6A 3TOLA 2XL8A 5JVEA 4JEBA 2YL3A 3M4BA 3QVYA 4CIPA 3M15A 4N6HA 2YL1A 5B3IA 4JEAA 1APCA 2XLDA 2XLOA 3M79A 2YKZA 1QQ3A 3ZQVA 4JE9A 2J8WA 2J9BA 1MQVA 4CDAA 1YZAA 1M6TA 5JLIA 3QW0A 2XM4A 3C62A 3ZTZA 3HNKA 3HNIA 3HNLA 3FOPA 1YYJA 5AGFA 2XLVA 3DE9A 4NC3A 4N4WA 2YL7A 1CPRA 4L6RA 3IQ5A 4WGYA 3TOMA 5JS5A 3HNJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XM0 A;  3QW1 A;  4WGZ A;  3VRC A;  1A7V A;  5JRA A;  3ZQY A;  2QLA A;  2XLH A;  5JUA A;  1QPU A;  2XLE A;  4CJO A;  4D4N A;  1CPQ A;  4D4X A;  4U9D A;  3L1M A;  1EKY A;  1BBH A;  5JSL A;  4CDY A;  3U8P A;  4CDV A;  3DE8 A;  1E84 A;  1RCP A;  1JAF A;  2YLI A;  5JP7 A;  1NBB A;  3NMI A;  2YLG A;  2XLM A;  4IAQ A;  4U9E A;  3NMK A;  2XLW A;  1CGO A;  1YZC A;  3IQ6 A;  1E86 A;  3ZWI A;  4CJG A;  2BC5 A;  4ER9 A;  256B A;  3NMJ A;  1YYX A;  4IAR A;  1CGN A;  1E83 A;  3C63 A;  2YLD A;  3M4C A;  3ZTM A;  2CCY A;  4IB4 A;  1LM3 B;  1GQA A;  3FOO A;  4EIY A;  4JKV A;  4CX9 A;  2YL0 A;  3QVZ A;  1S05 A;  1E85 A;  4ULV A;  5JT4 A;  2XL6 A;  3TOL A;  2XL8 A;  5JVE A;  4JEB A;  2YL3 A;  3M4B A;  3QVY A;  4CIP A;  3M15 A;  4N6H A;  2YL1 A;  5B3I A;  4JEA A;  1APC A;  2XLD A;  2XLO A;  3M79 A;  2YKZ A;  1QQ3 A;  3ZQV A;  4JE9 A;  2J8W A;  2J9B A;  1MQV A;  4CDA A;  1YZA A;  1M6T A;  5JLI A;  3QW0 A;  2XM4 A;  3C62 A;  3ZTZ A;  3HNK A;  3HNI A;  3HNL A;  3FOP A;  1YYJ A;  5AGF A;  2XLV A;  3DE9 A;  4NC3 A;  4N4W A;  2YL7 A;  1CPR A;  4L6R A;  3IQ5 A;  4WGY A;  3TOM A;  5JS5 A;  3HNJ A; 
#chains in the Genus database with same CATH topology
 3QMK A;  2AWY A;  5EHH A;  5F5F A;  4CS9 A;  1JR8 A;  4DVZ A;  1O87 A;  2MYS A;  2D5R B;  2LD6 A;  3DAF A;  1C03 A;  1OW7 A;  3JSZ A;  1K04 A;  2NPU A;  3JYY A;  4MVU A;  2R7S A;  2QLA A;  2IM8 A;  3BRJ A;  4J32 B;  4G7O F;  3JT1 A;  4MW8 A;  2XLE A;  1T6U A;  2P6V A;  4EKW A;  2LSE A;  2P0N A;  4FES A;  4I44 A;  1H9G A;  4C3D A;  1CPQ A;  2XSE A;  2KYH A;  1O5H A;  4D4X A;  4XLP F;  1C02 A;  1QKR A;  1Q0G A;  2R7T A;  3TD7 A;  4U9D A;  2AVK A;  3EG9 B;  1F1M A;  2V26 A;  3K33 A;  2Q7R A;  4A4A A;  1TWA A;  3IQT A;  4G78 A;  4MTG A;  4X0R A;  3F46 A;  1HMO A;  1L3P A;  3LS0 A;  3U8P A;  2ZD9 A;  2R7W A;  3JCU Q;  1RCP A;  4JTC B;  1MNE A;  1LPE A;  5COF A;  3TUL A;  3K7D A;  2V3C C;  1FMW A;  2EIJ C;  2A69 F;  4U5C E;  1A0B A;  2YLG A;  4U5B E;  2XL4 A;  1HW1 A;  2VB6 A;  2XLM A;  1LI5 A;  4DVY P;  3NMK A;  5BQG A;  4ANJ A;  3LES A;  1PD1 A;  3S90 A;  2IXN A;  4DXW A;  2DI3 A;  2QUP A;  1A7D A;  4WJ0 A;  4JJG A;  4MVO A;  2LFD A;  3T6J A;  2Q9C A;  2XRH A;  2CW0 F;  3K66 A;  4CJG A;  2IBF A;  1VTM P;  3T6B A;  1G4U S;  3U9M A;  1R5I D;  2BL2 A;  2EIL C;  2R7X A;  3S28 A;  1E83 A;  1CGN A;  3QZC A;  2H7V C;  5A69 A;  3C63 A;  2HJ3 A;  5DQT A;  1BR2 A;  1T9K A;  2XXA B;  1FR0 A;  1MMD A;  3EFO B;  4OIN F;  1JPN A;  2I15 A;  2PX0 A;  3AOU A;  5A6B A;  1T01 A;  4GYT A;  3SXY A;  1BZ4 A;  4P9T A;  4R32 A;  1LS4 A;  2CCY A;  2L6F A;  3K1H A;  3Q6N A;  4XQ1 A;  2HFI A;  3ECS A;  4XTK A;  2GFH A;  2KK1 A;  4ULW A;  1ZZP A;  2J46 A;  2JPU A;  3NKE A;  4JKV A;  1Z3I X;  3MFN A;  3GM1 A;  2VCC A;  2VC9 A;  3W8I A;  1E85 A;  3GEE A;  3EG9 A;  1O3U A;  4BJ6 C;  1WOL A;  4NTA A;  2LFF A;  3GEI A;  3C8Z A;  4K1O A;  3OEO A;  4DOZ A;  2XL8 A;  3AG4 C;  1Y6D A;  2HMQ A;  2LIG A;  4JTA B;  3MX3 A;  1RJ9 B;  1Z6A A;  2IYL D;  3AG3 C;  1ZW2 A;  1VK5 A;  4NTF A;  3SXZ A;  2ZXW C;  2YL1 A;  5B3I A;  1LE4 A;  4AL0 A;  4H54 A;  3R7C A;  2HMZ A;  1ORJ A;  2YKZ A;  1XZP A;  3PCV A;  4N6C A;  4PJM A;  2A6H F;  4CDV A;  2OJE D;  1MQV A;  2RD9 A;  4BEJ A;  2Q9A A;  2W9Y A;  5DLJ A;  1TQG A;  3CQZ A;  2WZG A;  1E84 A;  5E3C A;  3EHN A;  4ZLC A;  1M6T A;  5JLI A;  1ZHW A;  3FDQ A;  3QW0 A;  3G50 A;  5A6A A;  2EIK C;  3C62 A;  1TFO B;  3CAX A;  2EPO A;  4JUR I;  2PF4 E;  3DXJ F;  3S84 A;  1HY5 A;  2XXA A;  2EIN C;  3EFO A;  1LIH A;  1OXB A;  3NYJ A;  4Z9I A;  1Z5Z A;  2KQ9 A;  3T6G B;  3Q6M A;  1VMA A;  1FNT c;  4BJ5 C;  3I4U A;  4N4W A;  5L0H A;  2Q00 A;  3L8J A;  4E0I A;  1D1C A;  2ZXO A;  4BJ1 A;  4MTF A;  2YL7 A;  1WN0 A;  1D0Z A;  1OCR C;  4MVM A;  1DOV A;  3IQ5 A;  1H6G A;  2VCA A;  5L0D A;  3KL4 A;  4C3B A;  2Z15 A;  3KKB A;  3W4Y A;  2Q4F A;  1OCZ C;  5COM A;  2CGE A;  5JS5 A;  4OIP F;  3RIP A;  1I4Y A;  2HJM A;  1KTM A;  2OEV A;  5L0G A;  2OEX A;  2H7O A;  4EHP A;  4QI2 A;  3ABM C;  1ZU5 A;  1NG1 A;  2L6G A;  2XS1 A;  3QW1 A;  3VRC A;  4J7Y A;  3W2W A;  3ASN C;  1HE1 A;  2A1D D;  3BEH A;  1HE9 A;  1LE2 A;  4OIO F;  1RJ9 A;  2G3K A;  2M64 A;  3EZH A;  5BQI A;  4P9F A;  1OR2 A;  1YA9 A;  4WAB A;  4CSA C;  2J0X A;  5COG A;  2NUP B;  4JC7 A;  4DJ9 A;  3E70 C;  3IHU A;  3R2P A;  1V74 B;  3LUT B;  3QTH A;  1D0X A;  1BR1 A;  3C7J A;  1JOG A;  2Y39 A;  2ZXP A;  1J8M F;  3EJN A;  2PFD A;  4CS8 A;  3L1M A;  3AQC A;  3DM5 A;  3FAJ A;  2J9V A;  4O6N A;  3S9O A;  3SP1 A;  3U2M A;  1MND A;  3K1I A;  4EBJ A;  3GM3 A;  2OJQ A;  4KNW A;  2QTV A;  4CDY A;  2F22 A;  2NUT B;  3B9Q A;  2PP4 A;  3MLG A;  3FXH A;  3O39 A;  2J9W A;  3L34 A;  4XPY A;  5E3A A;  1UFB A;  4AK9 A;  4DBR A;  2YLI A;  2WL8 A;  1YVI A;  1Q0K A;  4BG0 A;  3WHN A;  1M2V B;  3U5S A;  1K40 A;  3S0X A;  1YAU O;  1RKE B;  4U9E A;  1JPJ A;  2G3V A;  3N0T A;  4GEH A;  1GGQ A;  3VYW A;  4PJL A;  1QZX A;  2GA0 A;  3VM6 A;  4A2N B;  1ZU4 A;  1H7I A;  4OD4 A;  4YT5 A;  1XWJ A;  3RQE A;  3ZWI A;  3O10 A;  4W8K A;  3AQB A;  2RSE B;  2W45 A;  3X1O A;  1NFN A;  1PCX A;  2WVO A;  2KJG A;  3NYL A;  3KYJ A;  2G62 A;  2H8A A;  1HW2 A;  1QVX A;  5EK0 A;  3M4C A;  3Q7G A;  3NG1 A;  1PD0 A;  3V5Y A;  4CIH A;  5EGY A;  1AVO B;  1ZHZ A;  4YT2 A;  3E9V A;  3ITF A;  3EPV A;  3J06 A;  3O6X A;  4IB4 A;  4U5G A;  3POV A;  3TQO A;  1GQA A;  2NUP A;  3EGX A;  5A6B D;  1GM5 A;  3RYL A;  1OR3 A;  4PK4 A;  3SZR A;  3FOO A;  1V55 C;  4EBK A;  3LEO A;  1V54 C;  3EHM A;  4YL1 A;  1NU7 D;  2O9X A;  4XPX A;  4ZLD A;  4Q7C A;  3TK0 A;  3U3B A;  2J45 A;  5B1B C;  4XLN F;  4I1M A;  4E17 A;  1Q0F A;  3ASO C;  3RQG A;  3FAP B;  5JT4 A;  4DRH B;  2CDQ A;  1W2W A;  1Q0D A;  3FHD A;  3AGT A;  1FFT C;  4Z9H A;  4W8P A;  1FAP B;  3C8G B;  3M4B A;  4JEB A;  3QVY A;  3FVY A;  4LER A;  1ZW3 A;  2OOC A;  3ZG1 A;  1M2V A;  1SR2 A;  1TWG A;  2HV6 A;  2NG1 A;  1VYI A;  2WZL A;  1WGW A;  1EA8 A;  1OXK A;  3M15 A;  3MYF A;  4IRU A;  4JEA A;  4LDQ A;  4YK5 A;  1APC A;  4PR9 A;  1QQ3 A;  3ZQV A;  1FMV A;  3UNG C;  4K7B A;  3AJM A;  2J9B A;  4MTO A;  4CDA A;  3JYH A;  5KYY B;  3HLZ A;  2W4B A;  3B0P A;  1U89 A;  2Y3H A;  1TR2 A;  2L7A A;  5B1A C;  5DS4 A;  4MVR A;  3ZC4 A;  2VCB A;  3AG1 C;  4JJF A;  2JX0 A;  3Q7L A;  1E2X A;  1OCO C;  1UG7 A;  1RKC A;  3ZVR A;  5T3T A;  5DS5 A;  2M4E A;  4I1O B;  5AGF A;  4PJJ A;  3RW0 A;  3UGP A;  1BR4 A;  3W2V A;  3T9O A;  3U9J A;  1L7C A;  1V4A A;  2WVN A;  1Z23 A;  2E87 A;  4U5D E;  2D4U A;  2GDC A;  4LDK A;  3GOR A;  1OKK D;  3B71 A;  2FFH A;  3DKA A;  2A0B A;  2IOQ A;  1SF8 A;  4OD5 A;  3TOM A;  3CZ6 A;  1YDI A;  3B0V C;  3EH1 A;  2OCC C;  4BJ6 A;  2PX3 A;  2R05 A;  3TJ6 A;  2XM0 A;  3G4Z A;  4WGZ A;  2P7V A;  3DZA A;  3RVY A;  1M56 C;  3U3F A;  1G5Z A;  3NYM A;  1WAS A;  5JRA A;  3ZQY A;  3C8G A;  3NDB B;  1AEP A;  2ZPA A;  3LLI A;  2ZXR A;  1MMA A;  5AC5 A;  1MMN A;  4MQ9 F;  4XWJ A;  4U5F E;  5TJ5 E;  2L81 A;  1Y4C A;  3UR3 C;  2MHR A;  4JTD B;  1YJG A;  3SYN A;  4AX2 A;  5CIV A;  5A6J A;  3V5X A;  5KYY A;  3RF3 A;  1T6I A;  4C3E A;  5T1D B;  1YAR O;  3HJC A;  3IPM O;  3RFY A;  4KI2 A;  3LS1 A;  1ZVZ A;  2NSF A;  1OKK A;  2QY9 A;  4JVS A;  1BBH A;  4HFF B;  1ZHX A;  2HKV A;  3JTL O;  3JRM O;  4PAC A;  4Z9J A;  3ZDL A;  3U2L A;  1J8Y F;  4XPW A;  4AL1 A;  3T4R A;  5IY5 C;  1OCC C;  3SXM A;  1JAF A;  3IQC A;  1WWP A;  1OW6 A;  2R25 A;  3N2Z B;  3NMI A;  4GQH A;  5CI9 A;  3O55 A;  5KYX B;  4MW3 A;  1XZQ A;  2R7V A;  2KSF A;  2XLW A;  4I3M A;  4BJ5 A;  3GEH A;  4O6Y A;  1CGO A;  1YZC A;  3GM2 A;  4IWB A;  4E0H A;  3IQ6 A;  2JD3 A;  1ST6 A;  3G4X A;  4J7T A;  2CNW D;  2BC5 A;  3JRT A;  4PFO A;  1VOM A;  3JZ0 A;  256B A;  3N24 A;  3NMJ A;  1YYX A;  4BJT A;  4OIQ F;  1ZHT A;  4QDL A;  2DYR C;  3GWL A;  3DJU B;  1JRA A;  2Y3B A;  2OU6 A;  2QNL A;  3ABK C;  2VAS A;  2ETS A;  4U5H A;  3UGO A;  5DQZ A;  4YL0 A;  3NKD A;  3KH2 A;  1TWC A;  3DJN B;  4O7G A;  3ZTM A;  5L3V A;  2YWA A;  5DS6 A;  4PJN A;  3UMK A;  4E7S A;  4NQF A;  1C17 M;  3V5Z A;  4CSA A;  3NRH A;  4DRJ B;  2QE9 A;  3V7O A;  4XEV A;  3W8H A;  3VAY A;  3PMR A;  1LVK A;  4JW1 A;  2LQG A;  4CX9 A;  2YL0 A;  3QVZ A;  3I5P A;  2CNW A;  4YT8 A;  1M57 C;  1LI7 A;  1D1A A;  2EIM C;  4CS9 C;  3ZIB A;  2XL6 A;  1WAT A;  3F47 A;  2C03 A;  1BDJ B;  3IEE A;  4JZA A;  3S27 A;  3TOL A;  5L0C A;  2OKU A;  4FX5 A;  5GPG B;  4CIP A;  1LS1 A;  1MMG A;  3UMH A;  5KYX A;  2Y3D A;  2P1A A;  3LJB A;  4N6H A;  4G7Z F;  1HMD A;  1N1C A;  2YVK A;  4YJW A;  2XS8 A;  2XLO A;  1M2O A;  1QLE C;  3M79 A;  4MVS A;  4DRI B;  4KBL A;  2J8W A;  2KNH A;  4IGG A;  2HZ8 A;  3EGD B;  4JRZ A;  2C04 A;  3C18 A;  5L0I A;  5B3S C;  1T5O A;  2HS5 A;  1D1B A;  1FTS A;  2BE5 F;  3EQL F;  4IJJ A;  1RMV A;  4N06 A;  3SNH A;  2IXM A;  2LCH A;  1Q0M A;  2WVQ A;  3DWW A;  2MWQ A;  3RVZ A;  1OW8 A;  5HSW A;  2DGJ A;  2GAQ A;  3GOD A;  5F5H A;  1VLS A;  1SYQ A;  2J7P D;  3AGU A;  1PV3 A;  2WZF A;  3RH3 A;  3WG7 C;  3HNL A;  2B0H A;  3U8V A;  3K6B A;  4OIR F;  3DMD A;  2XLV A;  3DE9 A;  1ZYR F;  2NUT A;  2GWW A;  4NC3 A;  2FGY A;  3CEX A;  1ORY A;  4KNV A;  1A7E A;  4J30 B;  1LKX A;  4L6R A;  3MYI A;  2IXO A;  1NFO A;  4IAO A;  1FFH A;  2AU5 A;  3A9C A;  2PNO A;  1RKE A;  5A6K A;  3CSK A;  3U0C A;  4MVZ A;  4JIO A;  3HNJ A;  1NLX A;  4B6I A;  4UDV A;  2J7P A;  1I5N A;  4RDA A;  3LNM B;  1K05 A;  1A7V A;  2L9J A;  4FWV A;  2CYD A;  3HKK A;  3L8I A;  1SZI A;  2J9U A;  3EH2 A;  1IW7 F;  2XLH A;  4CS7 A;  2Q3T A;  2Y69 C;  5FCL A;  1QPU A;  4BPM A;  5JUA A;  5KYW B;  4K0D A;  3A11 A;  4KC9 A;  2HSQ A;  3LLK A;  3LNR A;  3C8G D;  1ZHY A;  2B0J A;  4CJO A;  4D4N A;  4YT4 A;  5D91 A;  2YZS A;  4G7H F;  1SMY F;  1OQC A;  1VB5 A;  3EGD A;  3TJ5 A;  1EKY A;  4C7O B;  1NU9 C;  1KNY A;  1JMW A;  5JSL A;  1R4T A;  4NCQ A;  5CI8 A;  3DE8 A;  2Y3G A;  5E2Q A;  2IXP A;  3B0U X;  2X51 A;  5JP7 A;  2R7Q A;  1NBB A;  5DVW A;  3MBG A;  3RQF A;  1U6H A;  2DB4 A;  3VF0 A;  3KMI A;  2EPK X;  4IAQ A;  2KW3 C;  3UMI A;  3SXK A;  4O79 A;  1U0B B;  3DD7 A;  3RKO F;  3H2U A;  2VH3 A;  5FZT A;  3US6 A;  2R7R A;  1E86 A;  2PBE A;  4XEF A;  3KPH A;  4FAP B;  2UUH A;  4ER9 A;  4NTB A;  1T6Q A;  5HV9 A;  1S7Z A;  1AUE A;  2L6H A;  1YLM A;  2YEV A;  5T3W A;  3WOD F;  3FMS A;  4IAR A;  4YWQ A;  2R7U A;  1EQ1 A;  3HTK C;  2YLD A;  3B29 A;  2A6E F;  5F28 E;  2LK4 A;  4DBQ A;  5K0I A;  1Z63 A;  2TMV P;  4AE4 B;  4Q5S F;  2AWC A;  4MVQ A;  1B68 A;  1D0Y A;  4MND A;  4JCH A;  1Z7Q c;  3WAQ A;  1TFK B;  2R9R B;  1TKN A;  3DI5 A;  5E33 A;  5KYU B;  5KYW A;  1LM3 B;  2Q9B A;  3PDM P;  4M63 A;  3PHF 2;  3SEO A;  4EIY A;  3OWT A;  1NZE A;  4HE8 D;  4LDR A;  1IZM A;  4LLC A;  2HSB A;  4LAC B;  1H9T A;  4LLE A;  5D92 A;  1S05 A;  2YQY A;  1NSG B;  1GS9 A;  4JCZ A;  4EBB A;  4ULV A;  4Q4Z F;  4C7O A;  5BUO A;  2EPN A;  2R02 A;  1QSP A;  2KC3 A;  4QI0 A;  4XEK A;  2EPL X;  3AG2 C;  5JVE A;  3ZSU A;  5AC4 A;  2YRF A;  4RBN A;  2YHS A;  2YL3 A;  3L0I A;  2HUJ A;  3H2V A;  4MS2 A;  5L3Q A;  2A68 F;  2WB7 A;  4G0H A;  4EWC A;  4ONS A;  1DOW A;  2EPM X;  4HEA J;  2XLD A;  1G8X A;  4PFP A;  4P6I C;  4JE9 A;  2ICW G;  3DAG A;  3GWN A;  3S29 A;  4CS8 C;  5L0F A;  1A41 A;  2FAP B;  2H7B A;  2P61 A;  1YZA A;  2W4M A;  3K1I C;  4YL3 A;  3X2Q C;  1KU2 A;  2LP4 A;  1EI7 A;  2XM4 A;  3M1C B;  4H4K C;  3ZTZ A;  2R03 A;  3KYI A;  3LAY A;  3HNK A;  5KYN A;  1RXQ A;  3HNI A;  3EGX B;  5L0J A;  1ORS C;  2UUI A;  2HV7 A;  3I5Q A;  1WTY A;  2I8B A;  1YYJ A;  3FOP A;  4RD9 A;  4AE4 A;  2R7O A;  4F4B A;  1TWH A;  4O6M A;  3ATP A;  3LEV A;  2DYS C;  2KGO A;  3H65 A;  2A0U A;  1VLT A;  5KYU A;  3DM9 B;  4U5E E;  2X0C A;  2AP3 A;  2OQM A;  4CBE A;  1YA7 O;  4E7Z A;  1CPR A;  1VYK A;  4WGY A;  2OG2 A;  3EZI A;  4E18 A;  3GAN A;  1CGM E;  4NY3 A;  2ASR A;  2NSG A;  4YN0 B;  5BQH A;  3ABL C;  3JSE O;  4BEM J;  2J0W A;  4EUK B;  1G4W R;  4HFK B;  1I4Z A;  3OA1 A; 
#chains in the Genus database with same CATH homology
 2XM0 A;  3QW1 A;  4WGZ A;  3VRC A;  1A7V A;  5JRA A;  3ZQY A;  2QLA A;  2XLH A;  5JUA A;  1QPU A;  2XLE A;  4CJO A;  4D4N A;  1CPQ A;  4D4X A;  4U9D A;  3L1M A;  1EKY A;  1BBH A;  5JSL A;  4CDY A;  3U8P A;  4CDV A;  3DE8 A;  1E84 A;  1RCP A;  1JAF A;  2YLI A;  5JP7 A;  1NBB A;  3NMI A;  2YLG A;  2XLM A;  4IAQ A;  4U9E A;  3NMK A;  2XLW A;  1CGO A;  1YZC A;  3IQ6 A;  1E86 A;  3ZWI A;  4CJG A;  2BC5 A;  4ER9 A;  256B A;  3NMJ A;  1YYX A;  4IAR A;  1CGN A;  1E83 A;  3C63 A;  2YLD A;  3M4C A;  3ZTM A;  2CCY A;  4IB4 A;  1LM3 B;  1GQA A;  3FOO A;  4EIY A;  4JKV A;  4CX9 A;  2YL0 A;  3QVZ A;  1S05 A;  1E85 A;  4ULV A;  5JT4 A;  2XL6 A;  3TOL A;  2XL8 A;  5JVE A;  4JEB A;  2YL3 A;  3M4B A;  3QVY A;  4CIP A;  3M15 A;  4N6H A;  2YL1 A;  5B3I A;  4JEA A;  1APC A;  2XLD A;  2XLO A;  3M79 A;  2YKZ A;  1QQ3 A;  3ZQV A;  4JE9 A;  2J8W A;  2J9B A;  1MQV A;  4CDA A;  1YZA A;  1M6T A;  5JLI A;  3QW0 A;  2XM4 A;  3C62 A;  3ZTZ A;  3HNK A;  3HNI A;  3HNL A;  3FOP A;  1YYJ A;  5AGF A;  2XLV A;  3DE9 A;  4NC3 A;  4N4W A;  2YL7 A;  1CPR A;  4L6R A;  3IQ5 A;  4WGY A;  3TOM A;  5JS5 A;  3HNJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...