5JS5A

Nitric oxide complex of the l16f mutant of cytochrome c prime from alcaligenes xylosoxidans
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
125
structure length
125
Chain Sequence
b'EFAKPEDAVKYRQSAFTLMASHFGRMTPVVKGQAPYDAAQIKANVEVLKTLSALPWAAFGPGTEGGDARPEIWSDAASFKQKQQAFQDNIVKLSAAADAGDLDKLRAAFGDVGASCKACHDAYRK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c'
publication title Engineering proximal vs. distal heme-NO coordination via dinitrosyl dynamics: implications for NO sensor design.
pubmed doi rcsb
source organism Alcaligenes xylosoxydans xylosoxydans
molecule tags Electron transport
total genus 48
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2016-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01322 Cytochrom_C_2 Cytochrome C'
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 5js5A00
1JAFA 4CX9A 1MQVA 2YLDA 3U8PA 2XM0A 5JP7A 3FOPA 4L6RA 2XL8A 256BA 3HNIA 3DE9A 1YYJA 4D4XA 3QW0A 4CDVA 1E85A 2BC5A 3ZQYA 2XLVA 4IARA 1YZCA 5JSLA 3ZWIA 4JE9A 3QVZA 5B3IA 2XLEA 1QQ3A 1E86A 3TOLA 4JKVA 5JLIA 3HNKA 5JT4A 4WGYA 1S05A 3M79A 3L1MA 1CPRA 2YL7A 4U9DA 4EIYA 4ULVA 5JUAA 1A7VA 2YLGA 4N4WA 4U9EA 5JS5A 3NMKA 2XM4A 4CIPA 4N6HA 4JEAA 1M6TA 2YL0A 5JVEA 1YYXA 1EKYA 2CCYA 4NC3A 3ZTZA 1GQAA 2XL6A 2YL3A 2YKZA 1CGOA 2J8WA 1QPUA 3QW1A 1CGNA 3NMIA 1NBBA 2QLAA 3IQ5A 3ZQVA 3M15A 4WGZA 4CJGA 3M4BA 3C63A 4CDYA 2XLMA 4IAQA 4CJOA 4IB4A 2XLOA 3ZTMA 1E83A 3HNLA 3TOMA 1YZAA 1BBHA 1E84A 3IQ6A 3HNJA 3DE8A 3QVYA 3NMJA 4ER9A 4CDAA 3VRCA 1CPQA 2XLDA 3M4CA 2XLWA 5AGFA 2YL1A 4JEBA 2YLIA 1RCPA 2J9BA 1LM3B 1APCA 4D4NA 2XLHA 3FOOA 3C62A 5JRAA
chains in the Genus database with same CATH superfamily
3JSEO 2M4EA 2YWAA 4YN0B 4JJGA 1D0XA 2HV6A 3ZIBA 2G3VA 2OKUA 4JRZA 1ZW2A 3LESA 5KYWA 2GWWA 2J0XA 3EH2A 3L0IA 1NZEA 3X1OA 5KYNA 1V4AA 2XS8A 1VLSA 5T3WA 1OW6A 5JP7A 2UUHA 4AE4B 3ZDLA 5DS5A 1D0ZA 2OU6A 3DE9A 4PK4A 4PJNA 5HV9A 2QE9A 4D4XA 2R7RA 2WL8A 2X0CA 3UGOA 2GFHA 3TQOA 4IGGA 5L0JA 1PD1A 2IM8A 1E85A 3NG1A 3RF3A 4YL1A 2M64A 2W45A 3ZSUA 2VCAA 4MVMA 4AE4A 1FMWA 5DQTA 4E18A 1T6UA 3F47A 4GEHA 3JSZA 2VH3A 3DD7A 3E70C 2B0HA 4K7BA 4P6IC 5JSLA 2QY9A 1ST6A 3ZWIA 1DOVA 3MFNA 1ZZPA 2YVKA 4XWJA 4YL3A 3V5XA 1OW8A 2L6GA 4BJ6C 5CI8A 4MW3A 2R25A 3A9CA 1QVXA 1OCOC 3S0XA 1WOLA 2H7VC 2YRFA 5AC5A 5DQZA 4UDVA 1A7DA 1D1CA 1HMOA 1TFOB 1TWAA 1LIHA 2PNOA 4XEFA 3K7DA 5COFA 3U8VA 1TWHA 5JT4A 2R7SA 1L7CA 4WABA 5DS4A 1S05A 2LP4A 1R4TA 1YVIA 1G4WR 3EGDA 4BJ5C 3DAGA 2PX3A 4CSAA 4PJMA 5L0DA 3V5YA 1Q0FA 3DKAA 4U9DA 5BQHA 3DAFA 4EIYA 2XXAB 3C8ZA 4NCQA 4OD5A 1Z3IX 1Q0KA 1AEPA 1YA7O 4AK9A 3TK0A 1T6IA 4G78A 4MW8A 3IHUA 2Y3DA 5KYXB 1BR2A 3JRTA 2A68F 1ZVZA 2A69F 4LDQA 4U5HA 1D1BA 3U3FA 1LKXA 4KI2A 3H2VA 4ZLCA 2KK1A 3RH3A 3ZC4A 4CBEA 2J45A 4CIPA 4H54A 3CZ6A 4JEAA 2IOQA 1M6TA 2PBEA 4MTFA 1HE9A 5A69A 5L3VA 4G7OF 3MYFA 4I1OB 4K0DA 2HZ8A 2WB7A 3RQEA 4OIOF 1ZHZA 2VB6A 2OG2A 1VB5A 4JVSA 1N1CA 1J8MF 1EQ1A 2EIJC 3T6JA 3DI5A 2ZXRA 1GQAA 1WN0A 3O39A 4EHPA 3S29A 1K05A 2YL3A 3POVA 2ASRA 1C03A 2J8WA 3E9VA 3NKEA 1QPUA 4W8PA 2MYSA 2FGYA 3VF0A 2F22A 4JW1A 3ZQVA 2AWCA 4Z9HA 2I8BA 1M2VA 1U0BB 2E87A 2XLMA 5A6KA 2XLOA 1UFBA 3M1CB 1AUEA 4NTAA 4EUKB 4DBRA 4XLPF 3TOMA 1TFKB 2A0UA 2LFFA 2P61A 2PFDA 1E84A 3IQ6A 2R9RB 4MNDA 3EJNA 3NKDA 5KYYA 3AG4C 3FMSA 4ER9A 1HW1A 1VYKA 2AU5A 1BR4A 3K6BA 4DOZA 1ZHWA 3AG2C 3K1IA 4JTDB 2J0WA 2H8AA 2XLDA 3M4CA 1W2WA 4FWVA 4E0IA 1LS1A 2Y69C 2CW0F 2EIMC 3EG9B 3FAPB 3IEEA 1U89A 4YK5A 4CS9A 2R7QA 2X51A 1WGWA 4JIOA 3U9JA 2OCCC 1RCPA 1IZMA 1Q0MA 2A0BA 5DLJA 3MBGA 4D4NA 4XTKA 1OCZC 3C62A 1OXKA 5JRAA 1YJGA 1JPJA 3RIPA 1ZU4A 4OD4A 2VCCA 3FVYA 3GM1A 2NG1A 2YLDA 1OCRC 1BDJB 3C7JA 4I44A 4MTOA 4YL0A 4RDAA 5E2QA 3US6A 5EGYA 3W2VA 1V54C 4Z9IA 2PF4E 3K66A 2CNWD 3PMRA 3FOPA 2ICWG 3S27A 1A0BA 2W9YA 4NY3A 3VM6A 5FCLA 1FNTc 1O3UA 4K1OA 1OQCA 3C8GB 3DMDA 4MVOA 2L6HA 3RQGA 3U5SA 3LS1A 4XQ1A 3EGXA 4G0HA 3C18A 1NLXA 3C8GD 3OWTA 1SR2A 2OEVA 4XEVA 3ZQYA 2FAPB 5KYWB 1PV3A 3AJMA 1K04A 2ZD9A 4IARA 4U5GA 3L8IA 1YZCA 3TJ6A 1NU9C 4LDKA 1GM5A 3HJCA 3DM9B 2BE5F 1F1MA 3H2UA 3CEXA 2QTVA 4JE9A 4QDLA 1FAPB 1KU2A 2EPMX 3C8GA 2VC9A 4OINF 5B3IA 2JD3A 5T1DB 2WZFA 1E86A 4CIHA 3NYLA 3S84A 2MHRA 1RMVA 4ZLDA 3ASOC 2KJGA 3RKOF 3FXHA 4I1MA 3SXMA 4C7OA 3O6XA 1WATA 4JKVA 4X0RA 1TWCA 2XS1A 4N6CA 2LK4A 2NSGA 2P6VA 3ZVRA 4ONSA 4WGYA 4MVRA 3G4XA 1QLEC 1T6QA 4AX2A 4A2NB 3TD7A 1VOMA 2IXOA 4QI0A 3EHNA 1S7ZA 3BRJA 2XRHA 4P9TA 3L1MA 1CPRA 3KH2A 2ZPAA 4P9FA 2KGOA 3Q7GA 2JPUA 4MTGA 2ETSA 4O6NA 5E3AA 3WAQA 4AL1A 1A7VA 4DXWA 5JUAA 3ITFA 3MLGA 5E33A 3U2LA 1D0YA 4U9EA 1G5ZA 1T9KA 1YDIA 4JZAA 3OA1A 2MWQA 2NSFA 3IPMO 3JYYA 3EQLF 3LEVA 1ORJA 2H7BA 3NRHA 4HE8D 3EGDB 3NMKA 3PCVA 2HMZA 2XM4A 4DRJB 1LE2A 3AGUA 4EBJA 1UG7A 1KTMA 4U5BE 2AP3A 3NYJA 1T01A 4EBBA 2OJQA 3LNRA 1LI5A 1Q0DA 1RJ9B 2J9UA 1LI7A 3EPVA 5B1AC 1ORYA 2CCYA 1VTMP 4NC3A 5AC4A 3ASNC 1PD0A 1GGQA 5A6BD 1ZU5A 3WG7C 1SYQA 4LACB 2L81A 4GYTA 2YKZA 5T3TA 3RW0A 1RJ9A 3QW1A 4BPMA 1CGNA 2B0JA 2ZXWC 2WVNA 3MYIA 4W8KA 5A6AA 4RD9A 1HY5A 1A7EA 3M15A 1OKKA 5A6BA 3NYMA 3M4BA 4MVUA 3JCUQ 4PACA 1WWPA 4IAQA 4CJOA 4CS8A 2OOCA 3ZTMA 3O10A 4J30B 3HNLA 2EPOA 1ORSC 3EZIA 1SZIA 2CGEA 3VAYA 1DOWA 3PHF2 5E3CA 1WASA 3HNJA 3DE8A 3H65A 3JTLO 3QVYA 3UNGC 5EHHA 1K40A 3L8JA 2EPLX 3B0PA 1KNYA 4JCZA 4CDAA 4MS2A 3VRCA 1M2OA 4DVZA 1SF8A 4Q7CA 1RKEA 3EZHA 3T6BA 1M2VB 1VK5A 2IXPA 1O5HA 4JEBA 4LLCA 2D4UA 5HSWA 3RYLA 2J9BA 3S28A 1RKCA 1APCA 5L0IA 2XLHA 3HNIA 5KYYB 4GQHA 4EBKA 4JCHA 2KSFA 1M56C 3PDMP 1H9TA 5K0IA 3B9QA 4CX9A 2Q4FA 2V26A 3J06A 1MQVA 2VCBA 3U8PA 3FAJA 4EKWA 1VMAA 1ZYRF 1GS9A 2XM0A 3HKKA 3A11A 2R7TA 1RXQA 1U6HA 3UR3C 4L6RA 2XL8A 256BA 3OEOA 1HW2A 4NTBA 3SYNA 4BEMJ 1FTSA 5D92A 3U0CA 3T6GB 3SNHA 2Y39A 5F28E 2L6FA 3JRMO 3KMIA 4E7ZA 3NDBB 1H9GA 4LLEA 4WJ0A 5BUOA 3N0TA 4DRHB 2W4MA 4G7HF 3DXJF 4YT2A 3R2PA 4XEKA 4FESA 3U3BA 3QVZA 2PX0A 4XPXA 3G50A 4YT8A 3AG3C 2I15A 2CYDA 1QQ3A 2QUPA 3K33A 3N24A 2R7OA 4U5FE 1MMGA 2Q9BA 2EIKC 3EGXB 5JLIA 3K1IC 4QI2A 4H4KC 2HJMA 4O79A 3RFYA 4G7ZF 2EPNA 2H7OA 1J8YF 2DYRC 3KYJA 1Y6DA 1AVOB 4B6IA 3U2MA 4MVQA 1TQGA 1D1AA 1FMVA 5COGA 4JTAB 4XPYA 4CS7A 2GAQA 3ABMC 2A6EF 3SEOA 2VASA 4KC9A 1JMWA 1R5ID 2YL7A 3GEHA 3UMKA 1JRAA 3ABKC 1V74B 1LVKA 3DZAA 1Z7Qc 4C7OB 2LCHA 1HE1A 4C3EA 1PCXA 4YWQA 3KKBA 4M63A 2P0NA 2YLGA 4N4WA 4KBLA 1FFHA 1QZXA 3DM5A 4YJWA 3FOOA 3LAYA 1NFNA 1VLTA 2BL2A 1XZQA 2DYSC 3GM3A 4IJJA 4N6HA 1VYIA 1QSPA 2HFIA 2HV7A 3UMHA 5CIVA 5JVEA 1YYXA 1E2XA 4E0HA 2AVKA 2L9JA 3F46A 4O7GA 2NUPB 2J7PD 2J9WA 2LIGA 2Y3HA 1BR1A 3I4UA 3W8HA 1XWJA 2YZSA 1FFTC 2XL6A 2YHSA 2NPUA 3SP1A 2LSEA 2RD9A 4DJ9A 4JURI 3AQCA 4IAOA 2J7PA 3GEIA 1G4US 2IBFA 1NBBA 2JX0A 2GDCA 2Y3BA 3IQ5A 3QZCA 4KNWA 3W8IA 5B1BC 3SZRA 2HS5A 2NUPA 3GWNA 2Y3GA 4IRUA 1T5OA 3QMKA 4CDYA 3R7CA 1OR3A 1CGME 1MMDA 2W4BA 3GEEA 2KYHA 4LDRA 2KC3A 1YZAA 2P1AA 2Q3TA 4BJ6A 2NUTA 1I5NA 3LLIA 3GORA 3ATPA 3NMJA 4LERA 4PFPA 3RVZA 4XLNF 5KYUB 3T4RA 1LE4A 1TKNA 2EILC 1WTYA 3W2WA 5A6JA 1CPQA 3KYIA 2XLWA 2QNLA 3IQCA 3WHNA 1Z5ZA 1TWGA 2HKVA 3JYHA 4NQFA 4BJ5A 1OKKD 1FR0A 4JTCB 3LLKA 1LM3B 4O6YA 4HFKB 5KYUA 2KQ9A 3EH1A 1EI7A 1HMDA 1H6GA 1NG1A 5FZTA 3GODA 1I4YA 3BEHA 2A6HF 1JAFA 3CAXA 2WVOA 1I4ZA 4Q4ZF 1L3PA 1RKEB 3ABLC 3I5QA 1Z23A 4DBQA 3B0UX 1TR2A 4ANJA 1BZ4A 4PJJA 2R02A 1YYJA 4F4BA 5B3SC 1YLMA 2AWYA 3QW0A 3S9OA 3ECSA 3GM2A 4RBNA 4CSAC 3FDQA 4CDVA 4R32A 3ZG1A 1Z6AA 3GWLA 2LFDA 3JZ0A 3QTHA 4ULWA 2BC5A 2HSBA 2DGJA 2XLVA 4OIQF 2DB4A 2Q00A 2C04A 4EWCA 5IY5C 2R7WA 2OQMA 2R7UA 2R7XA 1Q0GA 3Q7LA 1OW7A 2J46A 2PP4A 4CS8C 3HTKC 2XLEA 1G8XA 4KNVA 3S90A 1ZHXA 3TOLA 1IW7F 3B29A 3KPHA 1QKRA 3AGTA 3GANA 3B71A 3EFOB 5COMA 3VYWA 4C3DA 3V5ZA 2XXAA 4XPWA 3DWWA 4YT4A 3HNKA 4IWBA 2EINC 5DVWA 3EHMA 1NSGB 3TJ5A 1JR8A 4MVSA 5KYXA 2G62A 2J9VA 2XSEA 3X2QC 1Y4CA 4JJFA 2YQYA 4OIRF 3WODF 5L0HA 3G4ZA 1M57C 5DS6A 1YA9A 2R03A 3JT1A 3EFOA 4J32B 5L0FA 1ZHYA 5L3QA 1XZPA 2P7VA 1LPEA 2HMQA 3AQBA 2FFHA 3AG1C 1MNDA 4HEAJ 2Q9AA 2D5RB 4ULVA 2HSQA 3L34A 3O55A 4PFOA 5L0GA 3LEOA 2C03A 3LNMB 2Q9CA 2A1DD 1B68A 3LJBA 4N06A 3IQTA 5JS5A 4E7SA 1MMAA 1Z63A 4J7TA 1ZHTA 4PR9A 2RSEB 4DRIB 3CSKA 2TMVP 1C02A 4JC7A 1H7IA 3SXKA 4BJ1A 1YAUO 2KNHA 2IXNA 3K1HA 1O87A 2YL0A 2ZXOA 4Z9JA 5TJ5E 4BEJA 4FX5A 1YARO 1EKYA 1JOGA 1OR2A 2OJED 5GPGB 4HFFB 4BJTA 2G3KA 4C3BA 4OIPF 4Q5SF 2HUJA 2EPKX 3LUTB 3DJNB 4CS9C 4MQ9F 5EK0A 3ZTZA 4YT5A 2Q7RA 1JPNA 5D91A 2YEVA 4E17A 5CI9A 4NTFA 3Q6MA 3LS0A 1C17M 3MX3A 2V3CC 4BG0A 1CGOA 2ZXPA 3NMIA 2QLAA 2GA0A 2L7AA 3KL4A 3W4YA 3SXYA 3UMIA 3EG9A 4WGZA 4CJGA 3RQFA 3DJUB 3C63A 2DI3A 2KW3C 4A4AA 4IB4A 1NU7D 1NFOA 2WVQA 3V7OA 4MVZA 1E83A 1OXBA 2LD6A 4U5DE 2HJ3A 5L0CA 3UGPA 1BBHA 2R7VA 3B0VC 3SXZA 4FAPB 5F5FA 2IXMA 3U9MA 3N2ZB 4AL0A 4I3MA 3AOUA 5BQIA 4U5CE 1MNEA 2CNWA 2IYLD 2O9XA 3FHDA 1LS4A 3T9OA 2Z15A 1A41A 5AGFA 3HLZA 2XL4A 1OCCC 1ZW3A 2YL1A 3I5PA 2LQGA 3Q6NA 4DVYP 2WZGA 4O6MA 2UUIA 2CDQA 2WZLA 1MMNA 4J7YA 5BQGA 4U5EE 3RVYA 2YLIA 2OEXA 1EA8A 1SMYF 3CQZA 1V55C 3M79A 4PJLA 3TULA 2R05A 5F5HA 2NUTB
chains in the Genus database with same CATH topology
1JAFA 4CX9A 1MQVA 2YLDA 3U8PA 2XM0A 5JP7A 3FOPA 4L6RA 2XL8A 256BA 3HNIA 3DE9A 1YYJA 4D4XA 3QW0A 4CDVA 1E85A 2BC5A 3ZQYA 2XLVA 4IARA 1YZCA 5JSLA 3ZWIA 4JE9A 3QVZA 5B3IA 2XLEA 1QQ3A 1E86A 3TOLA 4JKVA 5JLIA 3HNKA 5JT4A 4WGYA 1S05A 3M79A 3L1MA 1CPRA 2YL7A 4U9DA 4EIYA 4ULVA 5JUAA 1A7VA 2YLGA 4N4WA 4U9EA 5JS5A 3NMKA 2XM4A 4CIPA 4N6HA 4JEAA 1M6TA 2YL0A 5JVEA 1YYXA 1EKYA 2CCYA 4NC3A 3ZTZA 1GQAA 2XL6A 2YL3A 2YKZA 1CGOA 2J8WA 1QPUA 3QW1A 1CGNA 3NMIA 1NBBA 2QLAA 3IQ5A 3ZQVA 3M15A 4WGZA 4CJGA 3M4BA 3C63A 4CDYA 2XLMA 4IAQA 4CJOA 4IB4A 2XLOA 3ZTMA 1E83A 3HNLA 3TOMA 1YZAA 1BBHA 1E84A 3IQ6A 3HNJA 3DE8A 3QVYA 3NMJA 4ER9A 4CDAA 3VRCA 1CPQA 2XLDA 3M4CA 2XLWA 5AGFA 2YL1A 4JEBA 2YLIA 1RCPA 2J9BA 1LM3B 1APCA 4D4NA 2XLHA 3FOOA 3C62A 5JRAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JAF A;  4CX9 A;  1MQV A;  2YLD A;  3U8P A;  2XM0 A;  5JP7 A;  3FOP A;  4L6R A;  2XL8 A;  256B A;  3HNI A;  3DE9 A;  1YYJ A;  4D4X A;  3QW0 A;  4CDV A;  1E85 A;  2BC5 A;  3ZQY A;  2XLV A;  4IAR A;  1YZC A;  5JSL A;  3ZWI A;  4JE9 A;  3QVZ A;  5B3I A;  2XLE A;  1QQ3 A;  1E86 A;  3TOL A;  4JKV A;  5JLI A;  3HNK A;  5JT4 A;  4WGY A;  1S05 A;  3M79 A;  3L1M A;  1CPR A;  2YL7 A;  4U9D A;  4EIY A;  4ULV A;  5JUA A;  1A7V A;  2YLG A;  4N4W A;  4U9E A;  5JS5 A;  3NMK A;  2XM4 A;  4CIP A;  4N6H A;  4JEA A;  1M6T A;  2YL0 A;  5JVE A;  1YYX A;  1EKY A;  2CCY A;  4NC3 A;  3ZTZ A;  1GQA A;  2XL6 A;  2YL3 A;  2YKZ A;  1CGO A;  2J8W A;  1QPU A;  3QW1 A;  1CGN A;  3NMI A;  1NBB A;  2QLA A;  3IQ5 A;  3ZQV A;  3M15 A;  4WGZ A;  4CJG A;  3M4B A;  3C63 A;  4CDY A;  2XLM A;  4IAQ A;  4CJO A;  4IB4 A;  2XLO A;  3ZTM A;  1E83 A;  3HNL A;  3TOM A;  1YZA A;  1BBH A;  1E84 A;  3IQ6 A;  3HNJ A;  3DE8 A;  3QVY A;  3NMJ A;  4ER9 A;  4CDA A;  3VRC A;  1CPQ A;  2XLD A;  3M4C A;  2XLW A;  5AGF A;  2YL1 A;  4JEB A;  2YLI A;  1RCP A;  2J9B A;  1LM3 B;  1APC A;  4D4N A;  2XLH A;  3FOO A;  3C62 A;  5JRA A; 
#chains in the Genus database with same CATH topology
 3JSE O;  2M4E A;  2YWA A;  4YN0 B;  4JJG A;  1D0X A;  2HV6 A;  3ZIB A;  2G3V A;  2OKU A;  4JRZ A;  1ZW2 A;  3LES A;  5KYW A;  2GWW A;  2J0X A;  3EH2 A;  3L0I A;  1NZE A;  3X1O A;  5KYN A;  1V4A A;  2XS8 A;  1VLS A;  5T3W A;  1OW6 A;  5JP7 A;  2UUH A;  4AE4 B;  3ZDL A;  5DS5 A;  1D0Z A;  2OU6 A;  3DE9 A;  4PK4 A;  4PJN A;  5HV9 A;  2QE9 A;  4D4X A;  2R7R A;  2WL8 A;  2X0C A;  3UGO A;  2GFH A;  3TQO A;  4IGG A;  5L0J A;  1PD1 A;  2IM8 A;  1E85 A;  3NG1 A;  3RF3 A;  4YL1 A;  2M64 A;  2W45 A;  3ZSU A;  2VCA A;  4MVM A;  4AE4 A;  1FMW A;  5DQT A;  4E18 A;  1T6U A;  3F47 A;  4GEH A;  3JSZ A;  2VH3 A;  3DD7 A;  3E70 C;  2B0H A;  4K7B A;  4P6I C;  5JSL A;  2QY9 A;  1ST6 A;  3ZWI A;  1DOV A;  3MFN A;  1ZZP A;  2YVK A;  4XWJ A;  4YL3 A;  3V5X A;  1OW8 A;  2L6G A;  4BJ6 C;  5CI8 A;  4MW3 A;  2R25 A;  3A9C A;  1QVX A;  1OCO C;  3S0X A;  1WOL A;  2H7V C;  2YRF A;  5AC5 A;  5DQZ A;  4UDV A;  1A7D A;  1D1C A;  1HMO A;  1TFO B;  1TWA A;  1LIH A;  2PNO A;  4XEF A;  3K7D A;  5COF A;  3U8V A;  1TWH A;  5JT4 A;  2R7S A;  1L7C A;  4WAB A;  5DS4 A;  1S05 A;  2LP4 A;  1R4T A;  1YVI A;  1G4W R;  3EGD A;  4BJ5 C;  3DAG A;  2PX3 A;  4CSA A;  4PJM A;  5L0D A;  3V5Y A;  1Q0F A;  3DKA A;  4U9D A;  5BQH A;  3DAF A;  4EIY A;  2XXA B;  3C8Z A;  4NCQ A;  4OD5 A;  1Z3I X;  1Q0K A;  1AEP A;  1YA7 O;  4AK9 A;  3TK0 A;  1T6I A;  4G78 A;  4MW8 A;  3IHU A;  2Y3D A;  5KYX B;  1BR2 A;  3JRT A;  2A68 F;  1ZVZ A;  2A69 F;  4LDQ A;  4U5H A;  1D1B A;  3U3F A;  1LKX A;  4KI2 A;  3H2V A;  4ZLC A;  2KK1 A;  3RH3 A;  3ZC4 A;  4CBE A;  2J45 A;  4CIP A;  4H54 A;  3CZ6 A;  4JEA A;  2IOQ A;  1M6T A;  2PBE A;  4MTF A;  1HE9 A;  5A69 A;  5L3V A;  4G7O F;  3MYF A;  4I1O B;  4K0D A;  2HZ8 A;  2WB7 A;  3RQE A;  4OIO F;  1ZHZ A;  2VB6 A;  2OG2 A;  1VB5 A;  4JVS A;  1N1C A;  1J8M F;  1EQ1 A;  2EIJ C;  3T6J A;  3DI5 A;  2ZXR A;  1GQA A;  1WN0 A;  3O39 A;  4EHP A;  3S29 A;  1K05 A;  2YL3 A;  3POV A;  2ASR A;  1C03 A;  2J8W A;  3E9V A;  3NKE A;  1QPU A;  4W8P A;  2MYS A;  2FGY A;  3VF0 A;  2F22 A;  4JW1 A;  3ZQV A;  2AWC A;  4Z9H A;  2I8B A;  1M2V A;  1U0B B;  2E87 A;  2XLM A;  5A6K A;  2XLO A;  1UFB A;  3M1C B;  1AUE A;  4NTA A;  4EUK B;  4DBR A;  4XLP F;  3TOM A;  1TFK B;  2A0U A;  2LFF A;  2P61 A;  2PFD A;  1E84 A;  3IQ6 A;  2R9R B;  4MND A;  3EJN A;  3NKD A;  5KYY A;  3AG4 C;  3FMS A;  4ER9 A;  1HW1 A;  1VYK A;  2AU5 A;  1BR4 A;  3K6B A;  4DOZ A;  1ZHW A;  3AG2 C;  3K1I A;  4JTD B;  2J0W A;  2H8A A;  2XLD A;  3M4C A;  1W2W A;  4FWV A;  4E0I A;  1LS1 A;  2Y69 C;  2CW0 F;  2EIM C;  3EG9 B;  3FAP B;  3IEE A;  1U89 A;  4YK5 A;  4CS9 A;  2R7Q A;  2X51 A;  1WGW A;  4JIO A;  3U9J A;  2OCC C;  1RCP A;  1IZM A;  1Q0M A;  2A0B A;  5DLJ A;  3MBG A;  4D4N A;  4XTK A;  1OCZ C;  3C62 A;  1OXK A;  5JRA A;  1YJG A;  1JPJ A;  3RIP A;  1ZU4 A;  4OD4 A;  2VCC A;  3FVY A;  3GM1 A;  2NG1 A;  2YLD A;  1OCR C;  1BDJ B;  3C7J A;  4I44 A;  4MTO A;  4YL0 A;  4RDA A;  5E2Q A;  3US6 A;  5EGY A;  3W2V A;  1V54 C;  4Z9I A;  2PF4 E;  3K66 A;  2CNW D;  3PMR A;  3FOP A;  2ICW G;  3S27 A;  1A0B A;  2W9Y A;  4NY3 A;  3VM6 A;  5FCL A;  1FNT c;  1O3U A;  4K1O A;  1OQC A;  3C8G B;  3DMD A;  4MVO A;  2L6H A;  3RQG A;  3U5S A;  3LS1 A;  4XQ1 A;  3EGX A;  4G0H A;  3C18 A;  1NLX A;  3C8G D;  3OWT A;  1SR2 A;  2OEV A;  4XEV A;  3ZQY A;  2FAP B;  5KYW B;  1PV3 A;  3AJM A;  1K04 A;  2ZD9 A;  4IAR A;  4U5G A;  3L8I A;  1YZC A;  3TJ6 A;  1NU9 C;  4LDK A;  1GM5 A;  3HJC A;  3DM9 B;  2BE5 F;  1F1M A;  3H2U A;  3CEX A;  2QTV A;  4JE9 A;  4QDL A;  1FAP B;  1KU2 A;  2EPM X;  3C8G A;  2VC9 A;  4OIN F;  5B3I A;  2JD3 A;  5T1D B;  2WZF A;  1E86 A;  4CIH A;  3NYL A;  3S84 A;  2MHR A;  1RMV A;  4ZLD A;  3ASO C;  2KJG A;  3RKO F;  3FXH A;  4I1M A;  3SXM A;  4C7O A;  3O6X A;  1WAT A;  4JKV A;  4X0R A;  1TWC A;  2XS1 A;  4N6C A;  2LK4 A;  2NSG A;  2P6V A;  3ZVR A;  4ONS A;  4WGY A;  4MVR A;  3G4X A;  1QLE C;  1T6Q A;  4AX2 A;  4A2N B;  3TD7 A;  1VOM A;  2IXO A;  4QI0 A;  3EHN A;  1S7Z A;  3BRJ A;  2XRH A;  4P9T A;  3L1M A;  1CPR A;  3KH2 A;  2ZPA A;  4P9F A;  2KGO A;  3Q7G A;  2JPU A;  4MTG A;  2ETS A;  4O6N A;  5E3A A;  3WAQ A;  4AL1 A;  1A7V A;  4DXW A;  5JUA A;  3ITF A;  3MLG A;  5E33 A;  3U2L A;  1D0Y A;  4U9E A;  1G5Z A;  1T9K A;  1YDI A;  4JZA A;  3OA1 A;  2MWQ A;  2NSF A;  3IPM O;  3JYY A;  3EQL F;  3LEV A;  1ORJ A;  2H7B A;  3NRH A;  4HE8 D;  3EGD B;  3NMK A;  3PCV A;  2HMZ A;  2XM4 A;  4DRJ B;  1LE2 A;  3AGU A;  4EBJ A;  1UG7 A;  1KTM A;  4U5B E;  2AP3 A;  3NYJ A;  1T01 A;  4EBB A;  2OJQ A;  3LNR A;  1LI5 A;  1Q0D A;  1RJ9 B;  2J9U A;  1LI7 A;  3EPV A;  5B1A C;  1ORY A;  2CCY A;  1VTM P;  4NC3 A;  5AC4 A;  3ASN C;  1PD0 A;  1GGQ A;  5A6B D;  1ZU5 A;  3WG7 C;  1SYQ A;  4LAC B;  2L81 A;  4GYT A;  2YKZ A;  5T3T A;  3RW0 A;  1RJ9 A;  3QW1 A;  4BPM A;  1CGN A;  2B0J A;  2ZXW C;  2WVN A;  3MYI A;  4W8K A;  5A6A A;  4RD9 A;  1HY5 A;  1A7E A;  3M15 A;  1OKK A;  5A6B A;  3NYM A;  3M4B A;  4MVU A;  3JCU Q;  4PAC A;  1WWP A;  4IAQ A;  4CJO A;  4CS8 A;  2OOC A;  3ZTM A;  3O10 A;  4J30 B;  3HNL A;  2EPO A;  1ORS C;  3EZI A;  1SZI A;  2CGE A;  3VAY A;  1DOW A;  3PHF 2;  5E3C A;  1WAS A;  3HNJ A;  3DE8 A;  3H65 A;  3JTL O;  3QVY A;  3UNG C;  5EHH A;  1K40 A;  3L8J A;  2EPL X;  3B0P A;  1KNY A;  4JCZ A;  4CDA A;  4MS2 A;  3VRC A;  1M2O A;  4DVZ A;  1SF8 A;  4Q7C A;  1RKE A;  3EZH A;  3T6B A;  1M2V B;  1VK5 A;  2IXP A;  1O5H A;  4JEB A;  4LLC A;  2D4U A;  5HSW A;  3RYL A;  2J9B A;  3S28 A;  1RKC A;  1APC A;  5L0I A;  2XLH A;  3HNI A;  5KYY B;  4GQH A;  4EBK A;  4JCH A;  2KSF A;  1M56 C;  3PDM P;  1H9T A;  5K0I A;  3B9Q A;  4CX9 A;  2Q4F A;  2V26 A;  3J06 A;  1MQV A;  2VCB A;  3U8P A;  3FAJ A;  4EKW A;  1VMA A;  1ZYR F;  1GS9 A;  2XM0 A;  3HKK A;  3A11 A;  2R7T A;  1RXQ A;  1U6H A;  3UR3 C;  4L6R A;  2XL8 A;  256B A;  3OEO A;  1HW2 A;  4NTB A;  3SYN A;  4BEM J;  1FTS A;  5D92 A;  3U0C A;  3T6G B;  3SNH A;  2Y39 A;  5F28 E;  2L6F A;  3JRM O;  3KMI A;  4E7Z A;  3NDB B;  1H9G A;  4LLE A;  4WJ0 A;  5BUO A;  3N0T A;  4DRH B;  2W4M A;  4G7H F;  3DXJ F;  4YT2 A;  3R2P A;  4XEK A;  4FES A;  3U3B A;  3QVZ A;  2PX0 A;  4XPX A;  3G50 A;  4YT8 A;  3AG3 C;  2I15 A;  2CYD A;  1QQ3 A;  2QUP A;  3K33 A;  3N24 A;  2R7O A;  4U5F E;  1MMG A;  2Q9B A;  2EIK C;  3EGX B;  5JLI A;  3K1I C;  4QI2 A;  4H4K C;  2HJM A;  4O79 A;  3RFY A;  4G7Z F;  2EPN A;  2H7O A;  1J8Y F;  2DYR C;  3KYJ A;  1Y6D A;  1AVO B;  4B6I A;  3U2M A;  4MVQ A;  1TQG A;  1D1A A;  1FMV A;  5COG A;  4JTA B;  4XPY A;  4CS7 A;  2GAQ A;  3ABM C;  2A6E F;  3SEO A;  2VAS A;  4KC9 A;  1JMW A;  1R5I D;  2YL7 A;  3GEH A;  3UMK A;  1JRA A;  3ABK C;  1V74 B;  1LVK A;  3DZA A;  1Z7Q c;  4C7O B;  2LCH A;  1HE1 A;  4C3E A;  1PCX A;  4YWQ A;  3KKB A;  4M63 A;  2P0N A;  2YLG A;  4N4W A;  4KBL A;  1FFH A;  1QZX A;  3DM5 A;  4YJW A;  3FOO A;  3LAY A;  1NFN A;  1VLT A;  2BL2 A;  1XZQ A;  2DYS C;  3GM3 A;  4IJJ A;  4N6H A;  1VYI A;  1QSP A;  2HFI A;  2HV7 A;  3UMH A;  5CIV A;  5JVE A;  1YYX A;  1E2X A;  4E0H A;  2AVK A;  2L9J A;  3F46 A;  4O7G A;  2NUP B;  2J7P D;  2J9W A;  2LIG A;  2Y3H A;  1BR1 A;  3I4U A;  3W8H A;  1XWJ A;  2YZS A;  1FFT C;  2XL6 A;  2YHS A;  2NPU A;  3SP1 A;  2LSE A;  2RD9 A;  4DJ9 A;  4JUR I;  3AQC A;  4IAO A;  2J7P A;  3GEI A;  1G4U S;  2IBF A;  1NBB A;  2JX0 A;  2GDC A;  2Y3B A;  3IQ5 A;  3QZC A;  4KNW A;  3W8I A;  5B1B C;  3SZR A;  2HS5 A;  2NUP A;  3GWN A;  2Y3G A;  4IRU A;  1T5O A;  3QMK A;  4CDY A;  3R7C A;  1OR3 A;  1CGM E;  1MMD A;  2W4B A;  3GEE A;  2KYH A;  4LDR A;  2KC3 A;  1YZA A;  2P1A A;  2Q3T A;  4BJ6 A;  2NUT A;  1I5N A;  3LLI A;  3GOR A;  3ATP A;  3NMJ A;  4LER A;  4PFP A;  3RVZ A;  4XLN F;  5KYU B;  3T4R A;  1LE4 A;  1TKN A;  2EIL C;  1WTY A;  3W2W A;  5A6J A;  1CPQ A;  3KYI A;  2XLW A;  2QNL A;  3IQC A;  3WHN A;  1Z5Z A;  1TWG A;  2HKV A;  3JYH A;  4NQF A;  4BJ5 A;  1OKK D;  1FR0 A;  4JTC B;  3LLK A;  1LM3 B;  4O6Y A;  4HFK B;  5KYU A;  2KQ9 A;  3EH1 A;  1EI7 A;  1HMD A;  1H6G A;  1NG1 A;  5FZT A;  3GOD A;  1I4Y A;  3BEH A;  2A6H F;  1JAF A;  3CAX A;  2WVO A;  1I4Z A;  4Q4Z F;  1L3P A;  1RKE B;  3ABL C;  3I5Q A;  1Z23 A;  4DBQ A;  3B0U X;  1TR2 A;  4ANJ A;  1BZ4 A;  4PJJ A;  2R02 A;  1YYJ A;  4F4B A;  5B3S C;  1YLM A;  2AWY A;  3QW0 A;  3S9O A;  3ECS A;  3GM2 A;  4RBN A;  4CSA C;  3FDQ A;  4CDV A;  4R32 A;  3ZG1 A;  1Z6A A;  3GWL A;  2LFD A;  3JZ0 A;  3QTH A;  4ULW A;  2BC5 A;  2HSB A;  2DGJ A;  2XLV A;  4OIQ F;  2DB4 A;  2Q00 A;  2C04 A;  4EWC A;  5IY5 C;  2R7W A;  2OQM A;  2R7U A;  2R7X A;  1Q0G A;  3Q7L A;  1OW7 A;  2J46 A;  2PP4 A;  4CS8 C;  3HTK C;  2XLE A;  1G8X A;  4KNV A;  3S90 A;  1ZHX A;  3TOL A;  1IW7 F;  3B29 A;  3KPH A;  1QKR A;  3AGT A;  3GAN A;  3B71 A;  3EFO B;  5COM A;  3VYW A;  4C3D A;  3V5Z A;  2XXA A;  4XPW A;  3DWW A;  4YT4 A;  3HNK A;  4IWB A;  2EIN C;  5DVW A;  3EHM A;  1NSG B;  3TJ5 A;  1JR8 A;  4MVS A;  5KYX A;  2G62 A;  2J9V A;  2XSE A;  3X2Q C;  1Y4C A;  4JJF A;  2YQY A;  4OIR F;  3WOD F;  5L0H A;  3G4Z A;  1M57 C;  5DS6 A;  1YA9 A;  2R03 A;  3JT1 A;  3EFO A;  4J32 B;  5L0F A;  1ZHY A;  5L3Q A;  1XZP A;  2P7V A;  1LPE A;  2HMQ A;  3AQB A;  2FFH A;  3AG1 C;  1MND A;  4HEA J;  2Q9A A;  2D5R B;  4ULV A;  2HSQ A;  3L34 A;  3O55 A;  4PFO A;  5L0G A;  3LEO A;  2C03 A;  3LNM B;  2Q9C A;  2A1D D;  1B68 A;  3LJB A;  4N06 A;  3IQT A;  5JS5 A;  4E7S A;  1MMA A;  1Z63 A;  4J7T A;  1ZHT A;  4PR9 A;  2RSE B;  4DRI B;  3CSK A;  2TMV P;  1C02 A;  4JC7 A;  1H7I A;  3SXK A;  4BJ1 A;  1YAU O;  2KNH A;  2IXN A;  3K1H A;  1O87 A;  2YL0 A;  2ZXO A;  4Z9J A;  5TJ5 E;  4BEJ A;  4FX5 A;  1YAR O;  1EKY A;  1JOG A;  1OR2 A;  2OJE D;  5GPG B;  4HFF B;  4BJT A;  2G3K A;  4C3B A;  4OIP F;  4Q5S F;  2HUJ A;  2EPK X;  3LUT B;  3DJN B;  4CS9 C;  4MQ9 F;  5EK0 A;  3ZTZ A;  4YT5 A;  2Q7R A;  1JPN A;  5D91 A;  2YEV A;  4E17 A;  5CI9 A;  4NTF A;  3Q6M A;  3LS0 A;  1C17 M;  3MX3 A;  2V3C C;  4BG0 A;  1CGO A;  2ZXP A;  3NMI A;  2QLA A;  2GA0 A;  2L7A A;  3KL4 A;  3W4Y A;  3SXY A;  3UMI A;  3EG9 A;  4WGZ A;  4CJG A;  3RQF A;  3DJU B;  3C63 A;  2DI3 A;  2KW3 C;  4A4A A;  4IB4 A;  1NU7 D;  1NFO A;  2WVQ A;  3V7O A;  4MVZ A;  1E83 A;  1OXB A;  2LD6 A;  4U5D E;  2HJ3 A;  5L0C A;  3UGP A;  1BBH A;  2R7V A;  3B0V C;  3SXZ A;  4FAP B;  5F5F A;  2IXM A;  3U9M A;  3N2Z B;  4AL0 A;  4I3M A;  3AOU A;  5BQI A;  4U5C E;  1MNE A;  2CNW A;  2IYL D;  2O9X A;  3FHD A;  1LS4 A;  3T9O A;  2Z15 A;  1A41 A;  5AGF A;  3HLZ A;  2XL4 A;  1OCC C;  1ZW3 A;  2YL1 A;  3I5P A;  2LQG A;  3Q6N A;  4DVY P;  2WZG A;  4O6M A;  2UUI A;  2CDQ A;  2WZL A;  1MMN A;  4J7Y A;  5BQG A;  4U5E E;  3RVY A;  2YLI A;  2OEX A;  1EA8 A;  1SMY F;  3CQZ A;  1V55 C;  3M79 A;  4PJL A;  3TUL A;  2R05 A;  5F5H A;  2NUT B; 
#chains in the Genus database with same CATH homology
 1JAF A;  4CX9 A;  1MQV A;  2YLD A;  3U8P A;  2XM0 A;  5JP7 A;  3FOP A;  4L6R A;  2XL8 A;  256B A;  3HNI A;  3DE9 A;  1YYJ A;  4D4X A;  3QW0 A;  4CDV A;  1E85 A;  2BC5 A;  3ZQY A;  2XLV A;  4IAR A;  1YZC A;  5JSL A;  3ZWI A;  4JE9 A;  3QVZ A;  5B3I A;  2XLE A;  1QQ3 A;  1E86 A;  3TOL A;  4JKV A;  5JLI A;  3HNK A;  5JT4 A;  4WGY A;  1S05 A;  3M79 A;  3L1M A;  1CPR A;  2YL7 A;  4U9D A;  4EIY A;  4ULV A;  5JUA A;  1A7V A;  2YLG A;  4N4W A;  4U9E A;  5JS5 A;  3NMK A;  2XM4 A;  4CIP A;  4N6H A;  4JEA A;  1M6T A;  2YL0 A;  5JVE A;  1YYX A;  1EKY A;  2CCY A;  4NC3 A;  3ZTZ A;  1GQA A;  2XL6 A;  2YL3 A;  2YKZ A;  1CGO A;  2J8W A;  1QPU A;  3QW1 A;  1CGN A;  3NMI A;  1NBB A;  2QLA A;  3IQ5 A;  3ZQV A;  3M15 A;  4WGZ A;  4CJG A;  3M4B A;  3C63 A;  4CDY A;  2XLM A;  4IAQ A;  4CJO A;  4IB4 A;  2XLO A;  3ZTM A;  1E83 A;  3HNL A;  3TOM A;  1YZA A;  1BBH A;  1E84 A;  3IQ6 A;  3HNJ A;  3DE8 A;  3QVY A;  3NMJ A;  4ER9 A;  4CDA A;  3VRC A;  1CPQ A;  2XLD A;  3M4C A;  2XLW A;  5AGF A;  2YL1 A;  4JEB A;  2YLI A;  1RCP A;  2J9B A;  1LM3 B;  1APC A;  4D4N A;  2XLH A;  3FOO A;  3C62 A;  5JRA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...