3NYJA

Crystal structure analysis of app e2 domain
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
181
structure length
181
Chain Sequence
b'LETPGDENEHAHFQKAKERLEAKHRERMSQVMREWEEAERQAKNLPKADKKAVIQHFQEKVESLEQEAANERQQLVETHMARVEAMLNDRRRLALENYITALQAVPPRPRHVFNMLKKYVRAEQKDRQHTLKHFEHVRMVDPKKAAQIRSQVMTHLRVIYERMNQSLSLLYNVPAVAEEIQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Amyloid beta A4 protein
publication title The E2 Domains of APP and APLP1 Share a Conserved Mode of Dimerization.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein fibril
total genus 56
structure length 181
sequence length 181
ec nomenclature
pdb deposition date 2010-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12925 APP_E2 E2 domain of amyloid precursor protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.770 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3nyjA00
3UMHA 3NYJA 4RDAA 3Q7LA 3PMRA 3UMIA 3K6BA 5BUOA 3K66A 4RD9A 3UMKA 3QMKA 1TKNA 3NYLA 4YN0B 3Q7GA
chains in the Genus database with same CATH superfamily
3ASNC 2G3VA 2Y3HA 3FVYA 3V5ZA 3FDQA 2A6EF 4MVSA 1LI7A 5HV9A 1Q0FA 4PACA 4QI2A 3VRCA 2ICWG 4O79A 3HNLA 2HKVA 4E7SA 3TJ6A 2NSGA 5JSLA 1T6QA 3DD7A 3JRMO 3CZ6A 5F5HA 3HJCA 1V54C 1D0YA 5DS4A 3RYLA 1N1CA 1WOLA 4AE4A 2R7VA 1D0XA 2AP3A 1PD1A 1VTMP 1A7EA 1ORYA 1OQCA 1ST6A 5CI9A 4U5CE 4K7BA 1TR2A 4BJ5A 2QY9A 5EHHA 2VCAA 3DE9A 1ZYRF 3US6A 5L3QA 4NC3A 3B0VC 3SEOA 2BE5F 4XEVA 2XLMA 3R7CA 2IYLD 2Q7RA 3WODF 5KYYA 1ZW3A 4RDAA 3UMIA 3DXJF 4CS9C 3SXMA 1HY5A 2Q9AA 3EZIA 3HNKA 4KNVA 2WB7A 3CSKA 1C02A 3QW0A 4JTDB 3NYMA 4MW8A 4XPWA 3U5SA 2EIMC 4JTAB 3S27A 5AGFA 1R5ID 1ZU4A 3FOPA 4PFPA 4YJWA 3TD7A 3U2LA 3IQ5A 1PCXA 256BA 1M2VA 2F22A 2QNLA 1VMAA 2NUPB 3L8JA 5B1BC 4EBJA 2DGJA 1YZAA 3GM1A 3IQCA 1SF8A 2P7VA 2LCHA 4XEFA 3T9OA 3B0UX 2J8WA 1KNYA 2KSFA 2Q9CA 1GGQA 4N4WA 4U5EE 4UDVA 3H2UA 4EBKA 1KTMA 3CQZA 1Z3IX 1ORSC 3QTHA 1G5ZA 2WZGA 3K66A 1YARO 4J7YA 1CGOA 2VCBA 2XS1A 1V55C 3I5QA 4BJ5C 4C3BA 4A4AA 3V5XA 2J7PD 5L0DA 4J30B 4O6YA 3NYJA 3R2PA 1NLXA 1LI5A 4DBRA 3AG2C 3IEEA 2G62A 3TK0A 3TOMA 2V3CC 2HMQA 3LS0A 4MTFA 2XSEA 2FAPB 1ZU5A 3K1IA 4JC7A 2LD6A 1K40A 1WTYA 2R02A 1VYIA 3RVZA 3JT1A 1OW7A 5L0GA 3BEHA 2R7SA 1SYQA 1U6HA 3B71A 2MYSA 3L0IA 1TWGA 3UGPA 3S28A 3GWNA 3HTKC 1FMWA 4IAQA 3EG9A 1E83A 3C8GD 4Z9JA 3EFOB 1LE4A 1ORJA 2MWQA 5E33A 1M56C 1NU9C 3I5PA 5KYNA 2NSFA 2VH3A 3CAXA 2YZSA 3NKDA 1B68A 2D5RB 3TOLA 1BDJB 1JOGA 1Z23A 1PV3A 4GEHA 4E18A 5A6AA 4CSAA 2GAQA 2XLEA 4OIRF 3N2ZB 1ZZPA 4G78A 1WASA 2EPKX 3NMKA 4IJJA 4U5DE 2VCCA 5L0HA 5T1DB 2ZXOA 4LLEA 1A7DA 1D1AA 4EKWA 3A11A 3B0PA 4KI2A 1EQ1A 1K05A 1LPEA 3JTLO 4R32A 2QTVA 4CIPA 2YL3A 4JKVA 2WVNA 1YAUO 2OJED 3WHNA 5JS5A 3W8IA 5DVWA 5GPGB 1JMWA 2YEVA 3ABLC 3G4XA 3QVZA 3RQGA 2CNWA 5T3TA 2ASRA 4A2NB 4P9TA 4E17A 4L6RA 3ITFA 5L0FA 4OIPF 1NG1A 2QLAA 3LNRA 1OKKD 4PFOA 4P6IC 1OXBA 3UNGC 3MBGA 4LACB 1JAFA 5COGA 3AGUA 4Q7CA 4YN0B 1EKYA 4YT4A 1H7IA 1JR8A 3BRJA 3HKKA 3RFYA 2L7AA 1VLSA 4JCZA 2HMZA 4K1OA 3AQBA 3W2VA 1ZHXA 4JEAA 1RCPA 5KYWB 1BR4A 4JEBA 3KYIA 2HS5A 2XLVA 4RD9A 4G7ZF 2IXPA 1Y6DA 2O9XA 1XZQA 4JCHA 4XTKA 5DLJA 2OOCA 5EK0A 1MNEA 5A6KA 3C8GB 5JRAA 2OG2A 3S0XA 2LP4A 1E2XA 3IQTA 4ONSA 3EFOA 3ZTZA 2J46A 1QSPA 3EH1A 2OKUA 3G50A 3VYWA 1SMYF 3M15A 1ZHWA 2OQMA 1QLEC 1C03A 2WZLA 3JZ0A 4JZAA 4XQ1A 3W8HA 3Q6NA 4DRJB 3ZTMA 4GYTA 1WN0A 2NPUA 3L8IA 2J0WA 3NG1A 1QQ3A 3LLKA 2KQ9A 3Q7LA 1J8MF 5B1AC 2XL6A 3PCVA 4CDVA 2YLIA 1Y4CA 3RF3A 4YT2A 4RBNA 3M4BA 1T6IA 4NCQA 2LFFA 1Q0GA 3E70C 3EHMA 2DYSC 3ZWIA 4CS7A 4E7ZA 1YA7O 4Z9HA 2J0XA 2DYRC 4U5FE 3MX3A 2EPOA 3JRTA 2ZD9A 4DJ9A 4AL1A 1T01A 2X0CA 2Y3GA 2JX0A 1WATA 5A6BD 2DI3A 2HUJA 1M6TA 1U0BB 2EPLX 3LEVA 3QW1A 1LS1A 1I4ZA 2J7PA 4MVOA 2J9BA 3T6GB 4ER9A 5KYXB 2VC9A 1APCA 4YWQA 3QMKA 4M63A 5BQHA 3O10A 2L6GA 1WGWA 4JIOA 2NUTB 1YA9A 2P6VA 4YL1A 3EGDB 3M79A 5COMA 5KYWA 1HW2A 1TWCA 3V7OA 2H7OA 2KK1A 1MMDA 3HNIA 3LAYA 4HFFB 3ZQVA 2R7RA 2XM0A 1MMGA 1TWHA 3RIPA 1ZHTA 3ECSA 2XXAB 4CIHA 2PX0A 1W2WA 5AC5A 1GQAA 2J9WA 4C7OB 2AVKA 2PP4A 3C8GA 3ZC4A 4DXWA 2XL8A 4LDRA 3ZDLA 2W4MA 4CX9A 2DB4A 2GA0A 4MVZA 2YVKA 4YK5A 1F1MA 2Q3TA 3ASOC 2XRHA 3IHUA 3OWTA 5KYUA 4OIQF 2Y69C 4K0DA 2G3KA 3CEXA 2A0BA 3DZAA 1H9GA 2HSBA 2KYHA 2PNOA 3KL4A 2A6HF 3O6XA 5E3CA 2JPUA 3UMKA 5JP7A 2A68F 3W4YA 3Q7GA 1ZW2A 4CS8A 3DJUB 1UFBA 3A9CA 3EQLF 2IXOA 1K04A 2B0HA 2EPMX 3AG1C 3LUTB 4DRIB 3PHF2 4PR9A 1HW1A 2IXMA 2YLDA 5AC4A 5KYUB 2R7XA 3ZQYA 2UUIA 4CBEA 3KKBA 2YL7A 3DMDA 4D4XA 3AQCA 1E85A 3LLIA 4YL0A 2A69F 1OKKA 1UG7A 3UGOA 1ZHYA 1Z5ZA 3EPVA 5DQTA 2R7WA 1FAPB 3HNJA 4QI0A 5DQZA 1L3PA 2D4UA 4FX5A 3GEHA 3TJ5A 2MHRA 1FTSA 3S84A 1MNDA 4MTGA 5EGYA 1VK5A 3MYFA 1ZVZA 4W8PA 2NUTA 3KMIA 3EGDA 4MVRA 3GANA 3GM3A 5JVEA 2ETSA 4EWCA 4IB4A 4MVMA 2P1AA 2QE9A 3EJNA 2B0JA 3U2MA 4C3EA 2KC3A 3DJNB 2BC5A 2XXAA 1SZIA 1HE1A 4KC9A 4F4BA 4LDKA 4ZLDA 1OR3A 5BQIA 3ABMC 4NTFA 3U8VA 3VF0A 2HZ8A 5D92A 3S90A 4BJ1A 1Q0DA 3B9QA 3FHDA 4MVQA 3HLZA 4OD4A 4CJOA 4DBQA 2ZXWC 3NMJA 4JRZA 2HSQA 2YWAA 2HV7A 5BQGA 4HEAJ 2Y39A 1S7ZA 2NUPA 4U5BE 4P9FA 1A7VA 1NBBA 4XPXA 3K1IC 3MFNA 4O6MA 2UUHA 2XS8A 4MQ9F 4O7GA 3UMHA 4DRHB 2PBEA 3SXZA 1C17M 3K6BA 2M4EA 1T6UA 4JJFA 3WAQA 4I3MA 5B3IA 3JYYA 1R4TA 3ABKC 3F47A 3GEEA 4FESA 4FAPB 1AUEA 3SXKA 1G4WR 4CDYA 3U3BA 4H54A 3K33A 4HFKB 4WABA 4DVYP 5L0CA 3K7DA 3KH2A 4AK9A 1FMVA 3C62A 4OINF 5A6BA 1V74B 3GODA 4CSAC 4WGZA 4NQFA 2CW0F 4X0RA 4XLPF 3JSEO 3NDBB 1BZ4A 2CCYA 2FFHA 1D1BA 3E9VA 3LEOA 2OJQA 4AX2A 4AL0A 2IBFA 4CDAA 1LIHA 1A41A 1TFKB 4IWBA 2J9UA 1YZCA 2VASA 3FXHA 4IRUA 4XWJA 1CGNA 1IW7F 4AE4B 4BJ6A 5IY5C 1KU2A 4JVSA 2R03A 2R9RB 1WWPA 4ZLCA 4W8KA 5K0IA 2R7QA 1VB5A 2J45A 2WVQA 1OCZC 3KPHA 1FFHA 2LQGA 3DM9B 1RKEB 1JRAA 3DE8A 3NYLA 4N06A 4JURI 4BEJA 4XLNF 1HE9A 2I15A 3NRHA 1GS9A 1TQGA 2V26A 2XM4A 1QZXA 4H4KC 1OXKA 1DOVA 3FAPB 2LIGA 2PFDA 3LS1A 5DS6A 1CPQA 1YJGA 2YLGA 3N24A 1H6GA 3W2WA 3WG7C 1MMNA 4DVZA 4N6HA 1DOWA 2GWWA 1VOMA 4EHPA 3S9OA 2IM8A 3DI5A 1VYKA 3M1CB 4Z9IA 4NY3A 1QVXA 2LK4A 5DS5A 2BL2A 2L9JA 1TFOB 4IGGA 3EGXB 3S29A 1M2VB 1Q0MA 1D0ZA 1O87A 4KNWA 1JPJA 5JT4A 4G7OF 2AU5A 1Z63A 3TQOA 1FFTC 2YL0A 5CIVA 4LLCA 1TWAA 4PJLA 1O5HA 3SNHA 5F5FA 1BR2A 4MW3A 4YT5A 3SXYA 4D4NA 5BUOA 2WL8A 3GM2A 1AEPA 4JW1A 2EINC 4EIYA 1T9KA 1YYXA 4PK4A 2JD3A 3H65A 1OCRC 3T6JA 1LE2A 4C3DA 5A6JA 1FR0A 4DOZA 5T3WA 3AJMA 4BEMJ 2H8AA 3K1HA 3U9JA 3ATPA 3F46A 3UR3C 1M57C 2R05A 1EI7A 4OD5A 2OCCC 1E84A 4FWVA 4OIOF 2TMVP 1PD0A 2R7TA 1Z6AA 1Z7Qc 3U0CA 1ZHZA 4HE8D 3LESA 3T4RA 4G0HA 1RKEA 2EIKC 2WVOA 3PMRA 2NG1A 1O3UA 4LERA 1NU7D 3EG9B 4PJJA 1CPRA 1Q0KA 1OCCC 4EUKB 1H9TA 2YKZA 1IZMA 2P0NA 5TJ5E 4QDLA 1S05A 3U9MA 1RXQA 2XLDA 5L0JA 2LFDA 3RKOF 2P61A 1HMOA 1L7CA 2R25A 2ZXPA 1RMVA 2YHSA 3JYHA 4GQHA 4O6NA 2A0UA 3N0TA 1U89A 4JE9A 1V4AA 1TKNA 4CJGA 4J32B 5JUAA 4I44A 5JLIA 3EGXA 1MMAA 3B29A 5COFA 2Z15A 1T5OA 2Y3BA 4MNDA 4EBBA 1LS4A 5KYXA 3EZHA 3MYIA 2KJGA 3FOOA 2XLWA 1SR2A 3ZG1A 2E87A 1XZPA 3U3FA 2IXNA 2RSEB 4YT8A 3RQFA 2XLOA 4WJ0A 1J8YF 5FCLA 3VM6A 2KGOA 4C7OA 4CS8C 3GEIA 3X1OA 4MTOA 4E0HA 4BPMA 2EPNA 1VLTA 3J06A 4U9EA 2CGEA 4MVUA 2I8BA 5FZTA 4U9DA 3M4CA 2WZFA 1NFNA 3C18A 4ULWA 3RW0A 3V5YA 2XL4A 5CI8A 2OEVA 3DAFA 5E3AA 3SYNA 4N6CA 1RJ9B 2CDQA 2EILC 2Q9BA 3G4ZA 3EH2A 4YL3A 4ULVA 4BJTA 1G4US 4J7TA 3KYJA 3ZVRA 4E0IA 5L0IA 4Q4ZF 3DKAA 3DM5A 2ZXRA 1JPNA 5F28E 3IPMO 2QUPA 3ZSUA 2L81A 2PX3A 3O39A 4PJMA 5L3VA 2Q4FA 2RD9A 3JCUQ 3U8PA 4NTBA 1M2OA 2H7BA 3AG4C 1LVKA 1MQVA 2ZPAA 4G7HF 3SZRA 2X51A 2C03A 1GM5A 1I4YA 5D91A 1FNTc 2OU6A 1OR2A 1OW6A 2H7VC 3IQ6A 2R7OA 2L6FA 2HV6A 3VAYA 3JSZA 2A1DD 2IOQA 4KBLA 3TULA 2HJMA 3C8ZA 1AVOB 2KW3C 4JTCB 2HJ3A 2YRFA 3LJBA 3T6BA 2M64A 3GWLA 2R7UA 2EIJC 4BG0A 4ANJA 4B6IA 3L1MA 4XPYA 2PF4E 3L34A 1EA8A 1YDIA 4XEKA 4Q5SF 1NZEA 2FGYA 2VB6A 2XLHA 2AWYA 2YL1A 3AOUA 3AG3C 2J9VA 4I1OB 1D1CA 1YYJA 2W9YA 3DAGA 3Q6MA 4U5GA 2Y3DA 3FAJA 3EHNA 3RVYA 1CGME 3SP1A 3OA1A 1NFOA 3NMIA 3QZCA 4IARA 2OEXA 4NTAA 2YQYA 4U5HA 3NKEA 2Q00A 3I4UA 3O55A 4JJGA 5B3SC 1LKXA 3C63A 5A69A 5KYYB 5E2QA 1RJ9A 3MLGA 3RQEA 2W4BA 2C04A 1QKRA 1RKCA 2LSEA 3AGTA 1I5NA 3C7JA 4IAOA 3OEOA 2GFHA 1XWJA 3QVYA 4WGYA 1YLMA 2W45A 2KNHA 1YVIA 3FMSA 3X2QC 5HSWA 4LDQA 3DWWA 3RH3A 1E86A 1LM3B 1A0BA 2AWCA 4MS2A 1G8XA 2L6HA 4BJ6C 3ZIBA 1BBHA 2GDCA 3PDMP 2CYDA 1OCOC 1QPUA 2CNWD 3GORA 4I1MA 1OW8A 1NSGB 3POVA 1HMDA 1BR1A 4PJNA 4CS9A 3LNMB 3H2VA 2HFIA
chains in the Genus database with same CATH topology
3ASNC 2G3VA 2Y3HA 3FVYA 3FDQA 2A6EF 4QI2A 4O79A 4E7SA 3DD7A 3CZ6A 5F5HA 3HJCA 1V54C 1D0YA 5DS4A 3RYLA 1N1CA 4AE4A 2R7VA 1D0XA 1PD1A 1ST6A 5CI9A 4U5CE 4K7BA 1TR2A 4BJ5A 2QY9A 5EHHA 5L3QA 1ZYRF 3B0VC 3SEOA 2BE5F 2IYLD 3WODF 5KYYA 4RDAA 3UMIA 3DXJF 4CS9C 2Q9AA 3EZIA 4KNVA 2WB7A 3CSKA 3NYMA 2EIMC 3S27A 4PFPA 1ZU4A 4YJWA 1PCXA 1M2VA 1VMAA 2NUPB 5B1BC 2DGJA 1SF8A 2P7VA 3B0UX 2Q9CA 4U5EE 3CQZA 1Z3IX 2WZGA 3K66A 4BJ5C 4G7OF 4C3BA 3I5QA 1V55C 2J7PD 4J30B 4O6YA 3NYJA 4DBRA 3AG2C 3IEEA 2G62A 2V3CC 3LS0A 2XSEA 1ZU5A 1VYIA 3JT1A 2MYSA 3L0IA 1TWGA 3UGPA 3S28A 3HTKC 1FMWA 3EG9A 3EFOB 2MWQA 5E33A 1M56C 1NU9C 3I5PA 5KYNA 2VH3A 3NKDA 2YZSA 2D5RB 1Z23A 4CSAA 4GEHA 4OIRF 3N2ZB 4IJJA 4U5DE 5T1DB 2ZXOA 4LLEA 1D1AA 4KI2A 3B0PA 2QTVA 2WVNA 3W8IA 5DVWA 2YEVA 3ABLC 2CNWA 5T3TA 4A2NB 3ITFA 4OIPF 1NG1A 3UNGC 3LNRA 1OKKD 4PFOA 4P6IC 4LACB 4Q7CA 4YN0B 4YT4A 3RFYA 3AQBA 3W2VA 1ZHXA 5KYWB 1BR4A 4RD9A 4G7ZF 2IXPA 2O9XA 4XTKA 5DLJA 4JCHA 1MNEA 2OG2A 3S0XA 3EFOA 2J46A 3EH1A 3VYWA 1SMYF 1ZHWA 1QLEC 2WZLA 4JZAA 3W8HA 5KYUB 3Q6NA 4GYTA 2J0WA 3NG1A 3LLKA 2KQ9A 3Q7LA 1J8MF 5B1AC 4YT2A 4RBNA 3E70C 3EHMA 2DYSC 4CS7A 4E7ZA 2J0XA 2DYRC 4U5FE 3MX3A 3JRTA 2Y3GA 3LEVA 1LS1A 2J7PA 5KYXB 4YWQA 3QMKA 4M63A 1WGWA 2NUTB 2P6VA 3EGDB 5KYWA 1TWCA 3V7OA 2H7OA 3LAYA 1MMDA 4HFFB 2R7RA 1TWHA 1MMGA 3RIPA 1ZHTA 3ECSA 2XXAB 4CIHA 2PX0A 1W2WA 4C7OB 2J9WA 2PP4A 3ZC4A 2W4MA 2Q3TA 3ASOC 2XRHA 5KYUA 3OWTA 4OIQF 2Y69C 4K0DA 2G3KA 3DZAA 3KL4A 5E3CA 2A6HF 3O6XA 3UMKA 2A68F 4CS8A 3Q7GA 3DJUB 3EQLF 2IXOA 3AG1C 3PHF2 2IXMA 2R7XA 4CBEA 3KKBA 3DMDA 3AQCA 3LLIA 2A69F 1OKKA 3UGOA 1ZHYA 1Z5ZA 3EPVA 5DQTA 2R7WA 4QI0A 5DQZA 4FX5A 1FTSA 1MNDA 5EGYA 1VK5A 2NUTA 3KMIA 3EGDA 3GANA 4EWCA 3EJNA 2B0JA 4C3EA 3DJNB 2XXAA 1SZIA 4KC9A 4F4BA 4ZLDA 3ABMC 5D92A 4BJ1A 3B9QA 3FHDA 4DBQA 4OD4A 3HLZA 2ZXWC 2HV7A 4HEAJ 2Y39A 1S7ZA 2NUPA 4U5BE 3K1IC 4O6MA 4O7GA 4MQ9F 3UMHA 3K6BA 2M4EA 4JJFA 4I3MA 3ABKC 3F47A 4FESA 4HFKB 3K33A 4DVYP 3K7DA 3KH2A 4AK9A 1FMVA 4OINF 4CSAC 3GODA 2CW0F 4X0RA 4XLPF 3NDBB 2FFHA 1D1BA 3E9VA 4AX2A 4IWBA 2J9UA 2VASA 4IRUA 4XWJA 4BJ6A 1IW7F 4AE4B 5IY5C 1KU2A 4JVSA 4ZLCA 4W8KA 2R7QA 2J45A 2WVQA 1OCZC 1FFHA 3DM9B 3NYLA 2R7SA 4BEJA 4N06A 4JURI 4XLNF 3TD7A 3NRHA 2V26A 4H4KC 1QZXA 2PFDA 3LS1A 5DS6A 3WG7C 3N24A 3W2WA 1MMNA 4DVZA 1VOMA 1VYKA 3M1CB 4NY3A 5DS5A 2L9JA 3S29A 3EGXB 1M2VB 1D0ZA 1O87A 4KNWA 1JPJA 1Z63A 1FFTC 4LLCA 1TWAA 4PJLA 1O5HA 3SNHA 5F5FA 1BR2A 4YT5A 5BUOA 2WL8A 4JW1A 2EINC 4PK4A 2JD3A 3H65A 1OCRC 3T6JA 4C3DA 4DOZA 5T3WA 3K1HA 3F46A 3UR3C 1M57C 4OD5A 2OCCC 4FWVA 4OIOF 1PD0A 2R7TA 1Z6AA 1ZHZA 4HE8D 3LESA 3T4RA 4G0HA 3PMRA 2EIKC 2WVOA 2NG1A 4LERA 1NU7D 3EG9B 4PJJA 1OCCC 1IZMA 4QDLA 3RKOF 2ZXPA 2YHSA 3JYHA 4O6NA 3N0TA 1TKNA 4J32B 4I44A 3EGXA 1MMAA 2Z15A 2Y3BA 4MNDA 4EBBA 5KYXA 3EZHA 2KJGA 3ZG1A 2E87A 2IXNA 4YT8A 4WJ0A 1J8YF 5FCLA 2KGOA 4C7OA 4CS8C 3X1OA 2CGEA 2I8BA 2WZFA 4ULWA 2XL4A 5CI8A 5E3AA 3DAFA 3SYNA 1RJ9B 2CDQA 2EILC 2Q9BA 3EH2A 4BJTA 3ZVRA 4Q4ZF 3DM5A 2ZXRA 1JPNA 3ZSUA 2L81A 2PX3A 3O39A 4PJMA 5L3VA 3JCUQ 1M2OA 2H7BA 3AG4C 1LVKA 2ZPAA 4G7HF 3SZRA 2X51A 2C03A 5D91A 2H7VC 2R7OA 2HV6A 3VAYA 3JSZA 2A1DD 2IOQA 4KBLA 2KW3C 3LJBA 3T6BA 2R7UA 2EIJC 4BG0A 4ANJA 4B6IA 2PF4E 3L34A 4Q5SF 1NZEA 2FGYA 2VB6A 3AG3C 2J9VA 4I1OB 1D1CA 2W9YA 3Q6MA 3DAGA 4U5GA 2Y3DA 3FAJA 3EHNA 3SP1A 3OA1A 3QZCA 4U5HA 3NKEA 3I4UA 4JJGA 5B3SC 1LKXA 5KYYB 5E2QA 1RJ9A 3MLGA 2W4BA 2C04A 2LSEA 4IAOA 3OEOA 2GFHA 2W45A 2KNHA 3X2QC 5HSWA 3RH3A 1G8XA 4BJ6C 3ZIBA 1OCOC 2CNWD 4I1MA 3POVA 4PJNA 1BR1A 4CS9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UMH A;  3NYJ A;  4RDA A;  3Q7L A;  3PMR A;  3UMI A;  3K6B A;  5BUO A;  3K66 A;  4RD9 A;  3UMK A;  3QMK A;  1TKN A;  3NYL A;  4YN0 B;  3Q7G A; 
#chains in the Genus database with same CATH topology
 3ASN C;  2G3V A;  2Y3H A;  3FVY A;  3V5Z A;  3FDQ A;  2A6E F;  4MVS A;  1LI7 A;  5HV9 A;  1Q0F A;  4PAC A;  4QI2 A;  3VRC A;  2ICW G;  4O79 A;  3HNL A;  2HKV A;  4E7S A;  3TJ6 A;  2NSG A;  5JSL A;  1T6Q A;  3DD7 A;  3JRM O;  3CZ6 A;  5F5H A;  3HJC A;  1V54 C;  1D0Y A;  5DS4 A;  3RYL A;  1N1C A;  1WOL A;  4AE4 A;  2R7V A;  1D0X A;  2AP3 A;  1PD1 A;  1VTM P;  1A7E A;  1ORY A;  1OQC A;  1ST6 A;  5CI9 A;  4U5C E;  4K7B A;  1TR2 A;  4BJ5 A;  2QY9 A;  5EHH A;  2VCA A;  3DE9 A;  1ZYR F;  3US6 A;  5L3Q A;  4NC3 A;  3B0V C;  3SEO A;  2BE5 F;  4XEV A;  2XLM A;  3R7C A;  2IYL D;  2Q7R A;  3WOD F;  5KYY A;  1ZW3 A;  4RDA A;  3UMI A;  3DXJ F;  4CS9 C;  3SXM A;  1HY5 A;  2Q9A A;  3EZI A;  3HNK A;  4KNV A;  2WB7 A;  3CSK A;  1C02 A;  3QW0 A;  4JTD B;  3NYM A;  4MW8 A;  4XPW A;  3U5S A;  2EIM C;  4JTA B;  3S27 A;  5AGF A;  1R5I D;  1ZU4 A;  3FOP A;  4PFP A;  4YJW A;  3TD7 A;  3U2L A;  3IQ5 A;  1PCX A;  256B A;  1M2V A;  2F22 A;  2QNL A;  1VMA A;  2NUP B;  3L8J A;  5B1B C;  4EBJ A;  2DGJ A;  1YZA A;  3GM1 A;  3IQC A;  1SF8 A;  2P7V A;  2LCH A;  4XEF A;  3T9O A;  3B0U X;  2J8W A;  1KNY A;  2KSF A;  2Q9C A;  1GGQ A;  4N4W A;  4U5E E;  4UDV A;  3H2U A;  4EBK A;  1KTM A;  3CQZ A;  1Z3I X;  1ORS C;  3QTH A;  1G5Z A;  2WZG A;  3K66 A;  1YAR O;  4J7Y A;  1CGO A;  2VCB A;  2XS1 A;  1V55 C;  3I5Q A;  4BJ5 C;  4C3B A;  4A4A A;  3V5X A;  2J7P D;  5L0D A;  4J30 B;  4O6Y A;  3NYJ A;  3R2P A;  1NLX A;  1LI5 A;  4DBR A;  3AG2 C;  3IEE A;  2G62 A;  3TK0 A;  3TOM A;  2V3C C;  2HMQ A;  3LS0 A;  4MTF A;  2XSE A;  2FAP B;  1ZU5 A;  3K1I A;  4JC7 A;  2LD6 A;  1K40 A;  1WTY A;  2R02 A;  1VYI A;  3RVZ A;  3JT1 A;  1OW7 A;  5L0G A;  3BEH A;  2R7S A;  1SYQ A;  1U6H A;  3B71 A;  2MYS A;  3L0I A;  1TWG A;  3UGP A;  3S28 A;  3GWN A;  3HTK C;  1FMW A;  4IAQ A;  3EG9 A;  1E83 A;  3C8G D;  4Z9J A;  3EFO B;  1LE4 A;  1ORJ A;  2MWQ A;  5E33 A;  1M56 C;  1NU9 C;  3I5P A;  5KYN A;  2NSF A;  2VH3 A;  3CAX A;  2YZS A;  3NKD A;  1B68 A;  2D5R B;  3TOL A;  1BDJ B;  1JOG A;  1Z23 A;  1PV3 A;  4GEH A;  4E18 A;  5A6A A;  4CSA A;  2GAQ A;  2XLE A;  4OIR F;  3N2Z B;  1ZZP A;  4G78 A;  1WAS A;  2EPK X;  3NMK A;  4IJJ A;  4U5D E;  2VCC A;  5L0H A;  5T1D B;  2ZXO A;  4LLE A;  1A7D A;  1D1A A;  4EKW A;  3A11 A;  3B0P A;  4KI2 A;  1EQ1 A;  1K05 A;  1LPE A;  3JTL O;  4R32 A;  2QTV A;  4CIP A;  2YL3 A;  4JKV A;  2WVN A;  1YAU O;  2OJE D;  3WHN A;  5JS5 A;  3W8I A;  5DVW A;  5GPG B;  1JMW A;  2YEV A;  3ABL C;  3G4X A;  3QVZ A;  3RQG A;  2CNW A;  5T3T A;  2ASR A;  4A2N B;  4P9T A;  4E17 A;  4L6R A;  3ITF A;  5L0F A;  4OIP F;  1NG1 A;  2QLA A;  3LNR A;  1OKK D;  4PFO A;  4P6I C;  1OXB A;  3UNG C;  3MBG A;  4LAC B;  1JAF A;  5COG A;  3AGU A;  4Q7C A;  4YN0 B;  1EKY A;  4YT4 A;  1H7I A;  1JR8 A;  3BRJ A;  3HKK A;  3RFY A;  2L7A A;  1VLS A;  4JCZ A;  2HMZ A;  4K1O A;  3AQB A;  3W2V A;  1ZHX A;  4JEA A;  1RCP A;  5KYW B;  1BR4 A;  4JEB A;  3KYI A;  2HS5 A;  2XLV A;  4RD9 A;  4G7Z F;  2IXP A;  1Y6D A;  2O9X A;  1XZQ A;  4JCH A;  4XTK A;  5DLJ A;  2OOC A;  5EK0 A;  1MNE A;  5A6K A;  3C8G B;  5JRA A;  2OG2 A;  3S0X A;  2LP4 A;  1E2X A;  3IQT A;  4ONS A;  3EFO A;  3ZTZ A;  2J46 A;  1QSP A;  3EH1 A;  2OKU A;  3G50 A;  3VYW A;  1SMY F;  3M15 A;  1ZHW A;  2OQM A;  1QLE C;  1C03 A;  2WZL A;  3JZ0 A;  4JZA A;  4XQ1 A;  3W8H A;  3Q6N A;  4DRJ B;  3ZTM A;  4GYT A;  1WN0 A;  2NPU A;  3L8I A;  2J0W A;  3NG1 A;  1QQ3 A;  3LLK A;  2KQ9 A;  3Q7L A;  1J8M F;  5B1A C;  2XL6 A;  3PCV A;  4CDV A;  2YLI A;  1Y4C A;  3RF3 A;  4YT2 A;  4RBN A;  3M4B A;  1T6I A;  4NCQ A;  2LFF A;  1Q0G A;  3E70 C;  3EHM A;  2DYS C;  3ZWI A;  4CS7 A;  4E7Z A;  1YA7 O;  4Z9H A;  2J0X A;  2DYR C;  4U5F E;  3MX3 A;  2EPO A;  3JRT A;  2ZD9 A;  4DJ9 A;  4AL1 A;  1T01 A;  2X0C A;  2Y3G A;  2JX0 A;  1WAT A;  5A6B D;  2DI3 A;  2HUJ A;  1M6T A;  1U0B B;  2EPL X;  3LEV A;  3QW1 A;  1LS1 A;  1I4Z A;  2J7P A;  4MVO A;  2J9B A;  3T6G B;  4ER9 A;  5KYX B;  2VC9 A;  1APC A;  4YWQ A;  3QMK A;  4M63 A;  5BQH A;  3O10 A;  2L6G A;  1WGW A;  4JIO A;  2NUT B;  1YA9 A;  2P6V A;  4YL1 A;  3EGD B;  3M79 A;  5COM A;  5KYW A;  1HW2 A;  1TWC A;  3V7O A;  2H7O A;  2KK1 A;  1MMD A;  3HNI A;  3LAY A;  4HFF B;  3ZQV A;  2R7R A;  2XM0 A;  1MMG A;  1TWH A;  3RIP A;  1ZHT A;  3ECS A;  2XXA B;  4CIH A;  2PX0 A;  1W2W A;  5AC5 A;  1GQA A;  2J9W A;  4C7O B;  2AVK A;  2PP4 A;  3C8G A;  3ZC4 A;  4DXW A;  2XL8 A;  4LDR A;  3ZDL A;  2W4M A;  4CX9 A;  2DB4 A;  2GA0 A;  4MVZ A;  2YVK A;  4YK5 A;  1F1M A;  2Q3T A;  3ASO C;  2XRH A;  3IHU A;  3OWT A;  5KYU A;  4OIQ F;  2Y69 C;  4K0D A;  2G3K A;  3CEX A;  2A0B A;  3DZA A;  1H9G A;  2HSB A;  2KYH A;  2PNO A;  3KL4 A;  2A6H F;  3O6X A;  5E3C A;  2JPU A;  3UMK A;  5JP7 A;  2A68 F;  3W4Y A;  3Q7G A;  1ZW2 A;  4CS8 A;  3DJU B;  1UFB A;  3A9C A;  3EQL F;  2IXO A;  1K04 A;  2B0H A;  2EPM X;  3AG1 C;  3LUT B;  4DRI B;  3PHF 2;  4PR9 A;  1HW1 A;  2IXM A;  2YLD A;  5AC4 A;  5KYU B;  2R7X A;  3ZQY A;  2UUI A;  4CBE A;  3KKB A;  2YL7 A;  3DMD A;  4D4X A;  3AQC A;  1E85 A;  3LLI A;  4YL0 A;  2A69 F;  1OKK A;  1UG7 A;  3UGO A;  1ZHY A;  1Z5Z A;  3EPV A;  5DQT A;  2R7W A;  1FAP B;  3HNJ A;  4QI0 A;  5DQZ A;  1L3P A;  2D4U A;  4FX5 A;  3GEH A;  3TJ5 A;  2MHR A;  1FTS A;  3S84 A;  1MND A;  4MTG A;  5EGY A;  1VK5 A;  3MYF A;  1ZVZ A;  4W8P A;  2NUT A;  3KMI A;  3EGD A;  4MVR A;  3GAN A;  3GM3 A;  5JVE A;  2ETS A;  4EWC A;  4IB4 A;  4MVM A;  2P1A A;  2QE9 A;  3EJN A;  2B0J A;  3U2M A;  4C3E A;  2KC3 A;  3DJN B;  2BC5 A;  2XXA A;  1SZI A;  1HE1 A;  4KC9 A;  4F4B A;  4LDK A;  4ZLD A;  1OR3 A;  5BQI A;  3ABM C;  4NTF A;  3U8V A;  3VF0 A;  2HZ8 A;  5D92 A;  3S90 A;  4BJ1 A;  1Q0D A;  3B9Q A;  3FHD A;  4MVQ A;  3HLZ A;  4OD4 A;  4CJO A;  4DBQ A;  2ZXW C;  3NMJ A;  4JRZ A;  2HSQ A;  2YWA A;  2HV7 A;  5BQG A;  4HEA J;  2Y39 A;  1S7Z A;  2NUP A;  4U5B E;  4P9F A;  1A7V A;  1NBB A;  4XPX A;  3K1I C;  3MFN A;  4O6M A;  2UUH A;  2XS8 A;  4MQ9 F;  4O7G A;  3UMH A;  4DRH B;  2PBE A;  3SXZ A;  1C17 M;  3K6B A;  2M4E A;  1T6U A;  4JJF A;  3WAQ A;  4I3M A;  5B3I A;  3JYY A;  1R4T A;  3ABK C;  3F47 A;  3GEE A;  4FES A;  4FAP B;  1AUE A;  3SXK A;  1G4W R;  4CDY A;  3U3B A;  4H54 A;  3K33 A;  4HFK B;  4WAB A;  4DVY P;  5L0C A;  3K7D A;  3KH2 A;  4AK9 A;  1FMV A;  3C62 A;  4OIN F;  5A6B A;  1V74 B;  3GOD A;  4CSA C;  4WGZ A;  4NQF A;  2CW0 F;  4X0R A;  4XLP F;  3JSE O;  3NDB B;  1BZ4 A;  2CCY A;  2FFH A;  1D1B A;  3E9V A;  3LEO A;  2OJQ A;  4AX2 A;  4AL0 A;  2IBF A;  4CDA A;  1LIH A;  1A41 A;  1TFK B;  4IWB A;  2J9U A;  1YZC A;  2VAS A;  3FXH A;  4IRU A;  4XWJ A;  1CGN A;  1IW7 F;  4AE4 B;  4BJ6 A;  5IY5 C;  1KU2 A;  4JVS A;  2R03 A;  2R9R B;  1WWP A;  4ZLC A;  4W8K A;  5K0I A;  2R7Q A;  1VB5 A;  2J45 A;  2WVQ A;  1OCZ C;  3KPH A;  1FFH A;  2LQG A;  3DM9 B;  1RKE B;  1JRA A;  3DE8 A;  3NYL A;  4N06 A;  4JUR I;  4BEJ A;  4XLN F;  1HE9 A;  2I15 A;  3NRH A;  1GS9 A;  1TQG A;  2V26 A;  2XM4 A;  1QZX A;  4H4K C;  1OXK A;  1DOV A;  3FAP B;  2LIG A;  2PFD A;  3LS1 A;  5DS6 A;  1CPQ A;  1YJG A;  2YLG A;  3N24 A;  1H6G A;  3W2W A;  3WG7 C;  1MMN A;  4DVZ A;  4N6H A;  1DOW A;  2GWW A;  1VOM A;  4EHP A;  3S9O A;  2IM8 A;  3DI5 A;  1VYK A;  3M1C B;  4Z9I A;  4NY3 A;  1QVX A;  2LK4 A;  5DS5 A;  2BL2 A;  2L9J A;  1TFO B;  4IGG A;  3EGX B;  3S29 A;  1M2V B;  1Q0M A;  1D0Z A;  1O87 A;  4KNW A;  1JPJ A;  5JT4 A;  4G7O F;  2AU5 A;  1Z63 A;  3TQO A;  1FFT C;  2YL0 A;  5CIV A;  4LLC A;  1TWA A;  4PJL A;  1O5H A;  3SNH A;  5F5F A;  1BR2 A;  4MW3 A;  4YT5 A;  3SXY A;  4D4N A;  5BUO A;  2WL8 A;  3GM2 A;  1AEP A;  4JW1 A;  2EIN C;  4EIY A;  1T9K A;  1YYX A;  4PK4 A;  2JD3 A;  3H65 A;  1OCR C;  3T6J A;  1LE2 A;  4C3D A;  5A6J A;  1FR0 A;  4DOZ A;  5T3W A;  3AJM A;  4BEM J;  2H8A A;  3K1H A;  3U9J A;  3ATP A;  3F46 A;  3UR3 C;  1M57 C;  2R05 A;  1EI7 A;  4OD5 A;  2OCC C;  1E84 A;  4FWV A;  4OIO F;  2TMV P;  1PD0 A;  2R7T A;  1Z6A A;  1Z7Q c;  3U0C A;  1ZHZ A;  4HE8 D;  3LES A;  3T4R A;  4G0H A;  1RKE A;  2EIK C;  2WVO A;  3PMR A;  2NG1 A;  1O3U A;  4LER A;  1NU7 D;  3EG9 B;  4PJJ A;  1CPR A;  1Q0K A;  1OCC C;  4EUK B;  1H9T A;  2YKZ A;  1IZM A;  2P0N A;  5TJ5 E;  4QDL A;  1S05 A;  3U9M A;  1RXQ A;  2XLD A;  5L0J A;  2LFD A;  3RKO F;  2P61 A;  1HMO A;  1L7C A;  2R25 A;  2ZXP A;  1RMV A;  2YHS A;  3JYH A;  4GQH A;  4O6N A;  2A0U A;  3N0T A;  1U89 A;  4JE9 A;  1V4A A;  1TKN A;  4CJG A;  4J32 B;  5JUA A;  4I44 A;  5JLI A;  3EGX A;  1MMA A;  3B29 A;  5COF A;  2Z15 A;  1T5O A;  2Y3B A;  4MND A;  4EBB A;  1LS4 A;  5KYX A;  3EZH A;  3MYI A;  2KJG A;  3FOO A;  2XLW A;  1SR2 A;  3ZG1 A;  2E87 A;  1XZP A;  3U3F A;  2IXN A;  2RSE B;  4YT8 A;  3RQF A;  2XLO A;  4WJ0 A;  1J8Y F;  5FCL A;  3VM6 A;  2KGO A;  4C7O A;  4CS8 C;  3GEI A;  3X1O A;  4MTO A;  4E0H A;  4BPM A;  2EPN A;  1VLT A;  3J06 A;  4U9E A;  2CGE A;  4MVU A;  2I8B A;  5FZT A;  4U9D A;  3M4C A;  2WZF A;  1NFN A;  3C18 A;  4ULW A;  3RW0 A;  3V5Y A;  2XL4 A;  5CI8 A;  2OEV A;  3DAF A;  5E3A A;  3SYN A;  4N6C A;  1RJ9 B;  2CDQ A;  2EIL C;  2Q9B A;  3G4Z A;  3EH2 A;  4YL3 A;  4ULV A;  4BJT A;  1G4U S;  4J7T A;  3KYJ A;  3ZVR A;  4E0I A;  5L0I A;  4Q4Z F;  3DKA A;  3DM5 A;  2ZXR A;  1JPN A;  5F28 E;  3IPM O;  2QUP A;  3ZSU A;  2L81 A;  2PX3 A;  3O39 A;  4PJM A;  5L3V A;  2Q4F A;  2RD9 A;  3JCU Q;  3U8P A;  4NTB A;  1M2O A;  2H7B A;  3AG4 C;  1LVK A;  1MQV A;  2ZPA A;  4G7H F;  3SZR A;  2X51 A;  2C03 A;  1GM5 A;  1I4Y A;  5D91 A;  1FNT c;  2OU6 A;  1OR2 A;  1OW6 A;  2H7V C;  3IQ6 A;  2R7O A;  2L6F A;  2HV6 A;  3VAY A;  3JSZ A;  2A1D D;  2IOQ A;  4KBL A;  3TUL A;  2HJM A;  3C8Z A;  1AVO B;  2KW3 C;  4JTC B;  2HJ3 A;  2YRF A;  3LJB A;  3T6B A;  2M64 A;  3GWL A;  2R7U A;  2EIJ C;  4BG0 A;  4ANJ A;  4B6I A;  3L1M A;  4XPY A;  2PF4 E;  3L34 A;  1EA8 A;  1YDI A;  4XEK A;  4Q5S F;  1NZE A;  2FGY A;  2VB6 A;  2XLH A;  2AWY A;  2YL1 A;  3AOU A;  3AG3 C;  2J9V A;  4I1O B;  1D1C A;  1YYJ A;  2W9Y A;  3DAG A;  3Q6M A;  4U5G A;  2Y3D A;  3FAJ A;  3EHN A;  3RVY A;  1CGM E;  3SP1 A;  3OA1 A;  1NFO A;  3NMI A;  3QZC A;  4IAR A;  2OEX A;  4NTA A;  2YQY A;  4U5H A;  3NKE A;  2Q00 A;  3I4U A;  3O55 A;  4JJG A;  5B3S C;  1LKX A;  3C63 A;  5A69 A;  5KYY B;  5E2Q A;  1RJ9 A;  3MLG A;  3RQE A;  2W4B A;  2C04 A;  1QKR A;  1RKC A;  2LSE A;  3AGT A;  1I5N A;  3C7J A;  4IAO A;  3OEO A;  2GFH A;  1XWJ A;  3QVY A;  4WGY A;  1YLM A;  2W45 A;  2KNH A;  1YVI A;  3FMS A;  3X2Q C;  5HSW A;  4LDQ A;  3DWW A;  3RH3 A;  1E86 A;  1LM3 B;  1A0B A;  2AWC A;  4MS2 A;  1G8X A;  2L6H A;  4BJ6 C;  3ZIB A;  1BBH A;  2GDC A;  3PDM P;  2CYD A;  1OCO C;  1QPU A;  2CNW D;  3GOR A;  4I1M A;  1OW8 A;  1NSG B;  3POV A;  1HMD A;  1BR1 A;  4PJN A;  4CS9 A;  3LNM B;  3H2V A;  2HFI A; 
#chains in the Genus database with same CATH homology
 3ASN C;  2G3V A;  2Y3H A;  3FVY A;  3FDQ A;  2A6E F;  4QI2 A;  4O79 A;  4E7S A;  3DD7 A;  3CZ6 A;  5F5H A;  3HJC A;  1V54 C;  1D0Y A;  5DS4 A;  3RYL A;  1N1C A;  4AE4 A;  2R7V A;  1D0X A;  1PD1 A;  1ST6 A;  5CI9 A;  4U5C E;  4K7B A;  1TR2 A;  4BJ5 A;  2QY9 A;  5EHH A;  5L3Q A;  1ZYR F;  3B0V C;  3SEO A;  2BE5 F;  2IYL D;  3WOD F;  5KYY A;  4RDA A;  3UMI A;  3DXJ F;  4CS9 C;  2Q9A A;  3EZI A;  4KNV A;  2WB7 A;  3CSK A;  3NYM A;  2EIM C;  3S27 A;  4PFP A;  1ZU4 A;  4YJW A;  1PCX A;  1M2V A;  1VMA A;  2NUP B;  5B1B C;  2DGJ A;  1SF8 A;  2P7V A;  3B0U X;  2Q9C A;  4U5E E;  3CQZ A;  1Z3I X;  2WZG A;  3K66 A;  4BJ5 C;  4G7O F;  4C3B A;  3I5Q A;  1V55 C;  2J7P D;  4J30 B;  4O6Y A;  3NYJ A;  4DBR A;  3AG2 C;  3IEE A;  2G62 A;  2V3C C;  3LS0 A;  2XSE A;  1ZU5 A;  1VYI A;  3JT1 A;  2MYS A;  3L0I A;  1TWG A;  3UGP A;  3S28 A;  3HTK C;  1FMW A;  3EG9 A;  3EFO B;  2MWQ A;  5E33 A;  1M56 C;  1NU9 C;  3I5P A;  5KYN A;  2VH3 A;  3NKD A;  2YZS A;  2D5R B;  1Z23 A;  4CSA A;  4GEH A;  4OIR F;  3N2Z B;  4IJJ A;  4U5D E;  5T1D B;  2ZXO A;  4LLE A;  1D1A A;  4KI2 A;  3B0P A;  2QTV A;  2WVN A;  3W8I A;  5DVW A;  2YEV A;  3ABL C;  2CNW A;  5T3T A;  4A2N B;  3ITF A;  4OIP F;  1NG1 A;  3UNG C;  3LNR A;  1OKK D;  4PFO A;  4P6I C;  4LAC B;  4Q7C A;  4YN0 B;  4YT4 A;  3RFY A;  3AQB A;  3W2V A;  1ZHX A;  5KYW B;  1BR4 A;  4RD9 A;  4G7Z F;  2IXP A;  2O9X A;  4XTK A;  5DLJ A;  4JCH A;  1MNE A;  2OG2 A;  3S0X A;  3EFO A;  2J46 A;  3EH1 A;  3VYW A;  1SMY F;  1ZHW A;  1QLE C;  2WZL A;  4JZA A;  3W8H A;  5KYU B;  3Q6N A;  4GYT A;  2J0W A;  3NG1 A;  3LLK A;  2KQ9 A;  3Q7L A;  1J8M F;  5B1A C;  4YT2 A;  4RBN A;  3E70 C;  3EHM A;  2DYS C;  4CS7 A;  4E7Z A;  2J0X A;  2DYR C;  4U5F E;  3MX3 A;  3JRT A;  2Y3G A;  3LEV A;  1LS1 A;  2J7P A;  5KYX B;  4YWQ A;  3QMK A;  4M63 A;  1WGW A;  2NUT B;  2P6V A;  3EGD B;  5KYW A;  1TWC A;  3V7O A;  2H7O A;  3LAY A;  1MMD A;  4HFF B;  2R7R A;  1TWH A;  1MMG A;  3RIP A;  1ZHT A;  3ECS A;  2XXA B;  4CIH A;  2PX0 A;  1W2W A;  4C7O B;  2J9W A;  2PP4 A;  3ZC4 A;  2W4M A;  2Q3T A;  3ASO C;  2XRH A;  5KYU A;  3OWT A;  4OIQ F;  2Y69 C;  4K0D A;  2G3K A;  3DZA A;  3KL4 A;  5E3C A;  2A6H F;  3O6X A;  3UMK A;  2A68 F;  4CS8 A;  3Q7G A;  3DJU B;  3EQL F;  2IXO A;  3AG1 C;  3PHF 2;  2IXM A;  2R7X A;  4CBE A;  3KKB A;  3DMD A;  3AQC A;  3LLI A;  2A69 F;  1OKK A;  3UGO A;  1ZHY A;  1Z5Z A;  3EPV A;  5DQT A;  2R7W A;  4QI0 A;  5DQZ A;  4FX5 A;  1FTS A;  1MND A;  5EGY A;  1VK5 A;  2NUT A;  3KMI A;  3EGD A;  3GAN A;  4EWC A;  3EJN A;  2B0J A;  4C3E A;  3DJN B;  2XXA A;  1SZI A;  4KC9 A;  4F4B A;  4ZLD A;  3ABM C;  5D92 A;  4BJ1 A;  3B9Q A;  3FHD A;  4DBQ A;  4OD4 A;  3HLZ A;  2ZXW C;  2HV7 A;  4HEA J;  2Y39 A;  1S7Z A;  2NUP A;  4U5B E;  3K1I C;  4O6M A;  4O7G A;  4MQ9 F;  3UMH A;  3K6B A;  2M4E A;  4JJF A;  4I3M A;  3ABK C;  3F47 A;  4FES A;  4HFK B;  3K33 A;  4DVY P;  3K7D A;  3KH2 A;  4AK9 A;  1FMV A;  4OIN F;  4CSA C;  3GOD A;  2CW0 F;  4X0R A;  4XLP F;  3NDB B;  2FFH A;  1D1B A;  3E9V A;  4AX2 A;  4IWB A;  2J9U A;  2VAS A;  4IRU A;  4XWJ A;  4BJ6 A;  1IW7 F;  4AE4 B;  5IY5 C;  1KU2 A;  4JVS A;  4ZLC A;  4W8K A;  2R7Q A;  2J45 A;  2WVQ A;  1OCZ C;  1FFH A;  3DM9 B;  3NYL A;  2R7S A;  4BEJ A;  4N06 A;  4JUR I;  4XLN F;  3TD7 A;  3NRH A;  2V26 A;  4H4K C;  1QZX A;  2PFD A;  3LS1 A;  5DS6 A;  3WG7 C;  3N24 A;  3W2W A;  1MMN A;  4DVZ A;  1VOM A;  1VYK A;  3M1C B;  4NY3 A;  5DS5 A;  2L9J A;  3S29 A;  3EGX B;  1M2V B;  1D0Z A;  1O87 A;  4KNW A;  1JPJ A;  1Z63 A;  1FFT C;  4LLC A;  1TWA A;  4PJL A;  1O5H A;  3SNH A;  5F5F A;  1BR2 A;  4YT5 A;  5BUO A;  2WL8 A;  4JW1 A;  2EIN C;  4PK4 A;  2JD3 A;  3H65 A;  1OCR C;  3T6J A;  4C3D A;  4DOZ A;  5T3W A;  3K1H A;  3F46 A;  3UR3 C;  1M57 C;  4OD5 A;  2OCC C;  4FWV A;  4OIO F;  1PD0 A;  2R7T A;  1Z6A A;  1ZHZ A;  4HE8 D;  3LES A;  3T4R A;  4G0H A;  3PMR A;  2EIK C;  2WVO A;  2NG1 A;  4LER A;  1NU7 D;  3EG9 B;  4PJJ A;  1OCC C;  1IZM A;  4QDL A;  3RKO F;  2ZXP A;  2YHS A;  3JYH A;  4O6N A;  3N0T A;  1TKN A;  4J32 B;  4I44 A;  3EGX A;  1MMA A;  2Z15 A;  2Y3B A;  4MND A;  4EBB A;  5KYX A;  3EZH A;  2KJG A;  3ZG1 A;  2E87 A;  2IXN A;  4YT8 A;  4WJ0 A;  1J8Y F;  5FCL A;  2KGO A;  4C7O A;  4CS8 C;  3X1O A;  2CGE A;  2I8B A;  2WZF A;  4ULW A;  2XL4 A;  5CI8 A;  5E3A A;  3DAF A;  3SYN A;  1RJ9 B;  2CDQ A;  2EIL C;  2Q9B A;  3EH2 A;  4BJT A;  3ZVR A;  4Q4Z F;  3DM5 A;  2ZXR A;  1JPN A;  3ZSU A;  2L81 A;  2PX3 A;  3O39 A;  4PJM A;  5L3V A;  3JCU Q;  1M2O A;  2H7B A;  3AG4 C;  1LVK A;  2ZPA A;  4G7H F;  3SZR A;  2X51 A;  2C03 A;  5D91 A;  2H7V C;  2R7O A;  2HV6 A;  3VAY A;  3JSZ A;  2A1D D;  2IOQ A;  4KBL A;  2KW3 C;  3LJB A;  3T6B A;  2R7U A;  2EIJ C;  4BG0 A;  4ANJ A;  4B6I A;  2PF4 E;  3L34 A;  4Q5S F;  1NZE A;  2FGY A;  2VB6 A;  3AG3 C;  2J9V A;  4I1O B;  1D1C A;  2W9Y A;  3Q6M A;  3DAG A;  4U5G A;  2Y3D A;  3FAJ A;  3EHN A;  3SP1 A;  3OA1 A;  3QZC A;  4U5H A;  3NKE A;  3I4U A;  4JJG A;  5B3S C;  1LKX A;  5KYY B;  5E2Q A;  1RJ9 A;  3MLG A;  2W4B A;  2C04 A;  2LSE A;  4IAO A;  3OEO A;  2GFH A;  2W45 A;  2KNH A;  3X2Q C;  5HSW A;  3RH3 A;  1G8X A;  4BJ6 C;  3ZIB A;  1OCO C;  2CNW D;  4I1M A;  3POV A;  4PJN A;  1BR1 A;  4CS9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...