3NYJA

Crystal structure analysis of app e2 domain
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
181
structure length
181
Chain Sequence
LETPGDENEHAHFQKAKERLEAKHRERMSQVMREWEEAERQAKNLPKADKKAVIQHFQEKVESLEQEAANERQQLVETHMARVEAMLNDRRRLALENYITALQAVPPRPRHVFNMLKKYVRAEQKDRQHTLKHFEHVRMVDPKKAAQIRSQVMTHLRVIYERMNQSLSLLYNVPAVAEEIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The E2 Domains of APP and APLP1 Share a Conserved Mode of Dimerization.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein fibril
molecule keywords Amyloid beta A4 protein
total genus 56
structure length 181
sequence length 181
ec nomenclature
pdb deposition date 2010-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12925 APP_E2 E2 domain of amyloid precursor protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.770 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3nyjA00
3K6BA 3Q7LA 3Q7GA 3UMIA 3K66A 1TKNA 5BUOA 4RDAA 3QMKA 3NYJA 3UMHA 3PMRA 3NYLA 3UMKA 4RD9A 4YN0B
chains in the Genus database with same CATH superfamily
4IARA 4A2NB 1GGQA 4LLCA 4WGZA 3ZSUA 4XEFA 3FOPA 2WB7A 4DRHB 3M4BA 3DKAA 4IAQA 3ECSA 3GEEA 1YDIA 4OD5A 1SZIA 1TFKB 2L6GA 4LACB 4BEJA 1NBBA 4MTOA 3NYJA 2X51A 1H9TA 2OG2A 3RVYA 3UMKA 3UGOA 3F46A 4YT5A 3DI5A 4YN0B 2HMQA 3Q7LA 4CDVA 2WZGA 3TOLA 1T5OA 1QPUA 2Y3DA 3A9CA 3LUTB 1IW7F 2LSEA 4G0HA 4CSAA 5DLJA 3M1CB 2A6HF 2MWQA 1W2WA 1NU7D 3ASNC 4YL1A 4N6CA 3S29A 1AVOB 3EG9A 1WGWA 4MVMA 1AUEA 2IXPA 2PX3A 3KKBA 3R2PA 1BZ4A 1LKXA 1C02A 3DZAA 2EPKX 1A7EA 2EINC 2PP4A 1YA9A 2XM0A 4DJ9A 2PF4E 1N1CA 3EGDA 4LLEA 1ST6A 1LM3B 3HNJA 3AJMA 2YHSA 5KYUB 3LNRA 3UGPA 4AL1A 2ICWG 2HSBA 3CAXA 2OJQA 4E0HA 2VCBA 3EJNA 1TKNA 1HE1A 4XQ1A 4ZLCA 5DS6A 3UMHA 4PR9A 2Q00A 2XLHA 4NCQA 1HW1A 1OCZC 3AG3C 4CIPA 1G4US 3S90A 3O39A 4K0DA 3U2MA 1SMYF 2Y3HA 2IYLD 3G50A 4U5GA 5L0DA 4ONSA 2R9RB 2XL4A 2YL1A 2E87A 2XSEA 2YEVA 3SZRA 4DBQA 4PACA 4E7SA 1MMAA 2QNLA 4QI0A 3TULA 4CS8C 4MVSA 5DS4A 3SXYA 2R7RA 4HFFB 4N06A 3WG7C 3EGXB 3PCVA 2GAQA 1V55C 3G4ZA 2IBFA 4FESA 3NKEA 4MVUA 2IXNA 2OQMA 3ZDLA 5JT4A 2I15A 2LFFA 2P6VA 4JJGA 5AC5A 2QLAA 5COMA 2DYRC 4EIYA 2NSGA 2C04A 4U9DA 3RW0A 3ZTMA 2P7VA 5AGFA 2VC9A 3L1MA 5JRAA 3DM9B 5L0IA 1CPRA 3AGUA 3RQEA 4IRUA 1E2XA 1WASA 2LK4A 2R7QA 3FMSA 3JZ0A 5F28E 3RIPA 4EWCA 3EFOB 1FTSA 1FMWA 3NG1A 4DVZA 4E7ZA 3FDQA 2AVKA 4MVRA 1ZVZA 4MTFA 1IZMA 3RQGA 4YWQA 5DS5A 5CIVA 3ATPA 1ZYRF 2L6FA 2OKUA 2PFDA 1O3UA 2R25A 3N24A 4J7YA 4RBNA 5T3WA 3W2WA 4C3DA 3HNLA 5E2QA 3T6JA 3I5QA 1OCOC 3BRJA 3EZHA 1U89A 1YA7O 3EHMA 2F22A 4PFOA 4UDVA 1DOWA 4BEMJ 2ZXOA 3KMIA 3LLKA 3PHF2 4JURI 4OIOF 4YT8A 1RJ9B 3K1IC 2DI3A 3E9VA 3LESA 1M2OA 3MFNA 3GWNA 3O55A 4ER9A 3T4RA 3FOOA 1T6QA 5BUOA 3PDMP 1D0ZA 2IM8A 3DD7A 2CNWA 1FFHA 3PMRA 1JPJA 1YZCA 3DJUB 1R5ID 1R4TA 4HFKB 4JCHA 1L7CA 2Q9CA 2NUTA 3AQBA 3IQCA 2W45A 2QY9A 2AU5A 2HUJA 2UUHA 3MX3A 1TQGA 1FMVA 1J8MF 3VRCA 3W8IA 4EHPA 2NUTB 5L3QA 4DOZA 2KK1A 3H2VA 3WHNA 2GDCA 4NTAA 2YL7A 1FAPB 1GS9A 3Q6MA 4CS8A 2KC3A 1BR4A 2ZD9A 1TWAA 1G8XA 3T6BA 3SYNA 2FGYA 2V3CC 3H2UA 1V4AA 2TMVP 1H7IA 3QW1A 3OWTA 4OD4A 2BE5F 4PJNA 1EI7A 1BR2A 5KYWA 3CQZA 3V5YA 2YRFA 1PV3A 3MLGA 1D0YA 1LIHA 2HFIA 1YZAA 1NSGB 4O6NA 1Z5ZA 1ZHYA 2UUIA 4KBLA 1I5NA 3HKKA 1U6HA 3KPHA 3EH1A 4BPMA 2IXOA 1H6GA 3NMJA 2YZSA 3ZQVA 1YAUO 2L7AA 4YK5A 3QVYA 4DVYP 4JKVA 4NC3A 4W8KA 2WL8A 3L0IA 3GODA 3U8VA 4QI2A 2QE9A 3MYIA 5KYNA 3NYMA 1OKKA 4DXWA 3LJBA 1JMWA 3EGDB 4PJLA 2HZ8A 3C8GB 5DVWA 4N6HA 1KU2A 1GQAA 5BQGA 4JEAA 5KYUA 2I8BA 4A4AA 2YLDA 5A6BA 1YYXA 1LVKA 1QKRA 2OEXA 4EBJA 3TJ5A 1RMVA 1FNTc 3IHUA 1A0BA 1MNEA 1OCCC 2J8WA 3X1OA 4CS9A 5EGYA 5GPGB 4BJ5C 3JRTA 2HV6A 3I4UA 4RDAA 3U2LA 5HSWA 4CBEA 1LS1A 4LERA 5FZTA 3U3FA 2EIJC 3U8PA 2CYDA 4CIHA 2H7OA 1YYJA 1NFNA 3Q7GA 3O6XA 4XEKA 1HY5A 3QVZA 1V54C 4O6MA 3ZG1A 4U5HA 1E83A 1WN0A 2KYHA 3DAFA 3IPMO 2H7BA 3NYLA 4Z9HA 1VLSA 3HNKA 2YVKA 3EHNA 4XLPF 3F47A 1KTMA 3H65A 3EGXA 2M64A 4JJFA 2R7OA 2B0HA 4MVZA 4NY3A 5L0HA 4CJOA 1Y6DA 2LCHA 3E70C 256BA 3ZVRA 4WABA 5K0IA 2L6HA 2YKZA 2KGOA 5EK0A 4MNDA 3AQCA 3KYJA 5AC4A 1CGME 2R7TA 1QZXA 3L8JA 1Z63A 1D1BA 3BEHA 1VYKA 4I3MA 4E17A 4RD9A 3LAYA 4BJ6A 1Z3IX 3V7OA 4D4NA 3EFOA 1TWHA 4GQHA 1TWCA 3B9QA 2LFDA 2YLGA 4MQ9F 4B6IA 5DQZA 4CX9A 2J9UA 1O87A 1OR2A 4J7TA 1UFBA 4U9EA 2YQYA 1BBHA 1YJGA 4G7OF 2CW0F 2CCYA 5COGA 3EZIA 2J7PA 2A1DD 2LD6A 2P0NA 5FCLA 3DAGA 4CJGA 3GM2A 1WATA 4AX2A 3RH3A 1LI7A 3WAQA 1K05A 3ABKC 1TFOB 4KC9A 3TJ6A 3U9MA 1LE4A 1NLXA 1Q0FA 2CDQA 4O6YA 2XM4A 3RVZA 3L34A 2LP4A 2J9BA 3SP1A 4IB4A 1M57C 4CS7A 4IWBA 1VOMA 5A69A 2NUPB 2EPOA 2R03A 4IAOA 4C3EA 3QZCA 1D1CA 2A68F 2WVOA 5TJ5E 2YL3A 1RJ9A 3AG2C 4LDRA 4GYTA 1PCXA 3JSZA 3W2VA 1HMDA 2Y3BA 4WGYA 5B3SC 2W9YA 4U5DE 3GWLA 3B29A 5B1BC 1A7DA 1EQ1A 1VTMP 1VLTA 4NQFA 3SNHA 1I4ZA 3HNIA 2J46A 1Q0KA 2PNOA 5KYXB 4XPYA 2A69F 3GANA 3KYIA 2J45A 1Y4CA 1E86A 1OQCA 2DGJA 4YL0A 2NG1A 5E3CA 5KYXA 4IJJA 3RYLA 3K7DA 4XWJA 4E18A 3AOUA 1RXQA 4YL3A 2W4BA 2R7XA 4O7GA 2MHRA 3DM5A 4J30B 3ABLC 3JYHA 3M4CA 2YL0A 2BC5A 3EQLF 3CEXA 2G3KA 5A6KA 1L3PA 1WOLA 5KYWB 4ZLDA 1EKYA 3KL4A 4IGGA 3K1IA 3L8IA 4MW3A 1ORJA 3T6GB 1XWJA 3K1HA 5JP7A 1ZHWA 4YJWA 4H54A 1SF8A 2FAPB 2YWAA 1D0XA 3NMIA 2OCCC 3CSKA 4L6RA 2ETSA 3GM1A 2XS1A 1ZHTA 5EHHA 2FFHA 4O79A 3ZIBA 5A6JA 2VCAA 5L0CA 1JRAA 3AGTA 3LNMB 4EBBA 2RSEB 3DE8A 4C7OB 3X2QC 1OCRC 1TWGA 4HEAJ 1MMNA 4JVSA 1V74B 1YLMA 2WVQA 3DMDA 3ITFA 2DB4A 4MW8A 3ZC4A 4H4KC 1D1AA 1APCA 1WWPA 2Q3TA 3C62A 4P9FA 5JLIA 4MTGA 2D5RB 1MNDA 1SYQA 1I4YA 3GM3A 5D91A 1B68A 5B3IA 3UR3C 4AK9A 3ZQYA 1T01A 1HE9A 2J0XA 4BJTA 3W8HA 1ZHXA 2A6EF 3QMKA 4XEVA 1NZEA 1AEPA 2LQGA 1OXKA 3FAPB 4YT2A 1E85A 1TR2A 1BR1A 3LEOA 2VASA 3B71A 4FAPB 1FR0A 2Q7RA 2P1AA 3VYWA 1JOGA 1OXBA 1RCPA 2A0UA 1K04A 2HV7A 1RKEB 3IQ6A 3UMIA 2DYSC 1G4WR 1LI5A 2IXMA 5HV9A 3U3BA 1YVIA 1EA8A 1M2VA 3WODF 1GM5A 1PD0A 2H8AA 2KJGA 4LDKA 4PJJA 2HMZA 3M15A 2Z15A 3RKOF 3V5XA 1T6IA 1T6UA 3B0PA 2QUPA 2O9XA 3DXJF 1NU9C 1MQVA 3K33A 4U5CE 2B0JA 2J7PD 4DRJB 2Y69C 1M6TA 2GWWA 4KNWA 2NPUA 2AP3A 3ABMC 4I44A 1OW7A 4G7HF 3IQTA 1WTYA 3T9OA 2J0WA 3S27A 1Q0GA 1S7ZA 3QW0A 3HLZA 4JW1A 5JS5A 3FXHA 4OINF 2Q9BA 3VF0A 4AL0A 1Z7Qc 3B0VC 4P9TA 2R7SA 4ULWA 1KNYA 2V26A 2JPUA 2CGEA 5DQTA 1Q0MA 4BJ6C 1ORYA 1PD1A 5BQIA 1ZU4A 1RKCA 1T9KA 1Z23A 2OOCA 2RD9A 2WZLA 3C63A 1SR2A 3CZ6A 1DOVA 5T1DB 3POVA 2ZPAA 3JT1A 2HJ3A 2VB6A 2OU6A 3QTHA 4OIRF 2J9VA 4CS9C 1ZW2A 2VCCA 3NMKA 5F5HA 5JUAA 1OR3A 2AWYA 3RF3A 4PFPA 3UNGC 1LS4A 4AE4B 2R05A 4OIPF 4Q7CA 3US6A 3MYFA 1U0BB 2IOQA 2WZFA 1OW6A 1QQ3A 2HJMA 2VH3A 4CDYA 3ZWIA 4AE4A 3GEIA 2XL8A 2R7UA 5CI8A 1ZHZA 5JVEA 1Q0DA 2C03A 1QSPA 4OIQF 5A6BD 3KH2A 1VB5A 2H7VC 4NTBA 5JSLA 3RQFA 5KYYB 2R7WA 2ZXPA 1Z6AA 2Q4FA 2HSQA 3Q6NA 4KNVA 4BJ1A 3DE9A 3AG4C 3JCUQ 1ZW3A 3OA1A 4LDQA 3O10A 1HW2A 5KYYA 4JCZA 2EIMC 1VMAA 2KSFA 4KI2A 3DWWA 2G3VA 5B1AC 5L0JA 2EPMX 4I1MA 2P61A 4Z9IA 2EIKC 3GEHA 3M79A 2YLIA 4Z9JA 2EPLX 4DRIB 1XZQA 2A0BA 4R32A 2L9JA 3B0UX 3C8GD 3C18A 3ASOC 3NRHA 1G5ZA 3JTLO 4EKWA 3VM6A 2GA0A 4JC7A 4F4BA 3S28A 4ANJA 3FVYA 1VYIA 2Y39A 4JZAA 3NDBB 4C7OA 4C3BA 2AWCA 3LLIA 3MBGA 5BQHA 3EG9B 3C7JA 4JIOA 3SXZA 3C8GA 3OEOA 4JTAB 1JPNA 1QVXA 5E33A 3JSEO 2XL6A 3TK0A 1S05A 4E0IA 1VK5A 1YARO 3TOMA 3U0CA 3VAYA 4U5FE 2GFHA 5COFA 3AG1C 5F5FA 4X0RA 1A41A 4GEHA 4I1OB 1LPEA 1F1MA 1MMGA 1H9GA 2LIGA 4U5EE 4BG0A 3R7CA 5L3VA 1CGOA 3S9OA 1BDJB 1NFOA 3V5ZA 2W4MA 2ZXRA 3IQ5A 2ASRA 3C8ZA 1A7VA 2Q9AA 3LS1A 4ULVA 4JTCB 4M63A 2KQ9A 2PBEA 3SXKA 4DBRA 4U5BE 2KNHA 4CSAC 5D92A 3EH2A 4JEBA 2XLEA 4JE9A 2J9WA 4EBKA 5IY5C 2XXAA 2R7VA 2CNWD 1UG7A 2XS8A 4K7BA 2BL2A 1RKEA 3G4XA 3GORA 4BJ5A 2ZXWC 2XXAB 3EPVA 4MVQA 4J32B 2D4UA 2OJED 2KW3C 1J8YF 4Q4ZF 3DJNB 3JRMO 4HE8D 4K1OA 4PK4A 2XLWA 4W8PA 1MMDA 2M4EA 3FAJA 3NKDA 4PJMA 3TD7A 2XLOA 3LS0A 1K40A 3I5PA 4FWVA 4XPWA 2HS5A 3LEVA 5E3AA 1C17M 3U9JA 1M2VB 1XZPA 4MVOA 1E84A 2JX0A 2QTVA 4XPXA 3A11A 1HMOA 3K6BA 4YT4A 4NTFA 3JYYA 2MYSA 3ZTZA 5L0FA 2G62A 4G78A 4P6IC 1ZU5A 5A6AA 3HJCA 2XLMA 1JR8A 4N4WA 1O5HA 1JAFA 4JTDB 1CGNA 4QDLA 1QLEC 2X0CA 2Y3GA 3IEEA 3SXMA 3TQOA 2EILC 4D4XA 2XLVA 1ORSC 3U5SA 4WJ0A 4MS2A 1OKKD 1OW8A 2JD3A 4G7ZF 3J06A 3W4YA 1M56C 5T3TA 3S0XA 1LE2A 3N2ZB 3K66A 4XLNF 2EPNA 2XRHA 3N0TA 3RFYA 2NSFA 5CI9A 2R02A 4XTKA 4CDAA 4FX5A 2XLDA 3SEOA 2L81A 2NUPA 4EUKB 4JRZA 3S84A 1CPQA 4Q5SF 2OEVA 3FHDA 1FFTC 2PX0A 2HKVA 3HTKC 1C03A 1NG1A 2WVNA 5L0GA 1ZZPA
chains in the Genus database with same CATH topology
4A2NB 4LLCA 3ZSUA 2WB7A 4BEJA 3ECSA 4OD5A 1SZIA 4LACB 3NYJA 2X51A 2OG2A 3UMKA 3UGOA 3F46A 4YT5A 4YN0B 3Q7LA 2WZGA 2Y3DA 1IW7F 2LSEA 4G0HA 4CSAA 5DLJA 3M1CB 2A6HF 2MWQA 1W2WA 1NU7D 3ASNC 3S29A 3EG9A 1WGWA 2PX3A 2IXPA 3KKBA 1LKXA 3DZAA 2EINC 2PP4A 2PF4E 1N1CA 3EGDA 4LLEA 1ST6A 5KYUB 2YHSA 3LNRA 3UGPA 4ZLCA 3EJNA 1TKNA 5DS6A 3UMHA 3AG3C 1OCZC 3O39A 4K0DA 1SMYF 2Y3HA 2IYLD 4U5GA 2XL4A 2YEVA 2E87A 2XSEA 3SZRA 4DBQA 4E7SA 1MMAA 4QI0A 4CS8C 5DS4A 4HFFB 4N06A 3WG7C 3EGXB 4FESA 1V55C 3NKEA 2IXNA 2P6VA 4JJGA 2DYRC 2C04A 2P7VA 3DM9B 4IRUA 4EWCA 2R7QA 3RIPA 3EFOB 1FTSA 1FMWA 3NG1A 4DVZA 4E7ZA 3FDQA 1IZMA 4YWQA 5DS5A 1ZYRF 2PFDA 3W2WA 3N24A 5T3WA 4RBNA 4C3DA 5E2QA 3T6JA 3I5QA 1OCOC 3EZHA 3EHMA 4PFOA 2ZXOA 3KMIA 3LLKA 3PHF2 4JURI 4OIOF 4YT8A 1RJ9B 3K1IC 3E9VA 3LESA 1M2OA 3T4RA 5BUOA 1D0ZA 3DD7A 2CNWA 3PMRA 4HFKB 1FFHA 1JPJA 3DJUB 2NUTA 4JCHA 3S28A 2Q9CA 3AQBA 3ZC4A 2W45A 2QY9A 2R7RA 3W8IA 3MX3A 1FMVA 1J8MF 2NUTB 5L3QA 4DOZA 4CS8A 3Q6MA 1BR4A 1TWAA 1G8XA 3T6BA 3SYNA 2FGYA 2V3CC 3OWTA 4OD4A 2BE5F 4PJNA 1BR2A 5KYWA 3CQZA 3MLGA 1D0YA 4O6NA 1ZHYA 1Z5ZA 4KBLA 3EH1A 2IXOA 2YZSA 4DVYP 4W8KA 2WL8A 3L0IA 3GODA 4QI2A 3NYMA 1OKKA 3LJBA 3EGDB 4PJLA 5DVWA 1KU2A 5KYUA 2I8BA 1LVKA 1MNEA 1OCCC 3X1OA 4CS9A 5EGYA 4BJ5C 3JRTA 2HV6A 3I4UA 4RDAA 5HSWA 4CBEA 1LS1A 4LERA 2EIJC 4CIHA 2H7OA 3Q7GA 3O6XA 1V54C 4O6MA 3ZG1A 4U5HA 3DAFA 3NYLA 2H7BA 3EHNA 4XLPF 3F47A 3H65A 3EGXA 4JJFA 2R7OA 4NY3A 3E70C 3ZVRA 2KGOA 4MNDA 3AQCA 2R7TA 1QZXA 1Z63A 1D1BA 1VYKA 4I3MA 4RD9A 3LAYA 4BJ6A 1Z3IX 3V7OA 3EFOA 1TWHA 5KYNA 1TWCA 3B9QA 4MQ9F 4B6IA 5DQZA 2J9UA 1O87A 4G7OF 2CW0F 5FCLA 3EZIA 2J7PA 2A1DD 3DAGA 4AX2A 3RH3A 3ABKC 4KC9A 2CDQA 4O6YA 3L34A 3SP1A 4CS7A 1M57C 4IWBA 1VOMA 2NUPB 4IAOA 4C3EA 3QZCA 1D1CA 2A68F 2WVOA 3AG2C 1RJ9A 4GYTA 3JSZA 1PCXA 3W2VA 2Y3BA 5B3SC 2W9YA 4U5DE 5B1BC 3SNHA 5KYXB 2J46A 2A69F 3GANA 2J45A 2DGJA 2NG1A 5E3CA 5KYXA 4IJJA 3RYLA 3K7DA 4XWJA 2W4BA 2R7XA 4O7GA 3DM5A 4J30B 3ABLC 3JYHA 5KYWB 4ZLDA 3EQLF 2G3KA 3KL4A 3WODF 3K1HA 1ZHWA 4YJWA 1SF8A 1D0XA 2OCCC 3CSKA 5EHHA 1ZHTA 2FFHA 4O79A 3ZIBA 4EBBA 4C7OB 3X2QC 1OCRC 1TWGA 4HEAJ 1MMNA 4JVSA 2WVQA 3DMDA 3ITFA 4H4KC 1D1AA 2Q3TA 2D5RB 1MNDA 5D91A 3UR3C 4AK9A 2J0XA 4BJTA 3W8HA 1ZHXA 2A6EF 3QMKA 1NZEA 4YT2A 1TR2A 1BR1A 2VASA 3VYWA 2HV7A 3UMIA 2DYSC 2IXMA 1M2VA 1PD0A 2KJGA 4PJJA 2Z15A 3RKOF 3B0PA 3DXJF 2O9XA 1NU9C 3K33A 4U5CE 2B0JA 2J7PD 2Y69C 4KNWA 3ABMC 4I44A 4G7HF 2J0WA 3S27A 1S7ZA 3HLZA 4JW1A 4OINF 2Q9BA 3B0VC 2R7SA 4ULWA 2V26A 5DQTA 2CGEA 4BJ6C 1PD1A 1ZU4A 1Z23A 2WZLA 3CZ6A 3POVA 5T1DB 2ZPAA 3JT1A 2VB6A 4OIRF 2J9VA 4CS9C 5F5HA 4PFPA 3UNGC 4AE4B 4OIPF 4Q7CA 2WZFA 2IOQA 2VH3A 4AE4A 2R7UA 5CI8A 1ZHZA 2C03A 4OIQF 3KH2A 2H7VC 5KYYB 2R7WA 2ZXPA 1Z6AA 3Q6NA 4BJ1A 4KNVA 3AG4C 3JCUQ 3OA1A 5KYYA 2EIMC 1VMAA 4KI2A 2G3VA 5B1AC 4I1MA 2EIKC 3B0UX 2L9JA 3ASOC 3NRHA 4F4BA 4ANJA 3FVYA 1VYIA 2Y39A 4JZAA 3NDBB 4C7OA 4C3BA 3LLIA 3EG9B 3OEOA 1JPNA 5E33A 1VK5A 3VAYA 4U5FE 2GFHA 3AG1C 5F5FA 4X0RA 4U5EE 4GEHA 4I1OB 4BG0A 1MMGA 5L3VA 2W4MA 2ZXRA 2Q9AA 3LS1A 4M63A 2KQ9A 4DBRA 4U5BE 2KNHA 4CSAC 5D92A 3EH2A 2J9WA 5IY5C 2XXAA 2R7VA 2CNWD 4K7BA 4BJ5A 2ZXWC 2XXAB 3EPVA 4J32B 2KW3C 1J8YF 4Q4ZF 3DJNB 4HE8D 4PK4A 1MMDA 2M4EA 3FAJA 3NKDA 4PJMA 3TD7A 3LS0A 4FWVA 3I5PA 5E3AA 3LEVA 1M2VB 2QTVA 3K6BA 4YT4A 2MYSA 2G62A 4P6IC 1ZU5A 3HJCA 1O5HA 4QDLA 1QLEC 2Y3GA 3IEEA 2EILC 4WJ0A 1OKKD 2JD3A 4G7ZF 1M56C 5T3TA 3S0XA 3N2ZB 3K66A 4XLNF 2XRHA 3N0TA 3RFYA 5CI9A 4XTKA 4FX5A 3SEOA 2L81A 2NUPA 4Q5SF 3FHDA 1FFTC 2PX0A 3HTKC 1NG1A 2WVNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K6B A;  3Q7L A;  3Q7G A;  3UMI A;  3K66 A;  1TKN A;  5BUO A;  4RDA A;  3QMK A;  3NYJ A;  3UMH A;  3PMR A;  3NYL A;  3UMK A;  4RD9 A;  4YN0 B; 
#chains in the Genus database with same CATH topology
 4IAR A;  4A2N B;  1GGQ A;  4LLC A;  4WGZ A;  3ZSU A;  4XEF A;  3FOP A;  2WB7 A;  4DRH B;  3M4B A;  3DKA A;  4IAQ A;  3ECS A;  3GEE A;  1YDI A;  4OD5 A;  1SZI A;  1TFK B;  2L6G A;  4LAC B;  4BEJ A;  1NBB A;  4MTO A;  3NYJ A;  2X51 A;  1H9T A;  2OG2 A;  3RVY A;  3UMK A;  3UGO A;  3F46 A;  4YT5 A;  3DI5 A;  4YN0 B;  2HMQ A;  3Q7L A;  4CDV A;  2WZG A;  3TOL A;  1T5O A;  1QPU A;  2Y3D A;  3A9C A;  3LUT B;  1IW7 F;  2LSE A;  4G0H A;  4CSA A;  5DLJ A;  3M1C B;  2A6H F;  2MWQ A;  1W2W A;  1NU7 D;  3ASN C;  4YL1 A;  4N6C A;  3S29 A;  1AVO B;  3EG9 A;  1WGW A;  4MVM A;  1AUE A;  2IXP A;  2PX3 A;  3KKB A;  3R2P A;  1BZ4 A;  1LKX A;  1C02 A;  3DZA A;  2EPK X;  1A7E A;  2EIN C;  2PP4 A;  1YA9 A;  2XM0 A;  4DJ9 A;  2PF4 E;  1N1C A;  3EGD A;  4LLE A;  1ST6 A;  1LM3 B;  3HNJ A;  3AJM A;  2YHS A;  5KYU B;  3LNR A;  3UGP A;  4AL1 A;  2ICW G;  2HSB A;  3CAX A;  2OJQ A;  4E0H A;  2VCB A;  3EJN A;  1TKN A;  1HE1 A;  4XQ1 A;  4ZLC A;  5DS6 A;  3UMH A;  4PR9 A;  2Q00 A;  2XLH A;  4NCQ A;  1HW1 A;  1OCZ C;  3AG3 C;  4CIP A;  1G4U S;  3S90 A;  3O39 A;  4K0D A;  3U2M A;  1SMY F;  2Y3H A;  2IYL D;  3G50 A;  4U5G A;  5L0D A;  4ONS A;  2R9R B;  2XL4 A;  2YL1 A;  2E87 A;  2XSE A;  2YEV A;  3SZR A;  4DBQ A;  4PAC A;  4E7S A;  1MMA A;  2QNL A;  4QI0 A;  3TUL A;  4CS8 C;  4MVS A;  5DS4 A;  3SXY A;  2R7R A;  4HFF B;  4N06 A;  3WG7 C;  3EGX B;  3PCV A;  2GAQ A;  1V55 C;  3G4Z A;  2IBF A;  4FES A;  3NKE A;  4MVU A;  2IXN A;  2OQM A;  3ZDL A;  5JT4 A;  2I15 A;  2LFF A;  2P6V A;  4JJG A;  5AC5 A;  2QLA A;  5COM A;  2DYR C;  4EIY A;  2NSG A;  2C04 A;  4U9D A;  3RW0 A;  3ZTM A;  2P7V A;  5AGF A;  2VC9 A;  3L1M A;  5JRA A;  3DM9 B;  5L0I A;  1CPR A;  3AGU A;  3RQE A;  4IRU A;  1E2X A;  1WAS A;  2LK4 A;  2R7Q A;  3FMS A;  3JZ0 A;  5F28 E;  3RIP A;  4EWC A;  3EFO B;  1FTS A;  1FMW A;  3NG1 A;  4DVZ A;  4E7Z A;  3FDQ A;  2AVK A;  4MVR A;  1ZVZ A;  4MTF A;  1IZM A;  3RQG A;  4YWQ A;  5DS5 A;  5CIV A;  3ATP A;  1ZYR F;  2L6F A;  2OKU A;  2PFD A;  1O3U A;  2R25 A;  3N24 A;  4J7Y A;  4RBN A;  5T3W A;  3W2W A;  4C3D A;  3HNL A;  5E2Q A;  3T6J A;  3I5Q A;  1OCO C;  3BRJ A;  3EZH A;  1U89 A;  1YA7 O;  3EHM A;  2F22 A;  4PFO A;  4UDV A;  1DOW A;  4BEM J;  2ZXO A;  3KMI A;  3LLK A;  3PHF 2;  4JUR I;  4OIO F;  4YT8 A;  1RJ9 B;  3K1I C;  2DI3 A;  3E9V A;  3LES A;  1M2O A;  3MFN A;  3GWN A;  3O55 A;  4ER9 A;  3T4R A;  3FOO A;  1T6Q A;  5BUO A;  3PDM P;  1D0Z A;  2IM8 A;  3DD7 A;  2CNW A;  1FFH A;  3PMR A;  1JPJ A;  1YZC A;  3DJU B;  1R5I D;  1R4T A;  4HFK B;  4JCH A;  1L7C A;  2Q9C A;  2NUT A;  3AQB A;  3IQC A;  2W45 A;  2QY9 A;  2AU5 A;  2HUJ A;  2UUH A;  3MX3 A;  1TQG A;  1FMV A;  1J8M F;  3VRC A;  3W8I A;  4EHP A;  2NUT B;  5L3Q A;  4DOZ A;  2KK1 A;  3H2V A;  3WHN A;  2GDC A;  4NTA A;  2YL7 A;  1FAP B;  1GS9 A;  3Q6M A;  4CS8 A;  2KC3 A;  1BR4 A;  2ZD9 A;  1TWA A;  1G8X A;  3T6B A;  3SYN A;  2FGY A;  2V3C C;  3H2U A;  1V4A A;  2TMV P;  1H7I A;  3QW1 A;  3OWT A;  4OD4 A;  2BE5 F;  4PJN A;  1EI7 A;  1BR2 A;  5KYW A;  3CQZ A;  3V5Y A;  2YRF A;  1PV3 A;  3MLG A;  1D0Y A;  1LIH A;  2HFI A;  1YZA A;  1NSG B;  4O6N A;  1Z5Z A;  1ZHY A;  2UUI A;  4KBL A;  1I5N A;  3HKK A;  1U6H A;  3KPH A;  3EH1 A;  4BPM A;  2IXO A;  1H6G A;  3NMJ A;  2YZS A;  3ZQV A;  1YAU O;  2L7A A;  4YK5 A;  3QVY A;  4DVY P;  4JKV A;  4NC3 A;  4W8K A;  2WL8 A;  3L0I A;  3GOD A;  3U8V A;  4QI2 A;  2QE9 A;  3MYI A;  5KYN A;  3NYM A;  1OKK A;  4DXW A;  3LJB A;  1JMW A;  3EGD B;  4PJL A;  2HZ8 A;  3C8G B;  5DVW A;  4N6H A;  1KU2 A;  1GQA A;  5BQG A;  4JEA A;  5KYU A;  2I8B A;  4A4A A;  2YLD A;  5A6B A;  1YYX A;  1LVK A;  1QKR A;  2OEX A;  4EBJ A;  3TJ5 A;  1RMV A;  1FNT c;  3IHU A;  1A0B A;  1MNE A;  1OCC C;  2J8W A;  3X1O A;  4CS9 A;  5EGY A;  5GPG B;  4BJ5 C;  3JRT A;  2HV6 A;  3I4U A;  4RDA A;  3U2L A;  5HSW A;  4CBE A;  1LS1 A;  4LER A;  5FZT A;  3U3F A;  2EIJ C;  3U8P A;  2CYD A;  4CIH A;  2H7O A;  1YYJ A;  1NFN A;  3Q7G A;  3O6X A;  4XEK A;  1HY5 A;  3QVZ A;  1V54 C;  4O6M A;  3ZG1 A;  4U5H A;  1E83 A;  1WN0 A;  2KYH A;  3DAF A;  3IPM O;  2H7B A;  3NYL A;  4Z9H A;  1VLS A;  3HNK A;  2YVK A;  3EHN A;  4XLP F;  3F47 A;  1KTM A;  3H65 A;  3EGX A;  2M64 A;  4JJF A;  2R7O A;  2B0H A;  4MVZ A;  4NY3 A;  5L0H A;  4CJO A;  1Y6D A;  2LCH A;  3E70 C;  256B A;  3ZVR A;  4WAB A;  5K0I A;  2L6H A;  2YKZ A;  2KGO A;  5EK0 A;  4MND A;  3AQC A;  3KYJ A;  5AC4 A;  1CGM E;  2R7T A;  1QZX A;  3L8J A;  1Z63 A;  1D1B A;  3BEH A;  1VYK A;  4I3M A;  4E17 A;  4RD9 A;  3LAY A;  4BJ6 A;  1Z3I X;  3V7O A;  4D4N A;  3EFO A;  1TWH A;  4GQH A;  1TWC A;  3B9Q A;  2LFD A;  2YLG A;  4MQ9 F;  4B6I A;  5DQZ A;  4CX9 A;  2J9U A;  1O87 A;  1OR2 A;  4J7T A;  1UFB A;  4U9E A;  2YQY A;  1BBH A;  1YJG A;  4G7O F;  2CW0 F;  2CCY A;  5COG A;  3EZI A;  2J7P A;  2A1D D;  2LD6 A;  2P0N A;  5FCL A;  3DAG A;  4CJG A;  3GM2 A;  1WAT A;  4AX2 A;  3RH3 A;  1LI7 A;  3WAQ A;  1K05 A;  3ABK C;  1TFO B;  4KC9 A;  3TJ6 A;  3U9M A;  1LE4 A;  1NLX A;  1Q0F A;  2CDQ A;  4O6Y A;  2XM4 A;  3RVZ A;  3L34 A;  2LP4 A;  2J9B A;  3SP1 A;  4IB4 A;  1M57 C;  4CS7 A;  4IWB A;  1VOM A;  5A69 A;  2NUP B;  2EPO A;  2R03 A;  4IAO A;  4C3E A;  3QZC A;  1D1C A;  2A68 F;  2WVO A;  5TJ5 E;  2YL3 A;  1RJ9 A;  3AG2 C;  4LDR A;  4GYT A;  1PCX A;  3JSZ A;  3W2V A;  1HMD A;  2Y3B A;  4WGY A;  5B3S C;  2W9Y A;  4U5D E;  3GWL A;  3B29 A;  5B1B C;  1A7D A;  1EQ1 A;  1VTM P;  1VLT A;  4NQF A;  3SNH A;  1I4Z A;  3HNI A;  2J46 A;  1Q0K A;  2PNO A;  5KYX B;  4XPY A;  2A69 F;  3GAN A;  3KYI A;  2J45 A;  1Y4C A;  1E86 A;  1OQC A;  2DGJ A;  4YL0 A;  2NG1 A;  5E3C A;  5KYX A;  4IJJ A;  3RYL A;  3K7D A;  4XWJ A;  4E18 A;  3AOU A;  1RXQ A;  4YL3 A;  2W4B A;  2R7X A;  4O7G A;  2MHR A;  3DM5 A;  4J30 B;  3ABL C;  3JYH A;  3M4C A;  2YL0 A;  2BC5 A;  3EQL F;  3CEX A;  2G3K A;  5A6K A;  1L3P A;  1WOL A;  5KYW B;  4ZLD A;  1EKY A;  3KL4 A;  4IGG A;  3K1I A;  3L8I A;  4MW3 A;  1ORJ A;  3T6G B;  1XWJ A;  3K1H A;  5JP7 A;  1ZHW A;  4YJW A;  4H54 A;  1SF8 A;  2FAP B;  2YWA A;  1D0X A;  3NMI A;  2OCC C;  3CSK A;  4L6R A;  2ETS A;  3GM1 A;  2XS1 A;  1ZHT A;  5EHH A;  2FFH A;  4O79 A;  3ZIB A;  5A6J A;  2VCA A;  5L0C A;  1JRA A;  3AGT A;  3LNM B;  4EBB A;  2RSE B;  3DE8 A;  4C7O B;  3X2Q C;  1OCR C;  1TWG A;  4HEA J;  1MMN A;  4JVS A;  1V74 B;  1YLM A;  2WVQ A;  3DMD A;  3ITF A;  2DB4 A;  4MW8 A;  3ZC4 A;  4H4K C;  1D1A A;  1APC A;  1WWP A;  2Q3T A;  3C62 A;  4P9F A;  5JLI A;  4MTG A;  2D5R B;  1MND A;  1SYQ A;  1I4Y A;  3GM3 A;  5D91 A;  1B68 A;  5B3I A;  3UR3 C;  4AK9 A;  3ZQY A;  1T01 A;  1HE9 A;  2J0X A;  4BJT A;  3W8H A;  1ZHX A;  2A6E F;  3QMK A;  4XEV A;  1NZE A;  1AEP A;  2LQG A;  1OXK A;  3FAP B;  4YT2 A;  1E85 A;  1TR2 A;  1BR1 A;  3LEO A;  2VAS A;  3B71 A;  4FAP B;  1FR0 A;  2Q7R A;  2P1A A;  3VYW A;  1JOG A;  1OXB A;  1RCP A;  2A0U A;  1K04 A;  2HV7 A;  1RKE B;  3IQ6 A;  3UMI A;  2DYS C;  1G4W R;  1LI5 A;  2IXM A;  5HV9 A;  3U3B A;  1YVI A;  1EA8 A;  1M2V A;  3WOD F;  1GM5 A;  1PD0 A;  2H8A A;  2KJG A;  4LDK A;  4PJJ A;  2HMZ A;  3M15 A;  2Z15 A;  3RKO F;  3V5X A;  1T6I A;  1T6U A;  3B0P A;  2QUP A;  2O9X A;  3DXJ F;  1NU9 C;  1MQV A;  3K33 A;  4U5C E;  2B0J A;  2J7P D;  4DRJ B;  2Y69 C;  1M6T A;  2GWW A;  4KNW A;  2NPU A;  2AP3 A;  3ABM C;  4I44 A;  1OW7 A;  4G7H F;  3IQT A;  1WTY A;  3T9O A;  2J0W A;  3S27 A;  1Q0G A;  1S7Z A;  3QW0 A;  3HLZ A;  4JW1 A;  5JS5 A;  3FXH A;  4OIN F;  2Q9B A;  3VF0 A;  4AL0 A;  1Z7Q c;  3B0V C;  4P9T A;  2R7S A;  4ULW A;  1KNY A;  2V26 A;  2JPU A;  2CGE A;  5DQT A;  1Q0M A;  4BJ6 C;  1ORY A;  1PD1 A;  5BQI A;  1ZU4 A;  1RKC A;  1T9K A;  1Z23 A;  2OOC A;  2RD9 A;  2WZL A;  3C63 A;  1SR2 A;  3CZ6 A;  1DOV A;  5T1D B;  3POV A;  2ZPA A;  3JT1 A;  2HJ3 A;  2VB6 A;  2OU6 A;  3QTH A;  4OIR F;  2J9V A;  4CS9 C;  1ZW2 A;  2VCC A;  3NMK A;  5F5H A;  5JUA A;  1OR3 A;  2AWY A;  3RF3 A;  4PFP A;  3UNG C;  1LS4 A;  4AE4 B;  2R05 A;  4OIP F;  4Q7C A;  3US6 A;  3MYF A;  1U0B B;  2IOQ A;  2WZF A;  1OW6 A;  1QQ3 A;  2HJM A;  2VH3 A;  4CDY A;  3ZWI A;  4AE4 A;  3GEI A;  2XL8 A;  2R7U A;  5CI8 A;  1ZHZ A;  5JVE A;  1Q0D A;  2C03 A;  1QSP A;  4OIQ F;  5A6B D;  3KH2 A;  1VB5 A;  2H7V C;  4NTB A;  5JSL A;  3RQF A;  5KYY B;  2R7W A;  2ZXP A;  1Z6A A;  2Q4F A;  2HSQ A;  3Q6N A;  4KNV A;  4BJ1 A;  3DE9 A;  3AG4 C;  3JCU Q;  1ZW3 A;  3OA1 A;  4LDQ A;  3O10 A;  1HW2 A;  5KYY A;  4JCZ A;  2EIM C;  1VMA A;  2KSF A;  4KI2 A;  3DWW A;  2G3V A;  5B1A C;  5L0J A;  2EPM X;  4I1M A;  2P61 A;  4Z9I A;  2EIK C;  3GEH A;  3M79 A;  2YLI A;  4Z9J A;  2EPL X;  4DRI B;  1XZQ A;  2A0B A;  4R32 A;  2L9J A;  3B0U X;  3C8G D;  3C18 A;  3ASO C;  3NRH A;  1G5Z A;  3JTL O;  4EKW A;  3VM6 A;  2GA0 A;  4JC7 A;  4F4B A;  3S28 A;  4ANJ A;  3FVY A;  1VYI A;  2Y39 A;  4JZA A;  3NDB B;  4C7O A;  4C3B A;  2AWC A;  3LLI A;  3MBG A;  5BQH A;  3EG9 B;  3C7J A;  4JIO A;  3SXZ A;  3C8G A;  3OEO A;  4JTA B;  1JPN A;  1QVX A;  5E33 A;  3JSE O;  2XL6 A;  3TK0 A;  1S05 A;  4E0I A;  1VK5 A;  1YAR O;  3TOM A;  3U0C A;  3VAY A;  4U5F E;  2GFH A;  5COF A;  3AG1 C;  5F5F A;  4X0R A;  1A41 A;  4GEH A;  4I1O B;  1LPE A;  1F1M A;  1MMG A;  1H9G A;  2LIG A;  4U5E E;  4BG0 A;  3R7C A;  5L3V A;  1CGO A;  3S9O A;  1BDJ B;  1NFO A;  3V5Z A;  2W4M A;  2ZXR A;  3IQ5 A;  2ASR A;  3C8Z A;  1A7V A;  2Q9A A;  3LS1 A;  4ULV A;  4JTC B;  4M63 A;  2KQ9 A;  2PBE A;  3SXK A;  4DBR A;  4U5B E;  2KNH A;  4CSA C;  5D92 A;  3EH2 A;  4JEB A;  2XLE A;  4JE9 A;  2J9W A;  4EBK A;  5IY5 C;  2XXA A;  2R7V A;  2CNW D;  1UG7 A;  2XS8 A;  4K7B A;  2BL2 A;  1RKE A;  3G4X A;  3GOR A;  4BJ5 A;  2ZXW C;  2XXA B;  3EPV A;  4MVQ A;  4J32 B;  2D4U A;  2OJE D;  2KW3 C;  1J8Y F;  4Q4Z F;  3DJN B;  3JRM O;  4HE8 D;  4K1O A;  4PK4 A;  2XLW A;  4W8P A;  1MMD A;  2M4E A;  3FAJ A;  3NKD A;  4PJM A;  3TD7 A;  2XLO A;  3LS0 A;  1K40 A;  3I5P A;  4FWV A;  4XPW A;  2HS5 A;  3LEV A;  5E3A A;  1C17 M;  3U9J A;  1M2V B;  1XZP A;  4MVO A;  1E84 A;  2JX0 A;  2QTV A;  4XPX A;  3A11 A;  1HMO A;  3K6B A;  4YT4 A;  4NTF A;  3JYY A;  2MYS A;  3ZTZ A;  5L0F A;  2G62 A;  4G78 A;  4P6I C;  1ZU5 A;  5A6A A;  3HJC A;  2XLM A;  1JR8 A;  4N4W A;  1O5H A;  1JAF A;  4JTD B;  1CGN A;  4QDL A;  1QLE C;  2X0C A;  2Y3G A;  3IEE A;  3SXM A;  3TQO A;  2EIL C;  4D4X A;  2XLV A;  1ORS C;  3U5S A;  4WJ0 A;  4MS2 A;  1OKK D;  1OW8 A;  2JD3 A;  4G7Z F;  3J06 A;  3W4Y A;  1M56 C;  5T3T A;  3S0X A;  1LE2 A;  3N2Z B;  3K66 A;  4XLN F;  2EPN A;  2XRH A;  3N0T A;  3RFY A;  2NSF A;  5CI9 A;  2R02 A;  4XTK A;  4CDA A;  4FX5 A;  2XLD A;  3SEO A;  2L81 A;  2NUP A;  4EUK B;  4JRZ A;  3S84 A;  1CPQ A;  4Q5S F;  2OEV A;  3FHD A;  1FFT C;  2PX0 A;  2HKV A;  3HTK C;  1C03 A;  1NG1 A;  2WVN A;  5L0G A;  1ZZP A; 
#chains in the Genus database with same CATH homology
 4A2N B;  4LLC A;  3ZSU A;  2WB7 A;  4BEJ A;  3ECS A;  4OD5 A;  1SZI A;  4LAC B;  3NYJ A;  2X51 A;  2OG2 A;  3UMK A;  3UGO A;  3F46 A;  4YT5 A;  4YN0 B;  3Q7L A;  2WZG A;  2Y3D A;  1IW7 F;  2LSE A;  4G0H A;  4CSA A;  5DLJ A;  3M1C B;  2A6H F;  2MWQ A;  1W2W A;  1NU7 D;  3ASN C;  3S29 A;  3EG9 A;  1WGW A;  2PX3 A;  2IXP A;  3KKB A;  1LKX A;  3DZA A;  2EIN C;  2PP4 A;  2PF4 E;  1N1C A;  3EGD A;  4LLE A;  1ST6 A;  5KYU B;  2YHS A;  3LNR A;  3UGP A;  4ZLC A;  3EJN A;  1TKN A;  5DS6 A;  3UMH A;  3AG3 C;  1OCZ C;  3O39 A;  4K0D A;  1SMY F;  2Y3H A;  2IYL D;  4U5G A;  2XL4 A;  2YEV A;  2E87 A;  2XSE A;  3SZR A;  4DBQ A;  4E7S A;  1MMA A;  4QI0 A;  4CS8 C;  5DS4 A;  4HFF B;  4N06 A;  3WG7 C;  3EGX B;  4FES A;  1V55 C;  3NKE A;  2IXN A;  2P6V A;  4JJG A;  2DYR C;  2C04 A;  2P7V A;  3DM9 B;  4IRU A;  4EWC A;  2R7Q A;  3RIP A;  3EFO B;  1FTS A;  1FMW A;  3NG1 A;  4DVZ A;  4E7Z A;  3FDQ A;  1IZM A;  4YWQ A;  5DS5 A;  1ZYR F;  2PFD A;  3W2W A;  3N24 A;  5T3W A;  4RBN A;  4C3D A;  5E2Q A;  3T6J A;  3I5Q A;  1OCO C;  3EZH A;  3EHM A;  4PFO A;  2ZXO A;  3KMI A;  3LLK A;  3PHF 2;  4JUR I;  4OIO F;  4YT8 A;  1RJ9 B;  3K1I C;  3E9V A;  3LES A;  1M2O A;  3T4R A;  5BUO A;  1D0Z A;  3DD7 A;  2CNW A;  3PMR A;  4HFK B;  1FFH A;  1JPJ A;  3DJU B;  2NUT A;  4JCH A;  3S28 A;  2Q9C A;  3AQB A;  3ZC4 A;  2W45 A;  2QY9 A;  2R7R A;  3W8I A;  3MX3 A;  1FMV A;  1J8M F;  2NUT B;  5L3Q A;  4DOZ A;  4CS8 A;  3Q6M A;  1BR4 A;  1TWA A;  1G8X A;  3T6B A;  3SYN A;  2FGY A;  2V3C C;  3OWT A;  4OD4 A;  2BE5 F;  4PJN A;  1BR2 A;  5KYW A;  3CQZ A;  3MLG A;  1D0Y A;  4O6N A;  1ZHY A;  1Z5Z A;  4KBL A;  3EH1 A;  2IXO A;  2YZS A;  4DVY P;  4W8K A;  2WL8 A;  3L0I A;  3GOD A;  4QI2 A;  3NYM A;  1OKK A;  3LJB A;  3EGD B;  4PJL A;  5DVW A;  1KU2 A;  5KYU A;  2I8B A;  1LVK A;  1MNE A;  1OCC C;  3X1O A;  4CS9 A;  5EGY A;  4BJ5 C;  3JRT A;  2HV6 A;  3I4U A;  4RDA A;  5HSW A;  4CBE A;  1LS1 A;  4LER A;  2EIJ C;  4CIH A;  2H7O A;  3Q7G A;  3O6X A;  1V54 C;  4O6M A;  3ZG1 A;  4U5H A;  3DAF A;  3NYL A;  2H7B A;  3EHN A;  4XLP F;  3F47 A;  3H65 A;  3EGX A;  4JJF A;  2R7O A;  4NY3 A;  3E70 C;  3ZVR A;  2KGO A;  4MND A;  3AQC A;  2R7T A;  1QZX A;  1Z63 A;  1D1B A;  1VYK A;  4I3M A;  4RD9 A;  3LAY A;  4BJ6 A;  1Z3I X;  3V7O A;  3EFO A;  1TWH A;  5KYN A;  1TWC A;  3B9Q A;  4MQ9 F;  4B6I A;  5DQZ A;  2J9U A;  1O87 A;  4G7O F;  2CW0 F;  5FCL A;  3EZI A;  2J7P A;  2A1D D;  3DAG A;  4AX2 A;  3RH3 A;  3ABK C;  4KC9 A;  2CDQ A;  4O6Y A;  3L34 A;  3SP1 A;  4CS7 A;  1M57 C;  4IWB A;  1VOM A;  2NUP B;  4IAO A;  4C3E A;  3QZC A;  1D1C A;  2A68 F;  2WVO A;  3AG2 C;  1RJ9 A;  4GYT A;  3JSZ A;  1PCX A;  3W2V A;  2Y3B A;  5B3S C;  2W9Y A;  4U5D E;  5B1B C;  3SNH A;  5KYX B;  2J46 A;  2A69 F;  3GAN A;  2J45 A;  2DGJ A;  2NG1 A;  5E3C A;  5KYX A;  4IJJ A;  3RYL A;  3K7D A;  4XWJ A;  2W4B A;  2R7X A;  4O7G A;  3DM5 A;  4J30 B;  3ABL C;  3JYH A;  5KYW B;  4ZLD A;  3EQL F;  2G3K A;  3KL4 A;  3WOD F;  3K1H A;  1ZHW A;  4YJW A;  1SF8 A;  1D0X A;  2OCC C;  3CSK A;  5EHH A;  1ZHT A;  2FFH A;  4O79 A;  3ZIB A;  4EBB A;  4C7O B;  3X2Q C;  1OCR C;  1TWG A;  4HEA J;  1MMN A;  4JVS A;  2WVQ A;  3DMD A;  3ITF A;  4H4K C;  1D1A A;  2Q3T A;  2D5R B;  1MND A;  5D91 A;  3UR3 C;  4AK9 A;  2J0X A;  4BJT A;  3W8H A;  1ZHX A;  2A6E F;  3QMK A;  1NZE A;  4YT2 A;  1TR2 A;  1BR1 A;  2VAS A;  3VYW A;  2HV7 A;  3UMI A;  2DYS C;  2IXM A;  1M2V A;  1PD0 A;  2KJG A;  4PJJ A;  2Z15 A;  3RKO F;  3B0P A;  3DXJ F;  2O9X A;  1NU9 C;  3K33 A;  4U5C E;  2B0J A;  2J7P D;  2Y69 C;  4KNW A;  3ABM C;  4I44 A;  4G7H F;  2J0W A;  3S27 A;  1S7Z A;  3HLZ A;  4JW1 A;  4OIN F;  2Q9B A;  3B0V C;  2R7S A;  4ULW A;  2V26 A;  5DQT A;  2CGE A;  4BJ6 C;  1PD1 A;  1ZU4 A;  1Z23 A;  2WZL A;  3CZ6 A;  3POV A;  5T1D B;  2ZPA A;  3JT1 A;  2VB6 A;  4OIR F;  2J9V A;  4CS9 C;  5F5H A;  4PFP A;  3UNG C;  4AE4 B;  4OIP F;  4Q7C A;  2WZF A;  2IOQ A;  2VH3 A;  4AE4 A;  2R7U A;  5CI8 A;  1ZHZ A;  2C03 A;  4OIQ F;  3KH2 A;  2H7V C;  5KYY B;  2R7W A;  2ZXP A;  1Z6A A;  3Q6N A;  4BJ1 A;  4KNV A;  3AG4 C;  3JCU Q;  3OA1 A;  5KYY A;  2EIM C;  1VMA A;  4KI2 A;  2G3V A;  5B1A C;  4I1M A;  2EIK C;  3B0U X;  2L9J A;  3ASO C;  3NRH A;  4F4B A;  4ANJ A;  3FVY A;  1VYI A;  2Y39 A;  4JZA A;  3NDB B;  4C7O A;  4C3B A;  3LLI A;  3EG9 B;  3OEO A;  1JPN A;  5E33 A;  1VK5 A;  3VAY A;  4U5F E;  2GFH A;  3AG1 C;  5F5F A;  4X0R A;  4U5E E;  4GEH A;  4I1O B;  4BG0 A;  1MMG A;  5L3V A;  2W4M A;  2ZXR A;  2Q9A A;  3LS1 A;  4M63 A;  2KQ9 A;  4DBR A;  4U5B E;  2KNH A;  4CSA C;  5D92 A;  3EH2 A;  2J9W A;  5IY5 C;  2XXA A;  2R7V A;  2CNW D;  4K7B A;  4BJ5 A;  2ZXW C;  2XXA B;  3EPV A;  4J32 B;  2KW3 C;  1J8Y F;  4Q4Z F;  3DJN B;  4HE8 D;  4PK4 A;  1MMD A;  2M4E A;  3FAJ A;  3NKD A;  4PJM A;  3TD7 A;  3LS0 A;  4FWV A;  3I5P A;  5E3A A;  3LEV A;  1M2V B;  2QTV A;  3K6B A;  4YT4 A;  2MYS A;  2G62 A;  4P6I C;  1ZU5 A;  3HJC A;  1O5H A;  4QDL A;  1QLE C;  2Y3G A;  3IEE A;  2EIL C;  4WJ0 A;  1OKK D;  2JD3 A;  4G7Z F;  1M56 C;  5T3T A;  3S0X A;  3N2Z B;  3K66 A;  4XLN F;  2XRH A;  3N0T A;  3RFY A;  5CI9 A;  4XTK A;  4FX5 A;  3SEO A;  2L81 A;  2NUP A;  4Q5S F;  3FHD A;  1FFT C;  2PX0 A;  3HTK C;  1NG1 A;  2WVN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...