3NYJA

Crystal structure analysis of app e2 domain
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
181
structure length
181
Chain Sequence
LETPGDENEHAHFQKAKERLEAKHRERMSQVMREWEEAERQAKNLPKADKKAVIQHFQEKVESLEQEAANERQQLVETHMARVEAMLNDRRRLALENYITALQAVPPRPRHVFNMLKKYVRAEQKDRQHTLKHFEHVRMVDPKKAAQIRSQVMTHLRVIYERMNQSLSLLYNVPAVAEEIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Protein fibril
molecule keywords Amyloid beta A4 protein
publication title The E2 Domains of APP and APLP1 Share a Conserved Mode of Dimerization.
pubmed doi rcsb
source organism Homo sapiens
total genus 56
structure length 181
sequence length 181
ec nomenclature
pdb deposition date 2010-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12925 APP_E2 E2 domain of amyloid precursor protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.770 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3nyjA00
3K6BA 3PMRA 4RD9A 5BUOA 3QMKA 4YN0B 3NYLA 3K66A 1TKNA 4RDAA 3UMKA 3Q7LA 3UMHA 3NYJA 3UMIA 3Q7GA
chains in the Genus database with same CATH superfamily
3K6BA 2NSFA 4J30B 5DS5A 3FXHA 4JTCB 2Q4FA 4LLCA 2LP4A 3RVZA 2R05A 2BE5F 1V4AA 4AE4B 4YT8A 1GGQA 1V54C 1V74B 2AVKA 5B1AC 4OINF 4CS7A 2R7OA 4QDLA 3QMKA 5BQHA 1HW2A 4MTGA 2R7TA 3HJCA 2LCHA 3NYJA 5E3AA 4PACA 1OR3A 2HUJA 2XM4A 3W8HA 3VRCA 4K0DA 2ETSA 3WODF 3KH2A 3SP1A 2L6GA 3NYLA 1VOMA 5T3TA 5AC5A 1RJ9A 5FZTA 1M56C 3IQ5A 1H6GA 1MNEA 3LS0A 3S29A 2KNHA 3W4YA 1UG7A 3TULA 3AGUA 1ORYA 1FNTc 4N6CA 4PK4A 1U89A 2R7QA 3IEEA 1YYJA 3EG9B 1M6TA 4NTAA 1CPQA 1K04A 1OW7A 2B0JA 3LJBA 3U2MA 5JVEA 5KYXA 3DWWA 3DE9A 2KK1A 3ECSA 3NKEA 3EFOA 2YL0A 2Q9AA 1G4WR 4DBRA 3KYIA 4W8PA 1A7VA 1S05A 1T6IA 1MMDA 1BR4A 1I4YA 2J9BA 1CGOA 3EHMA 3JYYA 1QPUA 1D1AA 1VLTA 4OIRF 3DMDA 3V5YA 5BQIA 5KYNA 2A0BA 2QLAA 4CSAA 2KYHA 2UUHA 2R7VA 2Y3GA 2R25A 4BJTA 1FMWA 1ZW2A 4MQ9F 1M2VA 4A4AA 3K7DA 5KYWB 3K33A 2EPOA 3SEOA 5JS5A 1O5HA 3OWTA 2KQ9A 4XEVA 2KC3A 2RSEB 2VC9A 5B3IA 2DYSC 3RIPA 1A7EA 1ZVZA 4YT5A 1JR8A 3DXJF 3IPMO 1FFHA 2H7OA 2IXOA 3MYFA 1MMNA 3DE8A 4YT4A 5JRAA 3B0UX 3RW0A 2C03A 2LK4A 2P0NA 2XL6A 1Z6AA 4XTKA 3PHF2 4BJ6A 2GDCA 4IGGA 2EIJC 2WB7A 3SZRA 2D5RB 3UNGC 3AJMA 1D1CA 2IXNA 3ABKC 3TK0A 1QZXA 1R5ID 3EZIA 2J0WA 4WABA 1MQVA 4KBLA 4MTFA 3LLIA 3DAFA 4JJFA 2EINC 4WGYA 1BZ4A 3ZQVA 3NMJA 2PX3A 2H8AA 3GM1A 2OOCA 1SR2A 3V5XA 4LDRA 3AOUA 1J8MF 1NBBA 4MVRA 2D4UA 2R03A 4DRIB 2VASA 3U9JA 2R7WA 5DS4A 2XXAA 2IYLD 3JZ0A 1E2XA 1I5NA 2H7BA 3Q7LA 1TR2A 3L1MA 4A2NB 2P6VA 1CGME 3Q7GA 3ASNC 5L3QA 4EBJA 4PR9A 2PNOA 2CNWD 3T9OA 3AGTA 1MNDA 2WVNA 2B0HA 2A0UA 2YQYA 3S84A 1VYKA 2YLIA 4H4KC 2PF4E 4JURI 4JZAA 3ZWIA 4CDAA 5L3VA 4XLPF 1T01A 4IARA 3DD7A 2A6HF 4O7GA 2JX0A 3SXMA 3HNKA 3O55A 1L3PA 2G62A 4EBBA 4CIHA 1ZU4A 1TWCA 2J9VA 1YDIA 1K05A 1N1CA 2NUPB 3KPHA 3RQGA 1KNYA 2YLGA 4CS8C 1ZYRF 3VM6A 1ZHZA 4YT2A 2GWWA 3JYHA 2HMZA 1JRAA 2NUTB 4D4XA 4KI2A 4I3MA 5D91A 5L0HA 2AU5A 3KL4A 3QTHA 4RD9A 2I8BA 3TJ6A 4EWCA 3IQ6A 4CS8A 1TKNA 3O10A 3NMKA 4MVSA 2R7RA 3KYJA 1XWJA 5L0IA 3ZTMA 2YRFA 1LM3B 3FMSA 2CDQA 2L81A 2Z15A 1W2WA 4MVMA 1TFKB 3UGPA 2DYRC 2OEXA 3SXKA 4K1OA 3LEVA 2VH3A 4RDAA 1TFOB 1Z3IX 1RKCA 5CI8A 1FR0A 2NPUA 3AG2C 3T6JA 1OKKA 3N2ZB 4FX5A 4JEAA 3G50A 1O3UA 4AL1A 2EILC 3MBGA 1T6UA 3UMKA 5A6JA 3NYMA 2J45A 4U5GA 1JOGA 1HY5A 3A11A 2L7AA 4N6HA 1AVOB 3AG1C 4NC3A 1OR2A 2Q9BA 4KC9A 5D92A 4P9TA 3UMIA 2OG2A 2XLVA 4X0RA 3T4RA 3ZSUA 4PJJA 3GODA 5COMA 1FTSA 1ORJA 2X51A 4O6MA 1WWPA 1TWAA 2ZXRA 1ZHTA 3E70C 2ZXPA 4JCHA 2WZLA 2YHSA 1VK5A 1A7DA 2XLMA 3TJ5A 4PFPA 2J9WA 1LIHA 3VAYA 1OQCA 2L9JA 4P9FA 4G7OF 2QE9A 2XS8A 4YJWA 2Q7RA 4CJGA 1O87A 2WVQA 4GQHA 1VB5A 1TWHA 5KYUB 3ATPA 5DLJA 2WZGA 4PFOA 5EGYA 3J06A 1LI5A 4JTDB 4XEKA 2BL2A 1V55C 2J0XA 3R2PA 2RD9A 1J8YF 4DBQA 5BUOA 3A9CA 4U5HA 1OKKD 2XM0A 2HZ8A 5DQZA 3O39A 4DRHB 4E18A 4JW1A 3HNIA 3OA1A 4LLEA 4BJ5A 5EK0A 1OXBA 4HEAJ 1OXKA 3N0TA 4CDVA 1K40A 1ST6A 4M63A 3NKDA 4H54A 1Q0MA 2H7VC 3TOMA 4CBEA 4IJJA 3C8ZA 4CSAC 2P61A 3BRJA 4N4WA 1MMGA 1U0BB 1WGWA 1XZQA 4D4NA 4JKVA 4EBKA 1E83A 1NU7D 3DAGA 2VCCA 4Q5SF 3C18A 3ZDLA 4I1OB 4U5BE 3FHDA 2HSBA 5T3WA 4BJ1A 1BBHA 1L7CA 4NCQA 5BQGA 4E0HA 4DOZA 1BR2A 3EGXB 2E87A 1RKEA 2HKVA 2MHRA 5DVWA 4DJ9A 5EHHA 3BEHA 2ZPAA 5HV9A 4C7OB 3L8IA 3JSZA 2X0CA 1FMVA 2LFFA 1ZHYA 2HJ3A 4MS2A 4I1MA 2Y3HA 1RMVA 4U5EE 2XLHA 4BJ6C 1ZW3A 3LNRA 3L34A 3O6XA 5K0IA 2CNWA 4G0HA 3B0VC 3EPVA 1I4ZA 3POVA 2I15A 2XSEA 3QVZA 3L0IA 5L0DA 1D1BA 3SXYA 3CAXA 3HKKA 3KKBA 4J7TA 4PJNA 2YL1A 3X2QC 1XZPA 2OJQA 3F47A 2EPMX 3U8VA 3RH3A 4YWQA 4W8KA 2KGOA 3G4ZA 1ZU5A 3K1HA 3EZHA 4LDKA 1B68A 3SYNA 1YARO 3AG4C 4N06A 3GANA 3QW0A 2XL8A 3AQBA 3LESA 1NSGB 3CEXA 1D0YA 3EGDB 4YL0A 3HNJA 4OD5A 4HE8D 4EHPA 3X1OA 1YLMA 1NLXA 4MVQA 5AGFA 2GA0A 5KYYB 4G7ZF 4AE4A 3GM2A 4U5CE 4MW8A 3W2WA 3JTLO 2HS5A 1YYXA 4UDVA 3FAPB 3CSKA 4YK5A 2IBFA 3NDBB 3CZ6A 2P7VA 1F1MA 2W45A 3B71A 3LNMB 4IAOA 4J7YA 2W9YA 1ZZPA 3M79A 1QQ3A 1LE2A 1Z5ZA 2DGJA 2HV6A 3GEEA 1CPRA 4K7BA 2EPLX 5JUAA 2ZD9A 4FESA 1D0ZA 2WZFA 3F46A 4JEBA 1RJ9B 4MVUA 4LDQA 2IXPA 4DVZA 2HSQA 3DI5A 5JT4A 1DOWA 3N24A 3RQEA 3EG9A 1YA7O 5L0JA 4LACB 1T5OA 4GEHA 2O9XA 2CCYA 3S28A 3S90A 4XPXA 4HFKB 2BC5A 1YZCA 4AK9A 1OCZC 1YAUO 1LS1A 1G4US 4O6NA 5KYXB 2YLDA 2YEVA 4XPWA 5COFA 3V5ZA 3EFOB 4ULVA 3RKOF 1C03A 3FAJA 3IQCA 4G78A 2IM8A 2XLWA 4U5DE 3SXZA 1D0XA 4E0IA 4C3DA 3I5PA 2OKUA 4CS9C 1HW1A 4JCZA 4YL3A 2AP3A 5A6KA 1BDJB 3C8GB 2CW0F 1NG1A 3LEOA 5F28E 5KYWA 3HTKC 1JPNA 3V7OA 2R7SA 5A6BA 1PV3A 2EIMC 4NTBA 3Q6MA 1M2VB 2Y39A 1DOVA 4RBNA 4JE9A 1NU9C 4CS9A 1T9KA 1GM5A 2A1DD 2V3CC 3JCUQ 1Z63A 2VB6A 5F5HA 2F22A 4DRJB 1E85A 3ZTZA 3U8PA 1YZAA 3U3FA 5CIVA 3ZVRA 2HMQA 4C3EA 3RYLA 1R4TA 2IXMA 2Q00A 4O79A 4ANJA 1S7ZA 3C7JA 4JIOA 2AWCA 5IY5C 3GWLA 3ABMC 2WL8A 4EIYA 2NG1A 1T6QA 4F4BA 2LQGA 2HV7A 2ICWG 4IAQA 3PDMP 1Q0DA 2KW3C 3DM9B 4B6IA 4BJ5C 3RQFA 4ER9A 1PCXA 2V26A 2OU6A 1VMAA 2PP4A 3NMIA 3U0CA 3B9QA 1Q0GA 2XS1A 3C62A 4Q7CA 5JLIA 4WJ0A 4P6IC 1WTYA 1JAFA 3CQZA 3UGOA 3ZQYA 1CGNA 3U5SA 5DQTA 5A6BD 3EHNA 5L0FA 4BEMJ 1LKXA 4Z9JA 1OW8A 2OCCC 2XXAB 1Q0FA 4PJMA 1NFNA 3AQCA 3B0PA 3B29A 4QI0A 1APCA 5DS6A 1H9GA 2W4MA 1HMOA 2Y3BA 1OCRC 2XL4A 1VYIA 3KMIA 5JP7A 3FVYA 3GEIA 3M15A 2LIGA 1LI7A 4IRUA 4AX2A 5A6AA 4MVZA 1M2OA 1GS9A 2GFHA 3SNHA 3W2VA 1RXQA 2QY9A 3DZAA 2VCAA 3H2UA 1GQAA 3ITFA 1ZHXA 4WGZA 2NUPA 3T6GB 4BEJA 5AC4A 3MFNA 4XEFA 4QI2A 1OW6A 1SZIA 5B3SC 4I44A 2A6EF 1SYQA 2NUTA 4FAPB 4CIPA 2LD6A 4HFFB 2JD3A 3UMHA 3FOPA 4ZLCA 4U9EA 1C17M 2PFDA 4L6RA 2IOQA 4XLNF 2OQMA 1LS4A 1IW7F 2J7PD 1M57C 3K1IC 3U3BA 3MLGA 3JT1A 3U9MA 3S27A 4U5FE 3US6A 2QTVA 2PBEA 1TQGA 3TD7A 2J8WA 2HJMA 3UR3C 3M4CA 1Y4CA 4Z9IA 1VLSA 4DVYP 1QLEC 3GEHA 3K1IA 4XWJA 5E3CA 1QKRA 2G3VA 1JMWA 3C8GA 2KSFA 3EH1A 3FOOA 5JSLA 2M64A 3HNLA 4O6YA 2YVKA 1LPEA 3HLZA 5A69A 2R7UA 3EH2A 5B1BC 3WHNA 4BPMA 1WN0A 1YVIA 2C04A 4U9DA 3W8IA 1BR1A 1WOLA 3H65A 3RVYA 3VF0A 4R32A 3L8JA 4OIPF 3QVYA 5E33A 1MMAA 3ZIBA 3QZCA 4JTAB 5L0CA 3U2LA 4PJLA 2MYSA 1E86A 2QNLA 1FFTC 2HFIA 3WAQA 3IHUA 2M4EA 2ZXOA 2CYDA 2DB4A 2OEVA 2UUIA 3NRHA 2OJED 3S9OA 2ASRA 3M1CB 3MYIA 1A0BA 2YZSA 4ZLDA 3RF3A 5KYUA 2W4BA 2R7XA 1ORSC 256BA 2Y3DA 1PD0A 2LSEA 1AUEA 1SMYF 2R02A 1ZHWA 3DJNB 2CGEA 3LAYA 3MX3A 1H9TA 2P1AA 4MVOA 3IQTA 1NZEA 3I4UA 4Q4ZF 2EIKC 1NFOA 1OCOC 4IWBA 3QW1A 2EPNA 3C8GD 2L6HA 1KU2A 4YN0B 3GORA 1H7IA 3JRTA 2A69F 4NTFA 5COGA 2XLEA 3TQOA 2QUPA 4ONSA 3DKAA 4CX9A 1JPJA 2YL3A 3AG3C 1A41A 2G3KA 2ZXWC 1HMDA 3OEOA 3LS1A 4DXWA 1YJGA 1G5ZA 1E84A 1EI7A 3GM3A 3WG7C 2AWYA 1EQ1A 1OCCC 4JJGA 3EJNA 1G8XA 2Q3TA 5FCLA 4KNVA 1LVKA 3LUTB 4JC7A 2GAQA 2XLOA 5HSWA 4Z9HA 2A68F 4MNDA 3VYWA 4G7HF 2PX0A 1EKYA 3ABLC 1U6HA 1Q0KA 2YWAA 4E7SA 1TWGA 3EGXA 4CDYA 4OD4A 2NSGA 3LLKA 3T6BA 3ZG1A 1RCPA 2TMVP 2J46A 1PD1A 1IZMA 2LFDA 2XRHA 4MW3A 4BG0A 4C7OA 1RKEB 2R9RB 1HE1A 4ULWA 2Y69C 3PMRA 1FAPB 2FGYA 3G4XA 1AEPA 5CI9A 4FWVA 3ASOC 3DJUB 4JVSA 1SF8A 3M4BA 4XQ1A 3H2VA 3RFYA 3TOLA 2FFHA 3R7CA 3C63A 4CJOA 4EKWA 4XPYA 5TJ5E 2DI3A 1Z23A 4NQFA 4E7ZA 2FAPB 2YL7A 4IB4A 2JPUA 5F5FA 3E9VA 3PCVA 3GWNA 3Q6NA 4OIQF 1QSPA 4KNWA 1QVXA 1Y6DA 3I5QA 3JSEO 2EPKX 4E17A 1VTMP 2J9UA 1YA9A 4EUKB 2KJGA 1KTMA 1EA8A 3FDQA 5L0GA 3EQLF 3K66A 1WASA 2VCBA 3DM5A 4GYTA 5T1DB 1UFBA 2MWQA 2Q9CA 4J32B 1WATA 4NY3A 5GPGB 1C02A 2WVOA 3EGDA 4JRZA 1Z7Qc 3ZC4A 4OIOF 2XLDA 5E2QA 2L6FA 1HE9A 2J7PA 1LE4A 3NG1A 3JRMO 4LERA 4AL0A 4YL1A 5KYYA 3S0XA 4MTOA 4C3BA 2YKZA
chains in the Genus database with same CATH topology
3K6BA 5DS5A 4J30B 4LLCA 2BE5F 4AE4B 4YT8A 1V54C 5B1AC 2R7TA 4OINF 4CS7A 2R7OA 4QDLA 3QMKA 3HJCA 3NYJA 5E3AA 3W8HA 4K0DA 3WODF 3KH2A 3SP1A 3NYLA 1VOMA 5T3TA 1RJ9A 1M56C 1MNEA 3LS0A 3S29A 2KNHA 4PK4A 2R7QA 3IEEA 3EG9B 3LJBA 2B0JA 5KYXA 3ECSA 3NKEA 3EFOA 2Q9AA 4DBRA 4XLNF 1MMDA 1BR4A 3EHMA 4OIRF 1D1AA 3DMDA 5KYNA 4CSAA 2R7VA 2Y3GA 4BJTA 1FMWA 4MQ9F 1M2VA 3K7DA 5KYWB 3K33A 3SEOA 1O5HA 3OWTA 2KQ9A 2DYSC 3RIPA 4YT5A 3DXJF 1FFHA 2H7OA 2IXOA 1MMNA 4YT4A 3B0UX 2C03A 4XTKA 1Z6AA 3PHF2 4BJ6A 2EIJC 2WB7A 3SZRA 2D5RB 3UNGC 1D1CA 2IXNA 3ABKC 1QZXA 3EZIA 2J0WA 4KBLA 3LLIA 3DAFA 4JJFA 2EINC 2PX3A 1J8MF 2VASA 2R7WA 5DS4A 2XXAA 2IYLD 2H7BA 3Q7LA 1TR2A 4A2NB 2P6VA 3Q7GA 3ASNC 5L3QA 2CNWD 1MNDA 2WVNA 1VYKA 2PF4E 4JURI 4JZAA 5L3VA 4XLPF 3DD7A 2A6HF 4O7GA 4EBBA 4CIHA 2G62A 1ZU4A 1TWCA 2J9VA 2NUPB 4CS8C 1N1CA 1ZYRF 1ZHZA 4YT2A 3JYHA 2NUTB 4KI2A 4I3MA 5D91A 3KL4A 4RD9A 2I8BA 4EWCA 4CS8A 1TKNA 2R7RA 2CDQA 2L81A 2Z15A 1W2WA 3UGPA 2DYRC 3LEVA 2VH3A 4RDAA 1Z3IX 5CI8A 3AG2C 3T6JA 1OKKA 3N2ZB 4FX5A 2EILC 3UMKA 3NYMA 2J45A 4U5GA 3AG1C 2Q9BA 4KC9A 5D92A 3UMIA 3ZSUA 2OG2A 4X0RA 3T4RA 4PJJA 3GODA 1FTSA 2X51A 4O6MA 3E70C 1TWAA 2ZXRA 1ZHTA 2ZXPA 4JCHA 2WZLA 2YHSA 1VK5A 4PFPA 2J9WA 3VAYA 2L9JA 4G7OF 4YJWA 1O87A 2WVQA 1TWHA 5KYUB 5DLJA 2WZGA 4PFOA 5EGYA 2J0XA 1V55C 1J8YF 4DBQA 5BUOA 4U5HA 1OKKD 5DQZA 3O39A 4JW1A 3OA1A 4LLEA 4BJ5A 4HEAJ 3N0TA 1ST6A 4M63A 3NKDA 2H7VC 4CBEA 4IJJA 4CSAC 1MMGA 1WGWA 1NU7D 3DAGA 4Q5SF 4I1OB 4U5BE 3FHDA 5T3WA 4BJ1A 4DOZA 1BR2A 3EGXB 2E87A 5DVWA 5EHHA 2ZPAA 4C7OB 3JSZA 1FMVA 1ZHYA 4I1MA 2Y3HA 4U5EE 4BJ6C 3LNRA 3O6XA 3L34A 2CNWA 4G0HA 3B0VC 3EPVA 3POVA 2XSEA 3L0IA 1D1BA 3KKBA 4PJNA 3X2QC 3F47A 3RH3A 4YWQA 4W8KA 2KGOA 1ZU5A 3K1HA 3EZHA 3AG4C 4N06A 3GANA 3AQBA 3LESA 1D0YA 3EGDB 4OD5A 4HE8D 3X1OA 5KYYB 4G7ZF 4AE4A 4U5CE 3W2WA 3CSKA 3NDBB 3CZ6A 2P7VA 2W45A 4IAOA 2W9YA 2DGJA 1Z5ZA 2HV6A 4K7BA 4FESA 1D0ZA 2WZFA 3F46A 1RJ9B 2IXPA 4DVZA 3N24A 3EG9A 4LACB 4GEHA 2O9XA 3S28A 4HFKB 4AK9A 1OCZC 1LS1A 4O6NA 5KYXB 2YEVA 3EFOB 3RKOF 3FAJA 4U5DE 1D0XA 4C3DA 3I5PA 4CS9C 5KYWA 2CW0F 1NG1A 3HTKC 1JPNA 3V7OA 2R7SA 2EIMC 3Q6MA 1M2VB 2Y39A 4RBNA 4CS9A 1NU9C 2A1DD 2V3CC 3JCUQ 1Z63A 2VB6A 5F5HA 3ZVRA 4C3EA 3RYLA 2IXMA 4O79A 4ANJA 1S7ZA 5IY5C 3ABMC 2WL8A 2NG1A 4F4BA 2HV7A 2KW3C 3DM9B 4B6IA 4BJ5C 1PCXA 2V26A 2PP4A 1VMAA 3B9QA 4Q7CA 4WJ0A 4P6IC 3CQZA 3UGOA 5DQTA 3EHNA 1LKXA 2OCCC 2XXAB 4PJMA 3AQCA 3B0PA 4QI0A 5DS6A 2W4MA 2Y3BA 1OCRC 2XL4A 1VYIA 3KMIA 3FVYA 4IRUA 4AX2A 1M2OA 2GFHA 3SNHA 3W2VA 2QY9A 3DZAA 3ITFA 1ZHXA 4BEJA 2NUPA 4QI2A 1SZIA 5B3SC 4I44A 2A6EF 2NUTA 4HFFB 2JD3A 3UMHA 4ZLCA 2PFDA 2IOQA 1IW7F 2J7PD 1M57C 3K1IC 3MLGA 3JT1A 3S27A 4U5FE 2QTVA 3TD7A 3UR3C 4DVYP 1QLEC 4XWJA 3SYNA 5E3CA 3EH1A 2G3VA 4O6YA 3HLZA 2R7UA 3EH2A 5B1BC 2C04A 3W8IA 1BR1A 3H65A 4OIPF 5E33A 1MMAA 3ZIBA 3QZCA 4PJLA 2MYSA 1FFTC 2M4EA 2ZXOA 3NRHA 3M1CB 2YZSA 4ZLDA 5KYUA 2W4BA 2R7XA 2Y3DA 1PD0A 2LSEA 3DJNB 1SMYF 1ZHWA 2CGEA 3LAYA 3MX3A 4Q4ZF 1NZEA 3I4UA 2EIKC 1OCOC 4IWBA 1KU2A 4YN0B 3JRTA 2A69F 1JPJA 3AG3C 2ZXWC 2G3KA 3OEOA 3LS1A 3WG7C 1OCCC 4JJGA 3EJNA 1G8XA 2Q3TA 5FCLA 4KNVA 1LVKA 5HSWA 2A68F 4MNDA 3VYWA 2PX0A 3ABLC 4E7SA 1TWGA 3EGXA 4OD4A 3T6BA 3LLKA 3ZG1A 2J46A 1PD1A 1IZMA 4C7OA 2XRHA 4BG0A 4ULWA 2Y69C 3PMRA 2FGYA 5CI9A 4FWVA 3ASOC 3DJUB 4JVSA 1SF8A 3RFYA 2FFHA 4E7ZA 1Z23A 5F5FA 3E9VA 3Q6NA 4OIQF 4KNWA 3I5QA 2J9UA 2KJGA 3FDQA 3EQLF 3K66A 4GYTA 3DM5A 5T1DB 2MWQA 2Q9CA 4J32B 4NY3A 4OIOF 2WVOA 3EGDA 3ZC4A 5E2QA 3NG1A 2J7PA 4LERA 5KYYA 3S0XA 4G7HF 4C3BA 4H4KC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K6B A;  3PMR A;  4RD9 A;  5BUO A;  3QMK A;  4YN0 B;  3NYL A;  3K66 A;  1TKN A;  4RDA A;  3UMK A;  3Q7L A;  3UMH A;  3NYJ A;  3UMI A;  3Q7G A; 
#chains in the Genus database with same CATH topology
 3K6B A;  2NSF A;  4J30 B;  5DS5 A;  3FXH A;  4JTC B;  2Q4F A;  4LLC A;  2LP4 A;  3RVZ A;  2R05 A;  2BE5 F;  1V4A A;  4AE4 B;  4YT8 A;  1GGQ A;  1V54 C;  1V74 B;  2AVK A;  5B1A C;  4OIN F;  4CS7 A;  2R7O A;  4QDL A;  3QMK A;  5BQH A;  1HW2 A;  4MTG A;  2R7T A;  3HJC A;  2LCH A;  3NYJ A;  5E3A A;  4PAC A;  1OR3 A;  2HUJ A;  2XM4 A;  3W8H A;  3VRC A;  4K0D A;  2ETS A;  3WOD F;  3KH2 A;  3SP1 A;  2L6G A;  3NYL A;  1VOM A;  5T3T A;  5AC5 A;  1RJ9 A;  5FZT A;  1M56 C;  3IQ5 A;  1H6G A;  1MNE A;  3LS0 A;  3S29 A;  2KNH A;  3W4Y A;  1UG7 A;  3TUL A;  3AGU A;  1ORY A;  1FNT c;  4N6C A;  4PK4 A;  1U89 A;  2R7Q A;  3IEE A;  1YYJ A;  3EG9 B;  1M6T A;  4NTA A;  1CPQ A;  1K04 A;  1OW7 A;  2B0J A;  3LJB A;  3U2M A;  5JVE A;  5KYX A;  3DWW A;  3DE9 A;  2KK1 A;  3ECS A;  3NKE A;  3EFO A;  2YL0 A;  2Q9A A;  1G4W R;  4DBR A;  3KYI A;  4W8P A;  1A7V A;  1S05 A;  1T6I A;  1MMD A;  1BR4 A;  1I4Y A;  2J9B A;  1CGO A;  3EHM A;  3JYY A;  1QPU A;  1D1A A;  1VLT A;  4OIR F;  3DMD A;  3V5Y A;  5BQI A;  5KYN A;  2A0B A;  2QLA A;  4CSA A;  2KYH A;  2UUH A;  2R7V A;  2Y3G A;  2R25 A;  4BJT A;  1FMW A;  1ZW2 A;  4MQ9 F;  1M2V A;  4A4A A;  3K7D A;  5KYW B;  3K33 A;  2EPO A;  3SEO A;  5JS5 A;  1O5H A;  3OWT A;  2KQ9 A;  4XEV A;  2KC3 A;  2RSE B;  2VC9 A;  5B3I A;  2DYS C;  3RIP A;  1A7E A;  1ZVZ A;  4YT5 A;  1JR8 A;  3DXJ F;  3IPM O;  1FFH A;  2H7O A;  2IXO A;  3MYF A;  1MMN A;  3DE8 A;  4YT4 A;  5JRA A;  3B0U X;  3RW0 A;  2C03 A;  2LK4 A;  2P0N A;  2XL6 A;  1Z6A A;  4XTK A;  3PHF 2;  4BJ6 A;  2GDC A;  4IGG A;  2EIJ C;  2WB7 A;  3SZR A;  2D5R B;  3UNG C;  3AJM A;  1D1C A;  2IXN A;  3ABK C;  3TK0 A;  1QZX A;  1R5I D;  3EZI A;  2J0W A;  4WAB A;  1MQV A;  4KBL A;  4MTF A;  3LLI A;  3DAF A;  4JJF A;  2EIN C;  4WGY A;  1BZ4 A;  3ZQV A;  3NMJ A;  2PX3 A;  2H8A A;  3GM1 A;  2OOC A;  1SR2 A;  3V5X A;  4LDR A;  3AOU A;  1J8M F;  1NBB A;  4MVR A;  2D4U A;  2R03 A;  4DRI B;  2VAS A;  3U9J A;  2R7W A;  5DS4 A;  2XXA A;  2IYL D;  3JZ0 A;  1E2X A;  1I5N A;  2H7B A;  3Q7L A;  1TR2 A;  3L1M A;  4A2N B;  2P6V A;  1CGM E;  3Q7G A;  3ASN C;  5L3Q A;  4EBJ A;  4PR9 A;  2PNO A;  2CNW D;  3T9O A;  3AGT A;  1MND A;  2WVN A;  2B0H A;  2A0U A;  2YQY A;  3S84 A;  1VYK A;  2YLI A;  4H4K C;  2PF4 E;  4JUR I;  4JZA A;  3ZWI A;  4CDA A;  5L3V A;  4XLP F;  1T01 A;  4IAR A;  3DD7 A;  2A6H F;  4O7G A;  2JX0 A;  3SXM A;  3HNK A;  3O55 A;  1L3P A;  2G62 A;  4EBB A;  4CIH A;  1ZU4 A;  1TWC A;  2J9V A;  1YDI A;  1K05 A;  1N1C A;  2NUP B;  3KPH A;  3RQG A;  1KNY A;  2YLG A;  4CS8 C;  1ZYR F;  3VM6 A;  1ZHZ A;  4YT2 A;  2GWW A;  3JYH A;  2HMZ A;  1JRA A;  2NUT B;  4D4X A;  4KI2 A;  4I3M A;  5D91 A;  5L0H A;  2AU5 A;  3KL4 A;  3QTH A;  4RD9 A;  2I8B A;  3TJ6 A;  4EWC A;  3IQ6 A;  4CS8 A;  1TKN A;  3O10 A;  3NMK A;  4MVS A;  2R7R A;  3KYJ A;  1XWJ A;  5L0I A;  3ZTM A;  2YRF A;  1LM3 B;  3FMS A;  2CDQ A;  2L81 A;  2Z15 A;  1W2W A;  4MVM A;  1TFK B;  3UGP A;  2DYR C;  2OEX A;  3SXK A;  4K1O A;  3LEV A;  2VH3 A;  4RDA A;  1TFO B;  1Z3I X;  1RKC A;  5CI8 A;  1FR0 A;  2NPU A;  3AG2 C;  3T6J A;  1OKK A;  3N2Z B;  4FX5 A;  4JEA A;  3G50 A;  1O3U A;  4AL1 A;  2EIL C;  3MBG A;  1T6U A;  3UMK A;  5A6J A;  3NYM A;  2J45 A;  4U5G A;  1JOG A;  1HY5 A;  3A11 A;  2L7A A;  4N6H A;  1AVO B;  3AG1 C;  4NC3 A;  1OR2 A;  2Q9B A;  4KC9 A;  5D92 A;  4P9T A;  3UMI A;  2OG2 A;  2XLV A;  4X0R A;  3T4R A;  3ZSU A;  4PJJ A;  3GOD A;  5COM A;  1FTS A;  1ORJ A;  2X51 A;  4O6M A;  1WWP A;  1TWA A;  2ZXR A;  1ZHT A;  3E70 C;  2ZXP A;  4JCH A;  2WZL A;  2YHS A;  1VK5 A;  1A7D A;  2XLM A;  3TJ5 A;  4PFP A;  2J9W A;  1LIH A;  3VAY A;  1OQC A;  2L9J A;  4P9F A;  4G7O F;  2QE9 A;  2XS8 A;  4YJW A;  2Q7R A;  4CJG A;  1O87 A;  2WVQ A;  4GQH A;  1VB5 A;  1TWH A;  5KYU B;  3ATP A;  5DLJ A;  2WZG A;  4PFO A;  5EGY A;  3J06 A;  1LI5 A;  4JTD B;  4XEK A;  2BL2 A;  1V55 C;  2J0X A;  3R2P A;  2RD9 A;  1J8Y F;  4DBQ A;  5BUO A;  3A9C A;  4U5H A;  1OKK D;  2XM0 A;  2HZ8 A;  5DQZ A;  3O39 A;  4DRH B;  4E18 A;  4JW1 A;  3HNI A;  3OA1 A;  4LLE A;  4BJ5 A;  5EK0 A;  1OXB A;  4HEA J;  1OXK A;  3N0T A;  4CDV A;  1K40 A;  1ST6 A;  4M63 A;  3NKD A;  4H54 A;  1Q0M A;  2H7V C;  3TOM A;  4CBE A;  4IJJ A;  3C8Z A;  4CSA C;  2P61 A;  3BRJ A;  4N4W A;  1MMG A;  1U0B B;  1WGW A;  1XZQ A;  4D4N A;  4JKV A;  4EBK A;  1E83 A;  1NU7 D;  3DAG A;  2VCC A;  4Q5S F;  3C18 A;  3ZDL A;  4I1O B;  4U5B E;  3FHD A;  2HSB A;  5T3W A;  4BJ1 A;  1BBH A;  1L7C A;  4NCQ A;  5BQG A;  4E0H A;  4DOZ A;  1BR2 A;  3EGX B;  2E87 A;  1RKE A;  2HKV A;  2MHR A;  5DVW A;  4DJ9 A;  5EHH A;  3BEH A;  2ZPA A;  5HV9 A;  4C7O B;  3L8I A;  3JSZ A;  2X0C A;  1FMV A;  2LFF A;  1ZHY A;  2HJ3 A;  4MS2 A;  4I1M A;  2Y3H A;  1RMV A;  4U5E E;  2XLH A;  4BJ6 C;  1ZW3 A;  3LNR A;  3L34 A;  3O6X A;  5K0I A;  2CNW A;  4G0H A;  3B0V C;  3EPV A;  1I4Z A;  3POV A;  2I15 A;  2XSE A;  3QVZ A;  3L0I A;  5L0D A;  1D1B A;  3SXY A;  3CAX A;  3HKK A;  3KKB A;  4J7T A;  4PJN A;  2YL1 A;  3X2Q C;  1XZP A;  2OJQ A;  3F47 A;  2EPM X;  3U8V A;  3RH3 A;  4YWQ A;  4W8K A;  2KGO A;  3G4Z A;  1ZU5 A;  3K1H A;  3EZH A;  4LDK A;  1B68 A;  3SYN A;  1YAR O;  3AG4 C;  4N06 A;  3GAN A;  3QW0 A;  2XL8 A;  3AQB A;  3LES A;  1NSG B;  3CEX A;  1D0Y A;  3EGD B;  4YL0 A;  3HNJ A;  4OD5 A;  4HE8 D;  4EHP A;  3X1O A;  1YLM A;  1NLX A;  4MVQ A;  5AGF A;  2GA0 A;  5KYY B;  4G7Z F;  4AE4 A;  3GM2 A;  4U5C E;  4MW8 A;  3W2W A;  3JTL O;  2HS5 A;  1YYX A;  4UDV A;  3FAP B;  3CSK A;  4YK5 A;  2IBF A;  3NDB B;  3CZ6 A;  2P7V A;  1F1M A;  2W45 A;  3B71 A;  3LNM B;  4IAO A;  4J7Y A;  2W9Y A;  1ZZP A;  3M79 A;  1QQ3 A;  1LE2 A;  1Z5Z A;  2DGJ A;  2HV6 A;  3GEE A;  1CPR A;  4K7B A;  2EPL X;  5JUA A;  2ZD9 A;  4FES A;  1D0Z A;  2WZF A;  3F46 A;  4JEB A;  1RJ9 B;  4MVU A;  4LDQ A;  2IXP A;  4DVZ A;  2HSQ A;  3DI5 A;  5JT4 A;  1DOW A;  3N24 A;  3RQE A;  3EG9 A;  1YA7 O;  5L0J A;  4LAC B;  1T5O A;  4GEH A;  2O9X A;  2CCY A;  3S28 A;  3S90 A;  4XPX A;  4HFK B;  2BC5 A;  1YZC A;  4AK9 A;  1OCZ C;  1YAU O;  1LS1 A;  1G4U S;  4O6N A;  5KYX B;  2YLD A;  2YEV A;  4XPW A;  5COF A;  3V5Z A;  3EFO B;  4ULV A;  3RKO F;  1C03 A;  3FAJ A;  3IQC A;  4G78 A;  2IM8 A;  2XLW A;  4U5D E;  3SXZ A;  1D0X A;  4E0I A;  4C3D A;  3I5P A;  2OKU A;  4CS9 C;  1HW1 A;  4JCZ A;  4YL3 A;  2AP3 A;  5A6K A;  1BDJ B;  3C8G B;  2CW0 F;  1NG1 A;  3LEO A;  5F28 E;  5KYW A;  3HTK C;  1JPN A;  3V7O A;  2R7S A;  5A6B A;  1PV3 A;  2EIM C;  4NTB A;  3Q6M A;  1M2V B;  2Y39 A;  1DOV A;  4RBN A;  4JE9 A;  1NU9 C;  4CS9 A;  1T9K A;  1GM5 A;  2A1D D;  2V3C C;  3JCU Q;  1Z63 A;  2VB6 A;  5F5H A;  2F22 A;  4DRJ B;  1E85 A;  3ZTZ A;  3U8P A;  1YZA A;  3U3F A;  5CIV A;  3ZVR A;  2HMQ A;  4C3E A;  3RYL A;  1R4T A;  2IXM A;  2Q00 A;  4O79 A;  4ANJ A;  1S7Z A;  3C7J A;  4JIO A;  2AWC A;  5IY5 C;  3GWL A;  3ABM C;  2WL8 A;  4EIY A;  2NG1 A;  1T6Q A;  4F4B A;  2LQG A;  2HV7 A;  2ICW G;  4IAQ A;  3PDM P;  1Q0D A;  2KW3 C;  3DM9 B;  4B6I A;  4BJ5 C;  3RQF A;  4ER9 A;  1PCX A;  2V26 A;  2OU6 A;  1VMA A;  2PP4 A;  3NMI A;  3U0C A;  3B9Q A;  1Q0G A;  2XS1 A;  3C62 A;  4Q7C A;  5JLI A;  4WJ0 A;  4P6I C;  1WTY A;  1JAF A;  3CQZ A;  3UGO A;  3ZQY A;  1CGN A;  3U5S A;  5DQT A;  5A6B D;  3EHN A;  5L0F A;  4BEM J;  1LKX A;  4Z9J A;  1OW8 A;  2OCC C;  2XXA B;  1Q0F A;  4PJM A;  1NFN A;  3AQC A;  3B0P A;  3B29 A;  4QI0 A;  1APC A;  5DS6 A;  1H9G A;  2W4M A;  1HMO A;  2Y3B A;  1OCR C;  2XL4 A;  1VYI A;  3KMI A;  5JP7 A;  3FVY A;  3GEI A;  3M15 A;  2LIG A;  1LI7 A;  4IRU A;  4AX2 A;  5A6A A;  4MVZ A;  1M2O A;  1GS9 A;  2GFH A;  3SNH A;  3W2V A;  1RXQ A;  2QY9 A;  3DZA A;  2VCA A;  3H2U A;  1GQA A;  3ITF A;  1ZHX A;  4WGZ A;  2NUP A;  3T6G B;  4BEJ A;  5AC4 A;  3MFN A;  4XEF A;  4QI2 A;  1OW6 A;  1SZI A;  5B3S C;  4I44 A;  2A6E F;  1SYQ A;  2NUT A;  4FAP B;  4CIP A;  2LD6 A;  4HFF B;  2JD3 A;  3UMH A;  3FOP A;  4ZLC A;  4U9E A;  1C17 M;  2PFD A;  4L6R A;  2IOQ A;  4XLN F;  2OQM A;  1LS4 A;  1IW7 F;  2J7P D;  1M57 C;  3K1I C;  3U3B A;  3MLG A;  3JT1 A;  3U9M A;  3S27 A;  4U5F E;  3US6 A;  2QTV A;  2PBE A;  1TQG A;  3TD7 A;  2J8W A;  2HJM A;  3UR3 C;  3M4C A;  1Y4C A;  4Z9I A;  1VLS A;  4DVY P;  1QLE C;  3GEH A;  3K1I A;  4XWJ A;  5E3C A;  1QKR A;  2G3V A;  1JMW A;  3C8G A;  2KSF A;  3EH1 A;  3FOO A;  5JSL A;  2M64 A;  3HNL A;  4O6Y A;  2YVK A;  1LPE A;  3HLZ A;  5A69 A;  2R7U A;  3EH2 A;  5B1B C;  3WHN A;  4BPM A;  1WN0 A;  1YVI A;  2C04 A;  4U9D A;  3W8I A;  1BR1 A;  1WOL A;  3H65 A;  3RVY A;  3VF0 A;  4R32 A;  3L8J A;  4OIP F;  3QVY A;  5E33 A;  1MMA A;  3ZIB A;  3QZC A;  4JTA B;  5L0C A;  3U2L A;  4PJL A;  2MYS A;  1E86 A;  2QNL A;  1FFT C;  2HFI A;  3WAQ A;  3IHU A;  2M4E A;  2ZXO A;  2CYD A;  2DB4 A;  2OEV A;  2UUI A;  3NRH A;  2OJE D;  3S9O A;  2ASR A;  3M1C B;  3MYI A;  1A0B A;  2YZS A;  4ZLD A;  3RF3 A;  5KYU A;  2W4B A;  2R7X A;  1ORS C;  256B A;  2Y3D A;  1PD0 A;  2LSE A;  1AUE A;  1SMY F;  2R02 A;  1ZHW A;  3DJN B;  2CGE A;  3LAY A;  3MX3 A;  1H9T A;  2P1A A;  4MVO A;  3IQT A;  1NZE A;  3I4U A;  4Q4Z F;  2EIK C;  1NFO A;  1OCO C;  4IWB A;  3QW1 A;  2EPN A;  3C8G D;  2L6H A;  1KU2 A;  4YN0 B;  3GOR A;  1H7I A;  3JRT A;  2A69 F;  4NTF A;  5COG A;  2XLE A;  3TQO A;  2QUP A;  4ONS A;  3DKA A;  4CX9 A;  1JPJ A;  2YL3 A;  3AG3 C;  1A41 A;  2G3K A;  2ZXW C;  1HMD A;  3OEO A;  3LS1 A;  4DXW A;  1YJG A;  1G5Z A;  1E84 A;  1EI7 A;  3GM3 A;  3WG7 C;  2AWY A;  1EQ1 A;  1OCC C;  4JJG A;  3EJN A;  1G8X A;  2Q3T A;  5FCL A;  4KNV A;  1LVK A;  3LUT B;  4JC7 A;  2GAQ A;  2XLO A;  5HSW A;  4Z9H A;  2A68 F;  4MND A;  3VYW A;  4G7H F;  2PX0 A;  1EKY A;  3ABL C;  1U6H A;  1Q0K A;  2YWA A;  4E7S A;  1TWG A;  3EGX A;  4CDY A;  4OD4 A;  2NSG A;  3LLK A;  3T6B A;  3ZG1 A;  1RCP A;  2TMV P;  2J46 A;  1PD1 A;  1IZM A;  2LFD A;  2XRH A;  4MW3 A;  4BG0 A;  4C7O A;  1RKE B;  2R9R B;  1HE1 A;  4ULW A;  2Y69 C;  3PMR A;  1FAP B;  2FGY A;  3G4X A;  1AEP A;  5CI9 A;  4FWV A;  3ASO C;  3DJU B;  4JVS A;  1SF8 A;  3M4B A;  4XQ1 A;  3H2V A;  3RFY A;  3TOL A;  2FFH A;  3R7C A;  3C63 A;  4CJO A;  4EKW A;  4XPY A;  5TJ5 E;  2DI3 A;  1Z23 A;  4NQF A;  4E7Z A;  2FAP B;  2YL7 A;  4IB4 A;  2JPU A;  5F5F A;  3E9V A;  3PCV A;  3GWN A;  3Q6N A;  4OIQ F;  1QSP A;  4KNW A;  1QVX A;  1Y6D A;  3I5Q A;  3JSE O;  2EPK X;  4E17 A;  1VTM P;  2J9U A;  1YA9 A;  4EUK B;  2KJG A;  1KTM A;  1EA8 A;  3FDQ A;  5L0G A;  3EQL F;  3K66 A;  1WAS A;  2VCB A;  3DM5 A;  4GYT A;  5T1D B;  1UFB A;  2MWQ A;  2Q9C A;  4J32 B;  1WAT A;  4NY3 A;  5GPG B;  1C02 A;  2WVO A;  3EGD A;  4JRZ A;  1Z7Q c;  3ZC4 A;  4OIO F;  2XLD A;  5E2Q A;  2L6F A;  1HE9 A;  2J7P A;  1LE4 A;  3NG1 A;  3JRM O;  4LER A;  4AL0 A;  4YL1 A;  5KYY A;  3S0X A;  4MTO A;  4C3B A;  2YKZ A; 
#chains in the Genus database with same CATH homology
 3K6B A;  5DS5 A;  4J30 B;  4LLC A;  2BE5 F;  4AE4 B;  4YT8 A;  1V54 C;  5B1A C;  2R7T A;  4OIN F;  4CS7 A;  2R7O A;  4QDL A;  3QMK A;  3HJC A;  3NYJ A;  5E3A A;  3W8H A;  4K0D A;  3WOD F;  3KH2 A;  3SP1 A;  3NYL A;  1VOM A;  5T3T A;  1RJ9 A;  1M56 C;  1MNE A;  3LS0 A;  3S29 A;  2KNH A;  4PK4 A;  2R7Q A;  3IEE A;  3EG9 B;  3LJB A;  2B0J A;  5KYX A;  3ECS A;  3NKE A;  3EFO A;  2Q9A A;  4DBR A;  4XLN F;  1MMD A;  1BR4 A;  3EHM A;  4OIR F;  1D1A A;  3DMD A;  5KYN A;  4CSA A;  2R7V A;  2Y3G A;  4BJT A;  1FMW A;  4MQ9 F;  1M2V A;  3K7D A;  5KYW B;  3K33 A;  3SEO A;  1O5H A;  3OWT A;  2KQ9 A;  2DYS C;  3RIP A;  4YT5 A;  3DXJ F;  1FFH A;  2H7O A;  2IXO A;  1MMN A;  4YT4 A;  3B0U X;  2C03 A;  4XTK A;  1Z6A A;  3PHF 2;  4BJ6 A;  2EIJ C;  2WB7 A;  3SZR A;  2D5R B;  3UNG C;  1D1C A;  2IXN A;  3ABK C;  1QZX A;  3EZI A;  2J0W A;  4KBL A;  3LLI A;  3DAF A;  4JJF A;  2EIN C;  2PX3 A;  1J8M F;  2VAS A;  2R7W A;  5DS4 A;  2XXA A;  2IYL D;  2H7B A;  3Q7L A;  1TR2 A;  4A2N B;  2P6V A;  3Q7G A;  3ASN C;  5L3Q A;  2CNW D;  1MND A;  2WVN A;  1VYK A;  2PF4 E;  4JUR I;  4JZA A;  5L3V A;  4XLP F;  3DD7 A;  2A6H F;  4O7G A;  4EBB A;  4CIH A;  2G62 A;  1ZU4 A;  1TWC A;  2J9V A;  2NUP B;  4CS8 C;  1N1C A;  1ZYR F;  1ZHZ A;  4YT2 A;  3JYH A;  2NUT B;  4KI2 A;  4I3M A;  5D91 A;  3KL4 A;  4RD9 A;  2I8B A;  4EWC A;  4CS8 A;  1TKN A;  2R7R A;  2CDQ A;  2L81 A;  2Z15 A;  1W2W A;  3UGP A;  2DYR C;  3LEV A;  2VH3 A;  4RDA A;  1Z3I X;  5CI8 A;  3AG2 C;  3T6J A;  1OKK A;  3N2Z B;  4FX5 A;  2EIL C;  3UMK A;  3NYM A;  2J45 A;  4U5G A;  3AG1 C;  2Q9B A;  4KC9 A;  5D92 A;  3UMI A;  3ZSU A;  2OG2 A;  4X0R A;  3T4R A;  4PJJ A;  3GOD A;  1FTS A;  2X51 A;  4O6M A;  3E70 C;  1TWA A;  2ZXR A;  1ZHT A;  2ZXP A;  4JCH A;  2WZL A;  2YHS A;  1VK5 A;  4PFP A;  2J9W A;  3VAY A;  2L9J A;  4G7O F;  4YJW A;  1O87 A;  2WVQ A;  1TWH A;  5KYU B;  5DLJ A;  2WZG A;  4PFO A;  5EGY A;  2J0X A;  1V55 C;  1J8Y F;  4DBQ A;  5BUO A;  4U5H A;  1OKK D;  5DQZ A;  3O39 A;  4JW1 A;  3OA1 A;  4LLE A;  4BJ5 A;  4HEA J;  3N0T A;  1ST6 A;  4M63 A;  3NKD A;  2H7V C;  4CBE A;  4IJJ A;  4CSA C;  1MMG A;  1WGW A;  1NU7 D;  3DAG A;  4Q5S F;  4I1O B;  4U5B E;  3FHD A;  5T3W A;  4BJ1 A;  4DOZ A;  1BR2 A;  3EGX B;  2E87 A;  5DVW A;  5EHH A;  2ZPA A;  4C7O B;  3JSZ A;  1FMV A;  1ZHY A;  4I1M A;  2Y3H A;  4U5E E;  4BJ6 C;  3LNR A;  3O6X A;  3L34 A;  2CNW A;  4G0H A;  3B0V C;  3EPV A;  3POV A;  2XSE A;  3L0I A;  1D1B A;  3KKB A;  4PJN A;  3X2Q C;  3F47 A;  3RH3 A;  4YWQ A;  4W8K A;  2KGO A;  1ZU5 A;  3K1H A;  3EZH A;  3AG4 C;  4N06 A;  3GAN A;  3AQB A;  3LES A;  1D0Y A;  3EGD B;  4OD5 A;  4HE8 D;  3X1O A;  5KYY B;  4G7Z F;  4AE4 A;  4U5C E;  3W2W A;  3CSK A;  3NDB B;  3CZ6 A;  2P7V A;  2W45 A;  4IAO A;  2W9Y A;  2DGJ A;  1Z5Z A;  2HV6 A;  4K7B A;  4FES A;  1D0Z A;  2WZF A;  3F46 A;  1RJ9 B;  2IXP A;  4DVZ A;  3N24 A;  3EG9 A;  4LAC B;  4GEH A;  2O9X A;  3S28 A;  4HFK B;  4AK9 A;  1OCZ C;  1LS1 A;  4O6N A;  5KYX B;  2YEV A;  3EFO B;  3RKO F;  3FAJ A;  4U5D E;  1D0X A;  4C3D A;  3I5P A;  4CS9 C;  5KYW A;  2CW0 F;  1NG1 A;  3HTK C;  1JPN A;  3V7O A;  2R7S A;  2EIM C;  3Q6M A;  1M2V B;  2Y39 A;  4RBN A;  4CS9 A;  1NU9 C;  2A1D D;  2V3C C;  3JCU Q;  1Z63 A;  2VB6 A;  5F5H A;  3ZVR A;  4C3E A;  3RYL A;  2IXM A;  4O79 A;  4ANJ A;  1S7Z A;  5IY5 C;  3ABM C;  2WL8 A;  2NG1 A;  4F4B A;  2HV7 A;  2KW3 C;  3DM9 B;  4B6I A;  4BJ5 C;  1PCX A;  2V26 A;  2PP4 A;  1VMA A;  3B9Q A;  4Q7C A;  4WJ0 A;  4P6I C;  3CQZ A;  3UGO A;  5DQT A;  3EHN A;  1LKX A;  2OCC C;  2XXA B;  4PJM A;  3AQC A;  3B0P A;  4QI0 A;  5DS6 A;  2W4M A;  2Y3B A;  1OCR C;  2XL4 A;  1VYI A;  3KMI A;  3FVY A;  4IRU A;  4AX2 A;  1M2O A;  2GFH A;  3SNH A;  3W2V A;  2QY9 A;  3DZA A;  3ITF A;  1ZHX A;  4BEJ A;  2NUP A;  4QI2 A;  1SZI A;  5B3S C;  4I44 A;  2A6E F;  2NUT A;  4HFF B;  2JD3 A;  3UMH A;  4ZLC A;  2PFD A;  2IOQ A;  1IW7 F;  2J7P D;  1M57 C;  3K1I C;  3MLG A;  3JT1 A;  3S27 A;  4U5F E;  2QTV A;  3TD7 A;  3UR3 C;  4DVY P;  1QLE C;  4XWJ A;  3SYN A;  5E3C A;  3EH1 A;  2G3V A;  4O6Y A;  3HLZ A;  2R7U A;  3EH2 A;  5B1B C;  2C04 A;  3W8I A;  1BR1 A;  3H65 A;  4OIP F;  5E33 A;  1MMA A;  3ZIB A;  3QZC A;  4PJL A;  2MYS A;  1FFT C;  2M4E A;  2ZXO A;  3NRH A;  3M1C B;  2YZS A;  4ZLD A;  5KYU A;  2W4B A;  2R7X A;  2Y3D A;  1PD0 A;  2LSE A;  3DJN B;  1SMY F;  1ZHW A;  2CGE A;  3LAY A;  3MX3 A;  4Q4Z F;  1NZE A;  3I4U A;  2EIK C;  1OCO C;  4IWB A;  1KU2 A;  4YN0 B;  3JRT A;  2A69 F;  1JPJ A;  3AG3 C;  2ZXW C;  2G3K A;  3OEO A;  3LS1 A;  3WG7 C;  1OCC C;  4JJG A;  3EJN A;  1G8X A;  2Q3T A;  5FCL A;  4KNV A;  1LVK A;  5HSW A;  2A68 F;  4MND A;  3VYW A;  2PX0 A;  3ABL C;  4E7S A;  1TWG A;  3EGX A;  4OD4 A;  3T6B A;  3LLK A;  3ZG1 A;  2J46 A;  1PD1 A;  1IZM A;  4C7O A;  2XRH A;  4BG0 A;  4ULW A;  2Y69 C;  3PMR A;  2FGY A;  5CI9 A;  4FWV A;  3ASO C;  3DJU B;  4JVS A;  1SF8 A;  3RFY A;  2FFH A;  4E7Z A;  1Z23 A;  5F5F A;  3E9V A;  3Q6N A;  4OIQ F;  4KNW A;  3I5Q A;  2J9U A;  2KJG A;  3FDQ A;  3EQL F;  3K66 A;  4GYT A;  3DM5 A;  5T1D B;  2MWQ A;  2Q9C A;  4J32 B;  4NY3 A;  4OIO F;  2WVO A;  3EGD A;  3ZC4 A;  5E2Q A;  3NG1 A;  2J7P A;  4LER A;  5KYY A;  3S0X A;  4G7H F;  4C3B A;  4H4K C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...