3NYJA

Crystal structure analysis of app e2 domain
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
181
structure length
181
Chain Sequence
LETPGDENEHAHFQKAKERLEAKHRERMSQVMREWEEAERQAKNLPKADKKAVIQHFQEKVESLEQEAANERQQLVETHMARVEAMLNDRRRLALENYITALQAVPPRPRHVFNMLKKYVRAEQKDRQHTLKHFEHVRMVDPKKAAQIRSQVMTHLRVIYERMNQSLSLLYNVPAVAEEIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Amyloid beta A4 protein
publication title The E2 Domains of APP and APLP1 Share a Conserved Mode of Dimerization.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein fibril
total genus 56
structure length 181
sequence length 181
ec nomenclature
pdb deposition date 2010-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12925 APP_E2 E2 domain of amyloid precursor protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.770 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3nyjA00
3QMKA 5BUOA 3UMHA 4RD9A 3UMIA 3K6BA 3NYJA 3K66A 3Q7GA 4YN0B 3Q7LA 4RDAA 3PMRA 3UMKA 1TKNA 3NYLA
chains in the Genus database with same CATH superfamily
4Z9IA 2OKUA 1WOLA 4BJ1A 2XLEA 4EBBA 1YYJA 2LSEA 3B71A 3O55A 1HE9A 1L7CA 4E0HA 1SZIA 3E70C 4HEAJ 2ETSA 1M2OA 5L0HA 4U5DE 2EIKC 2QUPA 5COFA 3ZWIA 3CSKA 4BEJA 3QZCA 1FMVA 3TULA 1JAFA 1BDJB 2PBEA 1KNYA 3KPHA 1DOVA 3W8HA 3RW0A 3JSZA 5AGFA 2Y3BA 2Q4FA 3B29A 4WGZA 3L34A 5AC5A 1AVOB 3MFNA 3R7CA 2OG2A 1E2XA 3AOUA 2ZD9A 3UMKA 2D5RB 4Q7CA 2YL1A 3NRHA 1APCA 3W2WA 5DQTA 5A6AA 5KYWA 3B0UX 4EIYA 1NFOA 5L3VA 3SXMA 2J7PD 3WAQA 2XXAA 1RKCA 1MNDA 1G4WR 3NKDA 2NUTA 4I1MA 3UNGC 3S28A 2AWYA 1QQ3A 2W4BA 1EKYA 1T5OA 4N6HA 4EUKB 4YT2A 4XWJA 4XPYA 2XLMA 4M63A 3JSEO 4RD9A 1NZEA 2KC3A 2H8AA 5JLIA 2R7WA 2KQ9A 2R9RB 3GANA 4ZLDA 1OW8A 1O3UA 2L7AA 3MYIA 1YA9A 3L0IA 4JTCB 5FCLA 1U6HA 2P7VA 1VLTA 5E2QA 2LFFA 3NYJA 2HMQA 2HZ8A 2Y69C 2R7QA 4JZAA 2DYSC 2L81A 3IPMO 3S29A 4NC3A 1RJ9B 1Y4CA 2KK1A 2XLVA 3K33A 1MMDA 1TWAA 2L6GA 2DI3A 4YN0B 1LI7A 4K7BA 4U5EE 5T3TA 1C03A 1Q0DA 5E3CA 3U9JA 1SR2A 3ECSA 3HLZA 5L0JA 2KNHA 5JVEA 4OIOF 1FAPB 4CDYA 2R7TA 3K1IC 3QW0A 3OA1A 4OIRF 3RVYA 4C3EA 3HNJA 2Y3HA 2BE5F 3FHDA 1SMYF 2XL4A 4JKVA 1I4YA 2J9BA 2R7OA 1MMGA 2EINC 2C03A 3K1IA 4XPXA 1H7IA 5EGYA 5KYUB 3QW1A 2RSEB 3HTKC 2HUJA 2G3KA 2P61A 2JX0A 5GPGB 3GODA 4O6NA 4MTGA 3B0VC 4BJ5C 3TK0A 4IJJA 3LNRA 3IQ5A 2XS8A 3ASOC 5F5FA 2R25A 3EQLF 2HSQA 3UR3C 2QY9A 4GEHA 4QDLA 4IAQA 2EPOA 4CSAA 2IXMA 1Z63A 2CCYA 5DS6A 4G0HA 1YZCA 1JMWA 1V74B 1OCZC 4OD4A 3NMIA 1I4ZA 3BEHA 3QMKA 1AEPA 2IXNA 1QPUA 4JCHA 4EBJA 2YLGA 2LFDA 4PJMA 3S84A 1H9TA 1JPNA 1N1CA 3C18A 3ABMC 3ATPA 2Y39A 2OOCA 4Q5SF 4IRUA 1GS9A 2YVKA 3HKKA 3PHF2 4E0IA 3RQGA 4B6IA 4A2NB 1L3PA 2HJ3A 3EHMA 3FOPA 1OW7A 3DM9B 3S90A 2M4EA 5L0GA 3LLKA 2OCCC 4CS9C 5F5HA 1BR2A 1JRAA 2ZPAA 3L8JA 1D0XA 2JPUA 4CS9A 2ZXPA 2EIJC 3LUTB 2NG1A 3EFOA 1LI5A 3ASNC 2AWCA 3EGXA 3X2QC 2QE9A 4JEAA 1G5ZA 5CIVA 2EPMX 3VRCA 3FXHA 4MVUA 1VK5A 4N06A 1B68A 3VYWA 5KYWB 4JE9A 2TMVP 3MLGA 1MQVA 1UG7A 4MVMA 3ZSUA 2PF4E 5DVWA 2R7XA 2NUTB 3EG9A 2EPLX 2LCHA 2HFIA 4CDAA 4CS8C 4C7OA 3M79A 2G3VA 2LP4A 3DE8A 3Q6MA 5A69A 2HSBA 4MVRA 1Z7Qc 1OCOC 4P9TA 4CS8A 1ZHWA 2XL6A 1VMAA 5IY5C 2HV7A 2R7RA 5JS5A 3H65A 4JTDB 1D0YA 3O10A 4PJNA 2XLWA 2L9JA 4RDAA 4CS7A 1TKNA 4G7OF 3FMSA 3QVZA 3TOLA 5A6JA 3AG4C 4MTOA 4XPWA 4MW3A 3K1HA 2H7OA 1CPRA 3WODF 3V7OA 3U9MA 3TJ5A 3WHNA 2Y3GA 4Q4ZF 2CNWA 2WL8A 3GEIA 3IQTA 4DXWA 3H2VA 2VASA 2QLAA 1MMNA 2YLIA 2YRFA 1YJGA 2R03A 3DXJF 4FX5A 1CGME 2MHRA 3M4BA 3L8IA 4U9EA 5DS4A 1RMVA 4YL1A 2L6FA 2HS5A 2IXOA 1XZPA 1Y6DA 4KC9A 3EGDA 2B0JA 3SYNA 3AQBA 1WN0A 2ASRA 2KJGA 4E7SA 4P9FA 2XLDA 3AG3C 3K66A 4LERA 4LACB 4C3BA 4U5FE 5B1AC 4H54A 1E85A 3B9QA 1R5ID 4X0RA 1WATA 4CJOA 4DRHB 3LAYA 1YVIA 3Q7LA 3CQZA 256BA 4ULWA 2VCBA 2DB4A 2OQMA 3G4XA 5BUOA 5E33A 1TR2A 2IYLD 2UUIA 5L3QA 1EQ1A 4WJ0A 4XLPF 1H9GA 2PFDA 1G4US 3QVYA 4PK4A 2HMZA 3AGTA 1HW2A 1ZHXA 2IOQA 1HMOA 2A6HF 2XS1A 3T9OA 2R05A 2HV6A 5L0IA 1VB5A 1FFTC 1F1MA 3DI5A 4DBRA 4JJFA 2J46A 1NG1A 1H6GA 4DJ9A 1BR1A 4MW8A 3JCUQ 1HW1A 1D1AA 2YZSA 5JT4A 3JYYA 2BL2A 1M2VA 3KL4A 3OEOA 4EWCA 5A6BD 1ZU4A 1VTMP 1J8YF 1V4AA 4YT4A 5JUAA 3F47A 2A1DD 4MVZA 3C62A 1FTSA 3I4UA 4BJ6A 5A6KA 3S27A 1K05A 4R32A 1E84A 4BJTA 4JTAB 3SXYA 1IW7F 2YHSA 5DLJA 2W9YA 1O87A 2E87A 4E7ZA 1LE2A 1Z5ZA 3C8GB 3K6BA 3LLIA 3I5QA 1QVXA 4JJGA 3G4ZA 5COGA 1A0BA 3TOMA 2Q9CA 4AE4A 1M56C 4AK9A 3PMRA 3CEXA 3JYHA 3ZTZA 4NTFA 1A7EA 4I44A 1YZAA 4XLNF 2W4MA 4AX2A 4N6CA 1NU7D 4NTBA 1WWPA 4LLEA 1T6IA 1ZHYA 2VB6A 5KYYA 2W45A 2XSEA 3O6XA 3EG9B 3EJNA 4H4KC 1OW6A 5T1DB 4CSAC 4J32B 1ZW3A 5EK0A 3A11A 1T01A 1DOWA 4FAPB 3PDMP 3RH3A 1YYXA 2P1AA 5JSLA 2A68F 1RCPA 2GAQA 2Y3DA 3ZQYA 1W2WA 3FVYA 1QKRA 1R4TA 3VM6A 3HNIA 4J7TA 1XZQA 4JW1A 2NSGA 3KYJA 5KYNA 5DQZA 4PR9A 3GWLA 3AG2C 3N0TA 5CI8A 1ST6A 5K0IA 2YWAA 3JRTA 2OU6A 2WB7A 2LIGA 1A7VA 3U5SA 4D4NA 3ITFA 4QI2A 2XLOA 2PX3A 2CW0F 4JEBA 2R7UA 4DVZA 4L6RA 1C02A 4EKWA 4HFFB 3MX3A 4U5HA 2EIMC 2J7PA 1T9KA 2DGJA 4CBEA 2VC9A 3JRMO 1LS1A 1MNEA 1G8XA 2R02A 2EPNA 3AQCA 2IM8A 2ZXRA 4PFOA 2M64A 2Q3TA 1TFKB 4PACA 1ZW2A 3KMIA 4IARA 4MTFA 3T6GB 3A9CA 4NTAA 2GWWA 2H7BA 3GM1A 3CAXA 3RQEA 2J0XA 4YT8A 3EGDB 5COMA 2PP4A 1LPEA 3FAPB 2DYRC 3MYFA 5B3SC 1E86A 1C17M 5JRAA 3RIPA 2KGOA 1ZHTA 4CIPA 4K0DA 3AG1C 3VF0A 1AUEA 3EH1A 4CDVA 1I5NA 3FOOA 3LEVA 2A6EF 3FAJA 4D4XA 4J30B 5TJ5E 3GEHA 2YL0A 4WGYA 5L0DA 2XXAB 3JT1A 4LLCA 3SNHA 2YL7A 4W8PA 4YT5A 2IBFA 4OD5A 3POVA 1OQCA 1V55C 3RFYA 1OCRC 3WG7C 3ZIBA 2CDQA 2EPKX 3NG1A 1LKXA 3ABKC 2ZXWC 2Z15A 1PCXA 4MVOA 1UFBA 3FDQA 1QSPA 3V5ZA 4XEFA 4JCZA 1PV3A 4K1OA 2GA0A 2J0WA 4KI2A 2HKVA 1WASA 1T6UA 1Z6AA 1M57C 4PFPA 4OINF 4MNDA 1GM5A 3DMDA 4U9DA 5KYUA 4HFKB 2VH3A 1HY5A 2YQYA 1VYIA 2CGEA 3LJBA 5JP7A 2V3CC 2MWQA 2VCAA 4O6MA 3DJUB 3DM5A 1ORSC 2F22A 3NYLA 2YEVA 1Q0KA 1PD0A 3EH2A 3E9VA 3NKEA 2KSFA 3KKBA 5B3IA 1RKEA 1TQGA 1VYKA 2AU5A 2EILC 2BC5A 1PD1A 3HNLA 1ZU5A 1XWJA 2J9WA 3HNKA 3IQ6A 3O39A 4IGGA 3N2ZB 3SEOA 1VOMA 2PNOA 5CI9A 4YJWA 1HMDA 3EPVA 3RF3A 2LQGA 3US6A 4ANJA 4BG0A 4O79A 4DRJB 2KYHA 2IXPA 4QI0A 3LS1A 5KYYB 4OIPF 2QNLA 5F28E 3GM3A 4JURI 4RBNA 2YLDA 4GYTA 1RXQA 3U0CA 3GWNA 5B1BC 5KYXA 3KH2A 3T6BA 4O7GA 3U8PA 3H2UA 4HE8D 4IAOA 1LM3B 3IHUA 3JTLO 1OKKD 3K7DA 2NUPA 1A41A 3EZHA 1JR8A 3TJ6A 2KW3C 3AJMA 4U5CE 3C63A 2X0CA 4ER9A 1OR3A 1ORJA 1CPQA 4CJGA 1LS4A 1Z3IX 1OXKA 2QTVA 3HJCA 3JZ0A 3X1OA 2NSFA 4G78A 2GFHA 2I8BA 3NMJA 1ZYRF 2MYSA 4E18A 1YAUO 1J8MF 3S0XA 1BZ4A 2WZGA 3DWWA 4U5BE 3UMHA 4BJ6C 1JOGA 4LDRA 3UMIA 2XRHA 3AGUA 3F46A 3GEEA 3SP1A 5BQIA 1NFNA 4N4WA 1QLEC 4DVYP 1FFHA 3KYIA 4NCQA 1D0ZA 3EZIA 1Q0MA 5L0FA 3EFOB 4AL0A 3EGXB 1ZHZA 4EHPA 1SF8A 1ZZPA 4UDVA 1BBHA 2A69F 4LDQA 2FAPB 1EI7A 2WVQA 3RKOF 3C8GD 3NMKA 4ONSA 3IEEA 2ICWG 3T4RA 4G7HF 5L0CA 1Z23A 1YA7O 3SXZA 5FZTA 3BRJA 1D1CA 1JPJA 1LIHA 1NU9C 2PX0A 1NBBA 2VCCA 3T6JA 1GGQA 3QTHA 1OCCC 2C04A 4JRZA 4XQ1A 4U5GA 4C7OB 4ZLCA 2L6HA 4WABA 3RVZA 1FR0A 3C7JA 1K04A 3EHNA 2WZLA 2J8WA 1FMWA 4MVSA 2J9VA 4YL0A 4MS2A 2Q7RA 2B0HA 2I15A 1M6TA 2ZXOA 3I5PA 1CGNA 1QZXA 4KNVA 2RD9A 5AC4A 5D92A 4ULVA 3SZRA 4DOZA 1KTMA 1U89A 3ZVRA 3W8IA 3LNMB 2R7SA 1OXBA 4E17A 2XM0A 2FFHA 3NDBB 3CZ6A 2NPUA 2WVNA 4KNWA 3U3FA 4BPMA 2H7VC 4DBQA 2WVOA 2CNWD 3RYLA 2D4UA 1ORYA 3DAFA 1OKKA 1RKEB 1LVKA 2J9UA 2V26A 3ZG1A 1YLMA 4BJ5A 2OJED 2X51A 3C8ZA 2AP3A 3N24A 2CYDA 3Q7GA 4JC7A 3ZC4A 4P6IC 4EBKA 2JD3A 1K40A 2LD6A 5EHHA 2YL3A 3TQOA 4AL1A 3UGPA 3U8VA 3V5YA 5DS5A 1GQAA 2FGYA 2YKZA 4NQFA 2AVKA 4PJLA 3NYMA 2HJMA 4O6YA 2OEXA 3Q6NA 4G7ZF 4BEMJ 3GM2A 4W8KA 4XEKA 3W4YA 5A6BA 2Q00A 5E3AA 1V54C 4XTKA 5BQGA 1E83A 4FWVA 4A4AA 2WZFA 3U3BA 1BR4A 2A0UA 4DRIB 5KYXB 3ZTMA 2GDCA 1NLXA 3M4CA 4MVQA 1TWGA 2P0NA 1OR2A 4IWBA 1RJ9A 3OWTA 1S05A 4YWQA 2NUPB 3DE9A 5BQHA 4XEVA 4J7YA 4I1OB 4C3DA 3GORA 1CGOA 4PJJA 4YL3A 5T3WA 3U2MA 5HV9A 4I3MA 2P6VA 3DAGA 3C8GA 1TFOB 3LESA 3ABLC 5D91A 1IZMA 1KU2A 3DZAA 3LEOA 4MQ9F 3RQFA 1D1BA 3LS0A 1T6QA 3TD7A 1FNTc 4OIQF 1U0BB 3M1CB 2LK4A 2O9XA 1O5HA 3UGOA 3W2VA 3R2PA 1YARO 1ZVZA 4YK5A 2XM4A 1Q0FA 2UUHA 1MMAA 3DJNB 3IQCA 4IB4A 3V5XA 1M2VB 1WGWA 4FESA 3L1MA 3U2LA 3VAYA 1TWHA 1A7DA 1NSGB 2R7VA 1LE4A 3DD7A 3MBGA 4NY3A 3SXKA 2Q9AA 1SYQA 1TWCA 3DKAA 3G50A 4LDKA 1VLSA 3M15A 4Z9HA 1HE1A 3ZDLA 4GQHA 2G62A 4JIOA 3B0PA 3ZQVA 1S7ZA 1EA8A 4CIHA 2A0BA 1YDIA 3PCVA 2Q9BA 2OEVA 3S9OA 1Q0GA 2OJQA 4Z9JA 2J45A 4AE4B 2XLHA 3J06A 2XL8A 4CX9A 4JVSA 4F4BA 4KBLA 1WTYA 5HSWA
chains in the Genus database with same CATH topology
4BJ1A 4EBBA 2LSEA 1SZIA 3E70C 4HEAJ 1M2OA 4U5DE 2EIKC 3CSKA 4BEJA 3QZCA 1FMVA 3W8HA 3JSZA 2Y3BA 3L34A 2OG2A 3UMKA 2D5RB 4Q7CA 3NRHA 3W2WA 5DQTA 5KYWA 3B0UX 5L3VA 2J7PD 2XXAA 1MNDA 3NKDA 2NUTA 4I1MA 3UNGC 3S28A 2W4BA 4YT2A 4XWJA 4M63A 4RD9A 1NZEA 2R7WA 2KQ9A 3GANA 4ZLDA 3L0IA 5FCLA 2P7VA 5E2QA 3NYJA 2Y69C 2R7QA 4JZAA 2DYSC 2L81A 3S29A 1RJ9B 3K33A 1MMDA 1TWAA 4YN0B 4A2NB 4U5EE 4K7BA 5T3TA 5E3CA 3ECSA 3HLZA 2KNHA 2R7TA 4OIOF 3K1IC 4C3EA 3OA1A 4OIRF 2Y3HA 2BE5F 3FHDA 1SMYF 2XL4A 2R7OA 1MMGA 2EINC 2C03A 5EGYA 5KYUB 3HTKC 2G3KA 3GODA 4O6NA 3B0VC 4BJ5C 4IJJA 3LNRA 5F5FA 3ASOC 3EQLF 3UR3C 2QY9A 4GEHA 4QDLA 4CSAA 2IXMA 1Z63A 5DS6A 4G0HA 4OD4A 1OCZC 3QMKA 2IXNA 4JCHA 4PJMA 1JPNA 1N1CA 3ABMC 2Y39A 4Q5SF 4IRUA 3PHF2 4B6IA 3EHMA 3DM9B 2M4EA 3LLKA 2OCCC 4CS9C 5F5HA 1BR2A 2ZPAA 1D0XA 2ZXPA 2EIJC 2NG1A 3EFOA 3ASNC 3EGXA 3X2QC 1VK5A 4N06A 3VYWA 5KYWB 3MLGA 3ZSUA 2PF4E 5DVWA 2R7XA 2NUTB 3EG9A 4CS8C 4C7OA 3Q6MA 2G3VA 1OCOC 4CS8A 1ZHWA 5IY5C 1VMAA 2R7RA 2HV7A 3H65A 4PJNA 1D0YA 4RDAA 4G7OF 2L9JA 4CS7A 1TKNA 3AG4C 3K1HA 2H7OA 3WODF 3V7OA 2Y3GA 4Q4ZF 2CNWA 2WL8A 2VASA 1MMNA 3DXJF 4FX5A 5DS4A 2IXOA 4KC9A 3EGDA 2B0JA 3SYNA 3AQBA 2KJGA 4E7SA 3AG3C 3K66A 4LERA 4LACB 4C3BA 4U5FE 5B1AC 3B9QA 4X0RA 3LAYA 3Q7LA 3CQZA 4ULWA 5BUOA 5L3QA 5E33A 1TR2A 2IYLD 4WJ0A 4XLPF 2PFDA 4PK4A 1ZHXA 2IOQA 2A6HF 2HV6A 1FFTC 4DBRA 4JJFA 2J46A 1NG1A 1BR1A 3JCUQ 1D1AA 2YZSA 1M2VA 3KL4A 3OEOA 4EWCA 1ZU4A 1J8YF 4YT4A 3F47A 2A1DD 1FTSA 3I4UA 4BJ6A 3S27A 4BJTA 5DLJA 1IW7F 2YHSA 2W9YA 1O87A 2E87A 4E7ZA 1Z5ZA 3LLIA 3K6BA 3I5QA 4JJGA 2Q9CA 4AE4A 1M56C 4AK9A 3PMRA 3JYHA 4I44A 4XLNF 2W4MA 4AX2A 1NU7D 4LLEA 1ZHYA 2VB6A 5KYYA 2W45A 2XSEA 3O6XA 3EG9B 3EJNA 4H4KC 5T1DB 4CSAC 4J32B 3RH3A 2A68F 2Y3DA 1W2WA 3FVYA 4JW1A 5KYNA 5DQZA 3N0TA 3AG2C 5CI8A 1ST6A 3JRTA 2WB7A 3ITFA 4QI2A 2R7UA 2PX3A 2CW0F 4DVZA 4HFFB 3MX3A 4U5HA 2EIMC 2J7PA 2DGJA 4CBEA 1LS1A 1MNEA 1G8XA 3AQCA 2ZXRA 4PFOA 2Q3TA 3KMIA 2H7BA 2J0XA 4YT8A 3EGDB 2PP4A 2DYRC 5B3SC 3RIPA 2KGOA 1ZHTA 4K0DA 3AG1C 3EH1A 3LEVA 2A6EF 3FAJA 4J30B 2XXAB 3JT1A 4LLCA 3SNHA 4YT5A 3POVA 4OD5A 1V55C 3RFYA 1OCRC 3WG7C 3ZIBA 2CDQA 3NG1A 1LKXA 3ABKC 2ZXWC 2Z15A 1PCXA 3FDQA 4KI2A 2J0WA 1Z6AA 1M57C 4PFPA 4OINF 4MNDA 3DMDA 5KYUA 4HFKB 2VH3A 1VYIA 2CGEA 3LJBA 2V3CC 2MWQA 4O6MA 3DJUB 3DM5A 3NYLA 2YEVA 1PD0A 3EH2A 3E9VA 3NKEA 3KKBA 2EILC 1VYKA 1PD1A 1ZU5A 2J9WA 3O39A 3SEOA 3N2ZB 1VOMA 5CI9A 4YJWA 3EPVA 4ANJA 4BG0A 4O79A 2IXPA 4QI0A 3LS1A 5KYYB 4OIPF 4JURI 4RBNA 4GYTA 5B1BC 5KYXA 3KH2A 3T6BA 4O7GA 4HE8D 4IAOA 3K7DA 1OKKD 2NUPA 3EZHA 2KW3C 4U5CE 1Z3IX 2QTVA 3HJCA 3X1OA 2GFHA 2I8BA 1ZYRF 2MYSA 1J8MF 3S0XA 2WZGA 4U5BE 3UMHA 4BJ6C 3UMIA 2XRHA 3F46A 3SP1A 4DVYP 1QLEC 1FFHA 1D0ZA 3EZIA 3EFOB 3EGXB 1ZHZA 1SF8A 2A69F 3RKOF 2WVQA 3IEEA 3T4RA 4G7HF 1Z23A 1D1CA 1JPJA 1NU9C 2PX0A 3T6JA 1OCCC 2C04A 4C7OB 4U5GA 4ZLCA 3EHNA 2WZLA 1FMWA 2J9VA 2ZXOA 3I5PA 1QZXA 4KNVA 5D92A 3SZRA 4DOZA 3ZVRA 3W8IA 2R7SA 2FFHA 3NDBB 3CZ6A 2WVNA 4KNWA 2H7VC 4DBQA 2WVOA 2CNWD 3RYLA 3DAFA 1OKKA 1LVKA 2J9UA 2V26A 3ZG1A 4BJ5A 2X51A 3N24A 3Q7GA 3ZC4A 4P6IC 2JD3A 5EHHA 3UGPA 5DS5A 2FGYA 4PJLA 3NYMA 4O6YA 3Q6NA 4G7ZF 4W8KA 5E3AA 1V54C 4XTKA 4FWVA 2WZFA 5KYXB 1BR4A 1TWGA 4IWBA 1RJ9A 3OWTA 4YWQA 2NUPB 4I1OB 4C3DA 4PJJA 5T3WA 4I3MA 2P6VA 3DAGA 3LESA 5D91A 4CS9A 3ABLC 1IZMA 1KU2A 3DZAA 4MQ9F 1D1BA 3LS0A 3TD7A 4OIQF 3M1CB 2O9XA 1O5HA 3UGOA 3W2VA 1MMAA 3DJNB 1M2VB 1WGWA 4FESA 3VAYA 1TWHA 2R7VA 3DD7A 4NY3A 2Q9AA 1TWCA 4CIHA 2G62A 3B0PA 1S7ZA 2Q9BA 2J45A 4AE4B 4F4BA 4JVSA 4KBLA 5HSWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QMK A;  5BUO A;  3UMH A;  4RD9 A;  3UMI A;  3K6B A;  3NYJ A;  3K66 A;  3Q7G A;  4YN0 B;  3Q7L A;  4RDA A;  3PMR A;  3UMK A;  1TKN A;  3NYL A; 
#chains in the Genus database with same CATH topology
 4Z9I A;  2OKU A;  1WOL A;  4BJ1 A;  2XLE A;  4EBB A;  1YYJ A;  2LSE A;  3B71 A;  3O55 A;  1HE9 A;  1L7C A;  4E0H A;  1SZI A;  3E70 C;  4HEA J;  2ETS A;  1M2O A;  5L0H A;  4U5D E;  2EIK C;  2QUP A;  5COF A;  3ZWI A;  3CSK A;  4BEJ A;  3QZC A;  1FMV A;  3TUL A;  1JAF A;  1BDJ B;  2PBE A;  1KNY A;  3KPH A;  1DOV A;  3W8H A;  3RW0 A;  3JSZ A;  5AGF A;  2Y3B A;  2Q4F A;  3B29 A;  4WGZ A;  3L34 A;  5AC5 A;  1AVO B;  3MFN A;  3R7C A;  2OG2 A;  1E2X A;  3AOU A;  2ZD9 A;  3UMK A;  2D5R B;  4Q7C A;  2YL1 A;  3NRH A;  1APC A;  3W2W A;  5DQT A;  5A6A A;  5KYW A;  3B0U X;  4EIY A;  1NFO A;  5L3V A;  3SXM A;  2J7P D;  3WAQ A;  2XXA A;  1RKC A;  1MND A;  1G4W R;  3NKD A;  2NUT A;  4I1M A;  3UNG C;  3S28 A;  2AWY A;  1QQ3 A;  2W4B A;  1EKY A;  1T5O A;  4N6H A;  4EUK B;  4YT2 A;  4XWJ A;  4XPY A;  2XLM A;  4M63 A;  3JSE O;  4RD9 A;  1NZE A;  2KC3 A;  2H8A A;  5JLI A;  2R7W A;  2KQ9 A;  2R9R B;  3GAN A;  4ZLD A;  1OW8 A;  1O3U A;  2L7A A;  3MYI A;  1YA9 A;  3L0I A;  4JTC B;  5FCL A;  1U6H A;  2P7V A;  1VLT A;  5E2Q A;  2LFF A;  3NYJ A;  2HMQ A;  2HZ8 A;  2Y69 C;  2R7Q A;  4JZA A;  2DYS C;  2L81 A;  3IPM O;  3S29 A;  4NC3 A;  1RJ9 B;  1Y4C A;  2KK1 A;  2XLV A;  3K33 A;  1MMD A;  1TWA A;  2L6G A;  2DI3 A;  4YN0 B;  1LI7 A;  4K7B A;  4U5E E;  5T3T A;  1C03 A;  1Q0D A;  5E3C A;  3U9J A;  1SR2 A;  3ECS A;  3HLZ A;  5L0J A;  2KNH A;  5JVE A;  4OIO F;  1FAP B;  4CDY A;  2R7T A;  3K1I C;  3QW0 A;  3OA1 A;  4OIR F;  3RVY A;  4C3E A;  3HNJ A;  2Y3H A;  2BE5 F;  3FHD A;  1SMY F;  2XL4 A;  4JKV A;  1I4Y A;  2J9B A;  2R7O A;  1MMG A;  2EIN C;  2C03 A;  3K1I A;  4XPX A;  1H7I A;  5EGY A;  5KYU B;  3QW1 A;  2RSE B;  3HTK C;  2HUJ A;  2G3K A;  2P61 A;  2JX0 A;  5GPG B;  3GOD A;  4O6N A;  4MTG A;  3B0V C;  4BJ5 C;  3TK0 A;  4IJJ A;  3LNR A;  3IQ5 A;  2XS8 A;  3ASO C;  5F5F A;  2R25 A;  3EQL F;  2HSQ A;  3UR3 C;  2QY9 A;  4GEH A;  4QDL A;  4IAQ A;  2EPO A;  4CSA A;  2IXM A;  1Z63 A;  2CCY A;  5DS6 A;  4G0H A;  1YZC A;  1JMW A;  1V74 B;  1OCZ C;  4OD4 A;  3NMI A;  1I4Z A;  3BEH A;  3QMK A;  1AEP A;  2IXN A;  1QPU A;  4JCH A;  4EBJ A;  2YLG A;  2LFD A;  4PJM A;  3S84 A;  1H9T A;  1JPN A;  1N1C A;  3C18 A;  3ABM C;  3ATP A;  2Y39 A;  2OOC A;  4Q5S F;  4IRU A;  1GS9 A;  2YVK A;  3HKK A;  3PHF 2;  4E0I A;  3RQG A;  4B6I A;  4A2N B;  1L3P A;  2HJ3 A;  3EHM A;  3FOP A;  1OW7 A;  3DM9 B;  3S90 A;  2M4E A;  5L0G A;  3LLK A;  2OCC C;  4CS9 C;  5F5H A;  1BR2 A;  1JRA A;  2ZPA A;  3L8J A;  1D0X A;  2JPU A;  4CS9 A;  2ZXP A;  2EIJ C;  3LUT B;  2NG1 A;  3EFO A;  1LI5 A;  3ASN C;  2AWC A;  3EGX A;  3X2Q C;  2QE9 A;  4JEA A;  1G5Z A;  5CIV A;  2EPM X;  3VRC A;  3FXH A;  4MVU A;  1VK5 A;  4N06 A;  1B68 A;  3VYW A;  5KYW B;  4JE9 A;  2TMV P;  3MLG A;  1MQV A;  1UG7 A;  4MVM A;  3ZSU A;  2PF4 E;  5DVW A;  2R7X A;  2NUT B;  3EG9 A;  2EPL X;  2LCH A;  2HFI A;  4CDA A;  4CS8 C;  4C7O A;  3M79 A;  2G3V A;  2LP4 A;  3DE8 A;  3Q6M A;  5A69 A;  2HSB A;  4MVR A;  1Z7Q c;  1OCO C;  4P9T A;  4CS8 A;  1ZHW A;  2XL6 A;  1VMA A;  5IY5 C;  2HV7 A;  2R7R A;  5JS5 A;  3H65 A;  4JTD B;  1D0Y A;  3O10 A;  4PJN A;  2XLW A;  2L9J A;  4RDA A;  4CS7 A;  1TKN A;  4G7O F;  3FMS A;  3QVZ A;  3TOL A;  5A6J A;  3AG4 C;  4MTO A;  4XPW A;  4MW3 A;  3K1H A;  2H7O A;  1CPR A;  3WOD F;  3V7O A;  3U9M A;  3TJ5 A;  3WHN A;  2Y3G A;  4Q4Z F;  2CNW A;  2WL8 A;  3GEI A;  3IQT A;  4DXW A;  3H2V A;  2VAS A;  2QLA A;  1MMN A;  2YLI A;  2YRF A;  1YJG A;  2R03 A;  3DXJ F;  4FX5 A;  1CGM E;  2MHR A;  3M4B A;  3L8I A;  4U9E A;  5DS4 A;  1RMV A;  4YL1 A;  2L6F A;  2HS5 A;  2IXO A;  1XZP A;  1Y6D A;  4KC9 A;  3EGD A;  2B0J A;  3SYN A;  3AQB A;  1WN0 A;  2ASR A;  2KJG A;  4E7S A;  4P9F A;  2XLD A;  3AG3 C;  3K66 A;  4LER A;  4LAC B;  4C3B A;  4U5F E;  5B1A C;  4H54 A;  1E85 A;  3B9Q A;  1R5I D;  4X0R A;  1WAT A;  4CJO A;  4DRH B;  3LAY A;  1YVI A;  3Q7L A;  3CQZ A;  256B A;  4ULW A;  2VCB A;  2DB4 A;  2OQM A;  3G4X A;  5BUO A;  5E33 A;  1TR2 A;  2IYL D;  2UUI A;  5L3Q A;  1EQ1 A;  4WJ0 A;  4XLP F;  1H9G A;  2PFD A;  1G4U S;  3QVY A;  4PK4 A;  2HMZ A;  3AGT A;  1HW2 A;  1ZHX A;  2IOQ A;  1HMO A;  2A6H F;  2XS1 A;  3T9O A;  2R05 A;  2HV6 A;  5L0I A;  1VB5 A;  1FFT C;  1F1M A;  3DI5 A;  4DBR A;  4JJF A;  2J46 A;  1NG1 A;  1H6G A;  4DJ9 A;  1BR1 A;  4MW8 A;  3JCU Q;  1HW1 A;  1D1A A;  2YZS A;  5JT4 A;  3JYY A;  2BL2 A;  1M2V A;  3KL4 A;  3OEO A;  4EWC A;  5A6B D;  1ZU4 A;  1VTM P;  1J8Y F;  1V4A A;  4YT4 A;  5JUA A;  3F47 A;  2A1D D;  4MVZ A;  3C62 A;  1FTS A;  3I4U A;  4BJ6 A;  5A6K A;  3S27 A;  1K05 A;  4R32 A;  1E84 A;  4BJT A;  4JTA B;  3SXY A;  1IW7 F;  2YHS A;  5DLJ A;  2W9Y A;  1O87 A;  2E87 A;  4E7Z A;  1LE2 A;  1Z5Z A;  3C8G B;  3K6B A;  3LLI A;  3I5Q A;  1QVX A;  4JJG A;  3G4Z A;  5COG A;  1A0B A;  3TOM A;  2Q9C A;  4AE4 A;  1M56 C;  4AK9 A;  3PMR A;  3CEX A;  3JYH A;  3ZTZ A;  4NTF A;  1A7E A;  4I44 A;  1YZA A;  4XLN F;  2W4M A;  4AX2 A;  4N6C A;  1NU7 D;  4NTB A;  1WWP A;  4LLE A;  1T6I A;  1ZHY A;  2VB6 A;  5KYY A;  2W45 A;  2XSE A;  3O6X A;  3EG9 B;  3EJN A;  4H4K C;  1OW6 A;  5T1D B;  4CSA C;  4J32 B;  1ZW3 A;  5EK0 A;  3A11 A;  1T01 A;  1DOW A;  4FAP B;  3PDM P;  3RH3 A;  1YYX A;  2P1A A;  5JSL A;  2A68 F;  1RCP A;  2GAQ A;  2Y3D A;  3ZQY A;  1W2W A;  3FVY A;  1QKR A;  1R4T A;  3VM6 A;  3HNI A;  4J7T A;  1XZQ A;  4JW1 A;  2NSG A;  3KYJ A;  5KYN A;  5DQZ A;  4PR9 A;  3GWL A;  3AG2 C;  3N0T A;  5CI8 A;  1ST6 A;  5K0I A;  2YWA A;  3JRT A;  2OU6 A;  2WB7 A;  2LIG A;  1A7V A;  3U5S A;  4D4N A;  3ITF A;  4QI2 A;  2XLO A;  2PX3 A;  2CW0 F;  4JEB A;  2R7U A;  4DVZ A;  4L6R A;  1C02 A;  4EKW A;  4HFF B;  3MX3 A;  4U5H A;  2EIM C;  2J7P A;  1T9K A;  2DGJ A;  4CBE A;  2VC9 A;  3JRM O;  1LS1 A;  1MNE A;  1G8X A;  2R02 A;  2EPN A;  3AQC A;  2IM8 A;  2ZXR A;  4PFO A;  2M64 A;  2Q3T A;  1TFK B;  4PAC A;  1ZW2 A;  3KMI A;  4IAR A;  4MTF A;  3T6G B;  3A9C A;  4NTA A;  2GWW A;  2H7B A;  3GM1 A;  3CAX A;  3RQE A;  2J0X A;  4YT8 A;  3EGD B;  5COM A;  2PP4 A;  1LPE A;  3FAP B;  2DYR C;  3MYF A;  5B3S C;  1E86 A;  1C17 M;  5JRA A;  3RIP A;  2KGO A;  1ZHT A;  4CIP A;  4K0D A;  3AG1 C;  3VF0 A;  1AUE A;  3EH1 A;  4CDV A;  1I5N A;  3FOO A;  3LEV A;  2A6E F;  3FAJ A;  4D4X A;  4J30 B;  5TJ5 E;  3GEH A;  2YL0 A;  4WGY A;  5L0D A;  2XXA B;  3JT1 A;  4LLC A;  3SNH A;  2YL7 A;  4W8P A;  4YT5 A;  2IBF A;  4OD5 A;  3POV A;  1OQC A;  1V55 C;  3RFY A;  1OCR C;  3WG7 C;  3ZIB A;  2CDQ A;  2EPK X;  3NG1 A;  1LKX A;  3ABK C;  2ZXW C;  2Z15 A;  1PCX A;  4MVO A;  1UFB A;  3FDQ A;  1QSP A;  3V5Z A;  4XEF A;  4JCZ A;  1PV3 A;  4K1O A;  2GA0 A;  2J0W A;  4KI2 A;  2HKV A;  1WAS A;  1T6U A;  1Z6A A;  1M57 C;  4PFP A;  4OIN F;  4MND A;  1GM5 A;  3DMD A;  4U9D A;  5KYU A;  4HFK B;  2VH3 A;  1HY5 A;  2YQY A;  1VYI A;  2CGE A;  3LJB A;  5JP7 A;  2V3C C;  2MWQ A;  2VCA A;  4O6M A;  3DJU B;  3DM5 A;  1ORS C;  2F22 A;  3NYL A;  2YEV A;  1Q0K A;  1PD0 A;  3EH2 A;  3E9V A;  3NKE A;  2KSF A;  3KKB A;  5B3I A;  1RKE A;  1TQG A;  1VYK A;  2AU5 A;  2EIL C;  2BC5 A;  1PD1 A;  3HNL A;  1ZU5 A;  1XWJ A;  2J9W A;  3HNK A;  3IQ6 A;  3O39 A;  4IGG A;  3N2Z B;  3SEO A;  1VOM A;  2PNO A;  5CI9 A;  4YJW A;  1HMD A;  3EPV A;  3RF3 A;  2LQG A;  3US6 A;  4ANJ A;  4BG0 A;  4O79 A;  4DRJ B;  2KYH A;  2IXP A;  4QI0 A;  3LS1 A;  5KYY B;  4OIP F;  2QNL A;  5F28 E;  3GM3 A;  4JUR I;  4RBN A;  2YLD A;  4GYT A;  1RXQ A;  3U0C A;  3GWN A;  5B1B C;  5KYX A;  3KH2 A;  3T6B A;  4O7G A;  3U8P A;  3H2U A;  4HE8 D;  4IAO A;  1LM3 B;  3IHU A;  3JTL O;  1OKK D;  3K7D A;  2NUP A;  1A41 A;  3EZH A;  1JR8 A;  3TJ6 A;  2KW3 C;  3AJM A;  4U5C E;  3C63 A;  2X0C A;  4ER9 A;  1OR3 A;  1ORJ A;  1CPQ A;  4CJG A;  1LS4 A;  1Z3I X;  1OXK A;  2QTV A;  3HJC A;  3JZ0 A;  3X1O A;  2NSF A;  4G78 A;  2GFH A;  2I8B A;  3NMJ A;  1ZYR F;  2MYS A;  4E18 A;  1YAU O;  1J8M F;  3S0X A;  1BZ4 A;  2WZG A;  3DWW A;  4U5B E;  3UMH A;  4BJ6 C;  1JOG A;  4LDR A;  3UMI A;  2XRH A;  3AGU A;  3F46 A;  3GEE A;  3SP1 A;  5BQI A;  1NFN A;  4N4W A;  1QLE C;  4DVY P;  1FFH A;  3KYI A;  4NCQ A;  1D0Z A;  3EZI A;  1Q0M A;  5L0F A;  3EFO B;  4AL0 A;  3EGX B;  1ZHZ A;  4EHP A;  1SF8 A;  1ZZP A;  4UDV A;  1BBH A;  2A69 F;  4LDQ A;  2FAP B;  1EI7 A;  2WVQ A;  3RKO F;  3C8G D;  3NMK A;  4ONS A;  3IEE A;  2ICW G;  3T4R A;  4G7H F;  5L0C A;  1Z23 A;  1YA7 O;  3SXZ A;  5FZT A;  3BRJ A;  1D1C A;  1JPJ A;  1LIH A;  1NU9 C;  2PX0 A;  1NBB A;  2VCC A;  3T6J A;  1GGQ A;  3QTH A;  1OCC C;  2C04 A;  4JRZ A;  4XQ1 A;  4U5G A;  4C7O B;  4ZLC A;  2L6H A;  4WAB A;  3RVZ A;  1FR0 A;  3C7J A;  1K04 A;  3EHN A;  2WZL A;  2J8W A;  1FMW A;  4MVS A;  2J9V A;  4YL0 A;  4MS2 A;  2Q7R A;  2B0H A;  2I15 A;  1M6T A;  2ZXO A;  3I5P A;  1CGN A;  1QZX A;  4KNV A;  2RD9 A;  5AC4 A;  5D92 A;  4ULV A;  3SZR A;  4DOZ A;  1KTM A;  1U89 A;  3ZVR A;  3W8I A;  3LNM B;  2R7S A;  1OXB A;  4E17 A;  2XM0 A;  2FFH A;  3NDB B;  3CZ6 A;  2NPU A;  2WVN A;  4KNW A;  3U3F A;  4BPM A;  2H7V C;  4DBQ A;  2WVO A;  2CNW D;  3RYL A;  2D4U A;  1ORY A;  3DAF A;  1OKK A;  1RKE B;  1LVK A;  2J9U A;  2V26 A;  3ZG1 A;  1YLM A;  4BJ5 A;  2OJE D;  2X51 A;  3C8Z A;  2AP3 A;  3N24 A;  2CYD A;  3Q7G A;  4JC7 A;  3ZC4 A;  4P6I C;  4EBK A;  2JD3 A;  1K40 A;  2LD6 A;  5EHH A;  2YL3 A;  3TQO A;  4AL1 A;  3UGP A;  3U8V A;  3V5Y A;  5DS5 A;  1GQA A;  2FGY A;  2YKZ A;  4NQF A;  2AVK A;  4PJL A;  3NYM A;  2HJM A;  4O6Y A;  2OEX A;  3Q6N A;  4G7Z F;  4BEM J;  3GM2 A;  4W8K A;  4XEK A;  3W4Y A;  5A6B A;  2Q00 A;  5E3A A;  1V54 C;  4XTK A;  5BQG A;  1E83 A;  4FWV A;  4A4A A;  2WZF A;  3U3B A;  1BR4 A;  2A0U A;  4DRI B;  5KYX B;  3ZTM A;  2GDC A;  1NLX A;  3M4C A;  4MVQ A;  1TWG A;  2P0N A;  1OR2 A;  4IWB A;  1RJ9 A;  3OWT A;  1S05 A;  4YWQ A;  2NUP B;  3DE9 A;  5BQH A;  4XEV A;  4J7Y A;  4I1O B;  4C3D A;  3GOR A;  1CGO A;  4PJJ A;  4YL3 A;  5T3W A;  3U2M A;  5HV9 A;  4I3M A;  2P6V A;  3DAG A;  3C8G A;  1TFO B;  3LES A;  3ABL C;  5D91 A;  1IZM A;  1KU2 A;  3DZA A;  3LEO A;  4MQ9 F;  3RQF A;  1D1B A;  3LS0 A;  1T6Q A;  3TD7 A;  1FNT c;  4OIQ F;  1U0B B;  3M1C B;  2LK4 A;  2O9X A;  1O5H A;  3UGO A;  3W2V A;  3R2P A;  1YAR O;  1ZVZ A;  4YK5 A;  2XM4 A;  1Q0F A;  2UUH A;  1MMA A;  3DJN B;  3IQC A;  4IB4 A;  3V5X A;  1M2V B;  1WGW A;  4FES A;  3L1M A;  3U2L A;  3VAY A;  1TWH A;  1A7D A;  1NSG B;  2R7V A;  1LE4 A;  3DD7 A;  3MBG A;  4NY3 A;  3SXK A;  2Q9A A;  1SYQ A;  1TWC A;  3DKA A;  3G50 A;  4LDK A;  1VLS A;  3M15 A;  4Z9H A;  1HE1 A;  3ZDL A;  4GQH A;  2G62 A;  4JIO A;  3B0P A;  3ZQV A;  1S7Z A;  1EA8 A;  4CIH A;  2A0B A;  1YDI A;  3PCV A;  2Q9B A;  2OEV A;  3S9O A;  1Q0G A;  2OJQ A;  4Z9J A;  2J45 A;  4AE4 B;  2XLH A;  3J06 A;  2XL8 A;  4CX9 A;  4JVS A;  4F4B A;  4KBL A;  1WTY A;  5HSW A; 
#chains in the Genus database with same CATH homology
 4BJ1 A;  4EBB A;  2LSE A;  1SZI A;  3E70 C;  4HEA J;  1M2O A;  4U5D E;  2EIK C;  3CSK A;  4BEJ A;  3QZC A;  1FMV A;  3W8H A;  3JSZ A;  2Y3B A;  3L34 A;  2OG2 A;  3UMK A;  2D5R B;  4Q7C A;  3NRH A;  3W2W A;  5DQT A;  5KYW A;  3B0U X;  5L3V A;  2J7P D;  2XXA A;  1MND A;  3NKD A;  2NUT A;  4I1M A;  3UNG C;  3S28 A;  2W4B A;  4YT2 A;  4XWJ A;  4M63 A;  4RD9 A;  1NZE A;  2R7W A;  2KQ9 A;  3GAN A;  4ZLD A;  3L0I A;  5FCL A;  2P7V A;  5E2Q A;  3NYJ A;  2Y69 C;  2R7Q A;  4JZA A;  2DYS C;  2L81 A;  3S29 A;  1RJ9 B;  3K33 A;  1MMD A;  1TWA A;  4YN0 B;  4A2N B;  4U5E E;  4K7B A;  5T3T A;  5E3C A;  3ECS A;  3HLZ A;  2KNH A;  2R7T A;  4OIO F;  3K1I C;  4C3E A;  3OA1 A;  4OIR F;  2Y3H A;  2BE5 F;  3FHD A;  1SMY F;  2XL4 A;  2R7O A;  1MMG A;  2EIN C;  2C03 A;  5EGY A;  5KYU B;  3HTK C;  2G3K A;  3GOD A;  4O6N A;  3B0V C;  4BJ5 C;  4IJJ A;  3LNR A;  5F5F A;  3ASO C;  3EQL F;  3UR3 C;  2QY9 A;  4GEH A;  4QDL A;  4CSA A;  2IXM A;  1Z63 A;  5DS6 A;  4G0H A;  4OD4 A;  1OCZ C;  3QMK A;  2IXN A;  4JCH A;  4PJM A;  1JPN A;  1N1C A;  3ABM C;  2Y39 A;  4Q5S F;  4IRU A;  3PHF 2;  4B6I A;  3EHM A;  3DM9 B;  2M4E A;  3LLK A;  2OCC C;  4CS9 C;  5F5H A;  1BR2 A;  2ZPA A;  1D0X A;  2ZXP A;  2EIJ C;  2NG1 A;  3EFO A;  3ASN C;  3EGX A;  3X2Q C;  1VK5 A;  4N06 A;  3VYW A;  5KYW B;  3MLG A;  3ZSU A;  2PF4 E;  5DVW A;  2R7X A;  2NUT B;  3EG9 A;  4CS8 C;  4C7O A;  3Q6M A;  2G3V A;  1OCO C;  4CS8 A;  1ZHW A;  5IY5 C;  1VMA A;  2R7R A;  2HV7 A;  3H65 A;  4PJN A;  1D0Y A;  4RDA A;  4G7O F;  2L9J A;  4CS7 A;  1TKN A;  3AG4 C;  3K1H A;  2H7O A;  3WOD F;  3V7O A;  2Y3G A;  4Q4Z F;  2CNW A;  2WL8 A;  2VAS A;  1MMN A;  3DXJ F;  4FX5 A;  5DS4 A;  2IXO A;  4KC9 A;  3EGD A;  2B0J A;  3SYN A;  3AQB A;  2KJG A;  4E7S A;  3AG3 C;  3K66 A;  4LER A;  4LAC B;  4C3B A;  4U5F E;  5B1A C;  3B9Q A;  4X0R A;  3LAY A;  3Q7L A;  3CQZ A;  4ULW A;  5BUO A;  5L3Q A;  5E33 A;  1TR2 A;  2IYL D;  4WJ0 A;  4XLP F;  2PFD A;  4PK4 A;  1ZHX A;  2IOQ A;  2A6H F;  2HV6 A;  1FFT C;  4DBR A;  4JJF A;  2J46 A;  1NG1 A;  1BR1 A;  3JCU Q;  1D1A A;  2YZS A;  1M2V A;  3KL4 A;  3OEO A;  4EWC A;  1ZU4 A;  1J8Y F;  4YT4 A;  3F47 A;  2A1D D;  1FTS A;  3I4U A;  4BJ6 A;  3S27 A;  4BJT A;  5DLJ A;  1IW7 F;  2YHS A;  2W9Y A;  1O87 A;  2E87 A;  4E7Z A;  1Z5Z A;  3LLI A;  3K6B A;  3I5Q A;  4JJG A;  2Q9C A;  4AE4 A;  1M56 C;  4AK9 A;  3PMR A;  3JYH A;  4I44 A;  4XLN F;  2W4M A;  4AX2 A;  1NU7 D;  4LLE A;  1ZHY A;  2VB6 A;  5KYY A;  2W45 A;  2XSE A;  3O6X A;  3EG9 B;  3EJN A;  4H4K C;  5T1D B;  4CSA C;  4J32 B;  3RH3 A;  2A68 F;  2Y3D A;  1W2W A;  3FVY A;  4JW1 A;  5KYN A;  5DQZ A;  3N0T A;  3AG2 C;  5CI8 A;  1ST6 A;  3JRT A;  2WB7 A;  3ITF A;  4QI2 A;  2R7U A;  2PX3 A;  2CW0 F;  4DVZ A;  4HFF B;  3MX3 A;  4U5H A;  2EIM C;  2J7P A;  2DGJ A;  4CBE A;  1LS1 A;  1MNE A;  1G8X A;  3AQC A;  2ZXR A;  4PFO A;  2Q3T A;  3KMI A;  2H7B A;  2J0X A;  4YT8 A;  3EGD B;  2PP4 A;  2DYR C;  5B3S C;  3RIP A;  2KGO A;  1ZHT A;  4K0D A;  3AG1 C;  3EH1 A;  3LEV A;  2A6E F;  3FAJ A;  4J30 B;  2XXA B;  3JT1 A;  4LLC A;  3SNH A;  4YT5 A;  3POV A;  4OD5 A;  1V55 C;  3RFY A;  1OCR C;  3WG7 C;  3ZIB A;  2CDQ A;  3NG1 A;  1LKX A;  3ABK C;  2ZXW C;  2Z15 A;  1PCX A;  3FDQ A;  4KI2 A;  2J0W A;  1Z6A A;  1M57 C;  4PFP A;  4OIN F;  4MND A;  3DMD A;  5KYU A;  4HFK B;  2VH3 A;  1VYI A;  2CGE A;  3LJB A;  2V3C C;  2MWQ A;  4O6M A;  3DJU B;  3DM5 A;  3NYL A;  2YEV A;  1PD0 A;  3EH2 A;  3E9V A;  3NKE A;  3KKB A;  2EIL C;  1VYK A;  1PD1 A;  1ZU5 A;  2J9W A;  3O39 A;  3SEO A;  3N2Z B;  1VOM A;  5CI9 A;  4YJW A;  3EPV A;  4ANJ A;  4BG0 A;  4O79 A;  2IXP A;  4QI0 A;  3LS1 A;  5KYY B;  4OIP F;  4JUR I;  4RBN A;  4GYT A;  5B1B C;  5KYX A;  3KH2 A;  3T6B A;  4O7G A;  4HE8 D;  4IAO A;  3K7D A;  1OKK D;  2NUP A;  3EZH A;  2KW3 C;  4U5C E;  1Z3I X;  2QTV A;  3HJC A;  3X1O A;  2GFH A;  2I8B A;  1ZYR F;  2MYS A;  1J8M F;  3S0X A;  2WZG A;  4U5B E;  3UMH A;  4BJ6 C;  3UMI A;  2XRH A;  3F46 A;  3SP1 A;  4DVY P;  1QLE C;  1FFH A;  1D0Z A;  3EZI A;  3EFO B;  3EGX B;  1ZHZ A;  1SF8 A;  2A69 F;  3RKO F;  2WVQ A;  3IEE A;  3T4R A;  4G7H F;  1Z23 A;  1D1C A;  1JPJ A;  1NU9 C;  2PX0 A;  3T6J A;  1OCC C;  2C04 A;  4C7O B;  4U5G A;  4ZLC A;  3EHN A;  2WZL A;  1FMW A;  2J9V A;  2ZXO A;  3I5P A;  1QZX A;  4KNV A;  5D92 A;  3SZR A;  4DOZ A;  3ZVR A;  3W8I A;  2R7S A;  2FFH A;  3NDB B;  3CZ6 A;  2WVN A;  4KNW A;  2H7V C;  4DBQ A;  2WVO A;  2CNW D;  3RYL A;  3DAF A;  1OKK A;  1LVK A;  2J9U A;  2V26 A;  3ZG1 A;  4BJ5 A;  2X51 A;  3N24 A;  3Q7G A;  3ZC4 A;  4P6I C;  2JD3 A;  5EHH A;  3UGP A;  5DS5 A;  2FGY A;  4PJL A;  3NYM A;  4O6Y A;  3Q6N A;  4G7Z F;  4W8K A;  5E3A A;  1V54 C;  4XTK A;  4FWV A;  2WZF A;  5KYX B;  1BR4 A;  1TWG A;  4IWB A;  1RJ9 A;  3OWT A;  4YWQ A;  2NUP B;  4I1O B;  4C3D A;  4PJJ A;  5T3W A;  4I3M A;  2P6V A;  3DAG A;  3LES A;  5D91 A;  4CS9 A;  3ABL C;  1IZM A;  1KU2 A;  3DZA A;  4MQ9 F;  1D1B A;  3LS0 A;  3TD7 A;  4OIQ F;  3M1C B;  2O9X A;  1O5H A;  3UGO A;  3W2V A;  1MMA A;  3DJN B;  1M2V B;  1WGW A;  4FES A;  3VAY A;  1TWH A;  2R7V A;  3DD7 A;  4NY3 A;  2Q9A A;  1TWC A;  4CIH A;  2G62 A;  3B0P A;  1S7Z A;  2Q9B A;  2J45 A;  4AE4 B;  4F4B A;  4JVS A;  4KBL A;  5HSW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...