3NYJA

Crystal structure analysis of app e2 domain
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
181
structure length
181
Chain Sequence
LETPGDENEHAHFQKAKERLEAKHRERMSQVMREWEEAERQAKNLPKADKKAVIQHFQEKVESLEQEAANERQQLVETHMARVEAMLNDRRRLALENYITALQAVPPRPRHVFNMLKKYVRAEQKDRQHTLKHFEHVRMVDPKKAAQIRSQVMTHLRVIYERMNQSLSLLYNVPAVAEEIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Amyloid beta A4 protein
publication title The E2 Domains of APP and APLP1 Share a Conserved Mode of Dimerization.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein fibril
total genus 56
structure length 181
sequence length 181
ec nomenclature
pdb deposition date 2010-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12925 APP_E2 E2 domain of amyloid precursor protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.770 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3nyjA00
3UMKA 3QMKA 3PMRA 4RD9A 3NYJA 3Q7GA 3UMHA 4YN0B 3UMIA 3Q7LA 3K6BA 1TKNA 5BUOA 3NYLA 3K66A 4RDAA
chains in the Genus database with same CATH superfamily
1OXBA 4OIOF 2D5RB 2XLHA 3SXMA 3GWLA 4MW3A 4XPXA 2IBFA 2XRHA 4N4WA 4I1MA 5DS5A 4ULVA 2EILC 4U5FE 2YEVA 5COFA 1GS9A 5KYUB 3JRTA 4JRZA 5DVWA 3AQBA 2VCAA 3V5ZA 5JSLA 5K0IA 3N2ZB 1BR1A 2L81A 4E0HA 1D1CA 2JX0A 4YK5A 4DRHB 2C03A 3FXHA 3U3BA 2QTVA 3TJ5A 3NKEA 5AC5A 3QTHA 4N6CA 3MYFA 2YVKA 4I1OB 1ORYA 2R05A 2XL4A 1NBBA 1TR2A 3EHNA 3L8JA 3OEOA 3ABMC 4HEAJ 5TJ5E 3LEOA 4JC7A 1NG1A 4CS7A 4A4AA 4W8KA 4U5GA 3L0IA 3GANA 4N6HA 1QQ3A 3NYLA 2XXAB 3C8GD 2P7VA 1M2OA 2QUPA 2WL8A 3EFOB 2J9VA 4J30B 3W4YA 3QVYA 1AUEA 2NUTB 5BQIA 2JPUA 2KQ9A 1K05A 3GWNA 4G0HA 1NLXA 3RIPA 5KYXA 3U8VA 4BEMJ 2KK1A 2NUPA 2G62A 2HZ8A 3HNJA 2I8BA 2XLOA 2IXNA 3DWWA 3LUTB 2A1DD 5HV9A 2YZSA 3VAYA 4QI2A 2YL3A 1M57C 1Z6AA 2V3CC 3I5PA 4LDKA 2EPLX 2R7SA 4PJMA 5JS5A 1JMWA 4MW8A 3ASNC 3GEEA 2XLVA 2X51A 4PJLA 5B1BC 4CDAA 2ZXPA 3JTLO 3KYJA 4EWCA 2Y39A 1ZZPA 1YA7O 4JKVA 2BE5F 4CSAC 1M6TA 3S28A 3NDBB 4DBQA 1E85A 4CSAA 2E87A 3CQZA 5FZTA 3I5QA 2EIKC 2VASA 3KL4A 3PMRA 3EQLF 1XZPA 3U5SA 2MYSA 3RQFA 2Q9CA 5L0CA 1L3PA 2WVQA 3E70C 1MNEA 3R2PA 1GQAA 2L9JA 4C7OB 3X1OA 2L6GA 3SZRA 1VYKA 1MMNA 4PFPA 4A2NB 1HMDA 3NMJA 3T9OA 3POVA 2EPKX 4G7OF 3MX3A 1ZHZA 3LNRA 1JRAA 3AG4C 2HSBA 1MNDA 2QY9A 3NKDA 2MWQA 4OD5A 3TULA 4JE9A 1NU9C 2OCCC 3HLZA 3RKOF 4O79A 3JSZA 3HJCA 2Y3BA 2PBEA 4IARA 4P9FA 3ZQYA 2YQYA 1OR3A 4H54A 2HUJA 1L7CA 1ST6A 1WATA 3JYHA 5E2QA 3ZG1A 5JRAA 2J7PA 3E9VA 1JAFA 2MHRA 4K1OA 3C8ZA 2J9UA 3T6JA 4Q5SF 2QNLA 1Y6DA 1FFTC 3L1MA 2VCBA 3H65A 3MLGA 3S90A 1OCCC 2NSGA 1BDJB 1VOMA 1TWAA 3ASOC 3N24A 2IXMA 4D4NA 5T1DB 1ORSC 4NTBA 1LS4A 3W2WA 3J06A 4YN0B 2R7QA 4AX2A 1SMYF 2YL0A 3M1CB 1H6GA 3ZIBA 2YHSA 4BJ5C 3S0XA 4BJ5A 5DS6A 3LLIA 3AG1C 4U5HA 3ABKC 3TK0A 5A6KA 4JJGA 4ONSA 2L7AA 3DM5A 2XL8A 3R7CA 1U89A 2VB6A 3ITFA 1FAPB 2A6HF 1T6UA 4RBNA 1OQCA 4JTAB 1LS1A 3IQCA 2EPMX 4U5BE 1O87A 2XM0A 1SF8A 4W8PA 5E3CA 1V55C 1W2WA 2CW0F 2J7PD 3K33A 1RKEA 4DOZA 3T6BA 1SYQA 5KYWA 4E18A 1YLMA 2XSEA 4PJJA 4WABA 4E0IA 5L0GA 2RD9A 1MQVA 4WGZA 4JURI 1QSPA 2KSFA 2XLDA 2XL6A 4YT4A 2R03A 3M4BA 4EBKA 4G78A 2ASRA 1VYIA 4XEFA 3CEXA 2TMVP 3DI5A 1OXKA 1I5NA 4XWJA 3B9QA 2IXOA 5L0FA 1ORJA 3DE8A 4BG0A 1APCA 4MNDA 2CYDA 3IPMO 2LQGA 3JSEO 3M15A 3JRMO 3N0TA 1Z23A 3B29A 3EJNA 2HJMA 5B3SC 2IYLD 2EPOA 1CGME 3C8GA 2R7TA 3RVZA 3S9OA 3CZ6A 3OWTA 2XLWA 4DVYP 2P61A 3UR3C 3F47A 3V7OA 3X2QC 3KKBA 2G3VA 2XS8A 3KPHA 1U6HA 3RH3A 1E2XA 2J8WA 5DQZA 1CPQA 3ZWIA 4PACA 3TQOA 2VCCA 2WB7A 4AL1A 1GM5A 1LM3B 1D0ZA 1R5ID 1EA8A 2DI3A 2H8AA 3EGXA 3EG9A 3MBGA 4H4KC 2YL7A 4I3MA 3ZDLA 3QW1A 3RQEA 1Z63A 4MVZA 1HW2A 3FMSA 1ZW3A 4QI0A 2ZD9A 3GM3A 3A9CA 1I4ZA 2C04A 1VMAA 2GAQA 3DM9B 3HNKA 3S84A 4IAOA 4XEKA 5L0DA 2Y3GA 3Q6MA 2WZGA 5GPGB 5CIVA 4JEAA 5A6BD 4O6MA 3NRHA 2PP4A 1ZHXA 4J32B 4J7TA 2YWAA 5E33A 3GEHA 5AC4A 1VLSA 5E3AA 1V4AA 2J9WA 1Q0MA 3LJBA 1YVIA 1YYXA 1YZAA 2ZXRA 3QMKA 4U9DA 5CI8A 3TOMA 1ZVZA 2R9RB 2J46A 1Z5ZA 3KH2A 1NFNA 4EBBA 1ZHTA 1HMOA 4EHPA 4G7HF 1HW1A 2LCHA 4JTCB 2KNHA 1IZMA 3B0VC 1YDIA 2KC3A 3U0CA 2ZXWC 3L8IA 3UMIA 1T6QA 1D1BA 4JVSA 3SXYA 2W4BA 2FGYA 3G4XA 4JTDB 4M63A 2Q9AA 3H2UA 5B3IA 1J8YF 1J8MF 3GORA 1CGOA 1VB5A 1FFHA 2HMZA 3Q7GA 3S27A 3ZC4A 3EGDA 3US6A 4D4XA 1C03A 2G3KA 2HV7A 4P6IC 3SEOA 4G7ZF 4U9EA 2QE9A 4NC3A 2NPUA 2AWCA 4KNVA 1ZHYA 1NZEA 2DB4A 4U5CE 3ZTZA 2VC9A 2OJQA 3LNMB 1RCPA 4FWVA 1EQ1A 3LAYA 1BR2A 3B0UX 4IJJA 4ZLDA 3VF0A 4PK4A 2R7XA 3RQGA 4CIHA 1XWJA 1LPEA 2HSQA 1R4TA 4PJNA 2UUIA 4JW1A 2X0CA 2R7VA 1WGWA 3C8GB 1YAUO 3M79A 1I4YA 4CDYA 4YT5A 3K66A 1S7ZA 4ANJA 5EK0A 4AE4A 1RJ9A 2BL2A 2Y69C 3UNGC 1WWPA 1G8XA 3G50A 3QW0A 1JPNA 5IY5C 1EKYA 4DXWA 4IRUA 5JVEA 2A0BA 3ABLC 5KYNA 2H7OA 1K04A 1A41A 1IW7F 1HE1A 1PV3A 3K1IC 4U5EE 3T4RA 5L3QA 2YKZA 3K1IA 4FESA 1RKCA 2R7OA 3W2VA 1E84A 4KC9A 1M2VA 3QVZA 4FAPB 1ZYRF 1Q0FA 3IQ6A 2EINC 3ZSUA 4XLPF 4MVOA 4NTAA 1Z7Qc 4EBJA 4YT8A 4CBEA 1OCZC 3AQCA 3MFNA 4BEJA 3B0PA 4EUKB 1YARO 2Z15A 2LP4A 3RW0A 2QLAA 4CDVA 4NY3A 4J7YA 4CJGA 2R7UA 4WJ0A 1A7VA 2J0WA 4LERA 3O55A 5KYUA 2LD6A 3FDQA 3LESA 5KYXB 2WZLA 5A6JA 1LKXA 2V26A 4OINF 2NUPB 4L6RA 3UGOA 3B71A 3KYIA 2XS1A 4CX9A 1BZ4A 3C63A 3AGTA 5COMA 3O6XA 2YLIA 2DYRC 4YL3A 2A0UA 1Q0DA 1QKRA 4B6IA 4I44A 1TFKB 1VK5A 2P6VA 2Y3DA 4LDRA 3DJUB 2IM8A 4O6YA 5F5FA 2Q7RA 1D0YA 1UG7A 2Q3TA 3DKAA 3FOOA 3PCVA 2GA0A 4OD4A 4CJOA 5L0IA 1EI7A 2L6FA 3HNLA 3EZHA 3RF3A 3RYLA 3U2LA 2OEXA 2XXAA 1B68A 3LS1A 1WOLA 3V5YA 1VLTA 5A69A 4C3BA 2NUTA 1KNYA 1YYJA 3I4UA 2LK4A 2J9BA 5JLIA 4NQFA 3IHUA 3DXJF 5AGFA 3AOUA 1NFOA 1OCRC 4AK9A 5HSWA 2HFIA 2I15A 3JYYA 1RMVA 3OA1A 1SZIA 1DOVA 3TJ6A 1FNTc 1YJGA 4O7GA 4LDQA 2CNWD 2FFHA 1FTSA 5COGA 4C3EA 5A6BA 4O6NA 5B1AC 3VYWA 3PDMP 1Q0GA 2IXPA 1TWHA 1RJ9B 4MTOA 4HE8D 1YA9A 1S05A 1WASA 3NMIA 3IEEA 1ZU5A 2Q4FA 3Q7LA 4MVSA 4XPWA 3W8HA 1Y4CA 3BEHA 5L0JA 3EHMA 1QZXA 4E7SA 5BQHA 5T3TA 1KTMA 2YRFA 3NYMA 1A0BA 2JD3A 4BJ6C 4LLCA 3K1HA 5FCLA 3ZTMA 4BJ6A 2YL1A 2EIJC 3U9JA 4KNWA 1JPJA 1OW7A 2AP3A 1PD1A 1E86A 1LE2A 1AVOB 5EGYA 4C7OA 5DS4A 3PHF2 2WVOA 1BR4A 2P0NA 3GM1A 2B0HA 3MYIA 4MQ9F 2HS5A 4KI2A 1XZQA 2L6HA 3WHNA 3FAJA 3WG7C 1V74B 5KYYA 2HKVA 4E17A 1T5OA 2OQMA 3JT1A 3FAPB 4MS2A 4OIRF 1OCOC 4CS9C 3K7DA 1OR2A 1H7IA 2UUHA 4MVQA 2ICWG 4BJTA 3HKKA 4CS9A 3K6BA 4BPMA 4K0DA 3DAGA 2OU6A 2OEVA 3GM2A 5JP7A 3CSKA 5CI9A 2M4EA 1WTYA 1FMWA 256BA 1VTMP 4K7BA 3TOLA 4ZLCA 4DBRA 2GDCA 1QLEC 3A11A 4HFKB 3T6GB 2PF4E 3IQTA 5BQGA 1PD0A 3TD7A 3RFYA 4BJ1A 1DOWA 1RKEB 5KYWB 2YLDA 3ATPA 1C17M 2NG1A 1OKKD 2AVKA 1H9TA 4GYTA 3RVYA 4E7ZA 4OIQF 2CDQA 4P9TA 2KJGA 1QPUA 2EPNA 1FMVA 2OOCA 2PNOA 4FX5A 1MMDA 4KBLA 3ZQVA 1YZCA 2EIMC 4R32A 1SR2A 4DRIB 4IAQA 3SXZA 1T6IA 2WVNA 3DD7A 4U5DE 3VRCA 3WODF 3H2VA 4Q4ZF 2HV6A 4C3DA 4LACB 3Q6NA 5A6AA 2A6EF 3JCUQ 1H9GA 1Z3IX 1O5HA 4MTFA 2XM4A 3AJMA 3C7JA 4IGGA 3V5XA 2HMQA 5DLJA 4DVZA 5BUOA 4IB4A 1TKNA 5EHHA 1FR0A 4N06A 2WZFA 4YL1A 3IQ5A 2XLEA 3F46A 3LLKA 2F22A 4XPYA 3WAQA 5F28E 1CGNA 1N1CA 3U2MA 2NSFA 5JUAA 3AGUA 3DE9A 1CPRA 1HY5A 2PFDA 4ER9A 1MMGA 3UMKA 2P1AA 3EGXB 2XLMA 3EG9B 4MTGA 1A7EA 2OKUA 2OJED 3O10A 1G4WR 4YL0A 2R25A 4CS8C 2W4MA 4EKWA 3KMIA 3QZCA 2YLGA 1T9KA 4CS8A 2ZXOA 1T01A 4NCQA 2R7WA 2O9XA 3C62A 3AG3C 2A69F 1A7DA 3BRJA 5F5HA 4XQ1A 3ZVRA 1NSGB 5L3VA 4UDVA 4Q7CA 1PCXA 2R7RA 1OKKA 1AEPA 2DYSC 4AL0A 4XTKA 4HFFB 2BC5A 4DRJB 2W9YA 4RD9A 3GODA 3LEVA 1C02A 2IOQA 1MMAA 2B0JA 4QDLA 1G5ZA 5KYYB 3O39A 2LFFA 1LI7A 4JIOA 3EPVA 1TWCA 4YWQA 3UMHA 3DZAA 1NU7D 1TFOB 3G4ZA 2A68F 2GFHA 3L34A 3FHDA 4MVUA 4CIPA 3U8PA 3DMDA 2ZPAA 4IWBA 4JEBA 4JCHA 5D91A 2OG2A 1LE4A 3DJNB 4RDAA 3HNIA 1O3UA 2R02A 4Z9IA 1JR8A 2M64A 5JT4A 3VM6A 1LVKA 3GEIA 1G4US 1ZU4A 3SXKA 2AWYA 4F4BA 1D1AA 4OIPF 2CNWA 4X0RA 1ZW2A 2LIGA 1QVXA 2Q9BA 1K40A 3NYJA 1JOGA 2KGOA 4GEHA 4GQHA 3EGDB 2VH3A 4PFOA 4MVMA 3U9MA 1F1MA 3NMKA 3DAFA 3EFOA 4JJFA 2W45A 3S29A 2H7VC 3CAXA 3EZIA 1UFBA 1TQGA 4Z9HA 2GWWA 4YJWA 4LLEA 1Q0KA 3AG2C 3SNHA 4EIYA 2D4UA 4Z9JA 5DQTA 3LS0A 2PX0A 1V54C 2LFDA 3EH1A 1KU2A 3SP1A 3W8IA 2RSEB 3EH2A 3NG1A 2CGEA 2KYHA 3C18A 4DJ9A 1LI5A 1OW8A 2ETSA 2LSEA 3M4CA 2J45A 1BBHA 2FAPB 2H7BA 2J0XA 4NTFA 4ULWA 3SYNA 1E83A 1TWGA 3UGPA 4JCZA 1U0BB 1LIHA 1OW6A 2Q00A 4AE4B 5L0HA 2KW3C 3JZ0A 4MVRA 3FOPA 4YT2A 1D0XA 1GGQA 3HTKC 1M56C 2DGJA 2PX3A 4PR9A 4XLNF 3FVYA 2AU5A 2CCYA 1M2VB 1HE9A 5T3WA 4XEVA 3ECSA 3U3FA 1WN0A 5D92A 4WGYA 2Y3HA 1RXQA 1ZHWA 2HJ3A 4JZAA
chains in the Genus database with same CATH topology
4OIOF 2D5RB 5DS5A 2XRHA 4I1MA 2EILC 4U5FE 2YEVA 5KYUB 3JRTA 5DVWA 3AQBA 3N2ZB 1BR1A 2L81A 1D1CA 2C03A 2QTVA 3NKEA 4I1OB 2XL4A 1TR2A 3EHNA 3OEOA 3ABMC 4HEAJ 1NG1A 4CS7A 4W8KA 4U5GA 3L0IA 3GANA 3NYLA 2XXAB 2P7VA 1M2OA 2WL8A 3EFOB 2J9VA 4J30B 2NUTB 2KQ9A 3RIPA 4G0HA 5KYXA 2NUPA 2G62A 2I8BA 2IXNA 2A1DD 2YZSA 3VAYA 4QI2A 1M57C 1Z6AA 2V3CC 3I5PA 2R7SA 4PJMA 3ASNC 4PJLA 4EWCA 2X51A 5B1BC 2ZXPA 2Y39A 4CSAC 2BE5F 3S28A 3NDBB 4DBQA 4CSAA 2E87A 3CQZA 3I5QA 2EIKC 2VASA 3KL4A 3PMRA 3EQLF 2MYSA 2Q9CA 2WVQA 3E70C 1MNEA 2L9JA 4C7OB 3X1OA 3SZRA 1VYKA 1MMNA 4PFPA 4A2NB 3POVA 4G7OF 3MX3A 1ZHZA 3LNRA 3AG4C 1MNDA 2QY9A 3NKDA 2MWQA 4OD5A 1NU9C 3HLZA 2OCCC 3RKOF 4O79A 3JSZA 3HJCA 2Y3BA 5E2QA 1ST6A 3JYHA 3ZG1A 2J7PA 3E9VA 4Q5SF 3T6JA 2J9UA 1FFTC 3H65A 3MLGA 1OCCC 1VOMA 1TWAA 3ASOC 3N24A 2IXMA 5T1DB 3W2WA 4YN0B 2R7QA 4AX2A 1SMYF 3M1CB 3ZIBA 4BJ5C 2YHSA 3S0XA 4BJ5A 5DS6A 3LLIA 3AG1C 4U5HA 3ABKC 4JJGA 3DM5A 2VB6A 3ITFA 4RBNA 2A6HF 1LS1A 4U5BE 1O87A 1SF8A 5E3CA 1V55C 1W2WA 2CW0F 2J7PD 3K33A 4DOZA 3T6BA 5KYWA 2XSEA 4PJJA 4JURI 4YT4A 1VYIA 4XWJA 3B9QA 2IXOA 4BG0A 4MNDA 3N0TA 1Z23A 3EJNA 5B3SC 2IYLD 2R7TA 3CZ6A 3OWTA 4DVYP 3UR3C 3F47A 3V7OA 3X2QC 3KKBA 2G3VA 3RH3A 5DQZA 2WB7A 1D0ZA 3EGXA 3EG9A 4I3MA 4H4KC 1Z63A 4QI0A 2C04A 1VMAA 3DM9B 4IAOA 2Y3GA 3Q6MA 2WZGA 4O6MA 3NRHA 2PP4A 1ZHXA 4J32B 5E33A 5E3AA 2J9WA 3LJBA 5CI8A 2ZXRA 3QMKA 2J46A 1Z5ZA 3KH2A 4EBBA 1ZHTA 4G7HF 2KNHA 1IZMA 3B0VC 2ZXWC 3UMIA 1D1BA 4JVSA 2W4BA 2FGYA 4M63A 2Q9AA 1J8YF 1J8MF 1FFHA 3Q7GA 3S27A 3ZC4A 3EGDA 2G3KA 2HV7A 4P6IC 3SEOA 4G7ZF 4KNVA 1ZHYA 1NZEA 4U5CE 4FWVA 3LAYA 1BR2A 3B0UX 4IJJA 4ZLDA 4PK4A 2R7XA 4CIHA 4PJNA 4JW1A 2R7VA 1WGWA 4YT5A 3K66A 1S7ZA 4ANJA 4AE4A 1RJ9A 2Y69C 3UNGC 1G8XA 1JPNA 5IY5C 4IRUA 3ABLC 5KYNA 2H7OA 3K1IC 1IW7F 4U5EE 3T4RA 5L3QA 4FESA 2R7OA 3W2VA 4KC9A 1M2VA 1ZYRF 3ZSUA 2EINC 4XLPF 4YT8A 4CBEA 1OCZC 3AQCA 4BEJA 3B0PA 2Z15A 4NY3A 4WJ0A 2J0WA 4LERA 5KYUA 3FDQA 3LESA 5KYXB 2WZLA 1LKXA 2V26A 4OINF 2NUPB 3UGOA 3O6XA 2DYRC 4B6IA 4I44A 2P6VA 1VK5A 2Y3DA 3DJUB 4O6YA 5F5FA 1D0YA 2Q3TA 4OD4A 2R7UA 3EZHA 3RYLA 2XXAA 3LS1A 4C3BA 2NUTA 3I4UA 3DXJF 1OCRC 4AK9A 5HSWA 3OA1A 1SZIA 4O7GA 4C3EA 2CNWD 2FFHA 1FTSA 4O6NA 5B1AC 3VYWA 2IXPA 1TWHA 1RJ9B 4HE8D 3IEEA 1ZU5A 3Q7LA 3W8HA 3EHMA 1QZXA 4E7SA 5T3TA 3NYMA 2JD3A 4BJ6C 4LLCA 3K1HA 5FCLA 4BJ6A 2EIJC 4KNWA 1JPJA 1PD1A 5EGYA 4C7OA 5DS4A 3PHF2 2WVOA 1BR4A 4MQ9F 4KI2A 3FAJA 3WG7C 5KYYA 3JT1A 4OIRF 1OCOC 4CS9C 3K7DA 4BJTA 4CS9A 3K6BA 4K0DA 3DAGA 3CSKA 5CI9A 2M4EA 1FMWA 4K7BA 4ZLCA 4DBRA 1QLEC 4HFKB 2PF4E 3TD7A 1PD0A 3RFYA 4BJ1A 5KYWB 2NG1A 1OKKD 4GYTA 4E7ZA 4OIQF 2CDQA 2KJGA 1FMVA 4FX5A 4KBLA 1MMDA 2EIMC 2WVNA 3DD7A 4U5DE 3WODF 4Q4ZF 2HV6A 4C3DA 4LACB 3Q6NA 2A6EF 3JCUQ 1Z3IX 1O5HA 5DLJA 4DVZA 5BUOA 1TKNA 5EHHA 4N06A 2WZFA 3F46A 3LLKA 1N1CA 2PFDA 1MMGA 3UMKA 3EGXB 3EG9B 4CS8C 2W4MA 3KMIA 3QZCA 4CS8A 2ZXOA 2R7WA 2O9XA 5F5HA 3AG3C 2A69F 3ZVRA 5L3VA 4Q7CA 1PCXA 2R7RA 2DYSC 4XTKA 4HFFB 2W9YA 4RD9A 3GODA 3LEVA 2IOQA 1MMAA 2B0JA 4QDLA 5KYYB 3O39A 3EPVA 1TWCA 4YWQA 3UMHA 3DZAA 1NU7D 2A68F 2GFHA 3L34A 3FHDA 3DMDA 2ZPAA 4IWBA 4JCHA 5D91A 2OG2A 4RDAA 3DJNB 1LVKA 1ZU4A 4F4BA 1D1AA 4OIPF 2CNWA 4X0RA 2Q9BA 3NYJA 2KGOA 4GEHA 3EGDB 2VH3A 4PFOA 3DAFA 3EFOA 4JJFA 2W45A 3S29A 2H7VC 3EZIA 4YJWA 4LLEA 3AG2C 3SNHA 5DQTA 3LS0A 2PX0A 1V54C 3EH1A 1KU2A 3SP1A 3W8IA 3EH2A 3NG1A 2CGEA 2LSEA 2J45A 3SYNA 2H7BA 2J0XA 4ULWA 1TWGA 3UGPA 4AE4B 2KW3C 4YT2A 1D0XA 3HTKC 1M56C 2DGJA 2PX3A 4XLNF 3FVYA 1M2VB 5T3WA 3ECSA 5D92A 2Y3HA 1ZHWA 1OKKA 4JZAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UMK A;  3QMK A;  3PMR A;  4RD9 A;  3NYJ A;  3Q7G A;  3UMH A;  4YN0 B;  3UMI A;  3Q7L A;  3K6B A;  1TKN A;  5BUO A;  3NYL A;  3K66 A;  4RDA A; 
#chains in the Genus database with same CATH topology
 1OXB A;  4OIO F;  2D5R B;  2XLH A;  3SXM A;  3GWL A;  4MW3 A;  4XPX A;  2IBF A;  2XRH A;  4N4W A;  4I1M A;  5DS5 A;  4ULV A;  2EIL C;  4U5F E;  2YEV A;  5COF A;  1GS9 A;  5KYU B;  3JRT A;  4JRZ A;  5DVW A;  3AQB A;  2VCA A;  3V5Z A;  5JSL A;  5K0I A;  3N2Z B;  1BR1 A;  2L81 A;  4E0H A;  1D1C A;  2JX0 A;  4YK5 A;  4DRH B;  2C03 A;  3FXH A;  3U3B A;  2QTV A;  3TJ5 A;  3NKE A;  5AC5 A;  3QTH A;  4N6C A;  3MYF A;  2YVK A;  4I1O B;  1ORY A;  2R05 A;  2XL4 A;  1NBB A;  1TR2 A;  3EHN A;  3L8J A;  3OEO A;  3ABM C;  4HEA J;  5TJ5 E;  3LEO A;  4JC7 A;  1NG1 A;  4CS7 A;  4A4A A;  4W8K A;  4U5G A;  3L0I A;  3GAN A;  4N6H A;  1QQ3 A;  3NYL A;  2XXA B;  3C8G D;  2P7V A;  1M2O A;  2QUP A;  2WL8 A;  3EFO B;  2J9V A;  4J30 B;  3W4Y A;  3QVY A;  1AUE A;  2NUT B;  5BQI A;  2JPU A;  2KQ9 A;  1K05 A;  3GWN A;  4G0H A;  1NLX A;  3RIP A;  5KYX A;  3U8V A;  4BEM J;  2KK1 A;  2NUP A;  2G62 A;  2HZ8 A;  3HNJ A;  2I8B A;  2XLO A;  2IXN A;  3DWW A;  3LUT B;  2A1D D;  5HV9 A;  2YZS A;  3VAY A;  4QI2 A;  2YL3 A;  1M57 C;  1Z6A A;  2V3C C;  3I5P A;  4LDK A;  2EPL X;  2R7S A;  4PJM A;  5JS5 A;  1JMW A;  4MW8 A;  3ASN C;  3GEE A;  2XLV A;  2X51 A;  4PJL A;  5B1B C;  4CDA A;  2ZXP A;  3JTL O;  3KYJ A;  4EWC A;  2Y39 A;  1ZZP A;  1YA7 O;  4JKV A;  2BE5 F;  4CSA C;  1M6T A;  3S28 A;  3NDB B;  4DBQ A;  1E85 A;  4CSA A;  2E87 A;  3CQZ A;  5FZT A;  3I5Q A;  2EIK C;  2VAS A;  3KL4 A;  3PMR A;  3EQL F;  1XZP A;  3U5S A;  2MYS A;  3RQF A;  2Q9C A;  5L0C A;  1L3P A;  2WVQ A;  3E70 C;  1MNE A;  3R2P A;  1GQA A;  2L9J A;  4C7O B;  3X1O A;  2L6G A;  3SZR A;  1VYK A;  1MMN A;  4PFP A;  4A2N B;  1HMD A;  3NMJ A;  3T9O A;  3POV A;  2EPK X;  4G7O F;  3MX3 A;  1ZHZ A;  3LNR A;  1JRA A;  3AG4 C;  2HSB A;  1MND A;  2QY9 A;  3NKD A;  2MWQ A;  4OD5 A;  3TUL A;  4JE9 A;  1NU9 C;  2OCC C;  3HLZ A;  3RKO F;  4O79 A;  3JSZ A;  3HJC A;  2Y3B A;  2PBE A;  4IAR A;  4P9F A;  3ZQY A;  2YQY A;  1OR3 A;  4H54 A;  2HUJ A;  1L7C A;  1ST6 A;  1WAT A;  3JYH A;  5E2Q A;  3ZG1 A;  5JRA A;  2J7P A;  3E9V A;  1JAF A;  2MHR A;  4K1O A;  3C8Z A;  2J9U A;  3T6J A;  4Q5S F;  2QNL A;  1Y6D A;  1FFT C;  3L1M A;  2VCB A;  3H65 A;  3MLG A;  3S90 A;  1OCC C;  2NSG A;  1BDJ B;  1VOM A;  1TWA A;  3ASO C;  3N24 A;  2IXM A;  4D4N A;  5T1D B;  1ORS C;  4NTB A;  1LS4 A;  3W2W A;  3J06 A;  4YN0 B;  2R7Q A;  4AX2 A;  1SMY F;  2YL0 A;  3M1C B;  1H6G A;  3ZIB A;  2YHS A;  4BJ5 C;  3S0X A;  4BJ5 A;  5DS6 A;  3LLI A;  3AG1 C;  4U5H A;  3ABK C;  3TK0 A;  5A6K A;  4JJG A;  4ONS A;  2L7A A;  3DM5 A;  2XL8 A;  3R7C A;  1U89 A;  2VB6 A;  3ITF A;  1FAP B;  2A6H F;  1T6U A;  4RBN A;  1OQC A;  4JTA B;  1LS1 A;  3IQC A;  2EPM X;  4U5B E;  1O87 A;  2XM0 A;  1SF8 A;  4W8P A;  5E3C A;  1V55 C;  1W2W A;  2CW0 F;  2J7P D;  3K33 A;  1RKE A;  4DOZ A;  3T6B A;  1SYQ A;  5KYW A;  4E18 A;  1YLM A;  2XSE A;  4PJJ A;  4WAB A;  4E0I A;  5L0G A;  2RD9 A;  1MQV A;  4WGZ A;  4JUR I;  1QSP A;  2KSF A;  2XLD A;  2XL6 A;  4YT4 A;  2R03 A;  3M4B A;  4EBK A;  4G78 A;  2ASR A;  1VYI A;  4XEF A;  3CEX A;  2TMV P;  3DI5 A;  1OXK A;  1I5N A;  4XWJ A;  3B9Q A;  2IXO A;  5L0F A;  1ORJ A;  3DE8 A;  4BG0 A;  1APC A;  4MND A;  2CYD A;  3IPM O;  2LQG A;  3JSE O;  3M15 A;  3JRM O;  3N0T A;  1Z23 A;  3B29 A;  3EJN A;  2HJM A;  5B3S C;  2IYL D;  2EPO A;  1CGM E;  3C8G A;  2R7T A;  3RVZ A;  3S9O A;  3CZ6 A;  3OWT A;  2XLW A;  4DVY P;  2P61 A;  3UR3 C;  3F47 A;  3V7O A;  3X2Q C;  3KKB A;  2G3V A;  2XS8 A;  3KPH A;  1U6H A;  3RH3 A;  1E2X A;  2J8W A;  5DQZ A;  1CPQ A;  3ZWI A;  4PAC A;  3TQO A;  2VCC A;  2WB7 A;  4AL1 A;  1GM5 A;  1LM3 B;  1D0Z A;  1R5I D;  1EA8 A;  2DI3 A;  2H8A A;  3EGX A;  3EG9 A;  3MBG A;  4H4K C;  2YL7 A;  4I3M A;  3ZDL A;  3QW1 A;  3RQE A;  1Z63 A;  4MVZ A;  1HW2 A;  3FMS A;  1ZW3 A;  4QI0 A;  2ZD9 A;  3GM3 A;  3A9C A;  1I4Z A;  2C04 A;  1VMA A;  2GAQ A;  3DM9 B;  3HNK A;  3S84 A;  4IAO A;  4XEK A;  5L0D A;  2Y3G A;  3Q6M A;  2WZG A;  5GPG B;  5CIV A;  4JEA A;  5A6B D;  4O6M A;  3NRH A;  2PP4 A;  1ZHX A;  4J32 B;  4J7T A;  2YWA A;  5E33 A;  3GEH A;  5AC4 A;  1VLS A;  5E3A A;  1V4A A;  2J9W A;  1Q0M A;  3LJB A;  1YVI A;  1YYX A;  1YZA A;  2ZXR A;  3QMK A;  4U9D A;  5CI8 A;  3TOM A;  1ZVZ A;  2R9R B;  2J46 A;  1Z5Z A;  3KH2 A;  1NFN A;  4EBB A;  1ZHT A;  1HMO A;  4EHP A;  4G7H F;  1HW1 A;  2LCH A;  4JTC B;  2KNH A;  1IZM A;  3B0V C;  1YDI A;  2KC3 A;  3U0C A;  2ZXW C;  3L8I A;  3UMI A;  1T6Q A;  1D1B A;  4JVS A;  3SXY A;  2W4B A;  2FGY A;  3G4X A;  4JTD B;  4M63 A;  2Q9A A;  3H2U A;  5B3I A;  1J8Y F;  1J8M F;  3GOR A;  1CGO A;  1VB5 A;  1FFH A;  2HMZ A;  3Q7G A;  3S27 A;  3ZC4 A;  3EGD A;  3US6 A;  4D4X A;  1C03 A;  2G3K A;  2HV7 A;  4P6I C;  3SEO A;  4G7Z F;  4U9E A;  2QE9 A;  4NC3 A;  2NPU A;  2AWC A;  4KNV A;  1ZHY A;  1NZE A;  2DB4 A;  4U5C E;  3ZTZ A;  2VC9 A;  2OJQ A;  3LNM B;  1RCP A;  4FWV A;  1EQ1 A;  3LAY A;  1BR2 A;  3B0U X;  4IJJ A;  4ZLD A;  3VF0 A;  4PK4 A;  2R7X A;  3RQG A;  4CIH A;  1XWJ A;  1LPE A;  2HSQ A;  1R4T A;  4PJN A;  2UUI A;  4JW1 A;  2X0C A;  2R7V A;  1WGW A;  3C8G B;  1YAU O;  3M79 A;  1I4Y A;  4CDY A;  4YT5 A;  3K66 A;  1S7Z A;  4ANJ A;  5EK0 A;  4AE4 A;  1RJ9 A;  2BL2 A;  2Y69 C;  3UNG C;  1WWP A;  1G8X A;  3G50 A;  3QW0 A;  1JPN A;  5IY5 C;  1EKY A;  4DXW A;  4IRU A;  5JVE A;  2A0B A;  3ABL C;  5KYN A;  2H7O A;  1K04 A;  1A41 A;  1IW7 F;  1HE1 A;  1PV3 A;  3K1I C;  4U5E E;  3T4R A;  5L3Q A;  2YKZ A;  3K1I A;  4FES A;  1RKC A;  2R7O A;  3W2V A;  1E84 A;  4KC9 A;  1M2V A;  3QVZ A;  4FAP B;  1ZYR F;  1Q0F A;  3IQ6 A;  2EIN C;  3ZSU A;  4XLP F;  4MVO A;  4NTA A;  1Z7Q c;  4EBJ A;  4YT8 A;  4CBE A;  1OCZ C;  3AQC A;  3MFN A;  4BEJ A;  3B0P A;  4EUK B;  1YAR O;  2Z15 A;  2LP4 A;  3RW0 A;  2QLA A;  4CDV A;  4NY3 A;  4J7Y A;  4CJG A;  2R7U A;  4WJ0 A;  1A7V A;  2J0W A;  4LER A;  3O55 A;  5KYU A;  2LD6 A;  3FDQ A;  3LES A;  5KYX B;  2WZL A;  5A6J A;  1LKX A;  2V26 A;  4OIN F;  2NUP B;  4L6R A;  3UGO A;  3B71 A;  3KYI A;  2XS1 A;  4CX9 A;  1BZ4 A;  3C63 A;  3AGT A;  5COM A;  3O6X A;  2YLI A;  2DYR C;  4YL3 A;  2A0U A;  1Q0D A;  1QKR A;  4B6I A;  4I44 A;  1TFK B;  1VK5 A;  2P6V A;  2Y3D A;  4LDR A;  3DJU B;  2IM8 A;  4O6Y A;  5F5F A;  2Q7R A;  1D0Y A;  1UG7 A;  2Q3T A;  3DKA A;  3FOO A;  3PCV A;  2GA0 A;  4OD4 A;  4CJO A;  5L0I A;  1EI7 A;  2L6F A;  3HNL A;  3EZH A;  3RF3 A;  3RYL A;  3U2L A;  2OEX A;  2XXA A;  1B68 A;  3LS1 A;  1WOL A;  3V5Y A;  1VLT A;  5A69 A;  4C3B A;  2NUT A;  1KNY A;  1YYJ A;  3I4U A;  2LK4 A;  2J9B A;  5JLI A;  4NQF A;  3IHU A;  3DXJ F;  5AGF A;  3AOU A;  1NFO A;  1OCR C;  4AK9 A;  5HSW A;  2HFI A;  2I15 A;  3JYY A;  1RMV A;  3OA1 A;  1SZI A;  1DOV A;  3TJ6 A;  1FNT c;  1YJG A;  4O7G A;  4LDQ A;  2CNW D;  2FFH A;  1FTS A;  5COG A;  4C3E A;  5A6B A;  4O6N A;  5B1A C;  3VYW A;  3PDM P;  1Q0G A;  2IXP A;  1TWH A;  1RJ9 B;  4MTO A;  4HE8 D;  1YA9 A;  1S05 A;  1WAS A;  3NMI A;  3IEE A;  1ZU5 A;  2Q4F A;  3Q7L A;  4MVS A;  4XPW A;  3W8H A;  1Y4C A;  3BEH A;  5L0J A;  3EHM A;  1QZX A;  4E7S A;  5BQH A;  5T3T A;  1KTM A;  2YRF A;  3NYM A;  1A0B A;  2JD3 A;  4BJ6 C;  4LLC A;  3K1H A;  5FCL A;  3ZTM A;  4BJ6 A;  2YL1 A;  2EIJ C;  3U9J A;  4KNW A;  1JPJ A;  1OW7 A;  2AP3 A;  1PD1 A;  1E86 A;  1LE2 A;  1AVO B;  5EGY A;  4C7O A;  5DS4 A;  3PHF 2;  2WVO A;  1BR4 A;  2P0N A;  3GM1 A;  2B0H A;  3MYI A;  4MQ9 F;  2HS5 A;  4KI2 A;  1XZQ A;  2L6H A;  3WHN A;  3FAJ A;  3WG7 C;  1V74 B;  5KYY A;  2HKV A;  4E17 A;  1T5O A;  2OQM A;  3JT1 A;  3FAP B;  4MS2 A;  4OIR F;  1OCO C;  4CS9 C;  3K7D A;  1OR2 A;  1H7I A;  2UUH A;  4MVQ A;  2ICW G;  4BJT A;  3HKK A;  4CS9 A;  3K6B A;  4BPM A;  4K0D A;  3DAG A;  2OU6 A;  2OEV A;  3GM2 A;  5JP7 A;  3CSK A;  5CI9 A;  2M4E A;  1WTY A;  1FMW A;  256B A;  1VTM P;  4K7B A;  3TOL A;  4ZLC A;  4DBR A;  2GDC A;  1QLE C;  3A11 A;  4HFK B;  3T6G B;  2PF4 E;  3IQT A;  5BQG A;  1PD0 A;  3TD7 A;  3RFY A;  4BJ1 A;  1DOW A;  1RKE B;  5KYW B;  2YLD A;  3ATP A;  1C17 M;  2NG1 A;  1OKK D;  2AVK A;  1H9T A;  4GYT A;  3RVY A;  4E7Z A;  4OIQ F;  2CDQ A;  4P9T A;  2KJG A;  1QPU A;  2EPN A;  1FMV A;  2OOC A;  2PNO A;  4FX5 A;  1MMD A;  4KBL A;  3ZQV A;  1YZC A;  2EIM C;  4R32 A;  1SR2 A;  4DRI B;  4IAQ A;  3SXZ A;  1T6I A;  2WVN A;  3DD7 A;  4U5D E;  3VRC A;  3WOD F;  3H2V A;  4Q4Z F;  2HV6 A;  4C3D A;  4LAC B;  3Q6N A;  5A6A A;  2A6E F;  3JCU Q;  1H9G A;  1Z3I X;  1O5H A;  4MTF A;  2XM4 A;  3AJM A;  3C7J A;  4IGG A;  3V5X A;  2HMQ A;  5DLJ A;  4DVZ A;  5BUO A;  4IB4 A;  1TKN A;  5EHH A;  1FR0 A;  4N06 A;  2WZF A;  4YL1 A;  3IQ5 A;  2XLE A;  3F46 A;  3LLK A;  2F22 A;  4XPY A;  3WAQ A;  5F28 E;  1CGN A;  1N1C A;  3U2M A;  2NSF A;  5JUA A;  3AGU A;  3DE9 A;  1CPR A;  1HY5 A;  2PFD A;  4ER9 A;  1MMG A;  3UMK A;  2P1A A;  3EGX B;  2XLM A;  3EG9 B;  4MTG A;  1A7E A;  2OKU A;  2OJE D;  3O10 A;  1G4W R;  4YL0 A;  2R25 A;  4CS8 C;  2W4M A;  4EKW A;  3KMI A;  3QZC A;  2YLG A;  1T9K A;  4CS8 A;  2ZXO A;  1T01 A;  4NCQ A;  2R7W A;  2O9X A;  3C62 A;  3AG3 C;  2A69 F;  1A7D A;  3BRJ A;  5F5H A;  4XQ1 A;  3ZVR A;  1NSG B;  5L3V A;  4UDV A;  4Q7C A;  1PCX A;  2R7R A;  1OKK A;  1AEP A;  2DYS C;  4AL0 A;  4XTK A;  4HFF B;  2BC5 A;  4DRJ B;  2W9Y A;  4RD9 A;  3GOD A;  3LEV A;  1C02 A;  2IOQ A;  1MMA A;  2B0J A;  4QDL A;  1G5Z A;  5KYY B;  3O39 A;  2LFF A;  1LI7 A;  4JIO A;  3EPV A;  1TWC A;  4YWQ A;  3UMH A;  3DZA A;  1NU7 D;  1TFO B;  3G4Z A;  2A68 F;  2GFH A;  3L34 A;  3FHD A;  4MVU A;  4CIP A;  3U8P A;  3DMD A;  2ZPA A;  4IWB A;  4JEB A;  4JCH A;  5D91 A;  2OG2 A;  1LE4 A;  3DJN B;  4RDA A;  3HNI A;  1O3U A;  2R02 A;  4Z9I A;  1JR8 A;  2M64 A;  5JT4 A;  3VM6 A;  1LVK A;  3GEI A;  1G4U S;  1ZU4 A;  3SXK A;  2AWY A;  4F4B A;  1D1A A;  4OIP F;  2CNW A;  4X0R A;  1ZW2 A;  2LIG A;  1QVX A;  2Q9B A;  1K40 A;  3NYJ A;  1JOG A;  2KGO A;  4GEH A;  4GQH A;  3EGD B;  2VH3 A;  4PFO A;  4MVM A;  3U9M A;  1F1M A;  3NMK A;  3DAF A;  3EFO A;  4JJF A;  2W45 A;  3S29 A;  2H7V C;  3CAX A;  3EZI A;  1UFB A;  1TQG A;  4Z9H A;  2GWW A;  4YJW A;  4LLE A;  1Q0K A;  3AG2 C;  3SNH A;  4EIY A;  2D4U A;  4Z9J A;  5DQT A;  3LS0 A;  2PX0 A;  1V54 C;  2LFD A;  3EH1 A;  1KU2 A;  3SP1 A;  3W8I A;  2RSE B;  3EH2 A;  3NG1 A;  2CGE A;  2KYH A;  3C18 A;  4DJ9 A;  1LI5 A;  1OW8 A;  2ETS A;  2LSE A;  3M4C A;  2J45 A;  1BBH A;  2FAP B;  2H7B A;  2J0X A;  4NTF A;  4ULW A;  3SYN A;  1E83 A;  1TWG A;  3UGP A;  4JCZ A;  1U0B B;  1LIH A;  1OW6 A;  2Q00 A;  4AE4 B;  5L0H A;  2KW3 C;  3JZ0 A;  4MVR A;  3FOP A;  4YT2 A;  1D0X A;  1GGQ A;  3HTK C;  1M56 C;  2DGJ A;  2PX3 A;  4PR9 A;  4XLN F;  3FVY A;  2AU5 A;  2CCY A;  1M2V B;  1HE9 A;  5T3W A;  4XEV A;  3ECS A;  3U3F A;  1WN0 A;  5D92 A;  4WGY A;  2Y3H A;  1RXQ A;  1ZHW A;  2HJ3 A;  4JZA A; 
#chains in the Genus database with same CATH homology
 4OIO F;  2D5R B;  5DS5 A;  2XRH A;  4I1M A;  2EIL C;  4U5F E;  2YEV A;  5KYU B;  3JRT A;  5DVW A;  3AQB A;  3N2Z B;  1BR1 A;  2L81 A;  1D1C A;  2C03 A;  2QTV A;  3NKE A;  4I1O B;  2XL4 A;  1TR2 A;  3EHN A;  3OEO A;  3ABM C;  4HEA J;  1NG1 A;  4CS7 A;  4W8K A;  4U5G A;  3L0I A;  3GAN A;  3NYL A;  2XXA B;  2P7V A;  1M2O A;  2WL8 A;  3EFO B;  2J9V A;  4J30 B;  2NUT B;  2KQ9 A;  3RIP A;  4G0H A;  5KYX A;  2NUP A;  2G62 A;  2I8B A;  2IXN A;  2A1D D;  2YZS A;  3VAY A;  4QI2 A;  1M57 C;  1Z6A A;  2V3C C;  3I5P A;  2R7S A;  4PJM A;  3ASN C;  4PJL A;  4EWC A;  2X51 A;  5B1B C;  2ZXP A;  2Y39 A;  4CSA C;  2BE5 F;  3S28 A;  3NDB B;  4DBQ A;  4CSA A;  2E87 A;  3CQZ A;  3I5Q A;  2EIK C;  2VAS A;  3KL4 A;  3PMR A;  3EQL F;  2MYS A;  2Q9C A;  2WVQ A;  3E70 C;  1MNE A;  2L9J A;  4C7O B;  3X1O A;  3SZR A;  1VYK A;  1MMN A;  4PFP A;  4A2N B;  3POV A;  4G7O F;  3MX3 A;  1ZHZ A;  3LNR A;  3AG4 C;  1MND A;  2QY9 A;  3NKD A;  2MWQ A;  4OD5 A;  1NU9 C;  3HLZ A;  2OCC C;  3RKO F;  4O79 A;  3JSZ A;  3HJC A;  2Y3B A;  5E2Q A;  1ST6 A;  3JYH A;  3ZG1 A;  2J7P A;  3E9V A;  4Q5S F;  3T6J A;  2J9U A;  1FFT C;  3H65 A;  3MLG A;  1OCC C;  1VOM A;  1TWA A;  3ASO C;  3N24 A;  2IXM A;  5T1D B;  3W2W A;  4YN0 B;  2R7Q A;  4AX2 A;  1SMY F;  3M1C B;  3ZIB A;  4BJ5 C;  2YHS A;  3S0X A;  4BJ5 A;  5DS6 A;  3LLI A;  3AG1 C;  4U5H A;  3ABK C;  4JJG A;  3DM5 A;  2VB6 A;  3ITF A;  4RBN A;  2A6H F;  1LS1 A;  4U5B E;  1O87 A;  1SF8 A;  5E3C A;  1V55 C;  1W2W A;  2CW0 F;  2J7P D;  3K33 A;  4DOZ A;  3T6B A;  5KYW A;  2XSE A;  4PJJ A;  4JUR I;  4YT4 A;  1VYI A;  4XWJ A;  3B9Q A;  2IXO A;  4BG0 A;  4MND A;  3N0T A;  1Z23 A;  3EJN A;  5B3S C;  2IYL D;  2R7T A;  3CZ6 A;  3OWT A;  4DVY P;  3UR3 C;  3F47 A;  3V7O A;  3X2Q C;  3KKB A;  2G3V A;  3RH3 A;  5DQZ A;  2WB7 A;  1D0Z A;  3EGX A;  3EG9 A;  4I3M A;  4H4K C;  1Z63 A;  4QI0 A;  2C04 A;  1VMA A;  3DM9 B;  4IAO A;  2Y3G A;  3Q6M A;  2WZG A;  4O6M A;  3NRH A;  2PP4 A;  1ZHX A;  4J32 B;  5E33 A;  5E3A A;  2J9W A;  3LJB A;  5CI8 A;  2ZXR A;  3QMK A;  2J46 A;  1Z5Z A;  3KH2 A;  4EBB A;  1ZHT A;  4G7H F;  2KNH A;  1IZM A;  3B0V C;  2ZXW C;  3UMI A;  1D1B A;  4JVS A;  2W4B A;  2FGY A;  4M63 A;  2Q9A A;  1J8Y F;  1J8M F;  1FFH A;  3Q7G A;  3S27 A;  3ZC4 A;  3EGD A;  2G3K A;  2HV7 A;  4P6I C;  3SEO A;  4G7Z F;  4KNV A;  1ZHY A;  1NZE A;  4U5C E;  4FWV A;  3LAY A;  1BR2 A;  3B0U X;  4IJJ A;  4ZLD A;  4PK4 A;  2R7X A;  4CIH A;  4PJN A;  4JW1 A;  2R7V A;  1WGW A;  4YT5 A;  3K66 A;  1S7Z A;  4ANJ A;  4AE4 A;  1RJ9 A;  2Y69 C;  3UNG C;  1G8X A;  1JPN A;  5IY5 C;  4IRU A;  3ABL C;  5KYN A;  2H7O A;  3K1I C;  1IW7 F;  4U5E E;  3T4R A;  5L3Q A;  4FES A;  2R7O A;  3W2V A;  4KC9 A;  1M2V A;  1ZYR F;  3ZSU A;  2EIN C;  4XLP F;  4YT8 A;  4CBE A;  1OCZ C;  3AQC A;  4BEJ A;  3B0P A;  2Z15 A;  4NY3 A;  4WJ0 A;  2J0W A;  4LER A;  5KYU A;  3FDQ A;  3LES A;  5KYX B;  2WZL A;  1LKX A;  2V26 A;  4OIN F;  2NUP B;  3UGO A;  3O6X A;  2DYR C;  4B6I A;  4I44 A;  2P6V A;  1VK5 A;  2Y3D A;  3DJU B;  4O6Y A;  5F5F A;  1D0Y A;  2Q3T A;  4OD4 A;  2R7U A;  3EZH A;  3RYL A;  2XXA A;  3LS1 A;  4C3B A;  2NUT A;  3I4U A;  3DXJ F;  1OCR C;  4AK9 A;  5HSW A;  3OA1 A;  1SZI A;  4O7G A;  4C3E A;  2CNW D;  2FFH A;  1FTS A;  4O6N A;  5B1A C;  3VYW A;  2IXP A;  1TWH A;  1RJ9 B;  4HE8 D;  3IEE A;  1ZU5 A;  3Q7L A;  3W8H A;  3EHM A;  1QZX A;  4E7S A;  5T3T A;  3NYM A;  2JD3 A;  4BJ6 C;  4LLC A;  3K1H A;  5FCL A;  4BJ6 A;  2EIJ C;  4KNW A;  1JPJ A;  1PD1 A;  5EGY A;  4C7O A;  5DS4 A;  3PHF 2;  2WVO A;  1BR4 A;  4MQ9 F;  4KI2 A;  3FAJ A;  3WG7 C;  5KYY A;  3JT1 A;  4OIR F;  1OCO C;  4CS9 C;  3K7D A;  4BJT A;  4CS9 A;  3K6B A;  4K0D A;  3DAG A;  3CSK A;  5CI9 A;  2M4E A;  1FMW A;  4K7B A;  4ZLC A;  4DBR A;  1QLE C;  4HFK B;  2PF4 E;  3TD7 A;  1PD0 A;  3RFY A;  4BJ1 A;  5KYW B;  2NG1 A;  1OKK D;  4GYT A;  4E7Z A;  4OIQ F;  2CDQ A;  2KJG A;  1FMV A;  4FX5 A;  4KBL A;  1MMD A;  2EIM C;  2WVN A;  3DD7 A;  4U5D E;  3WOD F;  4Q4Z F;  2HV6 A;  4C3D A;  4LAC B;  3Q6N A;  2A6E F;  3JCU Q;  1Z3I X;  1O5H A;  5DLJ A;  4DVZ A;  5BUO A;  1TKN A;  5EHH A;  4N06 A;  2WZF A;  3F46 A;  3LLK A;  1N1C A;  2PFD A;  1MMG A;  3UMK A;  3EGX B;  3EG9 B;  4CS8 C;  2W4M A;  3KMI A;  3QZC A;  4CS8 A;  2ZXO A;  2R7W A;  2O9X A;  5F5H A;  3AG3 C;  2A69 F;  3ZVR A;  5L3V A;  4Q7C A;  1PCX A;  2R7R A;  2DYS C;  4XTK A;  4HFF B;  2W9Y A;  4RD9 A;  3GOD A;  3LEV A;  2IOQ A;  1MMA A;  2B0J A;  4QDL A;  5KYY B;  3O39 A;  3EPV A;  1TWC A;  4YWQ A;  3UMH A;  3DZA A;  1NU7 D;  2A68 F;  2GFH A;  3L34 A;  3FHD A;  3DMD A;  2ZPA A;  4IWB A;  4JCH A;  5D91 A;  2OG2 A;  4RDA A;  3DJN B;  1LVK A;  1ZU4 A;  4F4B A;  1D1A A;  4OIP F;  2CNW A;  4X0R A;  2Q9B A;  3NYJ A;  2KGO A;  4GEH A;  3EGD B;  2VH3 A;  4PFO A;  3DAF A;  3EFO A;  4JJF A;  2W45 A;  3S29 A;  2H7V C;  3EZI A;  4YJW A;  4LLE A;  3AG2 C;  3SNH A;  5DQT A;  3LS0 A;  2PX0 A;  1V54 C;  3EH1 A;  1KU2 A;  3SP1 A;  3W8I A;  3EH2 A;  3NG1 A;  2CGE A;  2LSE A;  2J45 A;  3SYN A;  2H7B A;  2J0X A;  4ULW A;  1TWG A;  3UGP A;  4AE4 B;  2KW3 C;  4YT2 A;  1D0X A;  3HTK C;  1M56 C;  2DGJ A;  2PX3 A;  4XLN F;  3FVY A;  1M2V B;  5T3W A;  3ECS A;  5D92 A;  2Y3H A;  1ZHW A;  1OKK A;  4JZA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...