4ZLDA

Crystal structure of human roquin-2 roq domain in complex with roquin cde rna
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
151
structure length
151
Chain Sequence
QNPQQLSANLWAAVRARGCQFLGPAMQEEALKLVLLALEDGSALSRKVLVLFVVQRLEPRFPQASKTSIGHVVQLLYRASCFKVTKRDEDSSLMQLKEEFRSYEALRREHDAQIVHIAMEAGLRISPEQWSSLLYGDLAHKSHMQSIIDKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Rna binding protein/rna
molecule keywords Roquin-2
publication title Structure of human Roquin-2 and its complex with constitutive-decay element RNA
pubmed doi rcsb
source organism Homo sapiens
total genus 58
structure length 151
sequence length 151
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2015-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18386 ROQ_II Roquin II domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1790 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4zldA00
4QI2A 4QI0A 4ZLCA 3X1OA 4YWQA 5F5HA 5F5FA 4ZLDA 4ULWA
chains in the Genus database with same CATH superfamily
1M2VB 1RMVA 2EINC 3EGDA 4MTOA 3K7DA 1HW2A 4MVMA 4HFKB 4P9FA 3B9QA 3G4XA 1NZEA 2R05A 3SXYA 1EQ1A 3PCVA 3SXMA 1ZHWA 1LI7A 2XM0A 3ZTZA 4D4NA 1VLTA 5T3TA 3HNJA 3QZCA 4O79A 3LAYA 3LEVA 4KBLA 3LS1A 4JZAA 2C04A 1U89A 1YA7O 3Q6NA 1MMDA 1AUEA 2YWAA 4F4BA 5DVWA 4E0HA 3JRMO 4YT2A 2P1AA 1WN0A 1Y6DA 5EK0A 4W8KA 3CQZA 2NSGA 3X1OA 1QKRA 3KMIA 2HV6A 3M4CA 4KNWA 1DOWA 4ULVA 2QLAA 3KH2A 1E2XA 2LSEA 1YARO 2L7AA 1HMOA 2X51A 3LLIA 5A69A 2XS1A 4XLPF 4CJGA 3BRJA 2R7XA 2UUIA 3RW0A 4DRJB 2YVKA 2XLVA 5KYNA 3AG1C 2VASA 4MVSA 4JKVA 4C7OA 1ZW3A 3W4YA 4E0IA 2Q4FA 3EG9A 4QI0A 4YL1A 4IARA 2HUJA 2XLWA 3EH1A 4BJ5A 1JMWA 1S7ZA 2F22A 2Y69C 4JCZA 2G62A 2HSBA 2YLDA 4FAPB 1RJ9B 4MW8A 3GM1A 4U5DE 5BQGA 1LE4A 3CSKA 5KYXB 4IGGA 1H6GA 4JTAB 4M63A 1BDJB 3MBGA 3BEHA 3DM9B 3QW0A 4NQFA 3EQLF 4WGZA 3RH3A 3T6BA 4K7BA 2KW3C 5GPGB 1R5ID 3FAJA 4NTBA 3Q6MA 5JLIA 4CS8C 2IBFA 2Y3HA 2I8BA 4B6IA 2JD3A 3ZQYA 3DAGA 1JPJA 4W8PA 3HKKA 5DS4A 3AQBA 4ONSA 2ZXOA 2R7UA 1LPEA 3K1HA 2OEXA 3NMJA 5L3QA 1FMWA 4OIOF 1Z23A 2XL4A 3W2WA 4P6IC 5DQTA 2MYSA 1VTMP 3F46A 3IQ6A 3TK0A 1WASA 2NUPB 2XL8A 4AL1A 2IXPA 2KYHA 1V74B 5JS5A 1S05A 1GM5A 2J46A 3QVYA 3T4RA 4BPMA 1OCCC 4U9EA 4PJJA 3DM5A 3CAXA 2TMVP 3IEEA 3NMKA 1NFNA 2V3CC 2H7BA 3EJNA 2XL6A 4O7GA 2W4BA 1R4TA 3C8GA 5T3WA 4CDYA 3C63A 5L3VA 3RFYA 1LVKA 4CIHA 3T9OA 2BE5F 2J9VA 2YRFA 1LKXA 3ABMC 3TOMA 1DOVA 2HKVA 2XLOA 3VYWA 1NG1A 2DGJA 3U2LA 1XZPA 4JEAA 4KNVA 3ZVRA 3N24A 3GEEA 5JT4A 1M2VA 3DAFA 4MVRA 5KYYA 5KYWB 3KL4A 1JOGA 4EIYA 3LUTB 2UUHA 1LS4A 4CBEA 2QTVA 1KTMA 1T9KA 4BJ5C 1E83A 3O39A 1TWHA 1MNEA 1OCZC 3IHUA 3HNKA 1VYKA 1J8YF 2LD6A 3LEOA 5EGYA 4YJWA 4G0HA 5DS6A 3HJCA 1TKNA 4DRIB 4JJGA 2R7WA 2EPKX 1OKKD 1ORSC 3NKDA 3U5SA 2R7TA 1MMGA 3AQCA 2ZXWC 3MFNA 4AE4B 3NYJA 3QTHA 1K05A 1RKEB 1M56C 4MS2A 3H65A 2IXNA 2OQMA 1XZQA 3FOPA 1K04A 4IB4A 2W9YA 1ZHZA 2J7PA 3C8ZA 2OOCA 1T6QA 1PV3A 4PFOA 1A41A 2C03A 3DJUB 1CGME 4OIQF 1V4AA 2H7OA 1BBHA 3JZ0A 4O6MA 4E7SA 4IWBA 3IQCA 2P61A 3S90A 5L0IA 1TWCA 2ZXRA 3NG1A 4LLCA 2NUTA 3T6GB 1PD1A 2E87A 3DI5A 5E3AA 3NMIA 4MVZA 2ASRA 1ZZPA 3MYIA 4UDVA 3H2VA 3HTKC 4U5GA 4RBNA 2YHSA 3GORA 4XPYA 3JSEO 4H4KC 5L0GA 5B3IA 3U0CA 1FFTC 2R9RB 2DYSC 4JVSA 4QDLA 2P6VA 4YN0B 1OW8A 2M4EA 2NG1A 5KYXA 4PJMA 3T6JA 4LDQA 2YEVA 4ULWA 4J7TA 2LCHA 1YZCA 2X0CA 2R7RA 3FOOA 1Y4CA 4NCQA 5B1BC 3L1MA 3AOUA 4J32B 4JRZA 3VM6A 3R7CA 3FVYA 1UFBA 4JW1A 1M2OA 3TULA 4Q5SF 2OEVA 4MTGA 2I15A 3C18A 2OJQA 1YZAA 4EKWA 1B68A 2QY9A 3DE9A 3FXHA 2XXAA 2OCCC 5COFA 3KYIA 2Y3GA 4OIPF 1ZVZA 3NRHA 5HV9A 3SXZA 3U9MA 3DMDA 4N6CA 1SR2A 1T6UA 2NSFA 4CX9A 5EHHA 1LIHA 4BG0A 2MHRA 3ASOC 3DZAA 3IPMO 5F5HA 4CS7A 1Z63A 1C02A 2JPUA 4NC3A 4KI2A 2OJED 4EWCA 2QUPA 3QMKA 5AC4A 4PACA 2NUPA 3N0TA 3M79A 1I4ZA 4MVOA 4BJ6A 1U0BB 3LNRA 2HS5A 2OG2A 4JTDB 5D92A 2AVKA 5DLJA 4EBKA 1FNTc 3ECSA 3S84A 3L0IA 3SEOA 2KK1A 2YL1A 1ZYRF 5BQHA 1FTSA 2KJGA 2BL2A 3W2VA 3RQEA 2B0JA 4CDVA 4CIPA 5CI9A 1T01A 2HJ3A 3M1CB 4BJTA 1FFHA 3MLGA 5D91A 3S27A 2QNLA 2VH3A 2VB6A 3A9CA 4IAOA 2ZXPA 4J7YA 4E7ZA 3E9VA 3I5QA 4DVYP 2CCYA 3FMSA 1QQ3A 5AGFA 5KYWA 4G7OF 2DB4A 3RKOF 3L34A 1EA8A 1WOLA 1A0BA 3L8JA 4CSAC 1NU9C 1OR2A 1RXQA 1VLSA 4JC7A 1ST6A 2A0BA 4K1OA 2WZGA 2R02A 1YVIA 3DD7A 4MTFA 3TJ6A 3B29A 1RCPA 3K66A 2XSEA 2HSQA 4RDAA 2PFDA 2VCBA 2CW0F 3U9JA 3UMIA 5A6BD 2L6FA 1SMYF 3RIPA 3WODF 3C8GD 1O3UA 3LESA 4DBQA 1RKEA 1AVOB 2W4MA 2XLDA 4DJ9A 3GEIA 1QVXA 4PJLA 1BR2A 2KQ9A 3DJNB 3C7JA 2WB7A 4E17A 1WWPA 2YZSA 2KNHA 1BR4A 4FWVA 5JRAA 3ABKC 2G3VA 1A7EA 1J8MF 1LS1A 1CGNA 3WAQA 1PCXA 4CJOA 4DXWA 1D1BA 2GA0A 5L0DA 3IQTA 4IJJA 4DVZA 3OEOA 4JCHA 3K6BA 4HE8D 2A6EF 3EZIA 2J9BA 1APCA 3ZQVA 3EGDB 5A6BA 1FMVA 2JX0A 4BJ6C 2R7QA 3EFOB 4P9TA 5KYUB 4AK9A 4MVUA 2R25A 2VCCA 3FAPB 3NKEA 2YLIA 5T1DB 1Z7Qc 4WGYA 4WABA 4QI2A 3B0UX 2J7PD 3MX3A 4JIOA 3RF3A 3V5YA 1E84A 2Y39A 4YL0A 4LACB 1D0YA 1Z3IX 1L3PA 2KGOA 2CDQA 3F47A 4JURI 4MNDA 4XTKA 4XPXA 4AL0A 3LS0A 4R32A 1ZW2A 2IXOA 3FHDA 4I44A 1D0XA 2J0XA 1I5NA 3H2UA 5L0JA 4NY3A 3C62A 2NPUA 2WZFA 1GGQA 1T6IA 2AP3A 2XLHA 2KSFA 4YT4A 4XLNF 4NTAA 1MQVA 4LERA 3UMKA 1SZIA 3K1IA 3A11A 3M4BA 2P7VA 1CPQA 2GDCA 1OR3A 3SZRA 4XPWA 5FZTA 2EPLX 2HZ8A 2ZD9A 1TQGA 4XEKA 2HMZA 4BEJA 4ANJA 3B0VC 2Y3DA 1F1MA 1WGWA 3JRTA 3V5XA 5BUOA 2H7VC 2A68F 2EPOA 2XRHA 1M57C 3JCUQ 1G4US 1QSPA 1WTYA 2J9UA 1VB5A 4U5BE 1BZ4A 4O6YA 3POVA 1Z5ZA 3ITFA 3E70C 3RVZA 3NYLA 2PNOA 4YWQA 4CSAA 3US6A 1Q0KA 2L6HA 4Z9IA 4OINF 1Q0MA 3AJMA 1RJ9A 3ZC4A 1N1CA 4C3DA 1ZHYA 2OU6A 4N06A 1HMDA 1C03A 2LP4A 3SYNA 1FR0A 3AG2C 3WG7C 2AWCA 3O10A 3EHMA 3GANA 3DXJF 3V7OA 2O9XA 2J45A 2ZPAA 3NYMA 4HEAJ 4JTCB 3EZHA 3S29A 4G78A 3KYJA 2Q7RA 2G3KA 5A6KA 2XS8A 3OWTA 1C17M 3U8VA 5A6JA 2ICWG 2GFHA 2YL7A 2VCAA 3I4UA 1YLMA 3EGXB 2R03A 1GQAA 3HNIA 2B0HA 2PX0A 2CNWA 3AGTA 4MVQA 1GS9A 4H54A 4LDKA 3UGOA 2MWQA 4N4WA 1NSGB 3TJ5A 3V5ZA 1OQCA 2A69F 4EHPA 1E85A 3ZDLA 256BA 4DBRA 1Q0DA 5E3CA 1ZU5A 4MQ9F 2HFIA 1A7DA 4U5EE 3RQGA 2XM4A 3DKAA 1KNYA 4BEMJ 1TFOB 2EPNA 3C8GB 3KKBA 3HNLA 2R7VA 1VYIA 1OCOC 3NDBB 4AX2A 2IOQA 5BQIA 1OCRC 3O6XA 5TJ5E 4KC9A 4E18A 2J9WA 2V26A 3AG4C 1MMNA 4PK4A 3S28A 1V54C 3K1IC 3Q7GA 5L0CA 4I1OB 2EILC 2BC5A 2J0WA 4JE9A 2AU5A 3RVYA 3EFOA 4G7HF 5KYUA 3AG3C 1G5ZA 2A0UA 5B3SC 3B71A 1V55C 1Z6AA 1O5HA 2DYRC 4RD9A 4JEBA 3CEXA 2PX3A 2EIJC 1YDIA 1G4WR 3GODA 3SNHA 2CYDA 2RD9A 1NLXA 1YYJA 1LM3B 3G4ZA 3JTLO 1YJGA 1PD0A 3JSZA 4LLEA 3HLZA 3GWLA 1EI7A 1ZU4A 2P0NA 3DWWA 2A1DD 4CS9A 2LFDA 2YKZA 2CGEA 1T5OA 4N6HA 4IAQA 5A6AA 4LDRA 1KU2A 3VAYA 2M64A 1HE1A 3ZWIA 1OXKA 3OA1A 2EPMX 2L9JA 4XEVA 2NUTB 5IY5C 4AE4A 1D0ZA 2IYLD 2D4UA 3EPVA 1CPRA 1TR2A 3LLKA 1Q0GA 3ASNC 1U6HA 3W8HA 2L81A 5AC5A 2Q9CA 1M6TA 2YL3A 3FDQA 1HE9A 1JPNA 3VF0A 4ZLDA 5CI8A 4U9DA 1OXBA 4Z9HA 2PP4A 1MNDA 4YT8A 4XWJA 4U5FE 5DQZA 1LI5A 1G8XA 4Q7CA 3JYYA 4ER9A 1AEPA 2WZLA 3O55A 4I3MA 3AGUA 1RKCA 1JAFA 3SP1A 1I4YA 3ATPA 2WVOA 2Q00A 4GQHA 2YLGA 1NFOA 3R2PA 3GWNA 3U8PA 3K33A 2HMQA 3JYHA 1XWJA 2PF4E 2XXAB 3EH2A 1O87A 3TQOA 2VC9A 3EHNA 4GYTA 2IXMA 4I1MA 4IRUA 4PR9A 2Q9AA 1CGOA 2XLEA 2XLMA 3WHNA 1LE2A 3EGXA 3Q7LA 3ABLC 1ZHXA 1A7VA 2GAQA 1SF8A 2FGYA 2WL8A 2FFHA 5HSWA 3S9OA 4WJ0A 2IM8A 1IZMA 2KC3A 3I5PA 2J8WA 1D1AA 1K40A 3QW1A 1ZHTA 5B1AC 3ZSUA 4X0RA 1JRAA 4EUKB 1D1CA 3QVZA 4BJ1A 4CDAA 3PDMP 3PMRA 4A4AA 4OD4A 5E2QA 3G50A 4C3BA 4Z9JA 2LFFA 4MW3A 4L6RA 4XEFA 4YT5A 3SXKA 4C7OB 2R7SA 3UR3C 3LNMB 2LIGA 2PBEA 3L8IA 3EG9B 3N2ZB 4FX5A 4NTFA 4XQ1A 4CS9C 4EBBA 3PHF2 4A2NB 1W2WA 1YYXA 4DOZA 1TFKB 1TWAA 3TD7A 3MYFA 3U3BA 4PFPA 5COMA 2Q9BA 3KPHA 1YAUO 2H8AA 4ZLCA 4D4XA 4G7ZF 1VK5A 1MMAA 3UGPA 1E86A 1OW7A 3M15A 5DS5A 2WVQA 4JJFA 3LJBA 2YQYA 2CNWD 1VMAA 1QZXA 2Q3TA 2Z15A 4FESA 3UMHA 1JR8A 3ZTMA 3GEHA 3VRCA 1TWGA 4GEHA 3GM2A 2A6HF 1Q0FA 1YA9A 4HFFB 4C3EA 1ORJA 4YL3A 5L0HA 2DI3A 2ETSA 3S0XA 1NU7D 3TOLA 3W8IA 4EBJA 5L0FA 3CZ6A 1H9TA 3RQFA 1EKYA 1UG7A 2L6GA 3U2MA 5K0IA 4OD5A 5KYYB 2GWWA 2D5RB 5FCLA 1SYQA 2W45A 4YK5A 2R7OA 4O6NA 2Y3BA 3B0PA 3U3FA 3DE8A 3ZIBA 4U5HA 1H9GA 1OW6A 1FAPB 5JVEA 2FAPB 1BR1A 1ORYA 4OIRF 3J06A 4PJNA 4DRHB 5COGA 2EIMC 2QE9A 1HY5A 5E33A 2YL0A 2LK4A 4J30B 1OKKA 3IQ5A 3UNGC 1VOMA 2HJMA 5F28E 1QLEC 4CS8A 5JP7A 5JUAA 1H7IA 3RYLA 2LQGA 2RSEB 3JT1A 5CIVA 1WATA 1IW7F 2EIKC 1NBBA 3GM3A 2AWYA 4U5CE 4Q4ZF 1HW1A 3X2QC 1QPUA 5JSLA 5F5FA 2OKUA 3ZG1A 1L7CA 2WVNA 4K0DA 2HV7A
chains in the Genus database with same CATH topology
1M2VB 2EINC 3EGDA 3K7DA 4HFKB 3B9QA 1NZEA 1ZHWA 5T3TA 3QZCA 4O79A 3LAYA 3LEVA 4KBLA 3LS1A 4JZAA 2C04A 3Q6NA 1MMDA 4YT2A 4F4BA 5DVWA 4W8KA 3CQZA 3X1OA 3KMIA 2HV6A 4KNWA 3KH2A 2LSEA 2X51A 3LLIA 4XLPF 2R7XA 5KYNA 3AG1C 2VASA 4C7OA 3EG9A 4QI0A 3EH1A 4BJ5A 1S7ZA 2Y69C 2G62A 1RJ9B 4U5DE 5KYXB 3CSKA 4M63A 4G7OF 3T6BA 3DM9B 3EQLF 3RH3A 4K7BA 2KW3C 3FAJA 3Q6MA 4CS8C 2Y3HA 2I8BA 4B6IA 2JD3A 3DAGA 1JPJA 5DS4A 3AQBA 2ZXOA 2R7UA 3K1HA 5L3QA 1FMWA 4OIOF 1Z23A 2XL4A 3W2WA 4P6IC 5DQTA 2MYSA 3F46A 2NUPB 2IXPA 2J46A 3T4RA 1OCCC 4PJJA 3DM5A 3IEEA 2V3CC 2H7BA 3EJNA 4O7GA 2W4BA 5T3WA 5L3VA 3RFYA 1LVKA 4CIHA 2BE5F 2J9VA 3ABMC 1LKXA 3VYWA 1NG1A 2DGJA 3ZVRA 4KNVA 3N24A 5KYYA 1M2VA 3DAFA 5KYWB 3KL4A 4CBEA 2QTVA 4BJ5C 3O39A 1TWHA 1MNEA 1OCZC 1VYKA 1J8YF 5EGYA 4YJWA 4G0HA 5DS6A 3HJCA 1TKNA 4JJGA 2R7WA 1OKKD 3NKDA 1MMGA 3AQCA 2ZXWC 4AE4B 3NYJA 1M56C 3H65A 2IXNA 2W9YA 2J7PA 1ZHZA 4PFOA 3DJUB 2C03A 4OIQF 4O6MA 2H7OA 4E7SA 4IWBA 1TWCA 2ZXRA 3NG1A 4LLCA 2NUTA 1PD1A 2E87A 5E3AA 3HTKC 4U5GA 4RBNA 2YHSA 4H4KC 1FFTC 2DYSC 4JVSA 4QDLA 2P6VA 4YN0B 2M4EA 2NG1A 5KYXA 4PJMA 3T6JA 4ULWA 2YEVA 2R7RA 5B1BC 4J32B 3FVYA 4JW1A 1M2OA 4Q5SF 2QY9A 2XXAA 2OCCC 4OIPF 2Y3GA 3NRHA 3DMDA 5EHHA 4BG0A 4CS7A 3DZAA 3ASOC 5F5HA 1Z63A 4KI2A 4EWCA 3QMKA 2NUPA 3N0TA 4BJ6A 3LNRA 2OG2A 5DLJA 5D92A 3ECSA 3L0IA 3SEOA 1ZYRF 1FTSA 2KJGA 3W2VA 2B0JA 5CI9A 3M1CB 4BJTA 1FFHA 3MLGA 5D91A 3S27A 2VH3A 2VB6A 4IAOA 4E7ZA 2ZXPA 3E9VA 3I5QA 5KYWA 3RKOF 3L34A 4CSAC 1NU9C 1ST6A 2WZGA 3DD7A 3K66A 2XSEA 4RDAA 2PFDA 3UMIA 2CW0F 1SMYF 3RIPA 3WODF 4DBQA 3LESA 2W4MA 4PJLA 1BR2A 2KQ9A 3DJNB 2WB7A 2YZSA 2KNHA 1BR4A 4FWVA 3ABKC 2G3VA 1J8MF 1LS1A 1PCXA 1D1BA 4IJJA 4DVZA 3OEOA 4JCHA 3K6BA 4HE8D 2A6EF 3EZIA 3EGDB 1FMVA 4BJ6C 2R7QA 3EFOB 5KYUB 4AK9A 5T1DB 3NKEA 4QI2A 3B0UX 2J7PD 3MX3A 2Y39A 4LACB 1D0YA 1Z3IX 3F47A 2KGOA 2CDQA 4JURI 4MNDA 4XTKA 3LS0A 2IXOA 3FHDA 4I44A 1D0XA 2J0XA 4NY3A 2WZFA 4YT4A 4XLNF 4LERA 3UMKA 1SZIA 2P7VA 3SZRA 3B0VC 4BEJA 4ANJA 2Y3DA 1WGWA 3JRTA 5BUOA 2H7VC 2A68F 2XRHA 1M57C 3JCUQ 4U5BE 2J9UA 4O6YA 3POVA 1Z5ZA 3ITFA 3E70C 3NYLA 4YWQA 4CSAA 4OINF 1RJ9A 3ZC4A 1N1CA 4C3DA 1ZHYA 3SYNA 4N06A 3AG2C 3WG7C 3EHMA 3GANA 3DXJF 3V7OA 2O9XA 2J45A 2ZPAA 3NYMA 4HEAJ 3S29A 3EZHA 2R7TA 2G3KA 3OWTA 2GFHA 3I4UA 3EGXB 2PX0A 2CNWA 3UGOA 2MWQA 2A69F 4DBRA 5E3CA 1ZU5A 4MQ9F 4U5EE 3KKBA 2R7VA 1VYIA 1OCOC 3NDBB 4AX2A 2IOQA 1OCRC 3O6XA 4KC9A 2J9WA 2V26A 3AG4C 1MMNA 4PK4A 3S28A 1V54C 3K1IC 3Q7GA 4I1OB 2EILC 2J0WA 4G7HF 3EFOA 5KYUA 3AG3C 5B3SC 1V55C 1Z6AA 1O5HA 2DYRC 4RD9A 2PX3A 2EIJC 3GODA 3SNHA 1PD0A 3JSZA 4LLEA 3HLZA 1ZU4A 2A1DD 4CS9A 2CGEA 1KU2A 3VAYA 3OA1A 2L9JA 2NUTB 5IY5C 4AE4A 1D0ZA 2IYLD 3EPVA 1TR2A 3LLKA 3ASNC 3W8HA 2L81A 2Q9CA 3FDQA 4ZLDA 1JPNA 5CI8A 2PP4A 1MNDA 4YT8A 4XWJA 4U5FE 5DQZA 4Q7CA 1G8XA 2WZLA 4I3MA 3SP1A 2WVOA 3K33A 3JYHA 2PF4E 2XXAB 3EH2A 1O87A 3EHNA 4GYTA 2IXMA 4I1MA 4IRUA 2Q9AA 3EGXA 3Q7LA 3ABLC 1ZHXA 1SF8A 2FGYA 2WL8A 5HSWA 2FFHA 4WJ0A 1IZMA 3I5PA 1D1AA 5B1AC 3ZSUA 1ZHTA 4X0RA 1D1CA 4BJ1A 3PMRA 4OD4A 5E2QA 4C3BA 4YT5A 4C7OB 2R7SA 3UR3C 4FX5A 4CS9C 3EG9B 3N2ZB 4EBBA 3PHF2 4A2NB 1W2WA 4DOZA 1TWAA 3TD7A 4PFPA 2Q9BA 4ZLCA 4G7ZF 1VK5A 1MMAA 3UGPA 5DS5A 2WVQA 4JJFA 3LJBA 2CNWD 1VMAA 1QZXA 2Q3TA 2Z15A 4FESA 3UMHA 1TWGA 4GEHA 2A6HF 4HFFB 4C3EA 3S0XA 1NU7D 3W8IA 3CZ6A 4OD5A 5KYYB 2D5RB 5FCLA 2W45A 2R7OA 4O6NA 2Y3BA 3B0PA 3ZIBA 4U5HA 1BR1A 4OIRF 4PJNA 2EIMC 5E33A 4J30B 1OKKA 3UNGC 4CS8A 1VOMA 1QLEC 3RYLA 3JT1A 1IW7F 2EIKC 4U5CE 4Q4ZF 3X2QC 5F5FA 3ZG1A 4DVYP 2WVNA 4K0DA 2HV7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QI2 A;  4QI0 A;  4ZLC A;  3X1O A;  4YWQ A;  5F5H A;  5F5F A;  4ZLD A;  4ULW A; 
#chains in the Genus database with same CATH topology
 1M2V B;  1RMV A;  2EIN C;  3EGD A;  4MTO A;  3K7D A;  1HW2 A;  4MVM A;  4HFK B;  4P9F A;  3B9Q A;  3G4X A;  1NZE A;  2R05 A;  3SXY A;  1EQ1 A;  3PCV A;  3SXM A;  1ZHW A;  1LI7 A;  2XM0 A;  3ZTZ A;  4D4N A;  1VLT A;  5T3T A;  3HNJ A;  3QZC A;  4O79 A;  3LAY A;  3LEV A;  4KBL A;  3LS1 A;  4JZA A;  2C04 A;  1U89 A;  1YA7 O;  3Q6N A;  1MMD A;  1AUE A;  2YWA A;  4F4B A;  5DVW A;  4E0H A;  3JRM O;  4YT2 A;  2P1A A;  1WN0 A;  1Y6D A;  5EK0 A;  4W8K A;  3CQZ A;  2NSG A;  3X1O A;  1QKR A;  3KMI A;  2HV6 A;  3M4C A;  4KNW A;  1DOW A;  4ULV A;  2QLA A;  3KH2 A;  1E2X A;  2LSE A;  1YAR O;  2L7A A;  1HMO A;  2X51 A;  3LLI A;  5A69 A;  2XS1 A;  4XLP F;  4CJG A;  3BRJ A;  2R7X A;  2UUI A;  3RW0 A;  4DRJ B;  2YVK A;  2XLV A;  5KYN A;  3AG1 C;  2VAS A;  4MVS A;  4JKV A;  4C7O A;  1ZW3 A;  3W4Y A;  4E0I A;  2Q4F A;  3EG9 A;  4QI0 A;  4YL1 A;  4IAR A;  2HUJ A;  2XLW A;  3EH1 A;  4BJ5 A;  1JMW A;  1S7Z A;  2F22 A;  2Y69 C;  4JCZ A;  2G62 A;  2HSB A;  2YLD A;  4FAP B;  1RJ9 B;  4MW8 A;  3GM1 A;  4U5D E;  5BQG A;  1LE4 A;  3CSK A;  5KYX B;  4IGG A;  1H6G A;  4JTA B;  4M63 A;  1BDJ B;  3MBG A;  3BEH A;  3DM9 B;  3QW0 A;  4NQF A;  3EQL F;  4WGZ A;  3RH3 A;  3T6B A;  4K7B A;  2KW3 C;  5GPG B;  1R5I D;  3FAJ A;  4NTB A;  3Q6M A;  5JLI A;  4CS8 C;  2IBF A;  2Y3H A;  2I8B A;  4B6I A;  2JD3 A;  3ZQY A;  3DAG A;  1JPJ A;  4W8P A;  3HKK A;  5DS4 A;  3AQB A;  4ONS A;  2ZXO A;  2R7U A;  1LPE A;  3K1H A;  2OEX A;  3NMJ A;  5L3Q A;  1FMW A;  4OIO F;  1Z23 A;  2XL4 A;  3W2W A;  4P6I C;  5DQT A;  2MYS A;  1VTM P;  3F46 A;  3IQ6 A;  3TK0 A;  1WAS A;  2NUP B;  2XL8 A;  4AL1 A;  2IXP A;  2KYH A;  1V74 B;  5JS5 A;  1S05 A;  1GM5 A;  2J46 A;  3QVY A;  3T4R A;  4BPM A;  1OCC C;  4U9E A;  4PJJ A;  3DM5 A;  3CAX A;  2TMV P;  3IEE A;  3NMK A;  1NFN A;  2V3C C;  2H7B A;  3EJN A;  2XL6 A;  4O7G A;  2W4B A;  1R4T A;  3C8G A;  5T3W A;  4CDY A;  3C63 A;  5L3V A;  3RFY A;  1LVK A;  4CIH A;  3T9O A;  2BE5 F;  2J9V A;  2YRF A;  1LKX A;  3ABM C;  3TOM A;  1DOV A;  2HKV A;  2XLO A;  3VYW A;  1NG1 A;  2DGJ A;  3U2L A;  1XZP A;  4JEA A;  4KNV A;  3ZVR A;  3N24 A;  3GEE A;  5JT4 A;  1M2V A;  3DAF A;  4MVR A;  5KYY A;  5KYW B;  3KL4 A;  1JOG A;  4EIY A;  3LUT B;  2UUH A;  1LS4 A;  4CBE A;  2QTV A;  1KTM A;  1T9K A;  4BJ5 C;  1E83 A;  3O39 A;  1TWH A;  1MNE A;  1OCZ C;  3IHU A;  3HNK A;  1VYK A;  1J8Y F;  2LD6 A;  3LEO A;  5EGY A;  4YJW A;  4G0H A;  5DS6 A;  3HJC A;  1TKN A;  4DRI B;  4JJG A;  2R7W A;  2EPK X;  1OKK D;  1ORS C;  3NKD A;  3U5S A;  2R7T A;  1MMG A;  3AQC A;  2ZXW C;  3MFN A;  4AE4 B;  3NYJ A;  3QTH A;  1K05 A;  1RKE B;  1M56 C;  4MS2 A;  3H65 A;  2IXN A;  2OQM A;  1XZQ A;  3FOP A;  1K04 A;  4IB4 A;  2W9Y A;  1ZHZ A;  2J7P A;  3C8Z A;  2OOC A;  1T6Q A;  1PV3 A;  4PFO A;  1A41 A;  2C03 A;  3DJU B;  1CGM E;  4OIQ F;  1V4A A;  2H7O A;  1BBH A;  3JZ0 A;  4O6M A;  4E7S A;  4IWB A;  3IQC A;  2P61 A;  3S90 A;  5L0I A;  1TWC A;  2ZXR A;  3NG1 A;  4LLC A;  2NUT A;  3T6G B;  1PD1 A;  2E87 A;  3DI5 A;  5E3A A;  3NMI A;  4MVZ A;  2ASR A;  1ZZP A;  3MYI A;  4UDV A;  3H2V A;  3HTK C;  4U5G A;  4RBN A;  2YHS A;  3GOR A;  4XPY A;  3JSE O;  4H4K C;  5L0G A;  5B3I A;  3U0C A;  1FFT C;  2R9R B;  2DYS C;  4JVS A;  4QDL A;  2P6V A;  4YN0 B;  1OW8 A;  2M4E A;  2NG1 A;  5KYX A;  4PJM A;  3T6J A;  4LDQ A;  2YEV A;  4ULW A;  4J7T A;  2LCH A;  1YZC A;  2X0C A;  2R7R A;  3FOO A;  1Y4C A;  4NCQ A;  5B1B C;  3L1M A;  3AOU A;  4J32 B;  4JRZ A;  3VM6 A;  3R7C A;  3FVY A;  1UFB A;  4JW1 A;  1M2O A;  3TUL A;  4Q5S F;  2OEV A;  4MTG A;  2I15 A;  3C18 A;  2OJQ A;  1YZA A;  4EKW A;  1B68 A;  2QY9 A;  3DE9 A;  3FXH A;  2XXA A;  2OCC C;  5COF A;  3KYI A;  2Y3G A;  4OIP F;  1ZVZ A;  3NRH A;  5HV9 A;  3SXZ A;  3U9M A;  3DMD A;  4N6C A;  1SR2 A;  1T6U A;  2NSF A;  4CX9 A;  5EHH A;  1LIH A;  4BG0 A;  2MHR A;  3ASO C;  3DZA A;  3IPM O;  5F5H A;  4CS7 A;  1Z63 A;  1C02 A;  2JPU A;  4NC3 A;  4KI2 A;  2OJE D;  4EWC A;  2QUP A;  3QMK A;  5AC4 A;  4PAC A;  2NUP A;  3N0T A;  3M79 A;  1I4Z A;  4MVO A;  4BJ6 A;  1U0B B;  3LNR A;  2HS5 A;  2OG2 A;  4JTD B;  5D92 A;  2AVK A;  5DLJ A;  4EBK A;  1FNT c;  3ECS A;  3S84 A;  3L0I A;  3SEO A;  2KK1 A;  2YL1 A;  1ZYR F;  5BQH A;  1FTS A;  2KJG A;  2BL2 A;  3W2V A;  3RQE A;  2B0J A;  4CDV A;  4CIP A;  5CI9 A;  1T01 A;  2HJ3 A;  3M1C B;  4BJT A;  1FFH A;  3MLG A;  5D91 A;  3S27 A;  2QNL A;  2VH3 A;  2VB6 A;  3A9C A;  4IAO A;  2ZXP A;  4J7Y A;  4E7Z A;  3E9V A;  3I5Q A;  4DVY P;  2CCY A;  3FMS A;  1QQ3 A;  5AGF A;  5KYW A;  4G7O F;  2DB4 A;  3RKO F;  3L34 A;  1EA8 A;  1WOL A;  1A0B A;  3L8J A;  4CSA C;  1NU9 C;  1OR2 A;  1RXQ A;  1VLS A;  4JC7 A;  1ST6 A;  2A0B A;  4K1O A;  2WZG A;  2R02 A;  1YVI A;  3DD7 A;  4MTF A;  3TJ6 A;  3B29 A;  1RCP A;  3K66 A;  2XSE A;  2HSQ A;  4RDA A;  2PFD A;  2VCB A;  2CW0 F;  3U9J A;  3UMI A;  5A6B D;  2L6F A;  1SMY F;  3RIP A;  3WOD F;  3C8G D;  1O3U A;  3LES A;  4DBQ A;  1RKE A;  1AVO B;  2W4M A;  2XLD A;  4DJ9 A;  3GEI A;  1QVX A;  4PJL A;  1BR2 A;  2KQ9 A;  3DJN B;  3C7J A;  2WB7 A;  4E17 A;  1WWP A;  2YZS A;  2KNH A;  1BR4 A;  4FWV A;  5JRA A;  3ABK C;  2G3V A;  1A7E A;  1J8M F;  1LS1 A;  1CGN A;  3WAQ A;  1PCX A;  4CJO A;  4DXW A;  1D1B A;  2GA0 A;  5L0D A;  3IQT A;  4IJJ A;  4DVZ A;  3OEO A;  4JCH A;  3K6B A;  4HE8 D;  2A6E F;  3EZI A;  2J9B A;  1APC A;  3ZQV A;  3EGD B;  5A6B A;  1FMV A;  2JX0 A;  4BJ6 C;  2R7Q A;  3EFO B;  4P9T A;  5KYU B;  4AK9 A;  4MVU A;  2R25 A;  2VCC A;  3FAP B;  3NKE A;  2YLI A;  5T1D B;  1Z7Q c;  4WGY A;  4WAB A;  4QI2 A;  3B0U X;  2J7P D;  3MX3 A;  4JIO A;  3RF3 A;  3V5Y A;  1E84 A;  2Y39 A;  4YL0 A;  4LAC B;  1D0Y A;  1Z3I X;  1L3P A;  2KGO A;  2CDQ A;  3F47 A;  4JUR I;  4MND A;  4XTK A;  4XPX A;  4AL0 A;  3LS0 A;  4R32 A;  1ZW2 A;  2IXO A;  3FHD A;  4I44 A;  1D0X A;  2J0X A;  1I5N A;  3H2U A;  5L0J A;  4NY3 A;  3C62 A;  2NPU A;  2WZF A;  1GGQ A;  1T6I A;  2AP3 A;  2XLH A;  2KSF A;  4YT4 A;  4XLN F;  4NTA A;  1MQV A;  4LER A;  3UMK A;  1SZI A;  3K1I A;  3A11 A;  3M4B A;  2P7V A;  1CPQ A;  2GDC A;  1OR3 A;  3SZR A;  4XPW A;  5FZT A;  2EPL X;  2HZ8 A;  2ZD9 A;  1TQG A;  4XEK A;  2HMZ A;  4BEJ A;  4ANJ A;  3B0V C;  2Y3D A;  1F1M A;  1WGW A;  3JRT A;  3V5X A;  5BUO A;  2H7V C;  2A68 F;  2EPO A;  2XRH A;  1M57 C;  3JCU Q;  1G4U S;  1QSP A;  1WTY A;  2J9U A;  1VB5 A;  4U5B E;  1BZ4 A;  4O6Y A;  3POV A;  1Z5Z A;  3ITF A;  3E70 C;  3RVZ A;  3NYL A;  2PNO A;  4YWQ A;  4CSA A;  3US6 A;  1Q0K A;  2L6H A;  4Z9I A;  4OIN F;  1Q0M A;  3AJM A;  1RJ9 A;  3ZC4 A;  1N1C A;  4C3D A;  1ZHY A;  2OU6 A;  4N06 A;  1HMD A;  1C03 A;  2LP4 A;  3SYN A;  1FR0 A;  3AG2 C;  3WG7 C;  2AWC A;  3O10 A;  3EHM A;  3GAN A;  3DXJ F;  3V7O A;  2O9X A;  2J45 A;  2ZPA A;  3NYM A;  4HEA J;  4JTC B;  3EZH A;  3S29 A;  4G78 A;  3KYJ A;  2Q7R A;  2G3K A;  5A6K A;  2XS8 A;  3OWT A;  1C17 M;  3U8V A;  5A6J A;  2ICW G;  2GFH A;  2YL7 A;  2VCA A;  3I4U A;  1YLM A;  3EGX B;  2R03 A;  1GQA A;  3HNI A;  2B0H A;  2PX0 A;  2CNW A;  3AGT A;  4MVQ A;  1GS9 A;  4H54 A;  4LDK A;  3UGO A;  2MWQ A;  4N4W A;  1NSG B;  3TJ5 A;  3V5Z A;  1OQC A;  2A69 F;  4EHP A;  1E85 A;  3ZDL A;  256B A;  4DBR A;  1Q0D A;  5E3C A;  1ZU5 A;  4MQ9 F;  2HFI A;  1A7D A;  4U5E E;  3RQG A;  2XM4 A;  3DKA A;  1KNY A;  4BEM J;  1TFO B;  2EPN A;  3C8G B;  3KKB A;  3HNL A;  2R7V A;  1VYI A;  1OCO C;  3NDB B;  4AX2 A;  2IOQ A;  5BQI A;  1OCR C;  3O6X A;  5TJ5 E;  4KC9 A;  4E18 A;  2J9W A;  2V26 A;  3AG4 C;  1MMN A;  4PK4 A;  3S28 A;  1V54 C;  3K1I C;  3Q7G A;  5L0C A;  4I1O B;  2EIL C;  2BC5 A;  2J0W A;  4JE9 A;  2AU5 A;  3RVY A;  3EFO A;  4G7H F;  5KYU A;  3AG3 C;  1G5Z A;  2A0U A;  5B3S C;  3B71 A;  1V55 C;  1Z6A A;  1O5H A;  2DYR C;  4RD9 A;  4JEB A;  3CEX A;  2PX3 A;  2EIJ C;  1YDI A;  1G4W R;  3GOD A;  3SNH A;  2CYD A;  2RD9 A;  1NLX A;  1YYJ A;  1LM3 B;  3G4Z A;  3JTL O;  1YJG A;  1PD0 A;  3JSZ A;  4LLE A;  3HLZ A;  3GWL A;  1EI7 A;  1ZU4 A;  2P0N A;  3DWW A;  2A1D D;  4CS9 A;  2LFD A;  2YKZ A;  2CGE A;  1T5O A;  4N6H A;  4IAQ A;  5A6A A;  4LDR A;  1KU2 A;  3VAY A;  2M64 A;  1HE1 A;  3ZWI A;  1OXK A;  3OA1 A;  2EPM X;  2L9J A;  4XEV A;  2NUT B;  5IY5 C;  4AE4 A;  1D0Z A;  2IYL D;  2D4U A;  3EPV A;  1CPR A;  1TR2 A;  3LLK A;  1Q0G A;  3ASN C;  1U6H A;  3W8H A;  2L81 A;  5AC5 A;  2Q9C A;  1M6T A;  2YL3 A;  3FDQ A;  1HE9 A;  1JPN A;  3VF0 A;  4ZLD A;  5CI8 A;  4U9D A;  1OXB A;  4Z9H A;  2PP4 A;  1MND A;  4YT8 A;  4XWJ A;  4U5F E;  5DQZ A;  1LI5 A;  1G8X A;  4Q7C A;  3JYY A;  4ER9 A;  1AEP A;  2WZL A;  3O55 A;  4I3M A;  3AGU A;  1RKC A;  1JAF A;  3SP1 A;  1I4Y A;  3ATP A;  2WVO A;  2Q00 A;  4GQH A;  2YLG A;  1NFO A;  3R2P A;  3GWN A;  3U8P A;  3K33 A;  2HMQ A;  3JYH A;  1XWJ A;  2PF4 E;  2XXA B;  3EH2 A;  1O87 A;  3TQO A;  2VC9 A;  3EHN A;  4GYT A;  2IXM A;  4I1M A;  4IRU A;  4PR9 A;  2Q9A A;  1CGO A;  2XLE A;  2XLM A;  3WHN A;  1LE2 A;  3EGX A;  3Q7L A;  3ABL C;  1ZHX A;  1A7V A;  2GAQ A;  1SF8 A;  2FGY A;  2WL8 A;  2FFH A;  5HSW A;  3S9O A;  4WJ0 A;  2IM8 A;  1IZM A;  2KC3 A;  3I5P A;  2J8W A;  1D1A A;  1K40 A;  3QW1 A;  1ZHT A;  5B1A C;  3ZSU A;  4X0R A;  1JRA A;  4EUK B;  1D1C A;  3QVZ A;  4BJ1 A;  4CDA A;  3PDM P;  3PMR A;  4A4A A;  4OD4 A;  5E2Q A;  3G50 A;  4C3B A;  4Z9J A;  2LFF A;  4MW3 A;  4L6R A;  4XEF A;  4YT5 A;  3SXK A;  4C7O B;  2R7S A;  3UR3 C;  3LNM B;  2LIG A;  2PBE A;  3L8I A;  3EG9 B;  3N2Z B;  4FX5 A;  4NTF A;  4XQ1 A;  4CS9 C;  4EBB A;  3PHF 2;  4A2N B;  1W2W A;  1YYX A;  4DOZ A;  1TFK B;  1TWA A;  3TD7 A;  3MYF A;  3U3B A;  4PFP A;  5COM A;  2Q9B A;  3KPH A;  1YAU O;  2H8A A;  4ZLC A;  4D4X A;  4G7Z F;  1VK5 A;  1MMA A;  3UGP A;  1E86 A;  1OW7 A;  3M15 A;  5DS5 A;  2WVQ A;  4JJF A;  3LJB A;  2YQY A;  2CNW D;  1VMA A;  1QZX A;  2Q3T A;  2Z15 A;  4FES A;  3UMH A;  1JR8 A;  3ZTM A;  3GEH A;  3VRC A;  1TWG A;  4GEH A;  3GM2 A;  2A6H F;  1Q0F A;  1YA9 A;  4HFF B;  4C3E A;  1ORJ A;  4YL3 A;  5L0H A;  2DI3 A;  2ETS A;  3S0X A;  1NU7 D;  3TOL A;  3W8I A;  4EBJ A;  5L0F A;  3CZ6 A;  1H9T A;  3RQF A;  1EKY A;  1UG7 A;  2L6G A;  3U2M A;  5K0I A;  4OD5 A;  5KYY B;  2GWW A;  2D5R B;  5FCL A;  1SYQ A;  2W45 A;  4YK5 A;  2R7O A;  4O6N A;  2Y3B A;  3B0P A;  3U3F A;  3DE8 A;  3ZIB A;  4U5H A;  1H9G A;  1OW6 A;  1FAP B;  5JVE A;  2FAP B;  1BR1 A;  1ORY A;  4OIR F;  3J06 A;  4PJN A;  4DRH B;  5COG A;  2EIM C;  2QE9 A;  1HY5 A;  5E33 A;  2YL0 A;  2LK4 A;  4J30 B;  1OKK A;  3IQ5 A;  3UNG C;  1VOM A;  2HJM A;  5F28 E;  1QLE C;  4CS8 A;  5JP7 A;  5JUA A;  1H7I A;  3RYL A;  2LQG A;  2RSE B;  3JT1 A;  5CIV A;  1WAT A;  1IW7 F;  2EIK C;  1NBB A;  3GM3 A;  2AWY A;  4U5C E;  4Q4Z F;  1HW1 A;  3X2Q C;  1QPU A;  5JSL A;  5F5F A;  2OKU A;  3ZG1 A;  1L7C A;  2WVN A;  4K0D A;  2HV7 A; 
#chains in the Genus database with same CATH homology
 1M2V B;  2EIN C;  3EGD A;  3K7D A;  4HFK B;  3B9Q A;  1NZE A;  1ZHW A;  5T3T A;  3QZC A;  4O79 A;  3LAY A;  3LEV A;  4KBL A;  3LS1 A;  4JZA A;  2C04 A;  3Q6N A;  1MMD A;  4YT2 A;  4F4B A;  5DVW A;  4W8K A;  3CQZ A;  3X1O A;  3KMI A;  2HV6 A;  4KNW A;  3KH2 A;  2LSE A;  2X51 A;  3LLI A;  4XLP F;  2R7X A;  5KYN A;  3AG1 C;  2VAS A;  4C7O A;  3EG9 A;  4QI0 A;  3EH1 A;  4BJ5 A;  1S7Z A;  2Y69 C;  2G62 A;  1RJ9 B;  4U5D E;  5KYX B;  3CSK A;  4M63 A;  4G7O F;  3T6B A;  3DM9 B;  3EQL F;  3RH3 A;  4K7B A;  2KW3 C;  3FAJ A;  3Q6M A;  4CS8 C;  2Y3H A;  2I8B A;  4B6I A;  2JD3 A;  3DAG A;  1JPJ A;  5DS4 A;  3AQB A;  2ZXO A;  2R7U A;  3K1H A;  5L3Q A;  1FMW A;  4OIO F;  1Z23 A;  2XL4 A;  3W2W A;  4P6I C;  5DQT A;  2MYS A;  3F46 A;  2NUP B;  2IXP A;  2J46 A;  3T4R A;  1OCC C;  4PJJ A;  3DM5 A;  3IEE A;  2V3C C;  2H7B A;  3EJN A;  4O7G A;  2W4B A;  5T3W A;  5L3V A;  3RFY A;  1LVK A;  4CIH A;  2BE5 F;  2J9V A;  3ABM C;  1LKX A;  3VYW A;  1NG1 A;  2DGJ A;  3ZVR A;  4KNV A;  3N24 A;  5KYY A;  1M2V A;  3DAF A;  5KYW B;  3KL4 A;  4CBE A;  2QTV A;  4BJ5 C;  3O39 A;  1TWH A;  1MNE A;  1OCZ C;  1VYK A;  1J8Y F;  5EGY A;  4YJW A;  4G0H A;  5DS6 A;  3HJC A;  1TKN A;  4JJG A;  2R7W A;  1OKK D;  3NKD A;  1MMG A;  3AQC A;  2ZXW C;  4AE4 B;  3NYJ A;  1M56 C;  3H65 A;  2IXN A;  2W9Y A;  2J7P A;  1ZHZ A;  4PFO A;  3DJU B;  2C03 A;  4OIQ F;  4O6M A;  2H7O A;  4E7S A;  4IWB A;  1TWC A;  2ZXR A;  3NG1 A;  4LLC A;  2NUT A;  1PD1 A;  2E87 A;  5E3A A;  3HTK C;  4U5G A;  4RBN A;  2YHS A;  4H4K C;  1FFT C;  2DYS C;  4JVS A;  4QDL A;  2P6V A;  4YN0 B;  2M4E A;  2NG1 A;  5KYX A;  4PJM A;  3T6J A;  4ULW A;  2YEV A;  2R7R A;  5B1B C;  4J32 B;  3FVY A;  4JW1 A;  1M2O A;  4Q5S F;  2QY9 A;  2XXA A;  2OCC C;  4OIP F;  2Y3G A;  3NRH A;  3DMD A;  5EHH A;  4BG0 A;  4CS7 A;  3DZA A;  3ASO C;  5F5H A;  1Z63 A;  4KI2 A;  4EWC A;  3QMK A;  2NUP A;  3N0T A;  4BJ6 A;  3LNR A;  2OG2 A;  5DLJ A;  5D92 A;  3ECS A;  3L0I A;  3SEO A;  1ZYR F;  1FTS A;  2KJG A;  3W2V A;  2B0J A;  5CI9 A;  3M1C B;  4BJT A;  1FFH A;  3MLG A;  5D91 A;  3S27 A;  2VH3 A;  2VB6 A;  4IAO A;  4E7Z A;  2ZXP A;  3E9V A;  3I5Q A;  5KYW A;  3RKO F;  3L34 A;  4CSA C;  1NU9 C;  1ST6 A;  2WZG A;  3DD7 A;  3K66 A;  2XSE A;  4RDA A;  2PFD A;  3UMI A;  2CW0 F;  1SMY F;  3RIP A;  3WOD F;  4DBQ A;  3LES A;  2W4M A;  4PJL A;  1BR2 A;  2KQ9 A;  3DJN B;  2WB7 A;  2YZS A;  2KNH A;  1BR4 A;  4FWV A;  3ABK C;  2G3V A;  1J8M F;  1LS1 A;  1PCX A;  1D1B A;  4IJJ A;  4DVZ A;  3OEO A;  4JCH A;  3K6B A;  4HE8 D;  2A6E F;  3EZI A;  3EGD B;  1FMV A;  4BJ6 C;  2R7Q A;  3EFO B;  5KYU B;  4AK9 A;  5T1D B;  3NKE A;  4QI2 A;  3B0U X;  2J7P D;  3MX3 A;  2Y39 A;  4LAC B;  1D0Y A;  1Z3I X;  3F47 A;  2KGO A;  2CDQ A;  4JUR I;  4MND A;  4XTK A;  3LS0 A;  2IXO A;  3FHD A;  4I44 A;  1D0X A;  2J0X A;  4NY3 A;  2WZF A;  4YT4 A;  4XLN F;  4LER A;  3UMK A;  1SZI A;  2P7V A;  3SZR A;  3B0V C;  4BEJ A;  4ANJ A;  2Y3D A;  1WGW A;  3JRT A;  5BUO A;  2H7V C;  2A68 F;  2XRH A;  1M57 C;  3JCU Q;  4U5B E;  2J9U A;  4O6Y A;  3POV A;  1Z5Z A;  3ITF A;  3E70 C;  3NYL A;  4YWQ A;  4CSA A;  4OIN F;  1RJ9 A;  3ZC4 A;  1N1C A;  4C3D A;  1ZHY A;  3SYN A;  4N06 A;  3AG2 C;  3WG7 C;  3EHM A;  3GAN A;  3DXJ F;  3V7O A;  2O9X A;  2J45 A;  2ZPA A;  3NYM A;  4HEA J;  3S29 A;  3EZH A;  2R7T A;  2G3K A;  3OWT A;  2GFH A;  3I4U A;  3EGX B;  2PX0 A;  2CNW A;  3UGO A;  2MWQ A;  2A69 F;  4DBR A;  5E3C A;  1ZU5 A;  4MQ9 F;  4U5E E;  3KKB A;  2R7V A;  1VYI A;  1OCO C;  3NDB B;  4AX2 A;  2IOQ A;  1OCR C;  3O6X A;  4KC9 A;  2J9W A;  2V26 A;  3AG4 C;  1MMN A;  4PK4 A;  3S28 A;  1V54 C;  3K1I C;  3Q7G A;  4I1O B;  2EIL C;  2J0W A;  4G7H F;  3EFO A;  5KYU A;  3AG3 C;  5B3S C;  1V55 C;  1Z6A A;  1O5H A;  2DYR C;  4RD9 A;  2PX3 A;  2EIJ C;  3GOD A;  3SNH A;  1PD0 A;  3JSZ A;  4LLE A;  3HLZ A;  1ZU4 A;  2A1D D;  4CS9 A;  2CGE A;  1KU2 A;  3VAY A;  3OA1 A;  2L9J A;  2NUT B;  5IY5 C;  4AE4 A;  1D0Z A;  2IYL D;  3EPV A;  1TR2 A;  3LLK A;  3ASN C;  3W8H A;  2L81 A;  2Q9C A;  3FDQ A;  4ZLD A;  1JPN A;  5CI8 A;  2PP4 A;  1MND A;  4YT8 A;  4XWJ A;  4U5F E;  5DQZ A;  4Q7C A;  1G8X A;  2WZL A;  4I3M A;  3SP1 A;  2WVO A;  3K33 A;  3JYH A;  2PF4 E;  2XXA B;  3EH2 A;  1O87 A;  3EHN A;  4GYT A;  2IXM A;  4I1M A;  4IRU A;  2Q9A A;  3EGX A;  3Q7L A;  3ABL C;  1ZHX A;  1SF8 A;  2FGY A;  2WL8 A;  5HSW A;  2FFH A;  4WJ0 A;  1IZM A;  3I5P A;  1D1A A;  5B1A C;  3ZSU A;  1ZHT A;  4X0R A;  1D1C A;  4BJ1 A;  3PMR A;  4OD4 A;  5E2Q A;  4C3B A;  4YT5 A;  4C7O B;  2R7S A;  3UR3 C;  4FX5 A;  4CS9 C;  3EG9 B;  3N2Z B;  4EBB A;  3PHF 2;  4A2N B;  1W2W A;  4DOZ A;  1TWA A;  3TD7 A;  4PFP A;  2Q9B A;  4ZLC A;  4G7Z F;  1VK5 A;  1MMA A;  3UGP A;  5DS5 A;  2WVQ A;  4JJF A;  3LJB A;  2CNW D;  1VMA A;  1QZX A;  2Q3T A;  2Z15 A;  4FES A;  3UMH A;  1TWG A;  4GEH A;  2A6H F;  4HFF B;  4C3E A;  3S0X A;  1NU7 D;  3W8I A;  3CZ6 A;  4OD5 A;  5KYY B;  2D5R B;  5FCL A;  2W45 A;  2R7O A;  4O6N A;  2Y3B A;  3B0P A;  3ZIB A;  4U5H A;  1BR1 A;  4OIR F;  4PJN A;  2EIM C;  5E33 A;  4J30 B;  1OKK A;  3UNG C;  4CS8 A;  1VOM A;  1QLE C;  3RYL A;  3JT1 A;  1IW7 F;  2EIK C;  4U5C E;  4Q4Z F;  3X2Q C;  5F5F A;  3ZG1 A;  4DVY P;  2WVN A;  4K0D A;  2HV7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...