4ZLDA

Crystal structure of human roquin-2 roq domain in complex with roquin cde rna
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
151
structure length
151
Chain Sequence
QNPQQLSANLWAAVRARGCQFLGPAMQEEALKLVLLALEDGSALSRKVLVLFVVQRLEPRFPQASKTSIGHVVQLLYRASCFKVTKRDEDSSLMQLKEEFRSYEALRREHDAQIVHIAMEAGLRISPEQWSSLLYGDLAHKSHMQSIIDKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Roquin-2
publication title Structure of human Roquin-2 and its complex with constitutive-decay element RNA
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein/rna
total genus 58
structure length 151
sequence length 151
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2015-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18386 ROQ_II Roquin II domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1790 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4zldA00
3X1OA 5F5FA 4ULWA 5F5HA 4QI2A 4ZLDA 4ZLCA 4QI0A 4YWQA
chains in the Genus database with same CATH superfamily
3N2ZB 1M2VA 4CDYA 3M79A 2JPUA 1OXKA 1MMDA 1QQ3A 3NYMA 3PMRA 3QW1A 4IAOA 3LLKA 2J0WA 3FOPA 1H7IA 4JE9A 3UNGC 3I5PA 3V5XA 1OR2A 4C3BA 1WGWA 1Z23A 2W4BA 2Y3BA 3K66A 3M4BA 5E3CA 5CIVA 1M57C 2D4UA 1MMGA 3A9CA 4KC9A 1H9GA 2R7VA 2YZSA 1PD1A 2R7OA 3RF3A 2CDQA 1CGOA 4DOZA 2J9WA 1YZCA 3AGTA 2CCYA 5KYWB 1D1CA 2XLDA 2GDCA 3EG9A 3SXKA 4DJ9A 4QI0A 2YEVA 1I4YA 4LDRA 2AWCA 2HZ8A 1R4TA 3RQFA 5AC4A 1L3PA 3O10A 2D5RB 4YL1A 2NUTA 3KYIA 3MYIA 5HSWA 4IB4A 1ZHYA 1T9KA 1DOWA 1VLTA 3JRTA 2X51A 2IXMA 2KQ9A 1NFOA 4NCQA 2EPLX 3V7OA 4WABA 3LNMB 2E87A 2V26A 1SF8A 4U5EE 3VRCA 4BPMA 1JOGA 1NFNA 3RH3A 4DVYP 3BRJA 3K1HA 2YL0A 4YT5A 3IQ5A 4C7OA 4KNWA 3S90A 3KKBA 1DOVA 3OEOA 2CGEA 4O79A 5AC5A 3B0VC 3BEHA 3R7CA 3S27A 3NDBB 4AX2A 3AQBA 4PJJA 1QVXA 4JURI 1Q0KA 2VCBA 4NTAA 1Z7Qc 3ZDLA 3AOUA 2WVNA 3ECSA 1LM3B 4JCHA 4DXWA 3NRHA 2O9XA 4BJ5C 4G7OF 3S84A 1YYXA 1F1MA 1PD0A 2QTVA 2J9VA 2W4MA 4AE4A 2ZXPA 3ASNC 2NG1A 4EBKA 4EWCA 2Q00A 1VK5A 2YKZA 3DE8A 3DM9B 4LDQA 4MVZA 2DYSC 1EA8A 3CZ6A 3B9QA 4IARA 4YT4A 3WG7C 1I4ZA 1TWGA 3X1OA 4XQ1A 2DI3A 4HEAJ 2HMQA 3E9VA 3W8IA 5KYXA 2R7XA 1FFTC 3DD7A 2IXPA 3HNJA 2PNOA 4IWBA 4U9DA 2PX3A 1YLMA 1V55C 1ZU4A 2XM0A 2KK1A 4K0DA 4XLPF 3U5SA 3DAGA 3W2WA 4AL1A 4DRHB 2JD3A 1LPEA 2R7UA 1XZPA 3ZSUA 4A2NB 4WJ0A 3CAXA 2XRHA 3PDMP 4MS2A 1A7VA 5BQHA 3CQZA 2LIGA 2FFHA 2XSEA 3W4YA 1XZQA 3H2UA 3LAYA 2L81A 3GM2A 3S9OA 3EPVA 2KC3A 5CI8A 3SNHA 1TKNA 5EHHA 1ORYA 4M63A 2OKUA 1W2WA 4BJ6C 3SXZA 3ZQYA 4MVOA 3UMHA 1Q0FA 4EBBA 2A0UA 4X0RA 5B3IA 3EGDB 4NC3A 2J0XA 3WODF 1HMOA 2OOCA 4RD9A 1E84A 4YWQA 3DKAA 1OCCC 2I15A 4ULVA 1RJ9A 1A7EA 2HV7A 4E0IA 5BQGA 1ZHXA 4FX5A 4EBJA 1OW6A 3K7DA 1TFKB 3U3BA 1HW2A 2Q9BA 3SYNA 3POVA 2Y3HA 3FVYA 1GM5A 4EKWA 1HE1A 1Q0DA 3B0PA 1LS1A 5L0GA 1VYIA 1BR4A 2RD9A 2J9BA 3AQCA 4YT8A 3U3FA 2R05A 1AVOB 2LCHA 2C04A 5JSLA 3I4UA 2G3KA 4HFFB 2HV6A 3TK0A 1SZIA 2OJED 3ZVRA 3C18A 1Y6DA 5K0IA 3HNLA 3C7JA 1YAUO 2OJQA 2R7TA 1LS4A 3EZHA 3HNIA 3HJCA 5B1AC 3FOOA 3RQEA 2A69F 4BJ1A 2DGJA 4XPXA 3VM6A 2L6HA 1CGNA 4EIYA 4MVMA 4CS7A 3TOLA 2ZD9A 3MYFA 2WZLA 4W8PA 3ASOC 3T6GB 1K40A 2HJMA 1FMVA 5COFA 5L3VA 5COMA 4LLCA 2M64A 3Q6MA 4H54A 3G4ZA 3JRMO 2NUTB 2R25A 4CIHA 1KNYA 1RXQA 5DS5A 1WATA 2Q3TA 3EGXA 3CSKA 5HV9A 3B29A 2YVKA 3UGOA 2KNHA 2VCAA 2XLWA 2ASRA 4YT2A 1MMAA 4YN0B 3DJUB 4XTKA 3M4CA 4G7ZF 2J7PA 5TJ5E 3SXMA 3SXYA 4CS8C 2QY9A 2AVKA 2AP3A 3RYLA 2YWAA 1BZ4A 1FFHA 3DZAA 3G50A 1I5NA 3TOMA 1D1BA 2HSBA 2FAPB 4C7OB 1G4WR 3RVZA 1B68A 1FMWA 1C02A 5D92A 4NTBA 4JIOA 3ITFA 2H7VC 2ZPAA 4JTDB 2A6HF 1NSGB 2G3VA 2ETSA 2I8BA 3UGPA 2GWWA 3KPHA 2P0NA 4QDLA 4MW3A 4E0HA 4UDVA 4KBLA 2BE5F 1QZXA 2EPMX 3C8GA 4U5GA 3EHNA 3A11A 4AE4B 1FAPB 1O5HA 1AEPA 4OIRF 1TQGA 3TULA 3U9MA 4Z9JA 2LFDA 4WGYA 2HS5A 3GEHA 3H2VA 3VYWA 4BJ5A 2EPKX 1Z63A 2KYHA 4D4NA 3G4XA 4XEKA 1NZEA 1S7ZA 2HKVA 1T01A 1GGQA 1ST6A 1BR1A 2ZXOA 1KU2A 1NG1A 1ZHTA 2NSFA 4U5FE 3UR3C 5KYXB 4CJGA 3JSEO 1ZW3A 1JAFA 3KH2A 4U5DE 2EIMC 4E7SA 4Q7CA 3T4RA 3Q7LA 1OKKA 2XS8A 4PR9A 4G78A 4W8KA 5E3AA 4CX9A 1ZVZA 3NMJA 1LKXA 3EFOA 2H7BA 5L3QA 1Q0MA 1V74B 2VB6A 4Q4ZF 3EHMA 3LS1A 3FAPB 4MVQA 5JP7A 2XLOA 2MYSA 4L6RA 3IQ6A 2IOQA 5KYNA 2XLMA 4BJTA 4CSAC 1LVKA 3U2MA 3DXJF 1KTMA 4JTAB 1MMNA 4J7YA 2M4EA 3AJMA 4DRIB 2YHSA 1EQ1A 3GODA 1BDJB 1SMYF 1YA9A 3U2LA 3UMKA 3H65A 3LLIA 1N1CA 3N24A 2L9JA 2ZXRA 4HE8D 2CNWA 4BJ6A 4PJMA 1CPRA 2LQGA 3QTHA 3B0UX 1ZHWA 4NTFA 1RJ9B 4H4KC 5CI9A 1APCA 4C3EA 5T1DB 1TWAA 5JLIA 5FZTA 1ZW2A 3IQCA 3QMKA 4XPWA 4XLNF 2WL8A 2KJGA 3V5YA 1HW1A 4YL3A 3LEVA 5GPGB 2WB7A 4PJNA 1V4AA 3JCUQ 2HFIA 4PFPA 3QW0A 1BR2A 2J46A 2P6VA 3IPMO 3PHF2 5A6KA 3DAFA 1VYKA 1AUEA 2HMZA 3C8GD 4JJGA 1D0XA 2R03A 1ZZPA 5KYYB 5DS6A 5DQZA 2PP4A 4MVUA 2VCCA 3T9OA 1E85A 5KYWA 4FESA 4PJLA 3L1MA 1LE2A 2GFHA 4K7BA 2EPOA 2QNLA 2VH3A 2YQYA 3MX3A 4EUKB 1T6UA 2QUPA 4YJWA 4YL0A 3Q7GA 4GQHA 4AL0A 3SEOA 2Y3GA 2ZXWC 1JR8A 4XEVA 1OKKD 4MTFA 4IRUA 3ZIBA 2YLGA 3EGXB 4CS9A 2B0HA 5A6BA 4LLEA 2WVOA 2EIKC 5A6JA 2JX0A 4N6HA 3GM1A 2X0CA 1K04A 2XL8A 4DVZA 2HSQA 1U0BB 2QE9A 3ZG1A 4J7TA 4MVRA 2AU5A 3C63A 2YL3A 1ORJA 1LE4A 1M2VB 2CYDA 3FHDA 4CS8A 4OIQF 3FXHA 1VMAA 4KI2A 2BL2A 4ZLCA 3L8IA 3NG1A 3DM5A 3SP1A 3PCVA 1HMDA 3RIPA 3KMIA 2KSFA 2IYLD 2OCCC 1BBHA 3C8GB 1Z3IX 3C8ZA 3L8JA 1IW7F 1NU9C 4NY3A 4I1OB 2J45A 3DJNB 1OQCA 4G7HF 2AWYA 4D4XA 3MFNA 3GANA 4PFOA 2UUIA 1NU7D 4I1MA 2FGYA 5D91A 3EG9B 1JRAA 2Y69C 5DLJA 2LK4A 4MQ9F 4OIOF 4CS9C 3K33A 5KYUA 3B71A 3JYYA 5L0DA 2CW0F 2OEXA 2EINC 4DBRA 1OW8A 3DE9A 3DMDA 5EK0A 1A7DA 2DYRC 3RVYA 4EHPA 3RW0A 4P9FA 3S28A 3HNKA 3GWNA 4Z9HA 3EFOB 1ZU5A 4GEHA 3LS0A 4RBNA 3VF0A 3VAYA 4JJFA 2LP4A 3QZCA 1JMWA 2NSGA 3K1IA 4RDAA 5B3SC 1H6GA 3DWWA 1RMVA 2YRFA 1NLXA 3ZQVA 5L0JA 1VB5A 1WWPA 5DS4A 1RKEA 4OD4A 5B1BC 1WN0A 5T3TA 5JUAA 1EI7A 1E2XA 3U9JA 3RFYA 3JZ0A 3EGDA 1YYJA 3NKDA 3M15A 5T3WA 2OG2A 1C03A 3ABLC 1J8MF 3GWLA 2R7SA 2WVQA 4CSAA 1SYQA 4IGGA 1CGME 1MQVA 3L34A 1VTMP 2H8AA 3AG3C 2EIJC 3NYJA 4JC7A 4HFKB 3QVZA 2NUPA 2G62A 1XWJA 3FMSA 3EH1A 2XM4A 2GA0A 4ULWA 3NMIA 4I44A 3ZTMA 1OXBA 1VOMA 1L7CA 2PBEA 3ZWIA 2XXAA 4BEMJ 2Q7RA 1MNEA 3X2QC 4F4BA 1CPQA 1SR2A 256BA 2IBFA 3W8HA 1Z5ZA 4O6NA 1ORSC 2P61A 3JT1A 2F22A 3NKEA 5FCLA 3J06A 3K1IC 1EKYA 1MNDA 1GQAA 4MTGA 2B0JA 4N06A 3GORA 1U89A 3ABMC 5DQTA 5L0HA 4JRZA 3AGUA 2Y39A 5JS5A 4ANJA 4A4AA 4DRJB 4KNVA 3SZRA 2R7RA 2MWQA 3DI5A 5JRAA 1H9TA 1FTSA 1YARO 1YA7O 3JYHA 4R32A 4NQFA 3N0TA 2XLHA 3F46A 3KYJA 4O7GA 4OINF 1OR3A 1YZAA 5BQIA 2Q4FA 2R02A 2R7QA 3GEIA 1G8XA 4IAQA 4FWVA 3U8PA 1K05A 2C03A 3JSZA 3O39A 2H7OA 3TD7A 1Q0GA 3WAQA 4OIPF 2J7PD 2A68F 3TJ6A 2P7VA 3E70C 4E17A 2WZFA 1R5ID 5F28E 1TWHA 1M2OA 2Y3DA 4N4WA 4U5HA 2QLAA 4XEFA 1IZMA 3O55A 3QVYA 3R2PA 4IJJA 4CBEA 2J8WA 2PF4E 3EH2A 2OU6A 2KW3C 3IHUA 2VASA 3V5ZA 3NYLA 4K1OA 2IXOA 5IY5C 2PFDA 4MW8A 3IQTA 3EJNA 4P9TA 3KL4A 1UG7A 2EPNA 2PX0A 4U5BE 2BC5A 2EILC 3O6XA 2IM8A 3JTLO 3Q6NA 4WGZA 2XL4A 1E86A 5F5HA 2XLEA 4QI2A 2LD6A 2RSEB 4LDKA 4JKVA 2YLIA 2YL1A 1OW7A 3RKOF 2L6FA 4C3DA 4B6IA 4ER9A 2L7AA 3U0CA 4MVSA 5KYUB 1HE9A 2Q9CA 1A0BA 1A41A 3T6BA 3IEEA 1UFBA 1VLSA 1ZYRF 1U6HA 2MHRA 2L6GA 2UUHA 3M1CB 5L0CA 1PV3A 1RKCA 3F47A 4MNDA 4CJOA 3FDQA 1HY5A 5DVWA 4J32B 4OD5A 4YK5A 3EQLF 5BUOA 1NBBA 3LJBA 2YL7A 3FAJA 1ZHZA 2ICWG 4FAPB 1FNTc 4MTOA 4CIPA 1JPJA 1J8YF 1QPUA 1T6QA 3EZIA 1RKEB 4JTCB 3K6BA 4JVSA 4LERA 5L0FA 5L0IA 2HUJA 3OA1A 1D1AA 4G0HA 2GAQA 3ATPA 1M56C 4JEBA 3LEOA 3MLGA 5A69A 3LUTB 1QSPA 4U9EA 2CNWD 1OCZC 1S05A 1WTYA 2OQMA 3HLZA 4E7ZA 2TMVP 4CDAA 4ZLDA 2J9UA 5E33A 4P6IC 3GM3A 4CDVA 3OWTA 5JVEA 2NUPB 3U8VA 2VC9A 1LIHA 4U5CE 3TQOA 3LESA 4O6YA 3S29A 1QLEC 3LNRA 1TR2A 3TJ5A 3I5QA 3T6JA 1FR0A 1T6IA 2NPUA 1WOLA 2XXAB 2R9RB 4XWJA 1E83A 4JEAA 1O87A 3C62A 1QKRA 3US6A 5COGA 4BEJA 5AGFA 4Z9IA 1G4US 3GEEA 1Z6AA 4Q5SF 4XPYA 3HKKA 5F5FA 2LSEA 3ABKC 3AG4C 5KYYA 1O3UA 3L0IA 2A1DD 4PACA 4I3MA 1YDIA 3W2VA 4O6MA 4GYTA 3CEXA 1WASA 3RQGA 3ZTZA 1YJGA 2P1AA 4AK9A 1OCRC 2XL6A 5JT4A 2W9YA 2XLVA 1PCXA 2V3CC 2A0BA 4JCZA 2YLDA 4J30B 3MBGA 2DB4A 3AG1C 1GS9A 2XS1A 3HTKC 4LACB 4JZAA 1D0YA 3UMIA 4DBQA 2A6EF 1M6TA 2IXNA 4JW1A 1D0ZA 4BG0A 2KGOA 1YVIA 1RCPA 4N6CA 3AG2C 2W45A 2R7WA 2HJ3A 5E2QA 1TFOB 5A6BD 1LI5A 2WZGA 2Z15A 3ZC4A 2OEVA 3S0XA 2Q9AA 1OCOC 4ONSA 3NMKA 4E18A 1C17M 1JPNA 1T5OA 5EGYA 1Y4CA 4PK4A 2LFFA 1G5ZA 3WHNA 5A6AA 1TWCA 1V54C 1LI7A
chains in the Genus database with same CATH topology
3N2ZB 1M2VA 3NYMA 1MMDA 4IAOA 3PMRA 3UNGC 5EHHA 3LLKA 2J0WA 4C3BA 3I5PA 1WGWA 1Z23A 2W4BA 2Y3BA 3K66A 5E3CA 1M57C 1MMGA 4KC9A 2R7VA 2YZSA 1PD1A 2R7OA 2CDQA 4DOZA 2J9WA 5KYWB 1D1CA 3EG9A 4QI0A 2YEVA 2D5RB 2NUTA 5HSWA 1ZHYA 3JRTA 2X51A 2IXMA 2KQ9A 3V7OA 2E87A 2V26A 1SF8A 4U5EE 3RH3A 4DVYP 3K1HA 4YT5A 4C7OA 4KNWA 3KKBA 3OEOA 4O79A 2CGEA 3B0VC 3NDBB 3S27A 4AX2A 3AQBA 4PJJA 4JURI 2WVNA 3ECSA 4JCHA 3NRHA 2O9XA 4BJ5C 4G7OF 2QTVA 1PD0A 2W4MA 2J9VA 4AE4A 2ZXPA 3ASNC 2NG1A 4EWCA 3DM9B 1VK5A 2DYSC 3CZ6A 3B9QA 4YT4A 3WG7C 1TWGA 3X1OA 4HEAJ 3E9VA 3W8IA 5KYXA 2R7XA 1FFTC 3DD7A 2IXPA 4IWBA 2PX3A 1V55C 1ZU4A 4K0DA 4XLPF 3DAGA 3W2WA 2JD3A 2R7UA 3ZSUA 4A2NB 4WJ0A 2XRHA 3CQZA 2FFHA 2XSEA 3LAYA 2L81A 3EPVA 5CI8A 3SNHA 1TKNA 4M63A 1W2WA 4BJ6C 4EBBA 3UMHA 4X0RA 3EGDB 2J0XA 3WODF 4RD9A 4YWQA 1OCCC 1RJ9A 2HV7A 1ZHXA 4FX5A 3K7DA 2Q9BA 3SYNA 3POVA 2Y3HA 3B0PA 1LS1A 1VYIA 1BR4A 4YT8A 3AQCA 2C04A 3I4UA 2G3KA 4HFFB 2HV6A 1SZIA 3ZVRA 2R7TA 3EZHA 3HJCA 5B1AC 4BJ1A 2A69F 2DGJA 4CS7A 2WZLA 3ASOC 1FMVA 5L3VA 4LLCA 3Q6MA 2NUTB 5DS5A 4CIHA 2Q3TA 3EGXA 3CSKA 3UGOA 2KNHA 4YT2A 1MMAA 4YN0B 3DJUB 4XTKA 4G7ZF 2J7PA 4CS8C 2QY9A 3RYLA 1FFHA 3DZAA 1D1BA 4C7OB 1FMWA 5D92A 3ITFA 2H7VC 2ZPAA 2A6HF 2I8BA 2G3VA 3UGPA 4QDLA 4KBLA 2BE5F 1QZXA 4U5GA 3EHNA 4AE4B 1O5HA 4OIRF 3VYWA 4BJ5A 1Z63A 1NZEA 1S7ZA 2ZXOA 3FVYA 1ST6A 4U5FE 1BR1A 5FCLA 1KU2A 1NG1A 1ZHTA 3UR3C 5KYXB 3KH2A 4U5DE 2EIMC 4E7SA 4Q7CA 3T4RA 3Q7LA 1OKKA 4W8KA 5E3AA 1LKXA 3EFOA 2H7BA 5L3QA 2VB6A 4Q4ZF 3EHMA 3LS1A 2MYSA 2IOQA 5KYNA 4BJTA 4CSAC 1LVKA 3DXJF 1MMNA 2M4EA 2YHSA 3GODA 3UMKA 1SMYF 3H65A 3LLIA 1N1CA 3N24A 2L9JA 2ZXRA 4HE8D 2CNWA 4BJ6A 4PJMA 3B0UX 1ZHWA 1RJ9B 4H4KC 5CI9A 4C3EA 5T1DB 1TWAA 3QMKA 4XLNF 2WL8A 2KJGA 3LEVA 2WB7A 4PJNA 3JCUQ 4PFPA 1BR2A 2J46A 2P6VA 3PHF2 3DAFA 1VYKA 4JJGA 1D0XA 5KYYB 5DS6A 5DQZA 2PP4A 5KYWA 4FESA 4PJLA 2GFHA 4K7BA 2VH3A 3MX3A 4YJWA 3Q7GA 3SEOA 2Y3GA 2ZXWC 1OKKD 4IRUA 3ZIBA 3EGXB 4CS9A 4LLEA 2WVOA 2EIKC 4DVZA 3ZG1A 1M2VB 3FHDA 4CS8A 4OIQF 4KI2A 1VMAA 4ZLCA 3NG1A 3DM5A 3SP1A 3RIPA 3KMIA 2IYLD 2OCCC 1Z3IX 1IW7F 1NU9C 4NY3A 4I1OB 2J45A 3DJNB 4G7HF 4PFOA 3GANA 5D91A 1NU7D 4I1MA 2FGYA 3EG9B 2Y69C 5DLJA 4OIOF 4MQ9F 4CS9C 3K33A 5KYUA 2CW0F 4DBRA 2EINC 3DMDA 2DYRC 3S28A 3EFOB 1ZU5A 4GEHA 3LS0A 4RBNA 3VAYA 4JJFA 3QZCA 4RDAA 5B3SC 5DS4A 4OD4A 5B1BC 5T3TA 3RFYA 3EGDA 3NKDA 5T3WA 2OG2A 3ABLC 1J8MF 2R7SA 2WVQA 4CSAA 3L34A 3AG3C 2EIJC 3NYJA 4HFKB 2NUPA 2G62A 3EH1A 4ULWA 4I44A 1VOMA 2XXAA 1MNEA 3X2QC 4F4BA 3W8HA 1Z5ZA 4O6NA 3JT1A 3NKEA 3K1IC 1MNDA 2B0JA 4N06A 3ABMC 5DQTA 2Y39A 4ANJA 4KNVA 3SZRA 2R7RA 2MWQA 1FTSA 3JYHA 3N0TA 3F46A 4O7GA 4OINF 2R7QA 1G8XA 4FWVA 2C03A 3JSZA 3O39A 2H7OA 3TD7A 4OIPF 2J7PD 2A68F 2P7VA 3E70C 2WZFA 1TWHA 1M2OA 2Y3DA 4U5HA 1IZMA 4IJJA 4CBEA 2PF4E 3EH2A 2KW3C 2VASA 3NYLA 5IY5C 2IXOA 2PFDA 3EJNA 3KL4A 4U5BE 2PX0A 2EILC 3O6XA 3Q6NA 2XL4A 4QI2A 5F5HA 3RKOF 4C3DA 4B6IA 5KYUB 2Q9CA 3T6BA 3IEEA 1ZYRF 3M1CB 3F47A 4MNDA 3FDQA 5DVWA 4J32B 4OD5A 3EQLF 5BUOA 3LJBA 3FAJA 1ZHZA 1JPJA 1J8YF 3EZIA 4JVSA 3K6BA 4LERA 3OA1A 1D1AA 4G0HA 1M56C 3MLGA 2CNWD 1OCZC 3HLZA 4E7ZA 4ZLDA 2J9UA 5E33A 4P6IC 3OWTA 2NUPB 4U5CE 3LESA 4O6YA 3S29A 1QLEC 3LNRA 1TR2A 3I5QA 3T6JA 2XXAB 4XWJA 1O87A 4BEJA 1Z6AA 4Q5SF 5F5FA 2LSEA 3ABKC 3AG4C 5KYYA 3L0IA 2A1DD 4I3MA 3W2VA 4O6MA 4GYTA 4AK9A 1OCRC 2W9YA 1PCXA 2V3CC 4J30B 3AG1C 3HTKC 4JZAA 4LACB 4DBQA 1D0YA 3UMIA 2A6EF 2IXNA 4JW1A 1D0ZA 4BG0A 2KGOA 3AG2C 2W45A 2R7WA 5E2QA 2WZGA 2Z15A 3ZC4A 3S0XA 2Q9AA 1OCOC 1JPNA 5EGYA 4PK4A 1TWCA 1V54C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3X1O A;  5F5F A;  4ULW A;  5F5H A;  4QI2 A;  4ZLD A;  4ZLC A;  4QI0 A;  4YWQ A; 
#chains in the Genus database with same CATH topology
 3N2Z B;  1M2V A;  4CDY A;  3M79 A;  2JPU A;  1OXK A;  1MMD A;  1QQ3 A;  3NYM A;  3PMR A;  3QW1 A;  4IAO A;  3LLK A;  2J0W A;  3FOP A;  1H7I A;  4JE9 A;  3UNG C;  3I5P A;  3V5X A;  1OR2 A;  4C3B A;  1WGW A;  1Z23 A;  2W4B A;  2Y3B A;  3K66 A;  3M4B A;  5E3C A;  5CIV A;  1M57 C;  2D4U A;  1MMG A;  3A9C A;  4KC9 A;  1H9G A;  2R7V A;  2YZS A;  1PD1 A;  2R7O A;  3RF3 A;  2CDQ A;  1CGO A;  4DOZ A;  2J9W A;  1YZC A;  3AGT A;  2CCY A;  5KYW B;  1D1C A;  2XLD A;  2GDC A;  3EG9 A;  3SXK A;  4DJ9 A;  4QI0 A;  2YEV A;  1I4Y A;  4LDR A;  2AWC A;  2HZ8 A;  1R4T A;  3RQF A;  5AC4 A;  1L3P A;  3O10 A;  2D5R B;  4YL1 A;  2NUT A;  3KYI A;  3MYI A;  5HSW A;  4IB4 A;  1ZHY A;  1T9K A;  1DOW A;  1VLT A;  3JRT A;  2X51 A;  2IXM A;  2KQ9 A;  1NFO A;  4NCQ A;  2EPL X;  3V7O A;  4WAB A;  3LNM B;  2E87 A;  2V26 A;  1SF8 A;  4U5E E;  3VRC A;  4BPM A;  1JOG A;  1NFN A;  3RH3 A;  4DVY P;  3BRJ A;  3K1H A;  2YL0 A;  4YT5 A;  3IQ5 A;  4C7O A;  4KNW A;  3S90 A;  3KKB A;  1DOV A;  3OEO A;  2CGE A;  4O79 A;  5AC5 A;  3B0V C;  3BEH A;  3R7C A;  3S27 A;  3NDB B;  4AX2 A;  3AQB A;  4PJJ A;  1QVX A;  4JUR I;  1Q0K A;  2VCB A;  4NTA A;  1Z7Q c;  3ZDL A;  3AOU A;  2WVN A;  3ECS A;  1LM3 B;  4JCH A;  4DXW A;  3NRH A;  2O9X A;  4BJ5 C;  4G7O F;  3S84 A;  1YYX A;  1F1M A;  1PD0 A;  2QTV A;  2J9V A;  2W4M A;  4AE4 A;  2ZXP A;  3ASN C;  2NG1 A;  4EBK A;  4EWC A;  2Q00 A;  1VK5 A;  2YKZ A;  3DE8 A;  3DM9 B;  4LDQ A;  4MVZ A;  2DYS C;  1EA8 A;  3CZ6 A;  3B9Q A;  4IAR A;  4YT4 A;  3WG7 C;  1I4Z A;  1TWG A;  3X1O A;  4XQ1 A;  2DI3 A;  4HEA J;  2HMQ A;  3E9V A;  3W8I A;  5KYX A;  2R7X A;  1FFT C;  3DD7 A;  2IXP A;  3HNJ A;  2PNO A;  4IWB A;  4U9D A;  2PX3 A;  1YLM A;  1V55 C;  1ZU4 A;  2XM0 A;  2KK1 A;  4K0D A;  4XLP F;  3U5S A;  3DAG A;  3W2W A;  4AL1 A;  4DRH B;  2JD3 A;  1LPE A;  2R7U A;  1XZP A;  3ZSU A;  4A2N B;  4WJ0 A;  3CAX A;  2XRH A;  3PDM P;  4MS2 A;  1A7V A;  5BQH A;  3CQZ A;  2LIG A;  2FFH A;  2XSE A;  3W4Y A;  1XZQ A;  3H2U A;  3LAY A;  2L81 A;  3GM2 A;  3S9O A;  3EPV A;  2KC3 A;  5CI8 A;  3SNH A;  1TKN A;  5EHH A;  1ORY A;  4M63 A;  2OKU A;  1W2W A;  4BJ6 C;  3SXZ A;  3ZQY A;  4MVO A;  3UMH A;  1Q0F A;  4EBB A;  2A0U A;  4X0R A;  5B3I A;  3EGD B;  4NC3 A;  2J0X A;  3WOD F;  1HMO A;  2OOC A;  4RD9 A;  1E84 A;  4YWQ A;  3DKA A;  1OCC C;  2I15 A;  4ULV A;  1RJ9 A;  1A7E A;  2HV7 A;  4E0I A;  5BQG A;  1ZHX A;  4FX5 A;  4EBJ A;  1OW6 A;  3K7D A;  1TFK B;  3U3B A;  1HW2 A;  2Q9B A;  3SYN A;  3POV A;  2Y3H A;  3FVY A;  1GM5 A;  4EKW A;  1HE1 A;  1Q0D A;  3B0P A;  1LS1 A;  5L0G A;  1VYI A;  1BR4 A;  2RD9 A;  2J9B A;  3AQC A;  4YT8 A;  3U3F A;  2R05 A;  1AVO B;  2LCH A;  2C04 A;  5JSL A;  3I4U A;  2G3K A;  4HFF B;  2HV6 A;  3TK0 A;  1SZI A;  2OJE D;  3ZVR A;  3C18 A;  1Y6D A;  5K0I A;  3HNL A;  3C7J A;  1YAU O;  2OJQ A;  2R7T A;  1LS4 A;  3EZH A;  3HNI A;  3HJC A;  5B1A C;  3FOO A;  3RQE A;  2A69 F;  4BJ1 A;  2DGJ A;  4XPX A;  3VM6 A;  2L6H A;  1CGN A;  4EIY A;  4MVM A;  4CS7 A;  3TOL A;  2ZD9 A;  3MYF A;  2WZL A;  4W8P A;  3ASO C;  3T6G B;  1K40 A;  2HJM A;  1FMV A;  5COF A;  5L3V A;  5COM A;  4LLC A;  2M64 A;  3Q6M A;  4H54 A;  3G4Z A;  3JRM O;  2NUT B;  2R25 A;  4CIH A;  1KNY A;  1RXQ A;  5DS5 A;  1WAT A;  2Q3T A;  3EGX A;  3CSK A;  5HV9 A;  3B29 A;  2YVK A;  3UGO A;  2KNH A;  2VCA A;  2XLW A;  2ASR A;  4YT2 A;  1MMA A;  4YN0 B;  3DJU B;  4XTK A;  3M4C A;  4G7Z F;  2J7P A;  5TJ5 E;  3SXM A;  3SXY A;  4CS8 C;  2QY9 A;  2AVK A;  2AP3 A;  3RYL A;  2YWA A;  1BZ4 A;  1FFH A;  3DZA A;  3G50 A;  1I5N A;  3TOM A;  1D1B A;  2HSB A;  2FAP B;  4C7O B;  1G4W R;  3RVZ A;  1B68 A;  1FMW A;  1C02 A;  5D92 A;  4NTB A;  4JIO A;  3ITF A;  2H7V C;  2ZPA A;  4JTD B;  2A6H F;  1NSG B;  2G3V A;  2ETS A;  2I8B A;  3UGP A;  2GWW A;  3KPH A;  2P0N A;  4QDL A;  4MW3 A;  4E0H A;  4UDV A;  4KBL A;  2BE5 F;  1QZX A;  2EPM X;  3C8G A;  4U5G A;  3EHN A;  3A11 A;  4AE4 B;  1FAP B;  1O5H A;  1AEP A;  4OIR F;  1TQG A;  3TUL A;  3U9M A;  4Z9J A;  2LFD A;  4WGY A;  2HS5 A;  3GEH A;  3H2V A;  3VYW A;  4BJ5 A;  2EPK X;  1Z63 A;  2KYH A;  4D4N A;  3G4X A;  4XEK A;  1NZE A;  1S7Z A;  2HKV A;  1T01 A;  1GGQ A;  1ST6 A;  1BR1 A;  2ZXO A;  1KU2 A;  1NG1 A;  1ZHT A;  2NSF A;  4U5F E;  3UR3 C;  5KYX B;  4CJG A;  3JSE O;  1ZW3 A;  1JAF A;  3KH2 A;  4U5D E;  2EIM C;  4E7S A;  4Q7C A;  3T4R A;  3Q7L A;  1OKK A;  2XS8 A;  4PR9 A;  4G78 A;  4W8K A;  5E3A A;  4CX9 A;  1ZVZ A;  3NMJ A;  1LKX A;  3EFO A;  2H7B A;  5L3Q A;  1Q0M A;  1V74 B;  2VB6 A;  4Q4Z F;  3EHM A;  3LS1 A;  3FAP B;  4MVQ A;  5JP7 A;  2XLO A;  2MYS A;  4L6R A;  3IQ6 A;  2IOQ A;  5KYN A;  2XLM A;  4BJT A;  4CSA C;  1LVK A;  3U2M A;  3DXJ F;  1KTM A;  4JTA B;  1MMN A;  4J7Y A;  2M4E A;  3AJM A;  4DRI B;  2YHS A;  1EQ1 A;  3GOD A;  1BDJ B;  1SMY F;  1YA9 A;  3U2L A;  3UMK A;  3H65 A;  3LLI A;  1N1C A;  3N24 A;  2L9J A;  2ZXR A;  4HE8 D;  2CNW A;  4BJ6 A;  4PJM A;  1CPR A;  2LQG A;  3QTH A;  3B0U X;  1ZHW A;  4NTF A;  1RJ9 B;  4H4K C;  5CI9 A;  1APC A;  4C3E A;  5T1D B;  1TWA A;  5JLI A;  5FZT A;  1ZW2 A;  3IQC A;  3QMK A;  4XPW A;  4XLN F;  2WL8 A;  2KJG A;  3V5Y A;  1HW1 A;  4YL3 A;  3LEV A;  5GPG B;  2WB7 A;  4PJN A;  1V4A A;  3JCU Q;  2HFI A;  4PFP A;  3QW0 A;  1BR2 A;  2J46 A;  2P6V A;  3IPM O;  3PHF 2;  5A6K A;  3DAF A;  1VYK A;  1AUE A;  2HMZ A;  3C8G D;  4JJG A;  1D0X A;  2R03 A;  1ZZP A;  5KYY B;  5DS6 A;  5DQZ A;  2PP4 A;  4MVU A;  2VCC A;  3T9O A;  1E85 A;  5KYW A;  4FES A;  4PJL A;  3L1M A;  1LE2 A;  2GFH A;  4K7B A;  2EPO A;  2QNL A;  2VH3 A;  2YQY A;  3MX3 A;  4EUK B;  1T6U A;  2QUP A;  4YJW A;  4YL0 A;  3Q7G A;  4GQH A;  4AL0 A;  3SEO A;  2Y3G A;  2ZXW C;  1JR8 A;  4XEV A;  1OKK D;  4MTF A;  4IRU A;  3ZIB A;  2YLG A;  3EGX B;  4CS9 A;  2B0H A;  5A6B A;  4LLE A;  2WVO A;  2EIK C;  5A6J A;  2JX0 A;  4N6H A;  3GM1 A;  2X0C A;  1K04 A;  2XL8 A;  4DVZ A;  2HSQ A;  1U0B B;  2QE9 A;  3ZG1 A;  4J7T A;  4MVR A;  2AU5 A;  3C63 A;  2YL3 A;  1ORJ A;  1LE4 A;  1M2V B;  2CYD A;  3FHD A;  4CS8 A;  4OIQ F;  3FXH A;  1VMA A;  4KI2 A;  2BL2 A;  4ZLC A;  3L8I A;  3NG1 A;  3DM5 A;  3SP1 A;  3PCV A;  1HMD A;  3RIP A;  3KMI A;  2KSF A;  2IYL D;  2OCC C;  1BBH A;  3C8G B;  1Z3I X;  3C8Z A;  3L8J A;  1IW7 F;  1NU9 C;  4NY3 A;  4I1O B;  2J45 A;  3DJN B;  1OQC A;  4G7H F;  2AWY A;  4D4X A;  3MFN A;  3GAN A;  4PFO A;  2UUI A;  1NU7 D;  4I1M A;  2FGY A;  5D91 A;  3EG9 B;  1JRA A;  2Y69 C;  5DLJ A;  2LK4 A;  4MQ9 F;  4OIO F;  4CS9 C;  3K33 A;  5KYU A;  3B71 A;  3JYY A;  5L0D A;  2CW0 F;  2OEX A;  2EIN C;  4DBR A;  1OW8 A;  3DE9 A;  3DMD A;  5EK0 A;  1A7D A;  2DYR C;  3RVY A;  4EHP A;  3RW0 A;  4P9F A;  3S28 A;  3HNK A;  3GWN A;  4Z9H A;  3EFO B;  1ZU5 A;  4GEH A;  3LS0 A;  4RBN A;  3VF0 A;  3VAY A;  4JJF A;  2LP4 A;  3QZC A;  1JMW A;  2NSG A;  3K1I A;  4RDA A;  5B3S C;  1H6G A;  3DWW A;  1RMV A;  2YRF A;  1NLX A;  3ZQV A;  5L0J A;  1VB5 A;  1WWP A;  5DS4 A;  1RKE A;  4OD4 A;  5B1B C;  1WN0 A;  5T3T A;  5JUA A;  1EI7 A;  1E2X A;  3U9J A;  3RFY A;  3JZ0 A;  3EGD A;  1YYJ A;  3NKD A;  3M15 A;  5T3W A;  2OG2 A;  1C03 A;  3ABL C;  1J8M F;  3GWL A;  2R7S A;  2WVQ A;  4CSA A;  1SYQ A;  4IGG A;  1CGM E;  1MQV A;  3L34 A;  1VTM P;  2H8A A;  3AG3 C;  2EIJ C;  3NYJ A;  4JC7 A;  4HFK B;  3QVZ A;  2NUP A;  2G62 A;  1XWJ A;  3FMS A;  3EH1 A;  2XM4 A;  2GA0 A;  4ULW A;  3NMI A;  4I44 A;  3ZTM A;  1OXB A;  1VOM A;  1L7C A;  2PBE A;  3ZWI A;  2XXA A;  4BEM J;  2Q7R A;  1MNE A;  3X2Q C;  4F4B A;  1CPQ A;  1SR2 A;  256B A;  2IBF A;  3W8H A;  1Z5Z A;  4O6N A;  1ORS C;  2P61 A;  3JT1 A;  2F22 A;  3NKE A;  5FCL A;  3J06 A;  3K1I C;  1EKY A;  1MND A;  1GQA A;  4MTG A;  2B0J A;  4N06 A;  3GOR A;  1U89 A;  3ABM C;  5DQT A;  5L0H A;  4JRZ A;  3AGU A;  2Y39 A;  5JS5 A;  4ANJ A;  4A4A A;  4DRJ B;  4KNV A;  3SZR A;  2R7R A;  2MWQ A;  3DI5 A;  5JRA A;  1H9T A;  1FTS A;  1YAR O;  1YA7 O;  3JYH A;  4R32 A;  4NQF A;  3N0T A;  2XLH A;  3F46 A;  3KYJ A;  4O7G A;  4OIN F;  1OR3 A;  1YZA A;  5BQI A;  2Q4F A;  2R02 A;  2R7Q A;  3GEI A;  1G8X A;  4IAQ A;  4FWV A;  3U8P A;  1K05 A;  2C03 A;  3JSZ A;  3O39 A;  2H7O A;  3TD7 A;  1Q0G A;  3WAQ A;  4OIP F;  2J7P D;  2A68 F;  3TJ6 A;  2P7V A;  3E70 C;  4E17 A;  2WZF A;  1R5I D;  5F28 E;  1TWH A;  1M2O A;  2Y3D A;  4N4W A;  4U5H A;  2QLA A;  4XEF A;  1IZM A;  3O55 A;  3QVY A;  3R2P A;  4IJJ A;  4CBE A;  2J8W A;  2PF4 E;  3EH2 A;  2OU6 A;  2KW3 C;  3IHU A;  2VAS A;  3V5Z A;  3NYL A;  4K1O A;  2IXO A;  5IY5 C;  2PFD A;  4MW8 A;  3IQT A;  3EJN A;  4P9T A;  3KL4 A;  1UG7 A;  2EPN A;  2PX0 A;  4U5B E;  2BC5 A;  2EIL C;  3O6X A;  2IM8 A;  3JTL O;  3Q6N A;  4WGZ A;  2XL4 A;  1E86 A;  5F5H A;  2XLE A;  4QI2 A;  2LD6 A;  2RSE B;  4LDK A;  4JKV A;  2YLI A;  2YL1 A;  1OW7 A;  3RKO F;  2L6F A;  4C3D A;  4B6I A;  4ER9 A;  2L7A A;  3U0C A;  4MVS A;  5KYU B;  1HE9 A;  2Q9C A;  1A0B A;  1A41 A;  3T6B A;  3IEE A;  1UFB A;  1VLS A;  1ZYR F;  1U6H A;  2MHR A;  2L6G A;  2UUH A;  3M1C B;  5L0C A;  1PV3 A;  1RKC A;  3F47 A;  4MND A;  4CJO A;  3FDQ A;  1HY5 A;  5DVW A;  4J32 B;  4OD5 A;  4YK5 A;  3EQL F;  5BUO A;  1NBB A;  3LJB A;  2YL7 A;  3FAJ A;  1ZHZ A;  2ICW G;  4FAP B;  1FNT c;  4MTO A;  4CIP A;  1JPJ A;  1J8Y F;  1QPU A;  1T6Q A;  3EZI A;  1RKE B;  4JTC B;  3K6B A;  4JVS A;  4LER A;  5L0F A;  5L0I A;  2HUJ A;  3OA1 A;  1D1A A;  4G0H A;  2GAQ A;  3ATP A;  1M56 C;  4JEB A;  3LEO A;  3MLG A;  5A69 A;  3LUT B;  1QSP A;  4U9E A;  2CNW D;  1OCZ C;  1S05 A;  1WTY A;  2OQM A;  3HLZ A;  4E7Z A;  2TMV P;  4CDA A;  4ZLD A;  2J9U A;  5E33 A;  4P6I C;  3GM3 A;  4CDV A;  3OWT A;  5JVE A;  2NUP B;  3U8V A;  2VC9 A;  1LIH A;  4U5C E;  3TQO A;  3LES A;  4O6Y A;  3S29 A;  1QLE C;  3LNR A;  1TR2 A;  3TJ5 A;  3I5Q A;  3T6J A;  1FR0 A;  1T6I A;  2NPU A;  1WOL A;  2XXA B;  2R9R B;  4XWJ A;  1E83 A;  4JEA A;  1O87 A;  3C62 A;  1QKR A;  3US6 A;  5COG A;  4BEJ A;  5AGF A;  4Z9I A;  1G4U S;  3GEE A;  1Z6A A;  4Q5S F;  4XPY A;  3HKK A;  5F5F A;  2LSE A;  3ABK C;  3AG4 C;  5KYY A;  1O3U A;  3L0I A;  2A1D D;  4PAC A;  4I3M A;  1YDI A;  3W2V A;  4O6M A;  4GYT A;  3CEX A;  1WAS A;  3RQG A;  3ZTZ A;  1YJG A;  2P1A A;  4AK9 A;  1OCR C;  2XL6 A;  5JT4 A;  2W9Y A;  2XLV A;  1PCX A;  2V3C C;  2A0B A;  4JCZ A;  2YLD A;  4J30 B;  3MBG A;  2DB4 A;  3AG1 C;  1GS9 A;  2XS1 A;  3HTK C;  4LAC B;  4JZA A;  1D0Y A;  3UMI A;  4DBQ A;  2A6E F;  1M6T A;  2IXN A;  4JW1 A;  1D0Z A;  4BG0 A;  2KGO A;  1YVI A;  1RCP A;  4N6C A;  3AG2 C;  2W45 A;  2R7W A;  2HJ3 A;  5E2Q A;  1TFO B;  5A6B D;  1LI5 A;  2WZG A;  2Z15 A;  3ZC4 A;  2OEV A;  3S0X A;  2Q9A A;  1OCO C;  4ONS A;  3NMK A;  4E18 A;  1C17 M;  1JPN A;  1T5O A;  5EGY A;  1Y4C A;  4PK4 A;  2LFF A;  1G5Z A;  3WHN A;  5A6A A;  1TWC A;  1V54 C;  1LI7 A; 
#chains in the Genus database with same CATH homology
 3N2Z B;  1M2V A;  3NYM A;  1MMD A;  4IAO A;  3PMR A;  3UNG C;  5EHH A;  3LLK A;  2J0W A;  4C3B A;  3I5P A;  1WGW A;  1Z23 A;  2W4B A;  2Y3B A;  3K66 A;  5E3C A;  1M57 C;  1MMG A;  4KC9 A;  2R7V A;  2YZS A;  1PD1 A;  2R7O A;  2CDQ A;  4DOZ A;  2J9W A;  5KYW B;  1D1C A;  3EG9 A;  4QI0 A;  2YEV A;  2D5R B;  2NUT A;  5HSW A;  1ZHY A;  3JRT A;  2X51 A;  2IXM A;  2KQ9 A;  3V7O A;  2E87 A;  2V26 A;  1SF8 A;  4U5E E;  3RH3 A;  4DVY P;  3K1H A;  4YT5 A;  4C7O A;  4KNW A;  3KKB A;  3OEO A;  4O79 A;  2CGE A;  3B0V C;  3NDB B;  3S27 A;  4AX2 A;  3AQB A;  4PJJ A;  4JUR I;  2WVN A;  3ECS A;  4JCH A;  3NRH A;  2O9X A;  4BJ5 C;  4G7O F;  2QTV A;  1PD0 A;  2W4M A;  2J9V A;  4AE4 A;  2ZXP A;  3ASN C;  2NG1 A;  4EWC A;  3DM9 B;  1VK5 A;  2DYS C;  3CZ6 A;  3B9Q A;  4YT4 A;  3WG7 C;  1TWG A;  3X1O A;  4HEA J;  3E9V A;  3W8I A;  5KYX A;  2R7X A;  1FFT C;  3DD7 A;  2IXP A;  4IWB A;  2PX3 A;  1V55 C;  1ZU4 A;  4K0D A;  4XLP F;  3DAG A;  3W2W A;  2JD3 A;  2R7U A;  3ZSU A;  4A2N B;  4WJ0 A;  2XRH A;  3CQZ A;  2FFH A;  2XSE A;  3LAY A;  2L81 A;  3EPV A;  5CI8 A;  3SNH A;  1TKN A;  4M63 A;  1W2W A;  4BJ6 C;  4EBB A;  3UMH A;  4X0R A;  3EGD B;  2J0X A;  3WOD F;  4RD9 A;  4YWQ A;  1OCC C;  1RJ9 A;  2HV7 A;  1ZHX A;  4FX5 A;  3K7D A;  2Q9B A;  3SYN A;  3POV A;  2Y3H A;  3B0P A;  1LS1 A;  1VYI A;  1BR4 A;  4YT8 A;  3AQC A;  2C04 A;  3I4U A;  2G3K A;  4HFF B;  2HV6 A;  1SZI A;  3ZVR A;  2R7T A;  3EZH A;  3HJC A;  5B1A C;  4BJ1 A;  2A69 F;  2DGJ A;  4CS7 A;  2WZL A;  3ASO C;  1FMV A;  5L3V A;  4LLC A;  3Q6M A;  2NUT B;  5DS5 A;  4CIH A;  2Q3T A;  3EGX A;  3CSK A;  3UGO A;  2KNH A;  4YT2 A;  1MMA A;  4YN0 B;  3DJU B;  4XTK A;  4G7Z F;  2J7P A;  4CS8 C;  2QY9 A;  3RYL A;  1FFH A;  3DZA A;  1D1B A;  4C7O B;  1FMW A;  5D92 A;  3ITF A;  2H7V C;  2ZPA A;  2A6H F;  2I8B A;  2G3V A;  3UGP A;  4QDL A;  4KBL A;  2BE5 F;  1QZX A;  4U5G A;  3EHN A;  4AE4 B;  1O5H A;  4OIR F;  3VYW A;  4BJ5 A;  1Z63 A;  1NZE A;  1S7Z A;  2ZXO A;  3FVY A;  1ST6 A;  4U5F E;  1BR1 A;  5FCL A;  1KU2 A;  1NG1 A;  1ZHT A;  3UR3 C;  5KYX B;  3KH2 A;  4U5D E;  2EIM C;  4E7S A;  4Q7C A;  3T4R A;  3Q7L A;  1OKK A;  4W8K A;  5E3A A;  1LKX A;  3EFO A;  2H7B A;  5L3Q A;  2VB6 A;  4Q4Z F;  3EHM A;  3LS1 A;  2MYS A;  2IOQ A;  5KYN A;  4BJT A;  4CSA C;  1LVK A;  3DXJ F;  1MMN A;  2M4E A;  2YHS A;  3GOD A;  3UMK A;  1SMY F;  3H65 A;  3LLI A;  1N1C A;  3N24 A;  2L9J A;  2ZXR A;  4HE8 D;  2CNW A;  4BJ6 A;  4PJM A;  3B0U X;  1ZHW A;  1RJ9 B;  4H4K C;  5CI9 A;  4C3E A;  5T1D B;  1TWA A;  3QMK A;  4XLN F;  2WL8 A;  2KJG A;  3LEV A;  2WB7 A;  4PJN A;  3JCU Q;  4PFP A;  1BR2 A;  2J46 A;  2P6V A;  3PHF 2;  3DAF A;  1VYK A;  4JJG A;  1D0X A;  5KYY B;  5DS6 A;  5DQZ A;  2PP4 A;  5KYW A;  4FES A;  4PJL A;  2GFH A;  4K7B A;  2VH3 A;  3MX3 A;  4YJW A;  3Q7G A;  3SEO A;  2Y3G A;  2ZXW C;  1OKK D;  4IRU A;  3ZIB A;  3EGX B;  4CS9 A;  4LLE A;  2WVO A;  2EIK C;  4DVZ A;  3ZG1 A;  1M2V B;  3FHD A;  4CS8 A;  4OIQ F;  4KI2 A;  1VMA A;  4ZLC A;  3NG1 A;  3DM5 A;  3SP1 A;  3RIP A;  3KMI A;  2IYL D;  2OCC C;  1Z3I X;  1IW7 F;  1NU9 C;  4NY3 A;  4I1O B;  2J45 A;  3DJN B;  4G7H F;  4PFO A;  3GAN A;  5D91 A;  1NU7 D;  4I1M A;  2FGY A;  3EG9 B;  2Y69 C;  5DLJ A;  4OIO F;  4MQ9 F;  4CS9 C;  3K33 A;  5KYU A;  2CW0 F;  4DBR A;  2EIN C;  3DMD A;  2DYR C;  3S28 A;  3EFO B;  1ZU5 A;  4GEH A;  3LS0 A;  4RBN A;  3VAY A;  4JJF A;  3QZC A;  4RDA A;  5B3S C;  5DS4 A;  4OD4 A;  5B1B C;  5T3T A;  3RFY A;  3EGD A;  3NKD A;  5T3W A;  2OG2 A;  3ABL C;  1J8M F;  2R7S A;  2WVQ A;  4CSA A;  3L34 A;  3AG3 C;  2EIJ C;  3NYJ A;  4HFK B;  2NUP A;  2G62 A;  3EH1 A;  4ULW A;  4I44 A;  1VOM A;  2XXA A;  1MNE A;  3X2Q C;  4F4B A;  3W8H A;  1Z5Z A;  4O6N A;  3JT1 A;  3NKE A;  3K1I C;  1MND A;  2B0J A;  4N06 A;  3ABM C;  5DQT A;  2Y39 A;  4ANJ A;  4KNV A;  3SZR A;  2R7R A;  2MWQ A;  1FTS A;  3JYH A;  3N0T A;  3F46 A;  4O7G A;  4OIN F;  2R7Q A;  1G8X A;  4FWV A;  2C03 A;  3JSZ A;  3O39 A;  2H7O A;  3TD7 A;  4OIP F;  2J7P D;  2A68 F;  2P7V A;  3E70 C;  2WZF A;  1TWH A;  1M2O A;  2Y3D A;  4U5H A;  1IZM A;  4IJJ A;  4CBE A;  2PF4 E;  3EH2 A;  2KW3 C;  2VAS A;  3NYL A;  5IY5 C;  2IXO A;  2PFD A;  3EJN A;  3KL4 A;  4U5B E;  2PX0 A;  2EIL C;  3O6X A;  3Q6N A;  2XL4 A;  4QI2 A;  5F5H A;  3RKO F;  4C3D A;  4B6I A;  5KYU B;  2Q9C A;  3T6B A;  3IEE A;  1ZYR F;  3M1C B;  3F47 A;  4MND A;  3FDQ A;  5DVW A;  4J32 B;  4OD5 A;  3EQL F;  5BUO A;  3LJB A;  3FAJ A;  1ZHZ A;  1JPJ A;  1J8Y F;  3EZI A;  4JVS A;  3K6B A;  4LER A;  3OA1 A;  1D1A A;  4G0H A;  1M56 C;  3MLG A;  2CNW D;  1OCZ C;  3HLZ A;  4E7Z A;  4ZLD A;  2J9U A;  5E33 A;  4P6I C;  3OWT A;  2NUP B;  4U5C E;  3LES A;  4O6Y A;  3S29 A;  1QLE C;  3LNR A;  1TR2 A;  3I5Q A;  3T6J A;  2XXA B;  4XWJ A;  1O87 A;  4BEJ A;  1Z6A A;  4Q5S F;  5F5F A;  2LSE A;  3ABK C;  3AG4 C;  5KYY A;  3L0I A;  2A1D D;  4I3M A;  3W2V A;  4O6M A;  4GYT A;  4AK9 A;  1OCR C;  2W9Y A;  1PCX A;  2V3C C;  4J30 B;  3AG1 C;  3HTK C;  4JZA A;  4LAC B;  4DBQ A;  1D0Y A;  3UMI A;  2A6E F;  2IXN A;  4JW1 A;  1D0Z A;  4BG0 A;  2KGO A;  3AG2 C;  2W45 A;  2R7W A;  5E2Q A;  2WZG A;  2Z15 A;  3ZC4 A;  3S0X A;  2Q9A A;  1OCO C;  1JPN A;  5EGY A;  4PK4 A;  1TWC A;  1V54 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...