3T6GB

Structure of the complex between nsp3 (shep1) and p130cas
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
134
structure length
134
Chain Sequence
SDRQLLLFYLEQCEANLTTLTNAVDAFFTAVATNQPPKIFVAHSKFVILSAHKLVFIGDTLSRQAKAADVRSQVTHYSNLLCDLLRGIVATTKAAALQYPSPSAAQDMVERVKELGHSTQQFRRVLGQLAAALE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords SH2 domain-containing protein 3C
publication title NSP-Cas protein structures reveal a promiscuous interaction module in cell signaling.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein, cell adhesion
total genus 65
structure length 134
sequence length 134
chains with identical sequence D
ec nomenclature
pdb deposition date 2011-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF12026 CAS_C Crk-Associated Substrate C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 3t6gB00
2HSQA 2IBFA 1QKRA 2GDCA 5L0DA 5L0IA 1H6GA 1ZW3A 3TJ6A 1L7CA 1ZW2A 3T6GB 1RKEA 1DOWA 5L0CA 5L0FA 4P9TA 1DOVA 1U89A 1ZVZA 3H2VA 4W8PA 2LQGA 4PR9A 3S90A 1U6HA 1YDIA 2B0HA 3H2UA 4ONSA 4EHPA 5L0GA 4IGGA 3RF3A 3TJ5A 3ZDLA 1TR2A 1T01A 3MYIA 4E18A 5L0JA 4DJ9A 2L7AA 1RKEB 4K1OA 2X0CA 1XWJA 1ST6A 1RKCA 3VF0A 2GWWA 4E17A 5FZTA 5L0HA 1SYQA
chains in the Genus database with same CATH superfamily
2XLWA 4U9DA 3NKDA 4U5FE 3LEOA 5L0IA 1FMWA 1H6GA 1ZW3A 2PNOA 2R03A 3N2ZB 5D92A 3NMIA 4NCQA 3T6GB 4MNDA 5L0CA 2ZPAA 2IM8A 4YT2A 1B68A 3NKEA 5BQIA 2L9JA 4PR9A 2B0JA 2Q4FA 4J30B 4QDLA 2EPOA 1JR8A 1LI7A 1TQGA 4BEJA 1JOGA 4LDKA 4C3DA 2J46A 3G50A 2V3CC 3DWWA 4F4BA 4YL1A 2XLOA 4IAOA 2DYSC 3TD7A 2EILC 1VLSA 5JS5A 4J7TA 1FNTc 3LLKA 2CCYA 3UMKA 1YJGA 1ZHWA 2KK1A 2KSFA 3GEEA 3LS1A 3FXHA 4NY3A 1WWPA 4QI2A 1V4AA 4JRZA 2J9BA 3LLIA 2ETSA 2ICWG 1OCCC 2ZXPA 1R5ID 4BJ6C 1L7CA 1Q0GA 1ZW2A 2L6HA 3EGDB 4MQ9F 4XEKA 1VYKA 4K7BA 2PP4A 2BL2A 3HNIA 3JSEO 4WGYA 1HW1A 2XM0A 2HZ8A 3CZ6A 2YLGA 3NG1A 3K66A 2UUHA 2Y3BA 3M4BA 4O7GA 4PK4A 3HJCA 3QVZA 4JJGA 5L3VA 2YL7A 1AVOB 1Z63A 3KPHA 4G7ZF 5E33A 4P9FA 4JVSA 4YT8A 1VTMP 4CIHA 2R7QA 3T6BA 4BPMA 3EGDA 2CNWA 3RQGA 3B71A 4JEAA 2Q9BA 4OIPF 1OCZC 5DQTA 2QNLA 3ASNC 4ZLDA 1D0XA 3DD7A 2R9RB 2GWWA 3V7OA 1HW2A 4XLNF 3O39A 3UGOA 1T6UA 3R2PA 3PMRA 1H9GA 3TJ6A 5E2QA 5JT4A 1RKEA 2HV6A 4FX5A 2IYLD 2JD3A 1DOVA 3HLZA 3S29A 1LVKA 3JRTA 1MMAA 4O6MA 1ZZPA 2A69F 2M4EA 3FAJA 1APCA 1ORSC 3G4XA 3L1MA 2Y3HA 4E7ZA 3OEOA 4MTOA 3B0UX 3C8ZA 3EHNA 3DMDA 1MMGA 3FVYA 4IGGA 3CSKA 2KYHA 3FAPB 4W8KA 5A6KA 2XL6A 4LLCA 2LD6A 1J8YF 1TWAA 4Z9JA 4I1MA 5F28E 5K0IA 3DM9B 1D1BA 1QPUA 2PFDA 1IZMA 3C62A 3IQ6A 3L8IA 1LKXA 1ORYA 2AVKA 5FZTA 1Q0DA 4OD5A 1OKKA 5F5HA 5HV9A 1UG7A 5BQGA 1PV3A 2R02A 3JRMO 3DI5A 1PCXA 1J8MF 2YLIA 3GWLA 4MVOA 4ULVA 4YL3A 3PCVA 3S0XA 4G7HF 4LERA 3CEXA 2IOQA 2VB6A 2EPNA 4PJMA 5DS4A 1Z3IX 1Y6DA 2CGEA 2WZGA 1M2OA 4P9TA 3M4CA 3PHF2 1WTYA 4XPYA 2YVKA 4YJWA 3S90A 3NYMA 2V26A 2XM4A 4BJ5C 2OJED 2O9XA 2Y39A 2YL3A 1Q0KA 4C7OA 4BJ1A 2MWQA 1YZAA 3ZSUA 1M57C 3FMSA 2HJ3A 3Q6MA 2L81A 2YL1A 4P6IC 1LI5A 1SMYF 2QY9A 3K7DA 3PDMP 3KMIA 3SYNA 1PD1A 3MYIA 3ATPA 3GM2A 4ER9A 4NTBA 2RSEB 3V5XA 2R7SA 2EINC 2C04A 1NLXA 2L6GA 3B0VC 2EPLX 4YT5A 1TFOB 1PD0A 1AEPA 2J7PD 2X51A 1FTSA 1I4ZA 4JE9A 4JW1A 1MMDA 4U9EA 3DAFA 2HKVA 2Q9AA 4KC9A 3JCUQ 4IJJA 4AE4B 3Q7LA 1WGWA 2XL8A 5DS5A 3VRCA 2J9WA 1W2WA 2C03A 1U89A 1R4TA 1T6IA 5D91A 5FCLA 3POVA 2DGJA 1NSGB 1MNDA 2LFFA 1WATA 3DKAA 1WASA 5DQZA 4YT4A 2WVOA 4X0RA 1D1CA 5CIVA 3VYWA 5T3WA 3G4ZA 3GM1A 4AE4A 5F5FA 1KTMA 1TR2A 3TK0A 1JMWA 1NBBA 2R25A 2HS5A 3N0TA 4U5HA 4O6YA 2X0CA 4HE8D 3LNRA 5DS6A 1TWHA 3AGUA 3UNGC 2OOCA 2VCCA 1EKYA 3BEHA 3O6XA 1BBHA 3QW0A 2FAPB 3RYLA 2J9VA 2GA0A 4MS2A 5E3CA 2GFHA 4JIOA 5KYNA 5L0DA 2JX0A 4FWVA 3V5YA 1O5HA 3DJNB 3OA1A 2Q9CA 2QTVA 1YAUO 4N6HA 5A6BA 4L6RA 1I5NA 3VM6A 1I4YA 4B6IA 4YK5A 2R7WA 4IWBA 3MYFA 3E70C 3F47A 3ZQYA 4Q5SF 5DLJA 5L0GA 1UFBA 5KYWA 2CYDA 1Z5ZA 1K05A 1TWGA 2OQMA 2EPMX 4QI0A 4BEMJ 4EIYA 4WABA 3WODF 5KYUB 1A0BA 3EJNA 3NMKA 3U3BA 4XWJA 4OIRF 4R32A 1LS4A 3LUTB 3X2QC 2CNWD 1T6QA 2Y3DA 2KC3A 2XLEA 3K1IA 1E84A 3EH2A 4CS8A 3C63A 2Q3TA 2W4BA 1HY5A 1ZHZA 3GORA 2A6HF 4JC7A 1QQ3A 5KYUA 2CW0F 1NU9C 1XZQA 2XLVA 5BUOA 3EG9B 2IXNA 2D5RB 2OKUA 3EFOB 1DOWA 4XQ1A 1M6TA 1ZVZA 4CX9A 5A6JA 1FR0A 4G7OF 2NG1A 1NU7D 2M64A 3W8HA 2VCBA 1QVXA 2J9UA 2YKZA 3GWNA 3AJMA 3IHUA 4MVMA 4PFPA 2LCHA 3ECSA 3K33A 3ZG1A 2J8WA 4XTKA 3QMKA 4AL1A 3RF3A 3RFYA 3ZVRA 4YL0A 2GAQA 4PJNA 3EG9A 3W4YA 1M2VA 1SZIA 2PBEA 3EFOA 3W8IA 1G4WR 1MMNA 1RKEB 1SF8A 2I8BA 3MLGA 4CDVA 4G0HA 1CPQA 5B1BC 4CJOA 1ST6A 4DBQA 4Q4ZF 1N1CA 1NFOA 2VASA 2ZXOA 4XEVA 3UGPA 3M15A 4JJFA 3DM5A 1OKKD 3L34A 2WZFA 2KJGA 4OINF 2DYRC 3LEVA 1K04A 4PACA 1KNYA 3KL4A 3RIPA 3ZIBA 2HMQA 3JSZA 5KYYA 3IQCA 4AX2A 1ZHXA 2OU6A 1U6HA 2YLDA 1KU2A 2LFDA 4ONSA 3UR3C 2G3KA 4MVZA 3RVZA 3KYJA 3LAYA 1K40A 2WVQA 1Z23A 2YHSA 5T1DB 2BC5A 5T3TA 2R7VA 1OR2A 1BR4A 2ASRA 4DXWA 2XRHA 2YEVA 2F22A 2OEVA 4DJ9A 2PX3A 3E9VA 2LSEA 3B29A 2P0NA 1E86A 4DRJB 3I5QA 5HSWA 3DZAA 2XXAA 1BDJB 3VF0A 3H65A 1OW8A 2XLMA 3S27A 3NMJA 4EBJA 1XZPA 3HTKC 4NTFA 4LDRA 4EWCA 2KQ9A 4E0IA 4C7OB 1VYIA 1EQ1A 4FESA 4LDQA 3FHDA 3AQBA 3B0PA 1CGME 3EHMA 1QZXA 2NUTA 2NUPA 4ULWA 1A7EA 3H2VA 4E7SA 1EI7A 4RBNA 4ANJA 4CSAA 3EH1A 1RCPA 2FGYA 4JCZA 3WG7C 1C02A 3CAXA 1YYXA 3C18A 3I5PA 2Y3GA 4K0DA 2NSFA 4EHPA 3U3FA 3SXYA 1CGOA 1LE2A 1ZU5A 2A0BA 2W4MA 4MVSA 4AL0A 4ZLCA 2XSEA 1CGNA 4Z9HA 2YRFA 3TOLA 1MNEA 4H4KC 3U5SA 4BG0A 5EGYA 1EA8A 1RKCA 4JZAA 2H7VC 4HFFB 4EBKA 4NQFA 1CPRA 4JTCB 2IBFA 2H8AA 4CS9A 1LIHA 2TMVP 3AG3C 4CS9C 1ZHTA 1D0ZA 2J45A 3N24A 4DVYP 4YWQA 5JLIA 1FAPB 3HNJA 3IQ5A 3JYHA 3U2LA 2P6VA 3RKOF 3ZTMA 5AC5A 1E83A 3UMIA 3F46A 2YQYA 1Q0MA 1RJ9B 4W8PA 5A6BD 3SNHA 3JT1A 4JTDB 1LM3B 4XLPF 1G8XA 4MTFA 1G5ZA 3IEEA 5IY5C 2B0HA 5L0JA 2R7UA 2A6EF 4J32B 3CQZA 3GEIA 4KBLA 4IRUA 3FOOA 4DOZA 5JUAA 1ZHYA 2KW3C 4OIOF 4OIQF 1A7VA 2QE9A 4Q7CA 3NRHA 2BE5F 2CDQA 3C8GB 4U5GA 4UDVA 3JYYA 1RJ9A 3M79A 3QTHA 3TOMA 2W45A 4E17A 3S84A 4KI2A 5L0HA 1GGQA 2JPUA 2GDCA 4YN0B 3A11A 5KYWB 1WN0A 2PX0A 3LESA 4KNVA 3DXJF 3QVYA 4G78A 1BR2A 1YA9A 3S9OA 3V5ZA 3C8GA 2KGOA 4CIPA 2FFHA 3C7JA 3EZIA 4MW8A 5JP7A 1M56C 5CI8A 5TJ5E 4C3EA 2VCAA 3J06A 2P61A 1H7IA 4N06A 4XEFA 3SXKA 3EPVA 5JSLA 2I15A 4JURI 2WL8A 1T5OA 2XS8A 1JAFA 4OD4A 3AG1C 4U5EE 3SXZA 4PJLA 2L7AA 3B9QA 3GANA 4MVRA 1VB5A 4D4NA 2QLAA 256BA 1YARO 1V55C 2OJQA 4C3BA 5KYXB 3SZRA 5EHHA 1U0BB 3HNKA 4N4WA 3Q7GA 1O3UA 2HSQA 3K1IC 5B3SC 4CS8C 1D1AA 3RQEA 1NFNA 3WAQA 3GM3A 1Y4CA 3FOPA 2P7VA 2R7TA 1C17M 1M2VB 3IQTA 4WGZA 2ZXWC 2HJMA 4KNWA 2LQGA 1VK5A 5KYXA 2WZLA 2RD9A 4I1OB 2A68F 2WB7A 4DBRA 1V54C 4MVUA 5JVEA 4NTAA 3U9MA 3X1OA 4RDAA 3W2VA 4H54A 4JTAB 2J0XA 3ZDLA 5L3QA 1YYJA 2MYSA 3AQCA 4D4XA 1OCOC 2Z15A 4K1OA 1TKNA 3QW1A 3L0IA 4MVQA 5KYYB 3MFNA 1C03A 4Z9IA 2R05A 1BR1A 2AU5A 4BJ6A 2OCCC 2D4UA 2A0UA 3ABMC 5B3IA 1VLTA 5GPGB 1O87A 3M1CB 1YVIA 3DE8A 4JCHA 4AK9A 2A1DD 3U0CA 2QUPA 2YZSA 4I3MA 4JKVA 3RVYA 2YWAA 3JTLO 1FFTC 4XPXA 1ZU4A 2XXAB 1YZCA 2IXOA 4A4AA 2VH3A 2YL0A 4BJTA 1G4US 3H2UA 3HNLA 3GODA 4CBEA 4PJJA 4WJ0A 3KYIA 4O6NA 3TQOA 2OEXA 2G62A 4MTGA 3EQLF 1QSPA 2XLDA 4MW3A 4GQHA 1T01A 2H7OA 4NC3A 2XL4A 2NUTB 1JRAA 3GEHA 4GEHA 4FAPB 3LNMB 2J0WA 2NUPB 3AGTA 2HV7A 4DVZA 3US6A 3ABLC 3U8VA 3QZCA 2EIMC 1A7DA 4O79A 1SYQA 2LK4A 4A2NB 3NDBB 3IPMO 2R7XA 3DAGA 4LACB 1HE9A 3LJBA 2KNHA 1T9KA 4PFOA 2IXPA 1MQVA 1TFKB 3I4UA 2AWYA 3AG2C 3RW0A 4J7YA 1OXBA 5L0FA 1GQAA 3KH2A 5AC4A 5BQHA 2IXMA 1SR2A 3MX3A 2AWCA 3DE9A 2L6FA 2R7OA 1GM5A 3ABKC 1HMDA 3R7CA 3O55A 4CSAC 2EIKC 3ZC4A 2VC9A 2XS1A 1E85A 3FDQA 4RD9A 3O10A 3MBGA 2EPKX 4GYTA 3T4RA 5A69A 1OW6A 2DB4A 1Q0FA 1F1MA 4U5DE 1H9TA 4EKWA 1NZEA 1OQCA 1ZYRF 3EZHA 3OWTA 3SP1A 1Z7Qc 2PF4E 4CS7A 4HFKB 2AP3A 1TWCA 4E0HA 2HUJA 1QLEC 2UUIA 3JZ0A 3NYJA 5E3AA 3U2MA 5A6AA 2R7RA 3U8PA 2LIGA 3WHNA 1D0YA 3DJUB 3RQFA 1LS1A 3C8GD 4BJ5A 3KKBA 1GS9A 1YA7O 5CI9A 3EGXB 2E87A 2MHRA 3ASOC 2W9YA 3W2WA 1V74B 2H7BA 4DRHB 5COGA 4CDAA 2Y69C 3SEOA 3HKKA 2Q00A 2OG2A 3SXMA 4XPWA 4EUKB 1AUEA 1YLMA 1JPJA 2WVNA 1OW7A 1VMAA 2EIJC 1VOMA 1S7ZA 1OR3A 2P1AA 4IARA 4U5CE 5DVWA 3AOUA 2NPUA 3EGXA 2HMZA 1HMOA 5B1AC 2LP4A 3AG4C 4JEBA 1E2XA 1OXKA 1JPNA 4IB4A 4EBBA 1QKRA 4CDYA 1LE4A 3VAYA 4U5BE 1WOLA 3ZTZA 1RMVA 5COMA 3UMHA 4I44A 1FFHA 1NG1A 3NYLA 2ZD9A 1L3PA 3RH3A 2G3VA 4CJGA 3BRJA 3Q6NA 3ITFA 4N6CA 1A41A 4HEAJ 1YDIA 4LLEA 2ZXRA 1S05A 3K1HA 5COFA 3A9CA 5EK0A 1ORJA 1RXQA 4IAQA 5AGFA 1LPEA 3ZQVA 2DI3A 3T9OA 1OCRC 5JRAA 2HSBA 3TJ5A 3K6BA 1Z6AA 4E18A 1BZ4A 2NSGA 2XLHA 1IW7F 4M63A 2Q7RA 1HE1A 3ZWIA 2HFIA 2J7PA 1XWJA 3S28A 3LS0A 3T6JA 1FMVA 3L8JA 3U9JA 4DRIB 3TULA
chains in the Genus database with same CATH topology
2HSQA 2IBFA 1QKRA 2GDCA 5L0DA 5L0IA 1H6GA 1ZW3A 3TJ6A 1L7CA 1ZW2A 3T6GB 1RKEA 1DOWA 5L0CA 5L0FA 4P9TA 1DOVA 1U89A 1ZVZA 3H2VA 4W8PA 2LQGA 4PR9A 3S90A 1U6HA 1YDIA 2B0HA 3H2UA 4ONSA 4EHPA 5L0GA 4IGGA 3RF3A 3TJ5A 3ZDLA 1TR2A 1T01A 3MYIA 4E18A 5L0JA 4DJ9A 2L7AA 1RKEB 4K1OA 2X0CA 1XWJA 1ST6A 1RKCA 3VF0A 2GWWA 4E17A 5FZTA 5L0HA 1SYQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HSQ A;  2IBF A;  1QKR A;  2GDC A;  5L0D A;  5L0I A;  1H6G A;  1ZW3 A;  3TJ6 A;  1L7C A;  1ZW2 A;  3T6G B;  1RKE A;  1DOW A;  5L0C A;  5L0F A;  4P9T A;  1DOV A;  1U89 A;  1ZVZ A;  3H2V A;  4W8P A;  2LQG A;  4PR9 A;  3S90 A;  1U6H A;  1YDI A;  2B0H A;  3H2U A;  4ONS A;  4EHP A;  5L0G A;  4IGG A;  3RF3 A;  3TJ5 A;  3ZDL A;  1TR2 A;  1T01 A;  3MYI A;  4E18 A;  5L0J A;  4DJ9 A;  2L7A A;  1RKE B;  4K1O A;  2X0C A;  1XWJ A;  1ST6 A;  1RKC A;  3VF0 A;  2GWW A;  4E17 A;  5FZT A;  5L0H A;  1SYQ A; 
#chains in the Genus database with same CATH topology
 2XLW A;  4U9D A;  3NKD A;  4U5F E;  3LEO A;  5L0I A;  1FMW A;  1H6G A;  1ZW3 A;  2PNO A;  2R03 A;  3N2Z B;  5D92 A;  3NMI A;  4NCQ A;  3T6G B;  4MND A;  5L0C A;  2ZPA A;  2IM8 A;  4YT2 A;  1B68 A;  3NKE A;  5BQI A;  2L9J A;  4PR9 A;  2B0J A;  2Q4F A;  4J30 B;  4QDL A;  2EPO A;  1JR8 A;  1LI7 A;  1TQG A;  4BEJ A;  1JOG A;  4LDK A;  4C3D A;  2J46 A;  3G50 A;  2V3C C;  3DWW A;  4F4B A;  4YL1 A;  2XLO A;  4IAO A;  2DYS C;  3TD7 A;  2EIL C;  1VLS A;  5JS5 A;  4J7T A;  1FNT c;  3LLK A;  2CCY A;  3UMK A;  1YJG A;  1ZHW A;  2KK1 A;  2KSF A;  3GEE A;  3LS1 A;  3FXH A;  4NY3 A;  1WWP A;  4QI2 A;  1V4A A;  4JRZ A;  2J9B A;  3LLI A;  2ETS A;  2ICW G;  1OCC C;  2ZXP A;  1R5I D;  4BJ6 C;  1L7C A;  1Q0G A;  1ZW2 A;  2L6H A;  3EGD B;  4MQ9 F;  4XEK A;  1VYK A;  4K7B A;  2PP4 A;  2BL2 A;  3HNI A;  3JSE O;  4WGY A;  1HW1 A;  2XM0 A;  2HZ8 A;  3CZ6 A;  2YLG A;  3NG1 A;  3K66 A;  2UUH A;  2Y3B A;  3M4B A;  4O7G A;  4PK4 A;  3HJC A;  3QVZ A;  4JJG A;  5L3V A;  2YL7 A;  1AVO B;  1Z63 A;  3KPH A;  4G7Z F;  5E33 A;  4P9F A;  4JVS A;  4YT8 A;  1VTM P;  4CIH A;  2R7Q A;  3T6B A;  4BPM A;  3EGD A;  2CNW A;  3RQG A;  3B71 A;  4JEA A;  2Q9B A;  4OIP F;  1OCZ C;  5DQT A;  2QNL A;  3ASN C;  4ZLD A;  1D0X A;  3DD7 A;  2R9R B;  2GWW A;  3V7O A;  1HW2 A;  4XLN F;  3O39 A;  3UGO A;  1T6U A;  3R2P A;  3PMR A;  1H9G A;  3TJ6 A;  5E2Q A;  5JT4 A;  1RKE A;  2HV6 A;  4FX5 A;  2IYL D;  2JD3 A;  1DOV A;  3HLZ A;  3S29 A;  1LVK A;  3JRT A;  1MMA A;  4O6M A;  1ZZP A;  2A69 F;  2M4E A;  3FAJ A;  1APC A;  1ORS C;  3G4X A;  3L1M A;  2Y3H A;  4E7Z A;  3OEO A;  4MTO A;  3B0U X;  3C8Z A;  3EHN A;  3DMD A;  1MMG A;  3FVY A;  4IGG A;  3CSK A;  2KYH A;  3FAP B;  4W8K A;  5A6K A;  2XL6 A;  4LLC A;  2LD6 A;  1J8Y F;  1TWA A;  4Z9J A;  4I1M A;  5F28 E;  5K0I A;  3DM9 B;  1D1B A;  1QPU A;  2PFD A;  1IZM A;  3C62 A;  3IQ6 A;  3L8I A;  1LKX A;  1ORY A;  2AVK A;  5FZT A;  1Q0D A;  4OD5 A;  1OKK A;  5F5H A;  5HV9 A;  1UG7 A;  5BQG A;  1PV3 A;  2R02 A;  3JRM O;  3DI5 A;  1PCX A;  1J8M F;  2YLI A;  3GWL A;  4MVO A;  4ULV A;  4YL3 A;  3PCV A;  3S0X A;  4G7H F;  4LER A;  3CEX A;  2IOQ A;  2VB6 A;  2EPN A;  4PJM A;  5DS4 A;  1Z3I X;  1Y6D A;  2CGE A;  2WZG A;  1M2O A;  4P9T A;  3M4C A;  3PHF 2;  1WTY A;  4XPY A;  2YVK A;  4YJW A;  3S90 A;  3NYM A;  2V26 A;  2XM4 A;  4BJ5 C;  2OJE D;  2O9X A;  2Y39 A;  2YL3 A;  1Q0K A;  4C7O A;  4BJ1 A;  2MWQ A;  1YZA A;  3ZSU A;  1M57 C;  3FMS A;  2HJ3 A;  3Q6M A;  2L81 A;  2YL1 A;  4P6I C;  1LI5 A;  1SMY F;  2QY9 A;  3K7D A;  3PDM P;  3KMI A;  3SYN A;  1PD1 A;  3MYI A;  3ATP A;  3GM2 A;  4ER9 A;  4NTB A;  2RSE B;  3V5X A;  2R7S A;  2EIN C;  2C04 A;  1NLX A;  2L6G A;  3B0V C;  2EPL X;  4YT5 A;  1TFO B;  1PD0 A;  1AEP A;  2J7P D;  2X51 A;  1FTS A;  1I4Z A;  4JE9 A;  4JW1 A;  1MMD A;  4U9E A;  3DAF A;  2HKV A;  2Q9A A;  4KC9 A;  3JCU Q;  4IJJ A;  4AE4 B;  3Q7L A;  1WGW A;  2XL8 A;  5DS5 A;  3VRC A;  2J9W A;  1W2W A;  2C03 A;  1U89 A;  1R4T A;  1T6I A;  5D91 A;  5FCL A;  3POV A;  2DGJ A;  1NSG B;  1MND A;  2LFF A;  1WAT A;  3DKA A;  1WAS A;  5DQZ A;  4YT4 A;  2WVO A;  4X0R A;  1D1C A;  5CIV A;  3VYW A;  5T3W A;  3G4Z A;  3GM1 A;  4AE4 A;  5F5F A;  1KTM A;  1TR2 A;  3TK0 A;  1JMW A;  1NBB A;  2R25 A;  2HS5 A;  3N0T A;  4U5H A;  4O6Y A;  2X0C A;  4HE8 D;  3LNR A;  5DS6 A;  1TWH A;  3AGU A;  3UNG C;  2OOC A;  2VCC A;  1EKY A;  3BEH A;  3O6X A;  1BBH A;  3QW0 A;  2FAP B;  3RYL A;  2J9V A;  2GA0 A;  4MS2 A;  5E3C A;  2GFH A;  4JIO A;  5KYN A;  5L0D A;  2JX0 A;  4FWV A;  3V5Y A;  1O5H A;  3DJN B;  3OA1 A;  2Q9C A;  2QTV A;  1YAU O;  4N6H A;  5A6B A;  4L6R A;  1I5N A;  3VM6 A;  1I4Y A;  4B6I A;  4YK5 A;  2R7W A;  4IWB A;  3MYF A;  3E70 C;  3F47 A;  3ZQY A;  4Q5S F;  5DLJ A;  5L0G A;  1UFB A;  5KYW A;  2CYD A;  1Z5Z A;  1K05 A;  1TWG A;  2OQM A;  2EPM X;  4QI0 A;  4BEM J;  4EIY A;  4WAB A;  3WOD F;  5KYU B;  1A0B A;  3EJN A;  3NMK A;  3U3B A;  4XWJ A;  4OIR F;  4R32 A;  1LS4 A;  3LUT B;  3X2Q C;  2CNW D;  1T6Q A;  2Y3D A;  2KC3 A;  2XLE A;  3K1I A;  1E84 A;  3EH2 A;  4CS8 A;  3C63 A;  2Q3T A;  2W4B A;  1HY5 A;  1ZHZ A;  3GOR A;  2A6H F;  4JC7 A;  1QQ3 A;  5KYU A;  2CW0 F;  1NU9 C;  1XZQ A;  2XLV A;  5BUO A;  3EG9 B;  2IXN A;  2D5R B;  2OKU A;  3EFO B;  1DOW A;  4XQ1 A;  1M6T A;  1ZVZ A;  4CX9 A;  5A6J A;  1FR0 A;  4G7O F;  2NG1 A;  1NU7 D;  2M64 A;  3W8H A;  2VCB A;  1QVX A;  2J9U A;  2YKZ A;  3GWN A;  3AJM A;  3IHU A;  4MVM A;  4PFP A;  2LCH A;  3ECS A;  3K33 A;  3ZG1 A;  2J8W A;  4XTK A;  3QMK A;  4AL1 A;  3RF3 A;  3RFY A;  3ZVR A;  4YL0 A;  2GAQ A;  4PJN A;  3EG9 A;  3W4Y A;  1M2V A;  1SZI A;  2PBE A;  3EFO A;  3W8I A;  1G4W R;  1MMN A;  1RKE B;  1SF8 A;  2I8B A;  3MLG A;  4CDV A;  4G0H A;  1CPQ A;  5B1B C;  4CJO A;  1ST6 A;  4DBQ A;  4Q4Z F;  1N1C A;  1NFO A;  2VAS A;  2ZXO A;  4XEV A;  3UGP A;  3M15 A;  4JJF A;  3DM5 A;  1OKK D;  3L34 A;  2WZF A;  2KJG A;  4OIN F;  2DYR C;  3LEV A;  1K04 A;  4PAC A;  1KNY A;  3KL4 A;  3RIP A;  3ZIB A;  2HMQ A;  3JSZ A;  5KYY A;  3IQC A;  4AX2 A;  1ZHX A;  2OU6 A;  1U6H A;  2YLD A;  1KU2 A;  2LFD A;  4ONS A;  3UR3 C;  2G3K A;  4MVZ A;  3RVZ A;  3KYJ A;  3LAY A;  1K40 A;  2WVQ A;  1Z23 A;  2YHS A;  5T1D B;  2BC5 A;  5T3T A;  2R7V A;  1OR2 A;  1BR4 A;  2ASR A;  4DXW A;  2XRH A;  2YEV A;  2F22 A;  2OEV A;  4DJ9 A;  2PX3 A;  3E9V A;  2LSE A;  3B29 A;  2P0N A;  1E86 A;  4DRJ B;  3I5Q A;  5HSW A;  3DZA A;  2XXA A;  1BDJ B;  3VF0 A;  3H65 A;  1OW8 A;  2XLM A;  3S27 A;  3NMJ A;  4EBJ A;  1XZP A;  3HTK C;  4NTF A;  4LDR A;  4EWC A;  2KQ9 A;  4E0I A;  4C7O B;  1VYI A;  1EQ1 A;  4FES A;  4LDQ A;  3FHD A;  3AQB A;  3B0P A;  1CGM E;  3EHM A;  1QZX A;  2NUT A;  2NUP A;  4ULW A;  1A7E A;  3H2V A;  4E7S A;  1EI7 A;  4RBN A;  4ANJ A;  4CSA A;  3EH1 A;  1RCP A;  2FGY A;  4JCZ A;  3WG7 C;  1C02 A;  3CAX A;  1YYX A;  3C18 A;  3I5P A;  2Y3G A;  4K0D A;  2NSF A;  4EHP A;  3U3F A;  3SXY A;  1CGO A;  1LE2 A;  1ZU5 A;  2A0B A;  2W4M A;  4MVS A;  4AL0 A;  4ZLC A;  2XSE A;  1CGN A;  4Z9H A;  2YRF A;  3TOL A;  1MNE A;  4H4K C;  3U5S A;  4BG0 A;  5EGY A;  1EA8 A;  1RKC A;  4JZA A;  2H7V C;  4HFF B;  4EBK A;  4NQF A;  1CPR A;  4JTC B;  2IBF A;  2H8A A;  4CS9 A;  1LIH A;  2TMV P;  3AG3 C;  4CS9 C;  1ZHT A;  1D0Z A;  2J45 A;  3N24 A;  4DVY P;  4YWQ A;  5JLI A;  1FAP B;  3HNJ A;  3IQ5 A;  3JYH A;  3U2L A;  2P6V A;  3RKO F;  3ZTM A;  5AC5 A;  1E83 A;  3UMI A;  3F46 A;  2YQY A;  1Q0M A;  1RJ9 B;  4W8P A;  5A6B D;  3SNH A;  3JT1 A;  4JTD B;  1LM3 B;  4XLP F;  1G8X A;  4MTF A;  1G5Z A;  3IEE A;  5IY5 C;  2B0H A;  5L0J A;  2R7U A;  2A6E F;  4J32 B;  3CQZ A;  3GEI A;  4KBL A;  4IRU A;  3FOO A;  4DOZ A;  5JUA A;  1ZHY A;  2KW3 C;  4OIO F;  4OIQ F;  1A7V A;  2QE9 A;  4Q7C A;  3NRH A;  2BE5 F;  2CDQ A;  3C8G B;  4U5G A;  4UDV A;  3JYY A;  1RJ9 A;  3M79 A;  3QTH A;  3TOM A;  2W45 A;  4E17 A;  3S84 A;  4KI2 A;  5L0H A;  1GGQ A;  2JPU A;  2GDC A;  4YN0 B;  3A11 A;  5KYW B;  1WN0 A;  2PX0 A;  3LES A;  4KNV A;  3DXJ F;  3QVY A;  4G78 A;  1BR2 A;  1YA9 A;  3S9O A;  3V5Z A;  3C8G A;  2KGO A;  4CIP A;  2FFH A;  3C7J A;  3EZI A;  4MW8 A;  5JP7 A;  1M56 C;  5CI8 A;  5TJ5 E;  4C3E A;  2VCA A;  3J06 A;  2P61 A;  1H7I A;  4N06 A;  4XEF A;  3SXK A;  3EPV A;  5JSL A;  2I15 A;  4JUR I;  2WL8 A;  1T5O A;  2XS8 A;  1JAF A;  4OD4 A;  3AG1 C;  4U5E E;  3SXZ A;  4PJL A;  2L7A A;  3B9Q A;  3GAN A;  4MVR A;  1VB5 A;  4D4N A;  2QLA A;  256B A;  1YAR O;  1V55 C;  2OJQ A;  4C3B A;  5KYX B;  3SZR A;  5EHH A;  1U0B B;  3HNK A;  4N4W A;  3Q7G A;  1O3U A;  2HSQ A;  3K1I C;  5B3S C;  4CS8 C;  1D1A A;  3RQE A;  1NFN A;  3WAQ A;  3GM3 A;  1Y4C A;  3FOP A;  2P7V A;  2R7T A;  1C17 M;  1M2V B;  3IQT A;  4WGZ A;  2ZXW C;  2HJM A;  4KNW A;  2LQG A;  1VK5 A;  5KYX A;  2WZL A;  2RD9 A;  4I1O B;  2A68 F;  2WB7 A;  4DBR A;  1V54 C;  4MVU A;  5JVE A;  4NTA A;  3U9M A;  3X1O A;  4RDA A;  3W2V A;  4H54 A;  4JTA B;  2J0X A;  3ZDL A;  5L3Q A;  1YYJ A;  2MYS A;  3AQC A;  4D4X A;  1OCO C;  2Z15 A;  4K1O A;  1TKN A;  3QW1 A;  3L0I A;  4MVQ A;  5KYY B;  3MFN A;  1C03 A;  4Z9I A;  2R05 A;  1BR1 A;  2AU5 A;  4BJ6 A;  2OCC C;  2D4U A;  2A0U A;  3ABM C;  5B3I A;  1VLT A;  5GPG B;  1O87 A;  3M1C B;  1YVI A;  3DE8 A;  4JCH A;  4AK9 A;  2A1D D;  3U0C A;  2QUP A;  2YZS A;  4I3M A;  4JKV A;  3RVY A;  2YWA A;  3JTL O;  1FFT C;  4XPX A;  1ZU4 A;  2XXA B;  1YZC A;  2IXO A;  4A4A A;  2VH3 A;  2YL0 A;  4BJT A;  1G4U S;  3H2U A;  3HNL A;  3GOD A;  4CBE A;  4PJJ A;  4WJ0 A;  3KYI A;  4O6N A;  3TQO A;  2OEX A;  2G62 A;  4MTG A;  3EQL F;  1QSP A;  2XLD A;  4MW3 A;  4GQH A;  1T01 A;  2H7O A;  4NC3 A;  2XL4 A;  2NUT B;  1JRA A;  3GEH A;  4GEH A;  4FAP B;  3LNM B;  2J0W A;  2NUP B;  3AGT A;  2HV7 A;  4DVZ A;  3US6 A;  3ABL C;  3U8V A;  3QZC A;  2EIM C;  1A7D A;  4O79 A;  1SYQ A;  2LK4 A;  4A2N B;  3NDB B;  3IPM O;  2R7X A;  3DAG A;  4LAC B;  1HE9 A;  3LJB A;  2KNH A;  1T9K A;  4PFO A;  2IXP A;  1MQV A;  1TFK B;  3I4U A;  2AWY A;  3AG2 C;  3RW0 A;  4J7Y A;  1OXB A;  5L0F A;  1GQA A;  3KH2 A;  5AC4 A;  5BQH A;  2IXM A;  1SR2 A;  3MX3 A;  2AWC A;  3DE9 A;  2L6F A;  2R7O A;  1GM5 A;  3ABK C;  1HMD A;  3R7C A;  3O55 A;  4CSA C;  2EIK C;  3ZC4 A;  2VC9 A;  2XS1 A;  1E85 A;  3FDQ A;  4RD9 A;  3O10 A;  3MBG A;  2EPK X;  4GYT A;  3T4R A;  5A69 A;  1OW6 A;  2DB4 A;  1Q0F A;  1F1M A;  4U5D E;  1H9T A;  4EKW A;  1NZE A;  1OQC A;  1ZYR F;  3EZH A;  3OWT A;  3SP1 A;  1Z7Q c;  2PF4 E;  4CS7 A;  4HFK B;  2AP3 A;  1TWC A;  4E0H A;  2HUJ A;  1QLE C;  2UUI A;  3JZ0 A;  3NYJ A;  5E3A A;  3U2M A;  5A6A A;  2R7R A;  3U8P A;  2LIG A;  3WHN A;  1D0Y A;  3DJU B;  3RQF A;  1LS1 A;  3C8G D;  4BJ5 A;  3KKB A;  1GS9 A;  1YA7 O;  5CI9 A;  3EGX B;  2E87 A;  2MHR A;  3ASO C;  2W9Y A;  3W2W A;  1V74 B;  2H7B A;  4DRH B;  5COG A;  4CDA A;  2Y69 C;  3SEO A;  3HKK A;  2Q00 A;  2OG2 A;  3SXM A;  4XPW A;  4EUK B;  1AUE A;  1YLM A;  1JPJ A;  2WVN A;  1OW7 A;  1VMA A;  2EIJ C;  1VOM A;  1S7Z A;  1OR3 A;  2P1A A;  4IAR A;  4U5C E;  5DVW A;  3AOU A;  2NPU A;  3EGX A;  2HMZ A;  1HMO A;  5B1A C;  2LP4 A;  3AG4 C;  4JEB A;  1E2X A;  1OXK A;  1JPN A;  4IB4 A;  4EBB A;  1QKR A;  4CDY A;  1LE4 A;  3VAY A;  4U5B E;  1WOL A;  3ZTZ A;  1RMV A;  5COM A;  3UMH A;  4I44 A;  1FFH A;  1NG1 A;  3NYL A;  2ZD9 A;  1L3P A;  3RH3 A;  2G3V A;  4CJG A;  3BRJ A;  3Q6N A;  3ITF A;  4N6C A;  1A41 A;  4HEA J;  1YDI A;  4LLE A;  2ZXR A;  1S05 A;  3K1H A;  5COF A;  3A9C A;  5EK0 A;  1ORJ A;  1RXQ A;  4IAQ A;  5AGF A;  1LPE A;  3ZQV A;  2DI3 A;  3T9O A;  1OCR C;  5JRA A;  2HSB A;  3TJ5 A;  3K6B A;  1Z6A A;  4E18 A;  1BZ4 A;  2NSG A;  2XLH A;  1IW7 F;  4M63 A;  2Q7R A;  1HE1 A;  3ZWI A;  2HFI A;  2J7P A;  1XWJ A;  3S28 A;  3LS0 A;  3T6J A;  1FMV A;  3L8J A;  3U9J A;  4DRI B;  3TUL A; 
#chains in the Genus database with same CATH homology
 2HSQ A;  2IBF A;  1QKR A;  2GDC A;  5L0D A;  5L0I A;  1H6G A;  1ZW3 A;  3TJ6 A;  1L7C A;  1ZW2 A;  3T6G B;  1RKE A;  1DOW A;  5L0C A;  5L0F A;  4P9T A;  1DOV A;  1U89 A;  1ZVZ A;  3H2V A;  4W8P A;  2LQG A;  4PR9 A;  3S90 A;  1U6H A;  1YDI A;  2B0H A;  3H2U A;  4ONS A;  4EHP A;  5L0G A;  4IGG A;  3RF3 A;  3TJ5 A;  3ZDL A;  1TR2 A;  1T01 A;  3MYI A;  4E18 A;  5L0J A;  4DJ9 A;  2L7A A;  1RKE B;  4K1O A;  2X0C A;  1XWJ A;  1ST6 A;  1RKC A;  3VF0 A;  2GWW A;  4E17 A;  5FZT A;  5L0H A;  1SYQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...