3T6GB

Structure of the complex between nsp3 (shep1) and p130cas
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
134
structure length
134
Chain Sequence
SDRQLLLFYLEQCEANLTTLTNAVDAFFTAVATNQPPKIFVAHSKFVILSAHKLVFIGDTLSRQAKAADVRSQVTHYSNLLCDLLRGIVATTKAAALQYPSPSAAQDMVERVKELGHSTQQFRRVLGQLAAALE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Signaling protein, cell adhesion
molecule keywords SH2 domain-containing protein 3C
publication title NSP-Cas protein structures reveal a promiscuous interaction module in cell signaling.
pubmed doi rcsb
source organism Homo sapiens
total genus 65
structure length 134
sequence length 134
chains with identical sequence D
ec nomenclature
pdb deposition date 2011-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF12026 CAS_C Crk-Associated Substrate C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 3t6gB00
1YDIA 2LQGA 1DOVA 3MYIA 4ONSA 3TJ6A 1DOWA 5L0CA 3S90A 2GWWA 3H2UA 1SYQA 4K1OA 5L0GA 1RKCA 2L7AA 1ZW2A 1H6GA 5L0HA 1RKEB 1T01A 1U89A 3T6GB 3TJ5A 1ZW3A 5FZTA 1L7CA 2B0HA 2X0CA 4E17A 4PR9A 5L0JA 4P9TA 4E18A 5L0DA 5L0FA 5L0IA 3RF3A 1ST6A 2GDCA 2HSQA 3ZDLA 1ZVZA 4IGGA 4DJ9A 1U6HA 2IBFA 3VF0A 4EHPA 1QKRA 1XWJA 3H2VA 1TR2A 4W8PA 1RKEA
chains in the Genus database with same CATH superfamily
2WVNA 4AE4B 4Q4ZF 3FDQA 2OCCC 5DQZA 4C3DA 1FNTc 2AVKA 1MMDA 2XLEA 1DOWA 3EJNA 5COGA 2NUPB 4U5DE 1FFTC 3M4BA 4BPMA 4BEJA 1TQGA 3E9VA 4OD5A 1YA9A 3ABMC 4GEHA 2EIKC 1BR4A 4MVUA 2G3KA 1G4WR 1BR2A 3VRCA 3ZSUA 1J8YF 3GM3A 1Z7Qc 3ZWIA 3GWNA 5FCLA 5HV9A 3MFNA 1QSPA 1V55C 1ZVZA 4B6IA 1U6HA 4CS9C 2KSFA 1W2WA 3JT1A 4JJFA 4C3EA 5EGYA 2BL2A 3KKBA 4RBNA 4PACA 3VAYA 4EIYA 3DE9A 3G4XA 4IAOA 4JZAA 3B0UX 4OINF 2XL6A 4KBLA 3M4CA 4JW1A 1PCXA 5KYUB 3NRHA 5JRAA 3RQGA 4IB4A 4OIQF 1TFKB 2J0WA 4GQHA 2OEXA 1K04A 3N24A 2YZSA 4J7TA 1L3PA 3I5QA 1SF8A 2NG1A 3TJ5A 1BBHA 2LCHA 2NUTA 3U2MA 3W4YA 1D1AA 1ZHXA 3U2LA 3S9OA 2J0XA 2OJED 3T4RA 2HV6A 2R7QA 3IQCA 3S0XA 3S84A 3FMSA 3O39A 2A6EF 1YARO 2KW3C 2VASA 4JJGA 4CS8A 3VF0A 2HFIA 3HNKA 4BJ5C 4ZLDA 4C7OA 3W2WA 4LERA 2MYSA 1M57C 4WGYA 4DOZA 1WOLA 1G4US 5EK0A 2DYSC 1OW6A 1O87A 1OCRC 1YDIA 3FAJA 3ITFA 5IY5C 2Y3HA 2XS1A 5AC4A 5B3SC 2R7WA 3NKDA 1Z5ZA 1M2OA 3HKKA 4YL0A 3M1CB 3V7OA 3S90A 2R7VA 1OQCA 3CEXA 4O6NA 3ZVRA 3CAXA 2HJMA 1WGWA 3CQZA 3LEOA 3U8VA 5B1BC 2QY9A 2AU5A 3M15A 1A7EA 5F5HA 4EWCA 4OIOF 2GFHA 1Q0MA 2TMVP 3C8ZA 2ZXWC 1ST6A 3EGXA 3GEEA 4K0DA 3QVZA 2ZXPA 3ZQVA 5COFA 4EUKB 5KYXA 3WAQA 2Q4FA 2HSBA 2J46A 2J7PD 1CPRA 1BR1A 1T6QA 1OXBA 3UMKA 1FAPB 2QNLA 2XM0A 4H54A 4HFFB 1K40A 3C63A 3LESA 2V3CC 1MQVA 1NFNA 1QLEC 4RDAA 1OW7A 2KGOA 5AC5A 2EPMX 4CS9A 4JKVA 4YT8A 3NMKA 3IPMO 3TJ6A 1YYJA 4KC9A 2H7BA 1EQ1A 3RQEA 4DRIB 3PHF2 1H9GA 4OIRF 4CJOA 3U3BA 2CNWD 2VH3A 2L7AA 5E2QA 4U5FE 2EPOA 1OCOC 2FFHA 2ICWG 2Y3GA 4U9DA 1T01A 4CIHA 1U89A 1WASA 1HY5A 3ATPA 2G62A 3ASNC 3KMIA 1N1CA 2IXNA 4N6CA 5COMA 3WODF 3IHUA 3EGDB 1FR0A 2AWCA 4J32B 4ULWA 1M2VA 4E18A 1T9KA 4IAQA 4LDQA 3X1OA 4BJTA 5JUAA 5EHHA 5AGFA 1E84A 2IXOA 2P61A 5L3QA 4E0IA 3UGOA 4J7YA 2NSFA 1CGOA 3C7JA 1YZAA 1QKRA 1SMYF 4XQ1A 2QLAA 4EHPA 2KK1A 1FFHA 4XPWA 4R32A 5E33A 3AGTA 3ZTMA 1Y4CA 2LSEA 1E86A 4BJ6A 1JPJA 4G78A 2R02A 3S29A 5A6KA 4JE9A 4CDVA 4A2NB 5CIVA 4JCZA 3F46A 1T5OA 3QTHA 1RMVA 2R7UA 5L0GA 2XLMA 2F22A 3DI5A 3LUTB 1H6GA 2OU6A 4F4BA 4QI2A 1JPNA 1AVOB 2MWQA 2Q3TA 3ECSA 2W9YA 1JAFA 2J9VA 1WWPA 4MVQA 1QVXA 1ZHZA 1ZHWA 3AG1C 3B29A 1JMWA 3JTLO 2VCBA 4U5GA 2YWAA 1E85A 1E83A 1OKKD 1RXQA 2WVQA 1OCZC 4AK9A 1YZCA 2XRHA 1RKEA 4C3BA 1HMDA 2WZFA 3F47A 2CYDA 3IEEA 2L6GA 1LI7A 2KNHA 2XLWA 3KYJA 3N0TA 3QMKA 1D0XA 4DVYP 4YWQA 1CGME 2Y3DA 2PFDA 1H9TA 1NFOA 3CZ6A 2YL0A 4QI0A 4O6YA 5L0HA 2YL1A 5BQIA 1Q0GA 2AP3A 1D1BA 2GA0A 2I8BA 3DAFA 5FZTA 4CDYA 2ZXRA 3WG7C 3SXMA 1CPQA 1ZU4A 2RD9A 1Z3IX 3U8PA 2PX3A 2PX0A 3FAPB 5A6BD 1KTMA 2LFDA 2R7SA 4M63A 3QZCA 1H7IA 1YLMA 5JT4A 2W4BA 1LM3B 2EINC 5E3AA 4A4AA 3IQ6A 4N06A 4WJ0A 3AQCA 1TWCA 1TR2A 5HSWA 4W8PA 5D92A 2BC5A 3IQTA 2C03A 1YYXA 1HE1A 2KYHA 1D0ZA 3M79A 1VLTA 3QW0A 1HW1A 4Z9IA 1AEPA 3LLKA 3TK0A 1NBBA 4JURI 3V5ZA 3MLGA 3AQBA 2YL3A 3TD7A 3VM6A 1FMWA 4N4WA 4WABA 1GGQA 2UUIA 3LEVA 4CIPA 3HNLA 1LPEA 1LKXA 4XPYA 5T3TA 3UGPA 3AOUA 1NSGB 3N2ZB 4LACB 4PJMA 5KYUA 3SXKA 1XZQA 4ANJA 2NPUA 5KYWA 2Q9AA 4DJ9A 2OOCA 2J9BA 3MX3A 1UG7A 4MS2A 1QPUA 2NUTB 2R03A 2YVKA 3DJNB 1YVIA 2CW0F 2D4UA 4H4KC 3UMIA 3HJCA 4GYTA 2EILC 2VB6A 5T1DB 2LQGA 1MNDA 3NMIA 2DB4A 1EI7A 4EBBA 3JSEO 3GM2A 2WL8A 4I3MA 4MVSA 4K1OA 2PP4A 3NG1A 3T6BA 1JRAA 5JVEA 1APCA 1VTMP 1VB5A 3A11A 3JYYA 1Q0FA 1J8MF 1FTSA 1ZW3A 2XL4A 2B0HA 3JYHA 1GM5A 2DI3A 2YL7A 3MYFA 4FWVA 2X0CA 2IM8A 4P9TA 3B9QA 3WHNA 3GWLA 4E0HA 3Q6NA 2HV7A 3C8GB 4YJWA 4WGZA 1Z23A 4QDLA 2YHSA 3SNHA 1G5ZA 2M4EA 4DRJB 3EG9B 4N6HA 1EKYA 1ZHYA 1HW2A 2NSGA 3EFOB 4W8KA 4D4NA 2EIMC 3H2VA 3JRMO 2P1AA 3E70C 2EIJC 4MVMA 5A6JA 2OG2A 5KYXB 1R5ID 3L1MA 4PK4A 2ZXOA 3MYIA 4EKWA 4U9EA 4EBJA 2WZGA 3RW0A 2R05A 1TWAA 3NKEA 4Z9HA 3AG2C 3RKOF 4AX2A 4ER9A 3DM5A 1D0YA 2QUPA 2W45A 3C18A 3GODA 2ETSA 3X2QC 4D4XA 1RKCA 1K05A 4JC7A 1MMGA 4XEVA 3G4ZA 3J06A 2J8WA 2R7OA 1LI5A 3SZRA 2OJQA 4PFOA 4E7ZA 1L7CA 2HKVA 3EH1A 3JCUQ 3PCVA 4LLCA 2PBEA 3POVA 5DS5A 2DGJA 5A6AA 4G7ZF 4O6MA 4UDVA 3HNIA 3I5PA 3O10A 4CJGA 4IGGA 4L6RA 4ULVA 3RIPA 1A7VA 1OR2A 2HMZA 4MQ9F 2IBFA 1GQAA 1KU2A 3GM1A 1MNEA 3AG3C 2JD3A 3BRJA 4XPXA 2X51A 3PMRA 5CI8A 1OCCC 3A9CA 3CSKA 4K7BA 2B0JA 5JP7A 3RH3A 1M2VB 4NCQA 1DOVA 3EGDA 3VYWA 5F5FA 5B3IA 3SEOA 2WZLA 1ORJA 1RCPA 5F28E 3W2VA 4BJ5A 4O79A 3H2UA 1MMNA 3V5YA 1ZW2A 1BZ4A 3OWTA 2L9JA 3EHNA 3GEHA 2XLHA 3JSZA 2R9RB 2IXMA 3FVYA 1A41A 2J45A 3DKAA 2H7OA 5L0FA 3H65A 5L0IA 2L81A 3R7CA 3DAGA 4NQFA 3U9JA 1WTYA 1Q0DA 2J9UA 1LE2A 3K6BA 1ORYA 1PD0A 2H7VC 4FX5A 5L3VA 2LD6A 4MW3A 1SZIA 1WN0A 1RJ9A 1HE9A 1YAUO 2IOQA 3NYMA 1V4AA 3SP1A 3Q6MA 3TOMA 3U9MA 5JS5A 4KI2A 3S28A 2Y39A 1ORSC 3RVZA 5JLIA 3LLIA 3T6GB 3LS0A 5BQGA 2R7TA 2EPKX 2YLDA 1HMOA 3NDBB 4YL1A 1TWGA 3DJUB 2HJ3A 1CGNA 3K1IC 3UR3C 5KYYA 1E2XA 3DXJF 3KH2A 2Q00A 2C04A 3ABLC 3ZG1A 2YQYA 5E3CA 2AWYA 4PJNA 1RKEB 4HFKB 3C62A 3O6XA 2Z15A 3LNRA 1Z6AA 2GAQA 3EZIA 4E17A 4CDAA 2CGEA 2I15A 2J9WA 1NU9C 2IXPA 4AE4A 2HSQA 2MHRA 1A0BA 1LS1A 2NUPA 3RQFA 2VCCA 4KNVA 4U5BE 1PV3A 2FAPB 2A6HF 2XLVA 4U5EE 4XEFA 5B1AC 2Y69C 3KL4A 3JRTA 3K7DA 3NYJA 2PNOA 4MVOA 4YL3A 5BUOA 4NTFA 3R2PA 4FESA 3TOLA 1OXKA 3NMJA 4IRUA 4I1OB 3U5SA 1S7ZA 5JSLA 4DXWA 4JCHA 4FAPB 4MTFA 2JX0A 2ZPAA 4OD4A 2OKUA 4PJLA 2WVOA 3AG4C 1I4YA 2HZ8A 4HEAJ 4J30B 5DS4A 2A69F 4JEAA 3PDMP 4JEBA 3ZQYA 3GANA 4U5HA 1LS4A 3SXYA 3UNGC 5L0JA 1EA8A 3FHDA 4XWJA 2ASRA 2L6HA 1ZU5A 2J7PA 2V26A 4LDRA 2BE5F 3ZDLA 3ZTZA 4E7SA 3EHMA 3HNJA 2Q7RA 2M64A 1VYIA 2YLIA 3JZ0A 5GPGB 1JR8A 3L8JA 2YRFA 4YT5A 3T9OA 1SR2A 4IJJA 1C03A 1O5HA 2A1DD 2P0NA 2A0UA 2HUJA 3UMHA 3RFYA 4YT4A 1WATA 2KQ9A 4ONSA 3LS1A 5KYWB 2LP4A 2OEVA 1I5NA 2UUHA 2EPLX 3OEOA 2CNWA 1ZYRF 2E87A 2HMQA 4XEKA 4CSAC 4BJ1A 1NZEA 1LVKA 5TJ5E 3W8IA 4YN0B 4C7OB 4JTDB 3B71A 4RD9A 1VK5A 1QZXA 256BA 4XTKA 5K0IA 3K1IA 3G50A 4PR9A 5D91A 3ZIBA 1PD1A 4DRHB 3RF3A 1GS9A 1Z63A 2GDCA 4DBRA 1F1MA 4BJ6C 2A68F 1QQ3A 1MMAA 2XLDA 3K33A 4MVRA 1VOMA 2XM4A 4MVZA 1M56C 1XWJA 2Q9BA 5CI9A 1YA7O 1UFBA 3U0CA 3NYLA 2HS5A 3DWWA 4XLNF 5KYNA 3EGXB 4O7GA 1BDJB 2D5RB 3FXHA 4CBEA 5DVWA 4AL0A 3OA1A 4G7OF 2DYRC 1OW8A 1JOGA 3TULA 2GWWA 2QE9A 4I44A 3C8GA 3RVYA 2PF4E 1TFOB 1SYQA 3EQLF 3TQOA 3RYLA 1V74B 3L8IA 3QW1A 4EBKA 3EG9A 4MNDA 1KNYA 2RSEB 4LLEA 1S05A 3EFOA 2W4MA 3AJMA 3ASOC 4PJJA 3B0PA 2P7VA 1NG1A 4P6IC 2KC3A 4NY3A 1OKKA 1VYKA 3HLZA 4KNWA 2O9XA 2XSEA 3KPHA 3GORA 1VLSA 4CS7A 4CX9A 1TKNA 1VMAA 2CCYA 4ZLCA 4I1MA 3T6JA 3QVYA 3DMDA 3EPVA 1V54C 1XZPA 2LK4A 2VCAA 3Q7LA 3O55A 5DLJA 4MW8A 4YK5A 5BQHA 2R7RA 4G0HA 1LE4A 1D1CA 5T3WA 2OQMA 4JRZA 4NTBA 4X0RA 3LJBA 1B68A 1G8XA 3FOOA 3S27A 3Q7GA 3LAYA 5DS6A 3DE8A 4MTOA 3W8HA 1U0BB 1OR3A 4BEMJ 4JVSA 4G7HF 3IQ5A 2FGYA 4IWBA 1Y6DA 2JPUA 4NC3A 2H8AA 3AGUA 2XXAA 2EPNA 2KJGA 1C17M 2Y3BA 3LNMB 4JTAB 3K1HA 4BG0A 4CSAA 3EH2A 4P9FA 2YEVA 1AUEA 5A6BA 2LIGA 4AL1A 3B0VC 2Q9CA 1Q0KA 4Q5SF 3EZHA 2CDQA 1NU7D 2L6FA 4DVZA 1T6IA 4HE8D 1T6UA 2R7XA 2IYLD 2XLOA 4DBQA 1FMVA 3DZAA 4LDKA 1I4ZA 1IW7F 1TWHA 5A69A 2ZD9A 4U5CE 1O3UA 3DM9B 3U3FA 1ZZPA 4IARA 4JIOA 5L0CA 3DD7A 3BEHA 3I4UA 3K66A 3ZC4A 3US6A 4YT2A 3FOPA 1IZMA 1RJ9B 3L34A 3C8GD 3L0IA 2P6VA 3SYNA 4Z9JA 3KYIA 1C02A 1LIHA 3SXZA 1ZHTA 5DQTA 1M6TA 2G3VA 2A0BA 3V5XA 4XLPF 4NTAA 1A7DA 3MBGA 4CS8C 3GEIA 2XXAB 2YLGA 1R4TA 2XL8A 5L0DA 2LFFA 4OIPF 5KYYB 2YKZA 4Q7CA 1YJGA 4MTGA 2WB7A 3ABKC 4JTCB 2R25A 2XS8A 4PFPA 2QTVA 2VC9A 3HTKC 1NLXA
chains in the Genus database with same CATH topology
1YDIA 2LQGA 1DOVA 3MYIA 4ONSA 3TJ6A 1DOWA 5L0CA 3S90A 2GWWA 3H2UA 1SYQA 4K1OA 5L0GA 1RKCA 2L7AA 1ZW2A 1H6GA 5L0HA 1RKEB 1T01A 1U89A 3T6GB 3TJ5A 1ZW3A 5FZTA 1L7CA 2B0HA 2X0CA 4E17A 4PR9A 5L0JA 4P9TA 4E18A 5L0DA 5L0FA 5L0IA 3RF3A 1ST6A 2GDCA 2HSQA 3ZDLA 1ZVZA 4IGGA 4DJ9A 1U6HA 2IBFA 3VF0A 4EHPA 1QKRA 1XWJA 3H2VA 1TR2A 4W8PA 1RKEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YDI A;  2LQG A;  1DOV A;  3MYI A;  4ONS A;  3TJ6 A;  1DOW A;  5L0C A;  3S90 A;  2GWW A;  3H2U A;  1SYQ A;  4K1O A;  5L0G A;  1RKC A;  2L7A A;  1ZW2 A;  1H6G A;  5L0H A;  1RKE B;  1T01 A;  1U89 A;  3T6G B;  3TJ5 A;  1ZW3 A;  5FZT A;  1L7C A;  2B0H A;  2X0C A;  4E17 A;  4PR9 A;  5L0J A;  4P9T A;  4E18 A;  5L0D A;  5L0F A;  5L0I A;  3RF3 A;  1ST6 A;  2GDC A;  2HSQ A;  3ZDL A;  1ZVZ A;  4IGG A;  4DJ9 A;  1U6H A;  2IBF A;  3VF0 A;  4EHP A;  1QKR A;  1XWJ A;  3H2V A;  1TR2 A;  4W8P A;  1RKE A; 
#chains in the Genus database with same CATH topology
 2WVN A;  4AE4 B;  4Q4Z F;  3FDQ A;  2OCC C;  5DQZ A;  4C3D A;  1FNT c;  2AVK A;  1MMD A;  2XLE A;  1DOW A;  3EJN A;  5COG A;  2NUP B;  4U5D E;  1FFT C;  3M4B A;  4BPM A;  4BEJ A;  1TQG A;  3E9V A;  4OD5 A;  1YA9 A;  3ABM C;  4GEH A;  2EIK C;  1BR4 A;  4MVU A;  2G3K A;  1G4W R;  1BR2 A;  3VRC A;  3ZSU A;  1J8Y F;  3GM3 A;  1Z7Q c;  3ZWI A;  3GWN A;  5FCL A;  5HV9 A;  3MFN A;  1QSP A;  1V55 C;  1ZVZ A;  4B6I A;  1U6H A;  4CS9 C;  2KSF A;  1W2W A;  3JT1 A;  4JJF A;  4C3E A;  5EGY A;  2BL2 A;  3KKB A;  4RBN A;  4PAC A;  3VAY A;  4EIY A;  3DE9 A;  3G4X A;  4IAO A;  4JZA A;  3B0U X;  4OIN F;  2XL6 A;  4KBL A;  3M4C A;  4JW1 A;  1PCX A;  5KYU B;  3NRH A;  5JRA A;  3RQG A;  4IB4 A;  4OIQ F;  1TFK B;  2J0W A;  4GQH A;  2OEX A;  1K04 A;  3N24 A;  2YZS A;  4J7T A;  1L3P A;  3I5Q A;  1SF8 A;  2NG1 A;  3TJ5 A;  1BBH A;  2LCH A;  2NUT A;  3U2M A;  3W4Y A;  1D1A A;  1ZHX A;  3U2L A;  3S9O A;  2J0X A;  2OJE D;  3T4R A;  2HV6 A;  2R7Q A;  3IQC A;  3S0X A;  3S84 A;  3FMS A;  3O39 A;  2A6E F;  1YAR O;  2KW3 C;  2VAS A;  4JJG A;  4CS8 A;  3VF0 A;  2HFI A;  3HNK A;  4BJ5 C;  4ZLD A;  4C7O A;  3W2W A;  4LER A;  2MYS A;  1M57 C;  4WGY A;  4DOZ A;  1WOL A;  1G4U S;  5EK0 A;  2DYS C;  1OW6 A;  1O87 A;  1OCR C;  1YDI A;  3FAJ A;  3ITF A;  5IY5 C;  2Y3H A;  2XS1 A;  5AC4 A;  5B3S C;  2R7W A;  3NKD A;  1Z5Z A;  1M2O A;  3HKK A;  4YL0 A;  3M1C B;  3V7O A;  3S90 A;  2R7V A;  1OQC A;  3CEX A;  4O6N A;  3ZVR A;  3CAX A;  2HJM A;  1WGW A;  3CQZ A;  3LEO A;  3U8V A;  5B1B C;  2QY9 A;  2AU5 A;  3M15 A;  1A7E A;  5F5H A;  4EWC A;  4OIO F;  2GFH A;  1Q0M A;  2TMV P;  3C8Z A;  2ZXW C;  1ST6 A;  3EGX A;  3GEE A;  4K0D A;  3QVZ A;  2ZXP A;  3ZQV A;  5COF A;  4EUK B;  5KYX A;  3WAQ A;  2Q4F A;  2HSB A;  2J46 A;  2J7P D;  1CPR A;  1BR1 A;  1T6Q A;  1OXB A;  3UMK A;  1FAP B;  2QNL A;  2XM0 A;  4H54 A;  4HFF B;  1K40 A;  3C63 A;  3LES A;  2V3C C;  1MQV A;  1NFN A;  1QLE C;  4RDA A;  1OW7 A;  2KGO A;  5AC5 A;  2EPM X;  4CS9 A;  4JKV A;  4YT8 A;  3NMK A;  3IPM O;  3TJ6 A;  1YYJ A;  4KC9 A;  2H7B A;  1EQ1 A;  3RQE A;  4DRI B;  3PHF 2;  1H9G A;  4OIR F;  4CJO A;  3U3B A;  2CNW D;  2VH3 A;  2L7A A;  5E2Q A;  4U5F E;  2EPO A;  1OCO C;  2FFH A;  2ICW G;  2Y3G A;  4U9D A;  1T01 A;  4CIH A;  1U89 A;  1WAS A;  1HY5 A;  3ATP A;  2G62 A;  3ASN C;  3KMI A;  1N1C A;  2IXN A;  4N6C A;  5COM A;  3WOD F;  3IHU A;  3EGD B;  1FR0 A;  2AWC A;  4J32 B;  4ULW A;  1M2V A;  4E18 A;  1T9K A;  4IAQ A;  4LDQ A;  3X1O A;  4BJT A;  5JUA A;  5EHH A;  5AGF A;  1E84 A;  2IXO A;  2P61 A;  5L3Q A;  4E0I A;  3UGO A;  4J7Y A;  2NSF A;  1CGO A;  3C7J A;  1YZA A;  1QKR A;  1SMY F;  4XQ1 A;  2QLA A;  4EHP A;  2KK1 A;  1FFH A;  4XPW A;  4R32 A;  5E33 A;  3AGT A;  3ZTM A;  1Y4C A;  2LSE A;  1E86 A;  4BJ6 A;  1JPJ A;  4G78 A;  2R02 A;  3S29 A;  5A6K A;  4JE9 A;  4CDV A;  4A2N B;  5CIV A;  4JCZ A;  3F46 A;  1T5O A;  3QTH A;  1RMV A;  2R7U A;  5L0G A;  2XLM A;  2F22 A;  3DI5 A;  3LUT B;  1H6G A;  2OU6 A;  4F4B A;  4QI2 A;  1JPN A;  1AVO B;  2MWQ A;  2Q3T A;  3ECS A;  2W9Y A;  1JAF A;  2J9V A;  1WWP A;  4MVQ A;  1QVX A;  1ZHZ A;  1ZHW A;  3AG1 C;  3B29 A;  1JMW A;  3JTL O;  2VCB A;  4U5G A;  2YWA A;  1E85 A;  1E83 A;  1OKK D;  1RXQ A;  2WVQ A;  1OCZ C;  4AK9 A;  1YZC A;  2XRH A;  1RKE A;  4C3B A;  1HMD A;  2WZF A;  3F47 A;  2CYD A;  3IEE A;  2L6G A;  1LI7 A;  2KNH A;  2XLW A;  3KYJ A;  3N0T A;  3QMK A;  1D0X A;  4DVY P;  4YWQ A;  1CGM E;  2Y3D A;  2PFD A;  1H9T A;  1NFO A;  3CZ6 A;  2YL0 A;  4QI0 A;  4O6Y A;  5L0H A;  2YL1 A;  5BQI A;  1Q0G A;  2AP3 A;  1D1B A;  2GA0 A;  2I8B A;  3DAF A;  5FZT A;  4CDY A;  2ZXR A;  3WG7 C;  3SXM A;  1CPQ A;  1ZU4 A;  2RD9 A;  1Z3I X;  3U8P A;  2PX3 A;  2PX0 A;  3FAP B;  5A6B D;  1KTM A;  2LFD A;  2R7S A;  4M63 A;  3QZC A;  1H7I A;  1YLM A;  5JT4 A;  2W4B A;  1LM3 B;  2EIN C;  5E3A A;  4A4A A;  3IQ6 A;  4N06 A;  4WJ0 A;  3AQC A;  1TWC A;  1TR2 A;  5HSW A;  4W8P A;  5D92 A;  2BC5 A;  3IQT A;  2C03 A;  1YYX A;  1HE1 A;  2KYH A;  1D0Z A;  3M79 A;  1VLT A;  3QW0 A;  1HW1 A;  4Z9I A;  1AEP A;  3LLK A;  3TK0 A;  1NBB A;  4JUR I;  3V5Z A;  3MLG A;  3AQB A;  2YL3 A;  3TD7 A;  3VM6 A;  1FMW A;  4N4W A;  4WAB A;  1GGQ A;  2UUI A;  3LEV A;  4CIP A;  3HNL A;  1LPE A;  1LKX A;  4XPY A;  5T3T A;  3UGP A;  3AOU A;  1NSG B;  3N2Z B;  4LAC B;  4PJM A;  5KYU A;  3SXK A;  1XZQ A;  4ANJ A;  2NPU A;  5KYW A;  2Q9A A;  4DJ9 A;  2OOC A;  2J9B A;  3MX3 A;  1UG7 A;  4MS2 A;  1QPU A;  2NUT B;  2R03 A;  2YVK A;  3DJN B;  1YVI A;  2CW0 F;  2D4U A;  4H4K C;  3UMI A;  3HJC A;  4GYT A;  2EIL C;  2VB6 A;  5T1D B;  2LQG A;  1MND A;  3NMI A;  2DB4 A;  1EI7 A;  4EBB A;  3JSE O;  3GM2 A;  2WL8 A;  4I3M A;  4MVS A;  4K1O A;  2PP4 A;  3NG1 A;  3T6B A;  1JRA A;  5JVE A;  1APC A;  1VTM P;  1VB5 A;  3A11 A;  3JYY A;  1Q0F A;  1J8M F;  1FTS A;  1ZW3 A;  2XL4 A;  2B0H A;  3JYH A;  1GM5 A;  2DI3 A;  2YL7 A;  3MYF A;  4FWV A;  2X0C A;  2IM8 A;  4P9T A;  3B9Q A;  3WHN A;  3GWL A;  4E0H A;  3Q6N A;  2HV7 A;  3C8G B;  4YJW A;  4WGZ A;  1Z23 A;  4QDL A;  2YHS A;  3SNH A;  1G5Z A;  2M4E A;  4DRJ B;  3EG9 B;  4N6H A;  1EKY A;  1ZHY A;  1HW2 A;  2NSG A;  3EFO B;  4W8K A;  4D4N A;  2EIM C;  3H2V A;  3JRM O;  2P1A A;  3E70 C;  2EIJ C;  4MVM A;  5A6J A;  2OG2 A;  5KYX B;  1R5I D;  3L1M A;  4PK4 A;  2ZXO A;  3MYI A;  4EKW A;  4U9E A;  4EBJ A;  2WZG A;  3RW0 A;  2R05 A;  1TWA A;  3NKE A;  4Z9H A;  3AG2 C;  3RKO F;  4AX2 A;  4ER9 A;  3DM5 A;  1D0Y A;  2QUP A;  2W45 A;  3C18 A;  3GOD A;  2ETS A;  3X2Q C;  4D4X A;  1RKC A;  1K05 A;  4JC7 A;  1MMG A;  4XEV A;  3G4Z A;  3J06 A;  2J8W A;  2R7O A;  1LI5 A;  3SZR A;  2OJQ A;  4PFO A;  4E7Z A;  1L7C A;  2HKV A;  3EH1 A;  3JCU Q;  3PCV A;  4LLC A;  2PBE A;  3POV A;  5DS5 A;  2DGJ A;  5A6A A;  4G7Z F;  4O6M A;  4UDV A;  3HNI A;  3I5P A;  3O10 A;  4CJG A;  4IGG A;  4L6R A;  4ULV A;  3RIP A;  1A7V A;  1OR2 A;  2HMZ A;  4MQ9 F;  2IBF A;  1GQA A;  1KU2 A;  3GM1 A;  1MNE A;  3AG3 C;  2JD3 A;  3BRJ A;  4XPX A;  2X51 A;  3PMR A;  5CI8 A;  1OCC C;  3A9C A;  3CSK A;  4K7B A;  2B0J A;  5JP7 A;  3RH3 A;  1M2V B;  4NCQ A;  1DOV A;  3EGD A;  3VYW A;  5F5F A;  5B3I A;  3SEO A;  2WZL A;  1ORJ A;  1RCP A;  5F28 E;  3W2V A;  4BJ5 A;  4O79 A;  3H2U A;  1MMN A;  3V5Y A;  1ZW2 A;  1BZ4 A;  3OWT A;  2L9J A;  3EHN A;  3GEH A;  2XLH A;  3JSZ A;  2R9R B;  2IXM A;  3FVY A;  1A41 A;  2J45 A;  3DKA A;  2H7O A;  5L0F A;  3H65 A;  5L0I A;  2L81 A;  3R7C A;  3DAG A;  4NQF A;  3U9J A;  1WTY A;  1Q0D A;  2J9U A;  1LE2 A;  3K6B A;  1ORY A;  1PD0 A;  2H7V C;  4FX5 A;  5L3V A;  2LD6 A;  4MW3 A;  1SZI A;  1WN0 A;  1RJ9 A;  1HE9 A;  1YAU O;  2IOQ A;  3NYM A;  1V4A A;  3SP1 A;  3Q6M A;  3TOM A;  3U9M A;  5JS5 A;  4KI2 A;  3S28 A;  2Y39 A;  1ORS C;  3RVZ A;  5JLI A;  3LLI A;  3T6G B;  3LS0 A;  5BQG A;  2R7T A;  2EPK X;  2YLD A;  1HMO A;  3NDB B;  4YL1 A;  1TWG A;  3DJU B;  2HJ3 A;  1CGN A;  3K1I C;  3UR3 C;  5KYY A;  1E2X A;  3DXJ F;  3KH2 A;  2Q00 A;  2C04 A;  3ABL C;  3ZG1 A;  2YQY A;  5E3C A;  2AWY A;  4PJN A;  1RKE B;  4HFK B;  3C62 A;  3O6X A;  2Z15 A;  3LNR A;  1Z6A A;  2GAQ A;  3EZI A;  4E17 A;  4CDA A;  2CGE A;  2I15 A;  2J9W A;  1NU9 C;  2IXP A;  4AE4 A;  2HSQ A;  2MHR A;  1A0B A;  1LS1 A;  2NUP A;  3RQF A;  2VCC A;  4KNV A;  4U5B E;  1PV3 A;  2FAP B;  2A6H F;  2XLV A;  4U5E E;  4XEF A;  5B1A C;  2Y69 C;  3KL4 A;  3JRT A;  3K7D A;  3NYJ A;  2PNO A;  4MVO A;  4YL3 A;  5BUO A;  4NTF A;  3R2P A;  4FES A;  3TOL A;  1OXK A;  3NMJ A;  4IRU A;  4I1O B;  3U5S A;  1S7Z A;  5JSL A;  4DXW A;  4JCH A;  4FAP B;  4MTF A;  2JX0 A;  2ZPA A;  4OD4 A;  2OKU A;  4PJL A;  2WVO A;  3AG4 C;  1I4Y A;  2HZ8 A;  4HEA J;  4J30 B;  5DS4 A;  2A69 F;  4JEA A;  3PDM P;  4JEB A;  3ZQY A;  3GAN A;  4U5H A;  1LS4 A;  3SXY A;  3UNG C;  5L0J A;  1EA8 A;  3FHD A;  4XWJ A;  2ASR A;  2L6H A;  1ZU5 A;  2J7P A;  2V26 A;  4LDR A;  2BE5 F;  3ZDL A;  3ZTZ A;  4E7S A;  3EHM A;  3HNJ A;  2Q7R A;  2M64 A;  1VYI A;  2YLI A;  3JZ0 A;  5GPG B;  1JR8 A;  3L8J A;  2YRF A;  4YT5 A;  3T9O A;  1SR2 A;  4IJJ A;  1C03 A;  1O5H A;  2A1D D;  2P0N A;  2A0U A;  2HUJ A;  3UMH A;  3RFY A;  4YT4 A;  1WAT A;  2KQ9 A;  4ONS A;  3LS1 A;  5KYW B;  2LP4 A;  2OEV A;  1I5N A;  2UUH A;  2EPL X;  3OEO A;  2CNW A;  1ZYR F;  2E87 A;  2HMQ A;  4XEK A;  4CSA C;  4BJ1 A;  1NZE A;  1LVK A;  5TJ5 E;  3W8I A;  4YN0 B;  4C7O B;  4JTD B;  3B71 A;  4RD9 A;  1VK5 A;  1QZX A;  256B A;  4XTK A;  5K0I A;  3K1I A;  3G50 A;  4PR9 A;  5D91 A;  3ZIB A;  1PD1 A;  4DRH B;  3RF3 A;  1GS9 A;  1Z63 A;  2GDC A;  4DBR A;  1F1M A;  4BJ6 C;  2A68 F;  1QQ3 A;  1MMA A;  2XLD A;  3K33 A;  4MVR A;  1VOM A;  2XM4 A;  4MVZ A;  1M56 C;  1XWJ A;  2Q9B A;  5CI9 A;  1YA7 O;  1UFB A;  3U0C A;  3NYL A;  2HS5 A;  3DWW A;  4XLN F;  5KYN A;  3EGX B;  4O7G A;  1BDJ B;  2D5R B;  3FXH A;  4CBE A;  5DVW A;  4AL0 A;  3OA1 A;  4G7O F;  2DYR C;  1OW8 A;  1JOG A;  3TUL A;  2GWW A;  2QE9 A;  4I44 A;  3C8G A;  3RVY A;  2PF4 E;  1TFO B;  1SYQ A;  3EQL F;  3TQO A;  3RYL A;  1V74 B;  3L8I A;  3QW1 A;  4EBK A;  3EG9 A;  4MND A;  1KNY A;  2RSE B;  4LLE A;  1S05 A;  3EFO A;  2W4M A;  3AJM A;  3ASO C;  4PJJ A;  3B0P A;  2P7V A;  1NG1 A;  4P6I C;  2KC3 A;  4NY3 A;  1OKK A;  1VYK A;  3HLZ A;  4KNW A;  2O9X A;  2XSE A;  3KPH A;  3GOR A;  1VLS A;  4CS7 A;  4CX9 A;  1TKN A;  1VMA A;  2CCY A;  4ZLC A;  4I1M A;  3T6J A;  3QVY A;  3DMD A;  3EPV A;  1V54 C;  1XZP A;  2LK4 A;  2VCA A;  3Q7L A;  3O55 A;  5DLJ A;  4MW8 A;  4YK5 A;  5BQH A;  2R7R A;  4G0H A;  1LE4 A;  1D1C A;  5T3W A;  2OQM A;  4JRZ A;  4NTB A;  4X0R A;  3LJB A;  1B68 A;  1G8X A;  3FOO A;  3S27 A;  3Q7G A;  3LAY A;  5DS6 A;  3DE8 A;  4MTO A;  3W8H A;  1U0B B;  1OR3 A;  4BEM J;  4JVS A;  4G7H F;  3IQ5 A;  2FGY A;  4IWB A;  1Y6D A;  2JPU A;  4NC3 A;  2H8A A;  3AGU A;  2XXA A;  2EPN A;  2KJG A;  1C17 M;  2Y3B A;  3LNM B;  4JTA B;  3K1H A;  4BG0 A;  4CSA A;  3EH2 A;  4P9F A;  2YEV A;  1AUE A;  5A6B A;  2LIG A;  4AL1 A;  3B0V C;  2Q9C A;  1Q0K A;  4Q5S F;  3EZH A;  2CDQ A;  1NU7 D;  2L6F A;  4DVZ A;  1T6I A;  4HE8 D;  1T6U A;  2R7X A;  2IYL D;  2XLO A;  4DBQ A;  1FMV A;  3DZA A;  4LDK A;  1I4Z A;  1IW7 F;  1TWH A;  5A69 A;  2ZD9 A;  4U5C E;  1O3U A;  3DM9 B;  3U3F A;  1ZZP A;  4IAR A;  4JIO A;  5L0C A;  3DD7 A;  3BEH A;  3I4U A;  3K66 A;  3ZC4 A;  3US6 A;  4YT2 A;  3FOP A;  1IZM A;  1RJ9 B;  3L34 A;  3C8G D;  3L0I A;  2P6V A;  3SYN A;  4Z9J A;  3KYI A;  1C02 A;  1LIH A;  3SXZ A;  1ZHT A;  5DQT A;  1M6T A;  2G3V A;  2A0B A;  3V5X A;  4XLP F;  4NTA A;  1A7D A;  3MBG A;  4CS8 C;  3GEI A;  2XXA B;  2YLG A;  1R4T A;  2XL8 A;  5L0D A;  2LFF A;  4OIP F;  5KYY B;  2YKZ A;  4Q7C A;  1YJG A;  4MTG A;  2WB7 A;  3ABK C;  4JTC B;  2R25 A;  2XS8 A;  4PFP A;  2QTV A;  2VC9 A;  3HTK C;  1NLX A; 
#chains in the Genus database with same CATH homology
 1YDI A;  2LQG A;  1DOV A;  3MYI A;  4ONS A;  3TJ6 A;  1DOW A;  5L0C A;  3S90 A;  2GWW A;  3H2U A;  1SYQ A;  4K1O A;  5L0G A;  1RKC A;  2L7A A;  1ZW2 A;  1H6G A;  5L0H A;  1RKE B;  1T01 A;  1U89 A;  3T6G B;  3TJ5 A;  1ZW3 A;  5FZT A;  1L7C A;  2B0H A;  2X0C A;  4E17 A;  4PR9 A;  5L0J A;  4P9T A;  4E18 A;  5L0D A;  5L0F A;  5L0I A;  3RF3 A;  1ST6 A;  2GDC A;  2HSQ A;  3ZDL A;  1ZVZ A;  4IGG A;  4DJ9 A;  1U6H A;  2IBF A;  3VF0 A;  4EHP A;  1QKR A;  1XWJ A;  3H2V A;  1TR2 A;  4W8P A;  1RKE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...