3T6GB

Structure of the complex between nsp3 (shep1) and p130cas
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
134
structure length
134
Chain Sequence
b'SDRQLLLFYLEQCEANLTTLTNAVDAFFTAVATNQPPKIFVAHSKFVILSAHKLVFIGDTLSRQAKAADVRSQVTHYSNLLCDLLRGIVATTKAAALQYPSPSAAQDMVERVKELGHSTQQFRRVLGQLAAALE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords SH2 domain-containing protein 3C
publication title NSP-Cas protein structures reveal a promiscuous interaction module in cell signaling.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein, cell adhesion
total genus 65
structure length 134
sequence length 134
chains with identical sequence D
ec nomenclature
pdb deposition date 2011-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF12026 CAS_C Crk-Associated Substrate C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 3t6gB00
4E18A 4PR9A 2GDCA 4DJ9A 3RF3A 1RKEA 1L7CA 3S90A 2IBFA 4ONSA 3H2UA 1QKRA 4EHPA 3H2VA 2GWWA 5L0IA 5L0JA 2HSQA 5L0CA 1DOWA 5L0HA 1T01A 5FZTA 1XWJA 1YDIA 2B0HA 3VF0A 3MYIA 1ST6A 1U89A 4K1OA 3ZDLA 2X0CA 1RKCA 3TJ6A 4E17A 5L0FA 5L0GA 2L7AA 4IGGA 4W8PA 2LQGA 1DOVA 1RKEB 5L0DA 1TR2A 1U6HA 1ZW3A 1H6GA 1SYQA 4P9TA 1ZW2A 1ZVZA 3T6GB 3TJ5A
chains in the Genus database with same CATH superfamily
3RQGA 2R7TA 1H9GA 3DAGA 3HLZA 4J7TA 2OCCC 5E3CA 4KNWA 4FWVA 3ATPA 3GM3A 4IB4A 1XZQA 3AG2C 2J7PA 2EIMC 2XLOA 3AQBA 3U5SA 2HSBA 1PV3A 2NUTB 4G78A 1S7ZA 2ICWG 3DJUB 4CS9C 1Y4CA 1RJ9B 1Z5ZA 2EPOA 1A7VA 2IXOA 2L6GA 2Z15A 3AQCA 3F47A 4OIRF 3UMKA 4A4AA 2YLGA 5L0GA 3S84A 3HNIA 4MVZA 3C18A 2Q9CA 3M1CB 4JVSA 3NMIA 2G62A 5HV9A 2QE9A 5EGYA 4IAOA 4U5BE 2R05A 1FTSA 3A9CA 3L34A 3EHNA 3LS1A 2R7WA 1QLEC 3IPMO 2OJQA 1SMYF 3ZQYA 1VLSA 1ZW2A 1GQAA 3JRMO 3T6GB 4DRJB 1JPNA 3M15A 1YZCA 4DJ9A 3LNRA 4JTAB 4MQ9F 1LIHA 1ZZPA 1L7CA 2Y39A 4J7YA 4WJ0A 5JVEA 3L8IA 3NMJA 1K04A 4FESA 2R7RA 3M79A 4JCZA 3RKOF 2LK4A 5T3WA 5EHHA 2HSQA 3FXHA 3SNHA 3JRTA 4JZAA 3NDBB 1LS4A 4AL1A 3JYYA 1TWHA 4NTBA 2YZSA 2DB4A 4YN0B 4NY3A 2W45A 2XM0A 1J8MF 4GQHA 2XL6A 4WGYA 4EKWA 1G5ZA 4XLPF 2V3CC 4YK5A 2HKVA 4LERA 3VAYA 3W8HA 1JPJA 1VOMA 2G3VA 3EZIA 1M2OA 2BE5F 1NU7D 1OW6A 4YL3A 1A7EA 1ZHWA 3E70C 3LLIA 3SZRA 3JZ0A 3K1IC 4MVSA 2PP4A 3FDQA 3UGPA 3U3FA 3JSZA 1WATA 4RBNA 4BPMA 2XLVA 4CS8A 4DBQA 1G4WR 4DOZA 2OQMA 1J8YF 1Z6AA 1QKRA 4O6MA 4CS9A 1Q0GA 2YHSA 2HV6A 1JOGA 3PMRA 2XRHA 3IQCA 2B0HA 4PJMA 5E3AA 1NZEA 3N2ZB 4G0HA 3FMSA 3IHUA 1I5NA 1HMDA 2KYHA 2HS5A 2Q9AA 2VCAA 3K7DA 4JKVA 1FAPB 3HKKA 3LAYA 4AL0A 4EIYA 5L0DA 2CNWA 2WL8A 2A69F 3OWTA 2J9VA 3NYMA 4CDAA 5A6KA 3C8GD 4YJWA 3SXMA 4LLEA 2KNHA 4CDVA 1OCRC 4CIPA 2XSEA 1OKKA 2VASA 2AWYA 1E2XA 1A7DA 3RF3A 4CIHA 1HE9A 4QDLA 1YLMA 3B0PA 1VK5A 2A1DD 1I4YA 4KNVA 1UG7A 1FMWA 1OCCC 2XS8A 2HV7A 3K33A 2A0UA 1FMVA 2Q9BA 2G3KA 2AP3A 2XLEA 3JTLO 1TWCA 4U5CE 3UR3C 2CW0F 2LFDA 2J0XA 4IWBA 2NUPA 5AC4A 3SP1A 1TWAA 2HMZA 3FAPB 3DJNB 1MQVA 3G50A 3I5QA 3VYWA 4YWQA 3TQOA 5JT4A 2W4MA 2LFFA 3Q6MA 3ZIBA 4JTDB 4EBBA 1WGWA 3KL4A 1V55C 3EG9A 3K1IA 2I8BA 3M4BA 4DXWA 4E0IA 3TULA 4ZLDA 4MVOA 3U2LA 3TJ5A 1YZAA 2IXNA 3KYIA 1HMOA 5JP7A 3B29A 3R7CA 4BJTA 4XEKA 4BJ1A 1EKYA 4P6IC 5D92A 2Y3BA 3GORA 5E2QA 2EPMX 1OW7A 2CGEA 1K40A 2H7OA 2W9YA 2YLIA 2C04A 3DKAA 3KH2A 4ULVA 4Q4ZF 1M2VB 1M56C 1Q0MA 2WZGA 4AX2A 3S0XA 3EPVA 4BG0A 2PX0A 3QVZA 3AOUA 1OR2A 2OEXA 3GODA 4LDQA 3DWWA 4XEFA 4KC9A 1LKXA 2VC9A 1KNYA 4E7SA 5KYWB 1SR2A 4BEJA 1RMVA 1NSGB 3H65A 1XZPA 4JTCB 1ORYA 3MYFA 3NG1A 2XL4A 5KYYA 3NYJA 1WWPA 2OU6A 2HJMA 1RKEA 2VCBA 4H54A 4C3EA 3JYHA 1V4AA 2GAQA 4A2NB 2OG2A 2NPUA 2DYSC 3DD7A 3G4ZA 3EFOA 3LESA 3U2MA 3CSKA 3ECSA 3C62A 3FAJA 4I1MA 4LDKA 1R5ID 3TJ6A 5B3SC 2V26A 3JT1A 1NFOA 2KK1A 1RKEB 4JE9A 1FR0A 1QPUA 4Z9JA 4U9DA 1YJGA 3ZG1A 1WN0A 3V5XA 4U5EE 2IOQA 2R7SA 3EFOB 3GEEA 2A6HF 4L6RA 5JLIA 1SYQA 4P9TA 4AE4A 1MMAA 3L0IA 4JJFA 3RVZA 4MW8A 4C7OA 3DXJF 4CS7A 3L1MA 4FAPB 1IZMA 4UDVA 256BA 2IXMA 3S29A 2EPNA 5FCLA 5F5HA 3U3BA 1D0YA 1YYXA 3CZ6A 3H2VA 3HNJA 5L0IA 1LS1A 4IJJA 4U5FE 3MLGA 3RYLA 4BJ5C 3B0VC 4MVQA 3ZVRA 2JD3A 2H7VC 2OJED 3B71A 3DM5A 3IEEA 3QW0A 4G7HF 4XLNF 2X51A 3O6XA 1AUEA 2JX0A 2L7AA 4IRUA 1T6UA 2DI3A 1Z7Qc 1HY5A 2Y3DA 3EZHA 3TD7A 2P61A 3SXZA 2YKZA 3V5YA 1V54C 3LLKA 2BC5A 3ZSUA 1BR2A 3N0TA 4EBJA 2ZXPA 3QVYA 3SXYA 4WGZA 3ZDLA 3PCVA 4RDAA 3KKBA 3O39A 1CGME 1ORSC 4DBRA 4KI2A 4IARA 2L9JA 3WODF 4PJJA 3ABMC 2AU5A 2XLWA 5A6BD 2PNOA 1W2WA 1DOWA 1Z23A 5DS4A 2XLDA 4CX9A 4JCHA 2KW3C 1O87A 1ST6A 5COGA 3UMHA 1T6QA 1MMGA 3B9QA 3EQLF 4NTAA 2EINC 1HW2A 2XL8A 2R25A 1EI7A 3I4UA 4NQFA 1HE1A 3A11A 2VH3A 4RD9A 3L8JA 2O9XA 4LDRA 4R32A 4YT5A 3EH2A 1S05A 3X2QC 3EGDA 4PACA 1HW1A 4GYTA 4NTFA 2R02A 3EH1A 1ZHZA 1AVOB 2GFHA 3QW1A 1NFNA 1WASA 2LSEA 1UFBA 2YRFA 3X1OA 4QI2A 1TWGA 5F28E 2R9RB 2MWQA 5EK0A 1YARO 1A41A 1V74B 1JR8A 3CQZA 5DVWA 3MBGA 4XEVA 3H2UA 2ETSA 3U0CA 4W8KA 4I44A 5KYNA 3E9VA 2P6VA 1BBHA 3AGUA 3EGDB 3W4YA 5L0JA 4PJLA 4NCQA 4U5DE 2EPKX 2YEVA 5KYXA 2VCCA 3KPHA 2C03A 2CCYA 2Q7RA 3LUTB 2J8WA 3EGXA 2ZXOA 3Q6NA 5T1DB 3R2PA 2KSFA 3FHDA 4K0DA 4MTOA 5TJ5E 3POVA 2D5RB 4J30B 4ZLCA 4OIOF 5A69A 1MNEA 4CJOA 3ASNC 4N4WA 1G4US 1ZHTA 2J45A 2LIGA 1F1MA 3RFYA 4D4XA 3AGTA 4MVRA 3C8GA 4BJ6C 2P1AA 2Y69C 3LJBA 4XWJA 4OD4A 4PR9A 4YT2A 2NUPB 4JC7A 4U5GA 3EGXB 2TMVP 5DS6A 2YQYA 4JJGA 5JS5A 2PBEA 2HFIA 2DYRC 4EHPA 1MMNA 4EWCA 3LNMB 2BL2A 4CBEA 3Q7LA 2W4BA 3EG9B 3V7OA 5CI8A 4O79A 1K05A 2OOCA 4E7ZA 3C8GB 3MFNA 1U89A 2YWAA 4D4NA 2X0CA 3VRCA 1GGQA 3NMKA 4MW3A 4B6IA 3RH3A 4JURI 1QVXA 2DGJA 1Q0KA 2EIKC 2L6HA 2HJ3A 3HNKA 1MNDA 3CAXA 3HTKC 2XS1A 4MVUA 4PFPA 4MVMA 5IY5C 1VTMP 2HUJA 4E18A 5DQTA 2P7VA 2GDCA 5A6AA 2F22A 2J7PD 2R7VA 2CYDA 2ASRA 3K6BA 3S27A 1LE2A 1MMDA 2NG1A 3U9JA 4JEAA 1EA8A 1G8XA 2QNLA 2GWWA 2JPUA 4U9EA 4JEBA 4J32B 5L0CA 3FVYA 2A6EF 5FZTA 2PF4E 2H7BA 4ER9A 1U0BB 3UMIA 1H7IA 5JUAA 2Y3HA 5F5FA 2VB6A 4GEHA 4PK4A 4IGGA 3MX3A 5B1BC 3T6JA 4W8PA 1ZYRF 4PFOA 5KYYB 2XLMA 2IM8A 4JIOA 5B1AC 1U6HA 1LI5A 2WZFA 3C8ZA 2NUTA 3ZC4A 4BJ6A 1OXBA 3EHMA 1TQGA 3DE8A 2RD9A 4EUKB 1RJ9A 4CDYA 1N1CA 3KYJA 4K7BA 1QZXA 3DAFA 1ZVZA 2FAPB 1E86A 1A0BA 2XLHA 3AG1C 4PJNA 1OCOC 2WB7A 1WTYA 5GPGB 1D1BA 3S90A 4Z9HA 3OEOA 2FGYA 4CS8C 2R7UA 2J9WA 3LEVA 4XPWA 1YA9A 2YL7A 2MHRA 2R03A 2J46A 3ZQVA 1YA7O 4YT4A 4E0HA 1D0XA 1QSPA 1SF8A 2R7OA 3CEXA 3N24A 4P9FA 3BEHA 3SXKA 3DE9A 1ZU4A 2YL1A 3T4RA 4AE4B 5L3VA 1RKCA 3K1HA 3ABKC 4XQ1A 2OKUA 4C7OB 4X0RA 3ASOC 3IQ5A 3RQFA 1TFKB 1E85A 1T5OA 1SZIA 3C7JA 2LP4A 1L3PA 1PCXA 1E84A 1ZHXA 1VYIA 4IAQA 4LLCA 5BQGA 4C3BA 5DS5A 3B0UX 2NSGA 4CSAC 1B68A 2Q00A 4O6YA 5HSWA 3KMIA 1APCA 3IQ6A 3VM6A 3QMKA 2D4UA 2H8AA 1LE4A 1ZU5A 4XPYA 2J9UA 3HJCA 3UNGC 3V5ZA 3FOPA 5BQHA 1FFHA 5DLJA 4OD5A 2WVOA 3SYNA 2ZXRA 4Q5SF 3TOMA 4YL0A 1Q0FA 4N6CA 3QTHA 1Z3IX 4O7GA 1XWJA 1YDIA 4Q7CA 4EBKA 1C02A 2EILC 4K1OA 2IXPA 3M4CA 2RSEB 2CNWD 4HFKB 3PDMP 4G7ZF 2R7XA 5D91A 3EJNA 4YT8A 2A0BA 5CIVA 1T9KA 2ZPAA 1D1AA 3T6BA 1TR2A 3S9OA 4XTKA 2E87A 5T3TA 3W2WA 1C03A 4I3MA 3RVYA 3NKEA 2I15A 4LACB 3ZTMA 1LI7A 1OKKD 2YL3A 2QUPA 3LEOA 3RIPA 2ZD9A 1LPEA 3S28A 4G7OF 1TKNA 2A68F 4JRZA 5K0IA 2J0WA 3DI5A 4NC3A 3TOLA 1VYKA 2WVQA 1OR3A 1ORJA 2QY9A 4N06A 1IW7F 3GEIA 3US6A 2Y3GA 4ONSA 3GWNA 1VB5A 2UUIA 4BJ5A 3LS0A 2NSFA 1RXQA 3HNLA 3ITFA 1VLTA 5JRAA 3Q7GA 5A6BA 4FX5A 3IQTA 5E33A 1Y6DA 4MS2A 3T9OA 3WAQA 3J06A 1JMWA 2XM4A 3RQEA 1T6IA 1BR1A 2FFHA 3O10A 4HEAJ 4YL1A 4H4KC 4Z9IA 2LQGA 1NG1A 4CSAA 4ANJA 2YVKA 4CJGA 4OIQF 1GM5A 4HFFB 2GA0A 1ZW3A 4O6NA 1D0ZA 1KTMA 4OIPF 4F4BA 4M63A 5KYXB 2M64A 1AEPA 2QLAA 3DZAA 1YAUO 4MTFA 4WABA 1M6TA 2AWCA 3ABLC 1D1CA 2B0JA 2EIJC 2KQ9A 2QTVA 3U9MA 2KGOA 4OINF 3F46A 4BEMJ 5BUOA 1GS9A 5AGFA 2UUHA 1CGOA 2M4EA 3BRJA 5COFA 1BZ4A 3WG7C 3U8VA 1ZHYA 3QZCA 3RW0A 3NKDA 1FFTC 1CGNA 2KJGA 1T01A 1OQCA 5L0HA 2XXAA 4C3DA 1OXKA 3UGOA 2LCHA 3MYIA 1CPQA 1M57C 2CDQA 2YLDA 3SEOA 3TK0A 3W8IA 5L0FA 3DMDA 1JAFA 1PD0A 4HE8D 3C63A 5CI9A 4DRIB 1FNTc 1DOVA 1E83A 1BR4A 5DQZA 5A6JA 3GM1A 5BQIA 2KC3A 3JCUQ 2EPLX 2J9BA 2ZXWC 3K66A 1JRAA 1M2VA 2HMQA 1YVIA 2Q3TA 1H9TA 2R7QA 1H6GA 1O3UA 2OEVA 4XPXA 2XXAB 2WZLA 1NU9C 2MYSA 1OW8A 1VMAA 2WVNA 4N6HA 1PD1A 3ZWIA 4KBLA 2PX3A 4I1OB 5JSLA 5L3QA 1QQ3A 5B3IA 3PHF2 1BDJB 2IBFA 1R4TA 1O5HA 2HZ8A 4JW1A 4ULWA 5KYUA 5KYWA 4QI0A 3ZTZA 4AK9A 1CPRA 2IYLD 2AVKA 3GEHA 2L6FA 1RCPA 3AG4C 3NRHA 3VF0A 1Q0DA 2LD6A 2PFDA 3U8PA 3G4XA 1WOLA 3WHNA 4E17A 3GANA 3O55A 2Q4FA 3W2VA 4DVYP 3GWLA 1NLXA 3OA1A 1Z63A 4DVZA 3I5PA 1OCZC 3AJMA 4MNDA 4MTGA 5COMA 5KYUB 4U5HA 2L81A 1NBBA 1C17M 1KU2A 3GM2A 2YL0A 1LVKA 3NYLA 2P0NA 1EQ1A 4DRHB 1LM3B 5AC5A 3FOOA 1TFOB 3DM9B 3JSEO 1YYJA 3AG3C 1I4ZA
chains in the Genus database with same CATH topology
4E18A 4PR9A 2GDCA 4DJ9A 3RF3A 1RKEA 1L7CA 3S90A 2IBFA 4ONSA 3H2UA 1QKRA 4EHPA 3H2VA 2GWWA 5L0IA 5L0JA 2HSQA 5L0CA 1DOWA 5L0HA 1T01A 5FZTA 1XWJA 1YDIA 2B0HA 3VF0A 3MYIA 1ST6A 1U89A 4K1OA 3ZDLA 2X0CA 1RKCA 3TJ6A 4E17A 5L0FA 5L0GA 2L7AA 4IGGA 4W8PA 2LQGA 1DOVA 1RKEB 5L0DA 1TR2A 1U6HA 1ZW3A 1H6GA 1SYQA 4P9TA 1ZW2A 1ZVZA 3T6GB 3TJ5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4E18 A;  4PR9 A;  2GDC A;  4DJ9 A;  3RF3 A;  1RKE A;  1L7C A;  3S90 A;  2IBF A;  4ONS A;  3H2U A;  1QKR A;  4EHP A;  3H2V A;  2GWW A;  5L0I A;  5L0J A;  2HSQ A;  5L0C A;  1DOW A;  5L0H A;  1T01 A;  5FZT A;  1XWJ A;  1YDI A;  2B0H A;  3VF0 A;  3MYI A;  1ST6 A;  1U89 A;  4K1O A;  3ZDL A;  2X0C A;  1RKC A;  3TJ6 A;  4E17 A;  5L0F A;  5L0G A;  2L7A A;  4IGG A;  4W8P A;  2LQG A;  1DOV A;  1RKE B;  5L0D A;  1TR2 A;  1U6H A;  1ZW3 A;  1H6G A;  1SYQ A;  4P9T A;  1ZW2 A;  1ZVZ A;  3T6G B;  3TJ5 A; 
#chains in the Genus database with same CATH topology
 3RQG A;  2R7T A;  1H9G A;  3DAG A;  3HLZ A;  4J7T A;  2OCC C;  5E3C A;  4KNW A;  4FWV A;  3ATP A;  3GM3 A;  4IB4 A;  1XZQ A;  3AG2 C;  2J7P A;  2EIM C;  2XLO A;  3AQB A;  3U5S A;  2HSB A;  1PV3 A;  2NUT B;  4G78 A;  1S7Z A;  2ICW G;  3DJU B;  4CS9 C;  1Y4C A;  1RJ9 B;  1Z5Z A;  2EPO A;  1A7V A;  2IXO A;  2L6G A;  2Z15 A;  3AQC A;  3F47 A;  4OIR F;  3UMK A;  4A4A A;  2YLG A;  5L0G A;  3S84 A;  3HNI A;  4MVZ A;  3C18 A;  2Q9C A;  3M1C B;  4JVS A;  3NMI A;  2G62 A;  5HV9 A;  2QE9 A;  5EGY A;  4IAO A;  4U5B E;  2R05 A;  1FTS A;  3A9C A;  3L34 A;  3EHN A;  3LS1 A;  2R7W A;  1QLE C;  3IPM O;  2OJQ A;  1SMY F;  3ZQY A;  1VLS A;  1ZW2 A;  1GQA A;  3JRM O;  3T6G B;  4DRJ B;  1JPN A;  3M15 A;  1YZC A;  4DJ9 A;  3LNR A;  4JTA B;  4MQ9 F;  1LIH A;  1ZZP A;  1L7C A;  2Y39 A;  4J7Y A;  4WJ0 A;  5JVE A;  3L8I A;  3NMJ A;  1K04 A;  4FES A;  2R7R A;  3M79 A;  4JCZ A;  3RKO F;  2LK4 A;  5T3W A;  5EHH A;  2HSQ A;  3FXH A;  3SNH A;  3JRT A;  4JZA A;  3NDB B;  1LS4 A;  4AL1 A;  3JYY A;  1TWH A;  4NTB A;  2YZS A;  2DB4 A;  4YN0 B;  4NY3 A;  2W45 A;  2XM0 A;  1J8M F;  4GQH A;  2XL6 A;  4WGY A;  4EKW A;  1G5Z A;  4XLP F;  2V3C C;  4YK5 A;  2HKV A;  4LER A;  3VAY A;  3W8H A;  1JPJ A;  1VOM A;  2G3V A;  3EZI A;  1M2O A;  2BE5 F;  1NU7 D;  1OW6 A;  4YL3 A;  1A7E A;  1ZHW A;  3E70 C;  3LLI A;  3SZR A;  3JZ0 A;  3K1I C;  4MVS A;  2PP4 A;  3FDQ A;  3UGP A;  3U3F A;  3JSZ A;  1WAT A;  4RBN A;  4BPM A;  2XLV A;  4CS8 A;  4DBQ A;  1G4W R;  4DOZ A;  2OQM A;  1J8Y F;  1Z6A A;  1QKR A;  4O6M A;  4CS9 A;  1Q0G A;  2YHS A;  2HV6 A;  1JOG A;  3PMR A;  2XRH A;  3IQC A;  2B0H A;  4PJM A;  5E3A A;  1NZE A;  3N2Z B;  4G0H A;  3FMS A;  3IHU A;  1I5N A;  1HMD A;  2KYH A;  2HS5 A;  2Q9A A;  2VCA A;  3K7D A;  4JKV A;  1FAP B;  3HKK A;  3LAY A;  4AL0 A;  4EIY A;  5L0D A;  2CNW A;  2WL8 A;  2A69 F;  3OWT A;  2J9V A;  3NYM A;  4CDA A;  5A6K A;  3C8G D;  4YJW A;  3SXM A;  4LLE A;  2KNH A;  4CDV A;  1OCR C;  4CIP A;  2XSE A;  1OKK A;  2VAS A;  2AWY A;  1E2X A;  1A7D A;  3RF3 A;  4CIH A;  1HE9 A;  4QDL A;  1YLM A;  3B0P A;  1VK5 A;  2A1D D;  1I4Y A;  4KNV A;  1UG7 A;  1FMW A;  1OCC C;  2XS8 A;  2HV7 A;  3K33 A;  2A0U A;  1FMV A;  2Q9B A;  2G3K A;  2AP3 A;  2XLE A;  3JTL O;  1TWC A;  4U5C E;  3UR3 C;  2CW0 F;  2LFD A;  2J0X A;  4IWB A;  2NUP A;  5AC4 A;  3SP1 A;  1TWA A;  2HMZ A;  3FAP B;  3DJN B;  1MQV A;  3G50 A;  3I5Q A;  3VYW A;  4YWQ A;  3TQO A;  5JT4 A;  2W4M A;  2LFF A;  3Q6M A;  3ZIB A;  4JTD B;  4EBB A;  1WGW A;  3KL4 A;  1V55 C;  3EG9 A;  3K1I A;  2I8B A;  3M4B A;  4DXW A;  4E0I A;  3TUL A;  4ZLD A;  4MVO A;  3U2L A;  3TJ5 A;  1YZA A;  2IXN A;  3KYI A;  1HMO A;  5JP7 A;  3B29 A;  3R7C A;  4BJT A;  4XEK A;  4BJ1 A;  1EKY A;  4P6I C;  5D92 A;  2Y3B A;  3GOR A;  5E2Q A;  2EPM X;  1OW7 A;  2CGE A;  1K40 A;  2H7O A;  2W9Y A;  2YLI A;  2C04 A;  3DKA A;  3KH2 A;  4ULV A;  4Q4Z F;  1M2V B;  1M56 C;  1Q0M A;  2WZG A;  4AX2 A;  3S0X A;  3EPV A;  4BG0 A;  2PX0 A;  3QVZ A;  3AOU A;  1OR2 A;  2OEX A;  3GOD A;  4LDQ A;  3DWW A;  4XEF A;  4KC9 A;  1LKX A;  2VC9 A;  1KNY A;  4E7S A;  5KYW B;  1SR2 A;  4BEJ A;  1RMV A;  1NSG B;  3H65 A;  1XZP A;  4JTC B;  1ORY A;  3MYF A;  3NG1 A;  2XL4 A;  5KYY A;  3NYJ A;  1WWP A;  2OU6 A;  2HJM A;  1RKE A;  2VCB A;  4H54 A;  4C3E A;  3JYH A;  1V4A A;  2GAQ A;  4A2N B;  2OG2 A;  2NPU A;  2DYS C;  3DD7 A;  3G4Z A;  3EFO A;  3LES A;  3U2M A;  3CSK A;  3ECS A;  3C62 A;  3FAJ A;  4I1M A;  4LDK A;  1R5I D;  3TJ6 A;  5B3S C;  2V26 A;  3JT1 A;  1NFO A;  2KK1 A;  1RKE B;  4JE9 A;  1FR0 A;  1QPU A;  4Z9J A;  4U9D A;  1YJG A;  3ZG1 A;  1WN0 A;  3V5X A;  4U5E E;  2IOQ A;  2R7S A;  3EFO B;  3GEE A;  2A6H F;  4L6R A;  5JLI A;  1SYQ A;  4P9T A;  4AE4 A;  1MMA A;  3L0I A;  4JJF A;  3RVZ A;  4MW8 A;  4C7O A;  3DXJ F;  4CS7 A;  3L1M A;  4FAP B;  1IZM A;  4UDV A;  256B A;  2IXM A;  3S29 A;  2EPN A;  5FCL A;  5F5H A;  3U3B A;  1D0Y A;  1YYX A;  3CZ6 A;  3H2V A;  3HNJ A;  5L0I A;  1LS1 A;  4IJJ A;  4U5F E;  3MLG A;  3RYL A;  4BJ5 C;  3B0V C;  4MVQ A;  3ZVR A;  2JD3 A;  2H7V C;  2OJE D;  3B71 A;  3DM5 A;  3IEE A;  3QW0 A;  4G7H F;  4XLN F;  2X51 A;  3O6X A;  1AUE A;  2JX0 A;  2L7A A;  4IRU A;  1T6U A;  2DI3 A;  1Z7Q c;  1HY5 A;  2Y3D A;  3EZH A;  3TD7 A;  2P61 A;  3SXZ A;  2YKZ A;  3V5Y A;  1V54 C;  3LLK A;  2BC5 A;  3ZSU A;  1BR2 A;  3N0T A;  4EBJ A;  2ZXP A;  3QVY A;  3SXY A;  4WGZ A;  3ZDL A;  3PCV A;  4RDA A;  3KKB A;  3O39 A;  1CGM E;  1ORS C;  4DBR A;  4KI2 A;  4IAR A;  2L9J A;  3WOD F;  4PJJ A;  3ABM C;  2AU5 A;  2XLW A;  5A6B D;  2PNO A;  1W2W A;  1DOW A;  1Z23 A;  5DS4 A;  2XLD A;  4CX9 A;  4JCH A;  2KW3 C;  1O87 A;  1ST6 A;  5COG A;  3UMH A;  1T6Q A;  1MMG A;  3B9Q A;  3EQL F;  4NTA A;  2EIN C;  1HW2 A;  2XL8 A;  2R25 A;  1EI7 A;  3I4U A;  4NQF A;  1HE1 A;  3A11 A;  2VH3 A;  4RD9 A;  3L8J A;  2O9X A;  4LDR A;  4R32 A;  4YT5 A;  3EH2 A;  1S05 A;  3X2Q C;  3EGD A;  4PAC A;  1HW1 A;  4GYT A;  4NTF A;  2R02 A;  3EH1 A;  1ZHZ A;  1AVO B;  2GFH A;  3QW1 A;  1NFN A;  1WAS A;  2LSE A;  1UFB A;  2YRF A;  3X1O A;  4QI2 A;  1TWG A;  5F28 E;  2R9R B;  2MWQ A;  5EK0 A;  1YAR O;  1A41 A;  1V74 B;  1JR8 A;  3CQZ A;  5DVW A;  3MBG A;  4XEV A;  3H2U A;  2ETS A;  3U0C A;  4W8K A;  4I44 A;  5KYN A;  3E9V A;  2P6V A;  1BBH A;  3AGU A;  3EGD B;  3W4Y A;  5L0J A;  4PJL A;  4NCQ A;  4U5D E;  2EPK X;  2YEV A;  5KYX A;  2VCC A;  3KPH A;  2C03 A;  2CCY A;  2Q7R A;  3LUT B;  2J8W A;  3EGX A;  2ZXO A;  3Q6N A;  5T1D B;  3R2P A;  2KSF A;  3FHD A;  4K0D A;  4MTO A;  5TJ5 E;  3POV A;  2D5R B;  4J30 B;  4ZLC A;  4OIO F;  5A69 A;  1MNE A;  4CJO A;  3ASN C;  4N4W A;  1G4U S;  1ZHT A;  2J45 A;  2LIG A;  1F1M A;  3RFY A;  4D4X A;  3AGT A;  4MVR A;  3C8G A;  4BJ6 C;  2P1A A;  2Y69 C;  3LJB A;  4XWJ A;  4OD4 A;  4PR9 A;  4YT2 A;  2NUP B;  4JC7 A;  4U5G A;  3EGX B;  2TMV P;  5DS6 A;  2YQY A;  4JJG A;  5JS5 A;  2PBE A;  2HFI A;  2DYR C;  4EHP A;  1MMN A;  4EWC A;  3LNM B;  2BL2 A;  4CBE A;  3Q7L A;  2W4B A;  3EG9 B;  3V7O A;  5CI8 A;  4O79 A;  1K05 A;  2OOC A;  4E7Z A;  3C8G B;  3MFN A;  1U89 A;  2YWA A;  4D4N A;  2X0C A;  3VRC A;  1GGQ A;  3NMK A;  4MW3 A;  4B6I A;  3RH3 A;  4JUR I;  1QVX A;  2DGJ A;  1Q0K A;  2EIK C;  2L6H A;  2HJ3 A;  3HNK A;  1MND A;  3CAX A;  3HTK C;  2XS1 A;  4MVU A;  4PFP A;  4MVM A;  5IY5 C;  1VTM P;  2HUJ A;  4E18 A;  5DQT A;  2P7V A;  2GDC A;  5A6A A;  2F22 A;  2J7P D;  2R7V A;  2CYD A;  2ASR A;  3K6B A;  3S27 A;  1LE2 A;  1MMD A;  2NG1 A;  3U9J A;  4JEA A;  1EA8 A;  1G8X A;  2QNL A;  2GWW A;  2JPU A;  4U9E A;  4JEB A;  4J32 B;  5L0C A;  3FVY A;  2A6E F;  5FZT A;  2PF4 E;  2H7B A;  4ER9 A;  1U0B B;  3UMI A;  1H7I A;  5JUA A;  2Y3H A;  5F5F A;  2VB6 A;  4GEH A;  4PK4 A;  4IGG A;  3MX3 A;  5B1B C;  3T6J A;  4W8P A;  1ZYR F;  4PFO A;  5KYY B;  2XLM A;  2IM8 A;  4JIO A;  5B1A C;  1U6H A;  1LI5 A;  2WZF A;  3C8Z A;  2NUT A;  3ZC4 A;  4BJ6 A;  1OXB A;  3EHM A;  1TQG A;  3DE8 A;  2RD9 A;  4EUK B;  1RJ9 A;  4CDY A;  1N1C A;  3KYJ A;  4K7B A;  1QZX A;  3DAF A;  1ZVZ A;  2FAP B;  1E86 A;  1A0B A;  2XLH A;  3AG1 C;  4PJN A;  1OCO C;  2WB7 A;  1WTY A;  5GPG B;  1D1B A;  3S90 A;  4Z9H A;  3OEO A;  2FGY A;  4CS8 C;  2R7U A;  2J9W A;  3LEV A;  4XPW A;  1YA9 A;  2YL7 A;  2MHR A;  2R03 A;  2J46 A;  3ZQV A;  1YA7 O;  4YT4 A;  4E0H A;  1D0X A;  1QSP A;  1SF8 A;  2R7O A;  3CEX A;  3N24 A;  4P9F A;  3BEH A;  3SXK A;  3DE9 A;  1ZU4 A;  2YL1 A;  3T4R A;  4AE4 B;  5L3V A;  1RKC A;  3K1H A;  3ABK C;  4XQ1 A;  2OKU A;  4C7O B;  4X0R A;  3ASO C;  3IQ5 A;  3RQF A;  1TFK B;  1E85 A;  1T5O A;  1SZI A;  3C7J A;  2LP4 A;  1L3P A;  1PCX A;  1E84 A;  1ZHX A;  1VYI A;  4IAQ A;  4LLC A;  5BQG A;  4C3B A;  5DS5 A;  3B0U X;  2NSG A;  4CSA C;  1B68 A;  2Q00 A;  4O6Y A;  5HSW A;  3KMI A;  1APC A;  3IQ6 A;  3VM6 A;  3QMK A;  2D4U A;  2H8A A;  1LE4 A;  1ZU5 A;  4XPY A;  2J9U A;  3HJC A;  3UNG C;  3V5Z A;  3FOP A;  5BQH A;  1FFH A;  5DLJ A;  4OD5 A;  2WVO A;  3SYN A;  2ZXR A;  4Q5S F;  3TOM A;  4YL0 A;  1Q0F A;  4N6C A;  3QTH A;  1Z3I X;  4O7G A;  1XWJ A;  1YDI A;  4Q7C A;  4EBK A;  1C02 A;  2EIL C;  4K1O A;  2IXP A;  3M4C A;  2RSE B;  2CNW D;  4HFK B;  3PDM P;  4G7Z F;  2R7X A;  5D91 A;  3EJN A;  4YT8 A;  2A0B A;  5CIV A;  1T9K A;  2ZPA A;  1D1A A;  3T6B A;  1TR2 A;  3S9O A;  4XTK A;  2E87 A;  5T3T A;  3W2W A;  1C03 A;  4I3M A;  3RVY A;  3NKE A;  2I15 A;  4LAC B;  3ZTM A;  1LI7 A;  1OKK D;  2YL3 A;  2QUP A;  3LEO A;  3RIP A;  2ZD9 A;  1LPE A;  3S28 A;  4G7O F;  1TKN A;  2A68 F;  4JRZ A;  5K0I A;  2J0W A;  3DI5 A;  4NC3 A;  3TOL A;  1VYK A;  2WVQ A;  1OR3 A;  1ORJ A;  2QY9 A;  4N06 A;  1IW7 F;  3GEI A;  3US6 A;  2Y3G A;  4ONS A;  3GWN A;  1VB5 A;  2UUI A;  4BJ5 A;  3LS0 A;  2NSF A;  1RXQ A;  3HNL A;  3ITF A;  1VLT A;  5JRA A;  3Q7G A;  5A6B A;  4FX5 A;  3IQT A;  5E33 A;  1Y6D A;  4MS2 A;  3T9O A;  3WAQ A;  3J06 A;  1JMW A;  2XM4 A;  3RQE A;  1T6I A;  1BR1 A;  2FFH A;  3O10 A;  4HEA J;  4YL1 A;  4H4K C;  4Z9I A;  2LQG A;  1NG1 A;  4CSA A;  4ANJ A;  2YVK A;  4CJG A;  4OIQ F;  1GM5 A;  4HFF B;  2GA0 A;  1ZW3 A;  4O6N A;  1D0Z A;  1KTM A;  4OIP F;  4F4B A;  4M63 A;  5KYX B;  2M64 A;  1AEP A;  2QLA A;  3DZA A;  1YAU O;  4MTF A;  4WAB A;  1M6T A;  2AWC A;  3ABL C;  1D1C A;  2B0J A;  2EIJ C;  2KQ9 A;  2QTV A;  3U9M A;  2KGO A;  4OIN F;  3F46 A;  4BEM J;  5BUO A;  1GS9 A;  5AGF A;  2UUH A;  1CGO A;  2M4E A;  3BRJ A;  5COF A;  1BZ4 A;  3WG7 C;  3U8V A;  1ZHY A;  3QZC A;  3RW0 A;  3NKD A;  1FFT C;  1CGN A;  2KJG A;  1T01 A;  1OQC A;  5L0H A;  2XXA A;  4C3D A;  1OXK A;  3UGO A;  2LCH A;  3MYI A;  1CPQ A;  1M57 C;  2CDQ A;  2YLD A;  3SEO A;  3TK0 A;  3W8I A;  5L0F A;  3DMD A;  1JAF A;  1PD0 A;  4HE8 D;  3C63 A;  5CI9 A;  4DRI B;  1FNT c;  1DOV A;  1E83 A;  1BR4 A;  5DQZ A;  5A6J A;  3GM1 A;  5BQI A;  2KC3 A;  3JCU Q;  2EPL X;  2J9B A;  2ZXW C;  3K66 A;  1JRA A;  1M2V A;  2HMQ A;  1YVI A;  2Q3T A;  1H9T A;  2R7Q A;  1H6G A;  1O3U A;  2OEV A;  4XPX A;  2XXA B;  2WZL A;  1NU9 C;  2MYS A;  1OW8 A;  1VMA A;  2WVN A;  4N6H A;  1PD1 A;  3ZWI A;  4KBL A;  2PX3 A;  4I1O B;  5JSL A;  5L3Q A;  1QQ3 A;  5B3I A;  3PHF 2;  1BDJ B;  2IBF A;  1R4T A;  1O5H A;  2HZ8 A;  4JW1 A;  4ULW A;  5KYU A;  5KYW A;  4QI0 A;  3ZTZ A;  4AK9 A;  1CPR A;  2IYL D;  2AVK A;  3GEH A;  2L6F A;  1RCP A;  3AG4 C;  3NRH A;  3VF0 A;  1Q0D A;  2LD6 A;  2PFD A;  3U8P A;  3G4X A;  1WOL A;  3WHN A;  4E17 A;  3GAN A;  3O55 A;  2Q4F A;  3W2V A;  4DVY P;  3GWL A;  1NLX A;  3OA1 A;  1Z63 A;  4DVZ A;  3I5P A;  1OCZ C;  3AJM A;  4MND A;  4MTG A;  5COM A;  5KYU B;  4U5H A;  2L81 A;  1NBB A;  1C17 M;  1KU2 A;  3GM2 A;  2YL0 A;  1LVK A;  3NYL A;  2P0N A;  1EQ1 A;  4DRH B;  1LM3 B;  5AC5 A;  3FOO A;  1TFO B;  3DM9 B;  3JSE O;  1YYJ A;  3AG3 C;  1I4Z A; 
#chains in the Genus database with same CATH homology
 4E18 A;  4PR9 A;  2GDC A;  4DJ9 A;  3RF3 A;  1RKE A;  1L7C A;  3S90 A;  2IBF A;  4ONS A;  3H2U A;  1QKR A;  4EHP A;  3H2V A;  2GWW A;  5L0I A;  5L0J A;  2HSQ A;  5L0C A;  1DOW A;  5L0H A;  1T01 A;  5FZT A;  1XWJ A;  1YDI A;  2B0H A;  3VF0 A;  3MYI A;  1ST6 A;  1U89 A;  4K1O A;  3ZDL A;  2X0C A;  1RKC A;  3TJ6 A;  4E17 A;  5L0F A;  5L0G A;  2L7A A;  4IGG A;  4W8P A;  2LQG A;  1DOV A;  1RKE B;  5L0D A;  1TR2 A;  1U6H A;  1ZW3 A;  1H6G A;  1SYQ A;  4P9T A;  1ZW2 A;  1ZVZ A;  3T6G B;  3TJ5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...