3B71A

Cd4 endocytosis motif bound to the focal adhesion targeting (fat) domain of the focal adhesion kinase
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
134
structure length
134
Chain Sequence
NLDRSNDKVYENVTGLVKAVIEMSSKIQPAPPEEYVPMVKEVGLALRTLLATVDETIPLLPASTHREIEMAQKLLNSDLGELINKMKLAQQYVMTSLQQEYKKQMLTAAHALAVDAKNLLDVIDQARLKMLGQT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Protein binding
molecule keywords Focal adhesion kinase 1
publication title Structural basis for the interaction between focal adhesion kinase and CD4.
pubmed doi rcsb
source organism Homo sapiens
total genus 56
structure length 134
sequence length 134
chains with identical sequence B, C
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2007-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03623 Focal_AT Focal adhesion targeting region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.540 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 3b71A01
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 3b71A02
3RQEA 1KNYA 3AJMA 3AE2C 1ZZPA 2L6HA 1PV3A 2HSBA 1ZOYC 3AEBC 2YWAA 2G3AA 3AE5C 3C8GB 4R32A 3TULA 1OW6A 4XEKA 3K7DA 3L8JA 2JPUA 1YQ3C 3AE6C 3GM3A 1K40A 2H88C 3JZ0A 1UFBA 1WTYA 3AE3C 1K04A 4YXDC 4XEVA 4YTPC 3C8GD 3SFDC 3S9OA 3AECC 2WQYC 3ABVC 2JX0A 3GM2A 2Q00A 3O10A 1V4AA 2KK1A 1WWPA 3U0CA 3AEAC 3BRJA 4XEFA 3L8IA 1WOLA 4NQFA 1OW8A 1QVXA 2PBEA 3RQGA 3AE4C 2L6GA 1OW7A 3GM1A 3MFNA 2H89C 3C8GA 1KTMA 1ZP0C 3SFEC 3AE1C 3B71A 2FBWC 3AE7C 1O3UA 2LK4A 5F28E 3RQFA 3AEEC 3AEGC 3AE8C 1K05A 4EBKA 3JYYA 3AEFC 3U3FA 3C18A 3AE9C 3AEDC 1YQ4C 2L6FA 1JOGA 4EBJA
chains in the Genus database with same CATH superfamily
4C7OB 3MZWB 2R7WA 4BEMJ 2WMMA 3GF3A 5D91A 4E7ZA 3V2NA 2P1JA 4NPEA 1VLSA 1FFTC 5EK0A 1HW2A 4B86A 4W80A 3Q2YA 3EH1A 4K35A 3C7JA 3DXJF 1BE3D 3KKBA 1D0YA 4O6MA 2FYNC 5CCHC 1L0LJ 1GGQA 2P6VA 5AC5A 3HNLA 1S5LH 2W4MA 5AVWB 3HD7A 3H1JD 1T6AA 3E9VA 4PD4E 3EH2A 1FZBA 4G0HA 3H1KJ 4EHPA 1QGKB 3CCQP 1BBHA 1RKEB 1MV8A 3MBGA 2WSCJ 3MP7B 2WZFA 4J30B 1JY2N 3T6BA 3A0BE 4JYCA 2DYRC 1LP1B 3DJUB 3S0XA 1LT1A 4B6IA 1PGOA 3LJBA 1YJNP 5BVZA 3RK2B 5E79H 2D5RB 2Y39A 3ASOC 2J0WA 3US6A 2EIJC 1QEXA 5L8RJ 2LR2A 3JYHA 2HSQA 4U5CE 5AW8B 5CJ0A 2O9XA 2N9YB 2N1TB 2XDJA 2HODA 3BRJA 3T97B 1AVOB 3V4WA 3G3ZA 3L8IA 3N7NA 1VYKA 1L0NE 3IQ6A 2ZXWC 1L4AD 3L75J 5B3SC 4LDQA 3O8ZA 4XFJA 2R25A 2M64A 1ZU4A 3O55A 1NAYA 1VQ7P 5EHHA 1VQ5P 2AXCA 2KYHA 2ICWG 3SXZA 4PACA 4UB6H 4BJ5C 4J7YA 1APCA 2OYIC 1Z3IX 4PJLA 2A0UA 4QDLA 2BEQD 1LI7A 4EDFA 2KSEA 5KJ7D 2QM7A 1CGNA 1ZHTA 4NC3A 4EBKA 2E76B 2YHSA 4D6TD 4UB8E 5T3WA 1A02J 2WPRA 4IJJA 1QLED 4L6RA 3L0IA 3OWTA 3AG1C 3AJMA 4LDKA 2QA4P 3CMAP 3RK3E 3L74G 1BSNA 1E2XA 2WZGA 3OAKA 1EZVG 1D0XA 3OEOA 1ZOYC 1A7EA 4PK4A 4DRHB 3CCSP 5B5EE 2VCBA 2YXQB 2XLMA 2MKVA 2WVNA 3WUTA 2YLDA 3RIPA 3DE9A 2FGYA 4P6IC 1GD2E 1HWTC 4R32A 2K88A 2ITAA 5EGYA 1AV1A 5KYWA 4EYYQ 3USSA 4N78E 5AW2B 4OGQD 1NTMD 2E87A 4D4XA 3V4QA 2AU5A 3H2UA 3LEVA 4JZAA 4DCKA 3G9RA 1J8MF 1K73Q 1TR2A 2YNYA 1URQA 2XLDA 2KJGA 3V6IA 2J46A 3KPHA 1C03A 4IFDK 4DRJB 1G2CB 1BE3G 4R4MA 1IFPA 1D1CA 2B87A 3TQOA 1RF0C 2QVAA 3H1JG 2Q7CA 1IZMA 2WT7B 1PIXA 1T3UA 5COFA 2AXTE 1N73C 3CCJP 1WRGA 1E86A 2EPOA 3C63A 3ITFA 3WAQA 1BDJB 1WOLA 2QJKC 3RF3A 3OJAB 5CBNA 1PGQA 3FVYA 2PBEA 3U1CA 3AE4C 4XPYA 4JJGA 1BCCD 3L73D 1U57A 2PRRA 2FFDC 3H1JJ 3CWBE 4JJFA 3UMHA 2G3VA 2ZXXA 2P2UA 1M56D 1Z23A 1J1EB 3ABMC 3AE1C 1L0LK 4ULVA 1HTLC 3AE7C 5L0CA 3RQFA 1HF9A 5CJ4A 3JC22 3IAOA 2W45A 3RK3D 1GL2D 2WZLA 2XNDH 2N9BA 3U2LA 1KYOH 2B9BA 1NH4A 1BR1A 1XTGB 2A06G 4XA4A 1Z7Qc 4IAOA 1A7DA 2FY8A 3GEEA 3MX3A 4JURI 1N2DC 1KYOI 5KYUB 2XS8A 4NCQA 4U5FE 3F89A 4N78D 3DMDA 1DX7A 3V5XA 1YZCA 1V54C 4D6TG 2Q3TA 3K66A 4D4NA 2QUPA 1H0TB 1MKMA 2R9RB 3KL4A 3VMZA 3CX5E 4XLPF 5AVQB 5BQGA 256BA 2H7BA 1RF0A 2Z15A 2J9UA 4MTGA 2N1TC 4PV1B 4E7SA 3CCEP 4CPGA 1LS4A 1LWUB 2Y3GA 3ZSUA 1N73A 2KSFA 2LSEA 2M3BA 2K9JA 3TJ5A 2YIUC 4DBQA 2WPSA 4L73A 4CS9A 1M1KQ 2XL4A 2Y0EA 2XNXA 1FOSF 4AK9A 1U6HA 2ZT9D 3C8GD 1FDMA 3FWNA 3S9OA 2X51A 3AECC 2CPBA 4L75A 2P0NA 4JCZA 5KYYB 3CC2P 1NTMG 5APYA 4PFPA 4OVNF 2YL0A 1CGME 3J06A 1GK6A 3EHMA 4PJJA 2QJYB 1M6TA 2L9JA 1H88A 3NMJA 3IQTA 2E76C 1S3JA 3CXHH 2FKWB 1RCPA 5APWA 3M91A 2POHA 1IO4A 2O3JA 2K9YA 1M57D 2BEZF 3CXHI 3MFNA 2E42A 3A3YB 1U0BB 1NO4A 1ZP0C 4Q7CA 3T6JA 5COMA 1NTMJ 4XLNF 2OQQA 3LIDA 3HNKA 1LTIC 2FYUE 2W8ZA 3AGTA 1HMDA 3AEEC 2QTVA 4N6CA 3DM5A 2WVOA 4XE5B 2HKVA 3JYYA 3HD7B 3CPWO 5JRAA 3U59A 4WWIA 2OTKE 4GIFA 2KK7A 2GA0A 1OCZC 1LTBC 1BCCG 3L73G 1JOGA 1KNYA 3M4CA 2W27A 1YZAA 1GQAA 2PX3A 3LW5J 1VQ4P 1OMIA 2NSGA 2Q4FA 4O9BA 4NPDA 3CX5D 1BGYE 3JCUE 3NYLA 5DS4A 4PD4H 3UIAA 1AVOA 1T3JA 2KSJA 3AE5C 3K33A 2E74D 3VMYA 4YK5A 3TULA 4PD4I 1LTGC 1BCCJ 3L73J 2UUIA 1PPJG 1QSPA 3H25A 5DLJA 3VP8A 4CX9A 1OFCX 2OARA 1JCCA 4H4KC 4EI2A 1ZHYA 3V2RA 3T6GB 5DVWA 2O01N 1WTYA 2WVQA 2IYPA 1ZU5A 3DE8A 1SZIA 1FC2C 3TSIA 5A6KA 4PJNA 3NKDA 4WGYA 3V5YA 1TWAA 3UGOA 4OIRF 2ZYDA 1DOVA 2VRSA 4WY4D 3QZCA 1V4AA 3L72E 2I15A 4CBEA 3HJCA 2DGJA 4ULWA 3OA1A 4MNDA 3MD0A 1JNMA 4JEAA 4JPZB 3BCCD 3VYWA 2FXPA 2KQ9A 3AQBA 1OW8A 3BATA 3RW0A 1TFOB 2OJED 5DJUB 2JWDA 2FYUD 1SQVD 1NWQA 4MTFA 4CDAA 1GW4A 1QVFO 3ECSA 1SR2A 2C9LY 2ZXEB 1OX3A 4E0IA 4P9TA 3FAJA 2WTYA 1AQ5A 4UB8H 1AVYA 3AE8C 3T9OA 2W4BA 3IN6A 2L81A 2IBZD 2QSIA 5KYWB 3LESA 5AVYB 2FAPB 1BGYD 1URQB 5E3AA 3GANA 3CMEP 2G8YA 2HFED 1YJ9P 3ZTMA 3M0AA 1T2KC 2ZJSE 2B87B 1ZHWA 1TKNA 2DW3A 1M8OB 5KTBA 2FYZA 2ZYGA 3L74E 1ORYA 2R5DA 3AOUA 2Q5UA 5FZTA 3C1LA 1G1IA 4LC1A 1HE1A 2KGOA 4I1MA 4XEKA 1ORJA 3K7DA 2J9VA 4Z1MH 1FDIA 1VQOP 3A0HE 1R8EA 4N06A 3PP5A 2KW3C 2JPUA 4E17A 1YVIA 1KU2A 4N6JA 1GS9A 5KLIC 4H44C 2V26A 1YAUO 1JOCA 3QW0A 4CS8C 1C17M 3L72D 3H32A 1LNQA 2AXTH 2K3RA 3F5HA 1HUCA 2CW0F 1KZUB 3U8VA 3M0DC 2XKMA 1FJPA 3IQ5A 4YL1A 2YZSA 3NMKA 4U5BE 1NTMK 2Q00A 1BE3E 1N7SD 3ZDLA 5CHXA 1SQBG 2Q3EA 4YPCA 2KLUA 2W6AA 1SYQA 2OGUA 2IFMA 1VQMP 3FMSA 2BCCD 1LTTC 4ONSA 1P84H 3HD7C 5KYUA 5A6AA 4ANJA 3IQCA 3QMKA 3RQGA 4GQHA 4JBZA 1A41A 3TGUE 2ZD9A 3RKOF 1NLXA 2CCYA 1Q82Q 1P84I 2WPVB 3LS1A 2NPSC 4G7OF 1RE4A 1U7JA 1H0TA 1NTKD 2RN0A 3JSVC 4UDVA 3KYJA 4G7HF 2A45H 2QE7H 4G78A 2R7TA 4G7ZF 3BCCG 4Y99B 2YO3A 3FXEA 1NU1G 3S28A 2A45I 2AEMA 5M1BA 1VK5A 2EIKC 3KMIA 2YEVA 1ZW0A 2IFNA 3WU2E 2L6FA 1SQVG 5KAIE 3CI9A 3I55P 3CD6P 1XWJA 2K9JB 1FAPB 1LT9A 4JCHA 2HR3A 3HRNA 2SPZA 3L74D 2OQMA 4IFMA 3DM9B 3PJSK 1YA9A 1ZN5A 4ER9A 1UG7A 1T6UA 1H6GA 3S27A 1LJ2A 3P8CD 3WMM0 2QJKB 1OWAA 2R44A 2KC3A 3B0PA 2WVRA 3BCCJ 3NMIA 4RDAA 2IBZG 2A06E 1BDDA 2FFHA 4CS8A 1HMOA 2KZJA 3DWWA 3SWKA 1H7IA 1W2BO 2QM8A 3F46A 2FYUJ 4PJ0H 3UMKA 3ZC4A 1D0ZA 1NKNA 2JJLA 4D6TE 3B9QA 4BJ1A 1AFOA 2PNOA 5HSWA 3A11A 5IY5C 4YWQA 2H7HA 5CBOA 3W2VA 1IFJA 3WG7C 5TISH 1Y9BA 3AE3C 5BU8B 4MS2A 2GUSA 3HE5B 1YITP 4YXDC 2DB4A 2PF4E 3N24A 4BJTA 2BASA 2I8DA 2R03A 2XV5A 2OCCC 3MYIA 1NGMB 4C46A 1BGYJ 2RH0A 1KC8Q 4MQ9F 3M9QA 5A69A 2NPSA 3LUTB 3E7KA 3EQ2A 1G1JA 2EPNA 2WSEJ 1ZR4A 1HBWA 1GMJA 3TGUD 3V2QA 4PR9A 1SFCB 1D7MA 5CCHD 4LACB 3L72G 2MHRA 1M2VB 5APVA 1YARO 5E33A 1NTME 1WN0A 2Y69C 1KILE 4IL6X 3SP1A 4Q5SF 5TJ5E 1SMYF 1URQC 3LNRA 3DKAA 2ZVNB 3PLNA 1OIPA 4JKVA 2YIUB 4I1LA 3R7CA 3RL0B 1L7CA 2YKPA 2BCCG 4IL6E 4Y28J 4H13B 3AEFC 3FOPA 2Z5IA 3L72J 3K6BA 2UUHA 3C62A 3UR3C 5BUOA 4YT5A 1QPUA 4OIOF 3AG2C 1MNEA 3SEOA 3VMAA 2Q9AA 1BDCA 3JCUH 1NTKG 2WSCH 2A06D 4DVZA 5A6BA 1I4YA 1YDIA 1BCCE 3L73E 5AVZB 2QRXA 3TOLA 4NPFX 1USEA 3H1LD 2A69F 4IAQA 1Q0GA 2OYOA 2BCCJ 1LKXA 2M0BA 2ETSA 1A0BA 3II6A 2KNCA 1OW6A 1OCCC 3CZ6A 1KB9E 3MYFA 1EC5A 2E5YA 3SWFA 3CQZA 1OXKA 4XPXA 3W4YA 3R4YA 3FDQA 2J5UA 4HFKB 1CW5A 1E79H 1NTKJ 5E2QA 3H6PA 3Q5SA 4MW3A 2J58A 1PP9E 1DD3A 1BZ4A 1PPJE 3BRVB 3IPMO 4EKWA 1IJDB 3RVYA 2YO2A 4X0RA 4K3AA 1GM5A 2L7AA 3L34A 3NTNA 1BR2A 1WWPA 3L70E 2EIMC 1N86A 1KILD 2K37A 2LIGA 3GLMA 2C03A 3X2QC 2XLHA 1WMKA 3MLGA 3L74J 5H2FE 4JTAB 2V4HA 4Y99C 1JY3P 1U89A 2J8WA 1Q90D 1H9TA 2P58A 2R3CA 2Y3BA 1BR4A 1VPCA 1H89A 3EGXB 1L4AA 1ORSC 2Y3HA 1O5HA 3SXYA 3HNJA 3IEEA 1QZXA 3I56P 1FOSE 2R3SA 3D70A 3H1HD 3HUSB 1ZW2A 3U9MA 1EI7A 3B71A 2QNLA 3VRCA 3TGUG 4CS9C 2R7XA 2Y9ZA 1K05A 5AW7B 3D6ZA 1ZRTE 2C04A 4FX5A 4NTFA 1BE3J 1SVFA 4JW1A 3ZQYA 2FYUK 2M8RA 1K8AQ 2QLAA 4CJOA 5GTHE 4MVSA 3CLQA 3ABKC 1JMBA 1FS0E 1KFMA 1EDJA 2QEXP 1ST6A 1M56C 3H2VA 2MWQA 1HJ0A 2Y0CA 1S9KD 2CNWA 1JY3O 3H32B 1KB9D 2WITA 3TGUJ 4RJTA 5CI8A 2YWAA 5L3VA 1HJBA 3WHNA 3EGDA 3RK3C 1EZVI 3EFFK 3A0HH 1CZQA 2M5AA 4BG0A 1OVRA 1QL2A 3L37A 3NYJA 1PP9D 4DOJA 2KB7P 2YL7A 1PPJD 4MVMA 5JP7A 3G71P 4DVYP 3WUUA 3IFMA 1MFTA 2YQYA 1AUEA 3BASA 1T9KA 5CCGC 3VMXA 5AVXB 3EZIA 1SFCC 5AW9B 3L1MA 4Z9IA 3H1LG 5GTIE 3L70D 3B5NB 4OWFA 1B68A 3P7KA 2YKZA 2W6JH 1K9MQ 3Q6MA 3K1IA 2AWCA 1YTZT 3GM2A 1E84A 4PJMA 4BEJA 3E70C 1WGWA 3L71E 2NG1A 4C3BA 1Z63A 3C9IA 2WWWA 5BQIA 2B88A 2LCHA 1FDOA 1RY3A 2DYSC 3V2PA 2MJZA 4NQFA 1JY3N 3RL0C 2O1JA 1V74B 3A7OA 5AVUB 3RK2D 2HPCA 1XTCC 4LLHA 4H13C 3CCMP 2IX7C 3U8PA 2D2CB 4J7TA 1VF5B 2E75B 1JCDA 1SQBE 3H1LJ 1HW1A 1LT9B 4O7GA 4F4BA 1HVVA 4D6TJ 2YLGA 1ZMEC 1M90Q 4CSAA 2N1TD 1ZHXA 4IARA 3DAGA 2H89C 1EDKA 5KLVE 1ZRTD 2P61A 1JO5A 2QJPC 2W90A 1RJ9A 5KLIB 4H44B 4BRYA 2LK4A 4U7JA 4LLCA 1S5LX 1O87A 1JUNA 1DEEG 3H1IG 3WU2H 4U9EA 2XLEA 5KAIH 1SQQG 4HJGH 4RBNA 3U3FA 4OIQF 1OQCA 3GF7A 3FXHA 3B29A 3VAYA 4BPMA 2ZXPA 4IOIH 3HE5A 3KZIE 1VQ8P 3BCCE 1NTKK 1GL2A 3MUDC 1NU1E 3H1HG 4MVOA 2HSBA 1OZHA 2RMZA 1DEBA 2J7PD 1AEPA 4M63A 1SQVE 3ATPA 2E76D 4KT0J 3NKEA 3AEBC 1KORA 5CCGA 2HV7A 3EFOA 1SFCA 1NTZG 4KBLA 1M2VA 3I4UA 2QE9A 2VCCA 3NMDA 5E79E 1YJWP 2R02A 4MVRA 4NTAA 5B3IA 2NPSB 2I8BA 3GW6A 2CPSA 2L5GB 2OEXA 1PD0A 2IBZE 3AE6C 2NUPA 3H1HJ 1RKCA 5B66E 1HGZA 1PD1A 4GKGA 4DRIB 3V5ZA 2QIWA 3L71D 4JQ0D 5APXA 2LFFA 5JT4A 3P8MC 4YTPC 1FZGA 2WQYC 3CSKA 4OINF 3FWLA 3TOMA 1PP9G 3A0BH 3EG9A 4BXLA 3HUSC 1AA0A 2HS5A 2IXNA 3JCUQ 1SQBD 3M9BA 2OTJP 3RH3A 1VQKP 2RSEB 3ZWIA 1NG1A 4CDVA 2HFIA 3LEOA 3PHF2 1PGJA 3L70G 5KLVD 4OIPF 2FXOA 3M79A 2Y0DA 1QVXA 1G4WR 1NVOA 3FXDA 1PZQA 2PAJA 1L3PA 1T5OA 2P7VA 2X0CA 5KYNA 2Z5HA 4GT1A 1LTSC 4K7BA 1JM0A 2P7JA 5AW4B 4YT2A 3GEHA 4GDOA 4YL3A 3JTLO 4IL6H 1PP9J 3LW5H 2XSEA 2LFDA 3MUDA 1JPJA 1KQSO 1S72P 3L35A 2CK3H 2R32A 2IXMA 1RQUA 2R7QA 3GORA 5AW0B 3DI5A 1NU1D 2KNCB 4I2LC 2IZ1A 1JTHA 3B0VC 3L70J 3GHGC 3S84A 2M3EA 4HYTB 3KYIA 1T8ZA 2IOQA 3O39A 1DD4A 4C7NA 3G4XA 2BCCE 4XQ1A 2Q6QA 1X0TA 4TLFA 1VLTA 4QI2A 5EFWB 1W5CE 1SQXE 4EUKB 3GEIA 1NU9C 1IC2A 3SWYA 2J0XA 1PFIA 4PFOA 1IK7A 4IB4A 2J59M 1OR2A 2PFXA 3OW2O 3C8VA 2G3AA 2PP4A 1QKRA 1NTKE 2W83C 2JKVA 3B5NC 1TQGA 4NY3A 2Y9YA 1RE4C 1NJIQ 3NXSA 4HFFB 5BQHA 1USDA 3LIEA 2JO1A 5AVRB 3EGXA 1NHLA 1D1AA 1ZW3A 3GM3A 1SP4A 1EA8A 4DJGA 5B5EH 1G4US 1N1CA 1LGHB 1JB0J 1M1JC 5AW1B 3MTUE 2GM4A 4U5EE 2L91A 3HTKA 3LLKA 4DBRA 3HUSA 1YYJA 1JMWA 4N4WA 2NZ2A 5K0IA 4DZOA 4A4AA 1L4AB 2AVKA 3ITKA 3H1KD 4IGGA 2D2CC 1YIJP 4XEVA 1VF5C 2E75C 2H43A 3QVYA 5CI9A 2IM8A 2HJMA 3RFYA 5DQTA 1LT9C 1CPQA 3ABVC 5HV9A 3K5BA 4XWJA 3P8CE 1EXIA 4WB4A 4FAPB 4PV1D 1NU7D 5H2FH 4U5DE 2A0BA 2NUTA 4NTBA 4JTCB 1NOHA 2HMQA 4ZKPA 2JR8A 4H0LC 1FZCB 3HE4A 1RF1A 1Z5ZA 1QL1A 1Q0FA 2XU6A 3D6YA 2WB7A 3JT1A 4WJ0A 4YXWH 3NYMA 2UWJE 3L71G 3JSEO 1SLQA 1OW7A 3KDPB 3GM1A 2LP4A 3JSZA 4DXWA 4JRZA 1NFOA 3GHGA 1SF8A 3PMRA 1MMAA 1KTMA 1Q0KA 1EQ7A 3DZAA 3SNHA 1KYOE 2FBWC 4DT0A 3ABLC 1O3UA 3L4FA 1E85A 1Y47A 3L75D 2YKQA 2AP3A 3EGDB 4ASVA 1CSBA 2M5AB 1G5ZA 1LS1A 1VMAA 3SYNA 5KLVG 1MFZA 1SQPE 1SQXD 3AE9C 1CI6A 3L71J 3K1HA 3M15A 3TK1A 4W7ZA 4I3MA 3AGUA 3B5NA 2H7OA 1W2WA 4OGQB 2ZXOA 1ZZPA 5D92A 3CCUP 1T6IA 1FU1A 4GOEA 3V5BA 1LE2A 2H7VC 4P9FA 3PCVA 3IF4A 4BJ6C 1SQBJ 3B4SA 1HGVA 1IW7F 3RYLA 1M1JA 3HD7D 1Z6AA 3EPVA 2WSSH 3U3BA 2BE5F 4CIHA 1HH0A 2OJQA 1A02F 5KLVJ 2WPQA 2YXRB 2NPSD 4U5HA 2WL8A 2EILC 3V7OA 1DIPA 5GPGB 4U3FD 3E1RA 5TJHA 3I5PA 2C0XA 4A7PA 5GTIH 3HKKA 2PX0A 2OKUA 4MTOA 2HPCB 2OYHB 5T1DB 5L0FA 3AG3C 2B0JA 3CX5H 3WODF 2GDCA 3IHUA 3ZG1A 5AW6B 1MMGA 3ZQVA 3FAPB 4O6NA 1NU1J 1MNDA 3CX5I 2JX0A 3G50A 5KAFE 4H54A 4AL0A 3FHDA 3M9HA 3CXHE 4W8KA 4U5GA 2YVKA 3A5TA 2KOGA 1RJ9B 1SQVJ 4BRYB 3H1LE 3M1CB 4YN0B 3U0CA 1GU4A 2K1AA 1A7VA 1ZV8A 4XEFA 1DOWA 1NFNA 5KKZC 3HLZA 2R7OA 1L0LG 1N7SA 3RBZA 1TFKB 4HEAJ 1X9VA 3RK3B 3L36A 1V55C 2E43A 3H1KG 1R5SA 3RGUA 1XZQA 1GL2B 2KS1A 3P32A 1KYOD 1MQVA 4XTKA 5AW5B 2XZRA 2CDQA 5A6BD 1WATA 2ZPAA 3G4ZA 3Q1MA 4W7YA 1NZEA 1PL5A 3CCRP 3SFEC 1NSGB 1SQPD 3BEHA 1Z56A 1LTAC 3TDKA 3EJNA 1WT6A 1OXBA 3VP9A 3EFOB 2IXPA 3KZIH 4ZMDA 4BJ6A 3PH0A 3W8IA 3C18A 1J8YF 4ZNCA 1R5ID 3AEDC 3SZRA 5APTA 1Q0MA 2HMZA 5APSA 3T4RA 3C8ZA 5KYXA 3POVA 2NUPB 3D71A 3H1IE 5COGA 1SQQE 2EPKX 4JIOA 1G8XA 1Y4CA 1FTSA 2R7UA 4LGDE 3L75G 3W2WA 3S4RA 5A6JA 1GU5A 2A1DD 3S1KA 2RD9A 4DJ9A 2YL1A 2YRFA 3MHVA 3ZTZA 3H1HE 1L4AC 2KYVA 3M06A 3BRTB 3S29A 4AE4B 5L0HA 4MVQA 1SQXG 4A2NB 2ZT9B 3C8GB 1OKKA 1BSHA 3EG9B 5JS5A 4C3DA 1URQD 2W9YA 3O6QA 5B66H 4JEBA 3L8JA 3I5QA 2IBZI 2XXAA 4MN4C 2JDIH 1YLMA 3SXMA 3N4XA 1NKZB 2QJPB 1LPEA 1NTZE 2WSEH 2IDBA 1FZCC 2R7SA 1Q81Q 3JZ0A 1UFBA 1H9GA 2JD3A 3UGPA 2J9BA 3CXHD 5KJ7C 1FZAA 1OXZA 2YKOA 3PHLA 4GOFA 4IRUA 2KXPB 2C0WA 3VM6A 2VASA 2M4EA 1S9KE 5JSLA 2R05A 1SQXJ 4L74A 2Y3DA 1EDLA 1QLEC 3LS0A 1IFNA 3O10A 1TWGA 3U1AA 3Q3DA 1CPRA 4U3FG 5BU5A 4YJWA 4HH2A 3U9JA 4IFFA 1F1MA 3DAFA 3GODA 2RKLA 1JTHB 2CGEA 3CCVP 5E3CA 3TNUA 2LQGA 1YBKA 4JC7A 5CCHA 4C7NB 3R2PA 2OEVA 2L6GA 2F22A 4CJGA 1YJGA 2CNWD 1VDFA 4KC9A 3WUVA 3CL3D 4OGQC 4EIYA 1DH3A 1SQBK 4CIPA 1LTJC 1KILC 4U3FJ 2VH3A 4LLEA 1VOMA 4PD4D 2PGDA 5F28E 3TK0A 2LD6A 4EWCA 5KLVK 2GA1A 2EPLX 3H1ID 1S4XA 3K1IC 1SQQD 1S05A 2GWWA 2E74B 2NPUA 1T01A 2YMYA 1H8AA 1QX8A 2NSFA 4YT8A 1OR3A 3RQEA 5DJTB 2P1AA 1VYIA 2W6BA 3U5SA 2WZ7A 1X8YA 1HY5A 3HTKB 4FWVA 2EPMX 1SQPG 2AEFA 4C3EA 5FCLA 3AQCA 2P67A 2OYHC 2BL2A 4HE8D 2H8AA 1J1DB 1NU1K 1FZCA 4I1OB 4OD5A 2GUVA 1XZPA 4U9DA 3KXDA 4CSAC 2IPPA 5KJ7A 2ASRA 2XS1A 1SQVK 1NTZD 2G3KA 2NUTB 4E18A 1L0ND 4WY4B 3X1OA 1YYXA 4MW8A 3HE4B 1RF1B 2IZ0A 2ZXRA 4W8PA 2H88C 3FX0A 3TYYA 2LKMA 4BJ5A 1SQPJ 2OYIA 5AVVB 3VTPC 2KIKA 3JRMO 2KUBA 1YTZI 3FGAD 1OCRC 2Q1KA 1YA7O 5AC4A 3GHGB 1GL2C 3CCLP 1P84E 4EIJA 2OTLP 2D4UA 3TJ6A 4ZLCA 3B8EB 3MGNA 3U2MA 2BC5A 3AEAC 5AVSB 4JE9A 3PRJA 2VCAA 3RBXA 2KP8A 3QTHA 4RESB 4MVZA 1LTJA 1KILA 3GMAA 1I5NA 5APUA 1VQ6P 2IXOA 1CI6B 1AQTA 2VC9A 1FZFA 2XL6A 4GEHA 5JUAA 4ZLDA 1OVVA 1GZLA 2J9WA 1PGPA 3KYQA 4K0DA 3W8HA 3PDMP 3M4BA 4MVUA 2A6EF 2G62A 5B1AC 5APQA 3Q6NA 4FESA 2XLWA 1M1JB 5CCGD 1IFDA 1N8RQ 1Q7YQ 1SFCD 3G4SP 5F5FA 2JP3A 3QW1A 1GDTA 4WVZA 5L3QA 3RK2C 2OYHA 1RXQA 1PCXA 2HV6A 1KQLA 4WABA 4RKUJ 5C39A 5L0IA 2ZT9C 1MUUA 4LDRA 2YL3A 3DJNB 3JRTA 2AEJA 2V3CC 1E83A 2L6HA 4L76A 4H0LB 5L0JA 1JPNA 4PJ0E 3KPEA 3E1IA 2XLVA 3RL0D 4N3YB 1VQ9P 4H13D 1QVGO 1S2EA 4M3LA 3GWLA 1SQXK 2HZ8A 1RE3C 1HE9A 4AUWA 4CDYA 5TISE 1ZR2A 4QMAA 1SS1A 5F5HA 2R7RA 1FBMA 3RL0g 2XRHA 3KH2A 1M57C 2GAQA 3KQGA 2XM4A 1S5LE 4KHXA 1N7SB 2LXCB 1YQ3C 1FJKA 5K5GB 2FFDA 4C7OA 1K40A 1UIIA 4OD4A 1KN7A 4K1OA 3ZDMA 2EINC 3EZHA 3A2AA 1P84D 2IYOA 3CWBD 3N2ZB 5KAFH 2KS1B 1Q86Q 3H1IJ 1IK9A 1Y8AA 3NFQA 3SFDC 1SQQJ 3UMIA 2ZFCA 1L0NG 3VF0A 2OOCA 1KV4A 4JTDB 3CC4P 3H65A 4GODA 4EBBA 1RKEA 3ASNC 2PP6A 2P10A 2Z4EA 1ZVZA 3LNMB 5AVTB 1LP1A 4Q4ZF 4CS7A 5KYXB 5JVEA 4I7ZB 3Q7LA 1YHQP 2E74C 1KFNA 1L0LE 3I5CA 3Q5PA 1EQ1A 1J2JB 2H8PD 4AE4A 1NTZJ 1EKYA 1YI2P 3FOOA 4LERA 3C8GA 1GW3A 1L0NJ 3HTKC 1LE4A 3O6XA 1ZXGA 3H1KE 2N1TA 3NG1A 2Q7RA 2OU6A 1S7ZA 4AYCA 2A6HF 1R4TA 4WGZA 3AEGC 3ZIBA 1UIXA 4UB6E 3T97A 1J1DC 2YLIA 1NAFA 2QY9A 4IWBA 1LM3B 4E0HA 3OA7A 3O6QB 4C7RA 2HODB 1ZYRF 1RE3A 2XXAB 4WY4C 3AE2C 1D1BA 2Q9CA 1SQPK 2XM0A 3VYIA 1RF1C 4O6YA 3GG2A 5KKZB 1EXJA 4J32B 1JAFA 2HUJA 1VQLP 4GYTA 5AW3B 1NYHA 2J7PA 3F47A 1TWHA 4KNVA 3Q7GA 2VB6A 2JWAA 3L75E 1AJYA 1ZHZA 5DS6A 2WSFJ 1MMNA 1VB5A 3LLIA 2B89A 2R5BA 3QH9A 3A9CA 2Q9IA 2O01J 1J1EC 1Y6DA 1VL2A 2IYLD 1I4ZA 1RQVA 1Q0DA 3W68A 3TNUB 4QI0A 3DD7A 2Q3IA 1VQNP 2FYNB 1ZLLA 1S1CX 3EHNA 4AQRD 1K04A 1KB9H 5B1BC 3B0UX 1YYCA 1IFIA 4HB1A 3EFGA 3NDBB 1KB9I 4HKZH 4DOZA 2O1KA 4RD9A 5DS5A 3EWKA 1WASA 3TD7A 3EQLF 1EDIA 2HLOA 1IFMA 4KJMA 1FNTc 1L0LD 1KQGB 4XPWA 4KNWA 3PTZA 3CWBG 2XLOA 3LAYA 4ZKUA 2OG2A 1GK4A 3B5ND 4JF7A 4U3FE 1G2CA 3G6EP 2YMKA 5T3TA 4AX2A 1JRAA 2AWYA 2PFDA 2C9NY 1LVKA 3MIWA 1E5WA 1OVUA 2WSFH 4ASWA 4PV1C 4Z9JA 2WT7A 2A45G 2O01H 1LWUC 3NRHA 1OCOC 4WY4A 2KLVA 1T2KD 4YT4A 4Z9HA 1FR0A 3CEXA 2J45A 1RHZB 4AL1A 1KMIZ 3S90A 3CWBJ 2D2CD 2I1JA 1U7MA 1VF5D 1X22A 1EZVE 2E75D 2ZAEB 1GTWA 1TWCA 4O79A 4R4LA 5CIVA 2HJ3A 4JYBA 3SXKA 1LIHA 4EBJA 1T6QA 2LXBA 1JEKA 1FE6A 2Q9BA 2DI3A 1N7SC 4H0LD 1PV3A 2OYIB 3ZVRA 4H44D 2QJYC 2HG5D 5DQZA 4TT3H 1MZ9A 2V7QJ 1JR8A 1QQ3A 2GFHA 2MYSA 5GTHH 1SQQK 4N6HA 3W67A 1FMVA 1FAVA 1N7LA 1R5LA 1JMMA 3UNGC 2TMVP 1C02A 2KNHA 2KI7B 3AG4C 4YL0A 4BWNA 1FMWA 2R7VA 3TF5A 1VTMP 1LTJB 3HNIA 1KILB 1FFHA 3H1JE 2A68F 1RMVA 3CC7P 3N0TA 1JY2P 4OH8B 1M2OA 5L0GA 2HYNA 1L2PA 5JLIA 4JVSA 2QG4A 3IR9A 3RVZA 1NTZK 1IZNB 4I7ZC 2ZYAA 1L0NK 3VOPA 2ZVOB 2E5TA 2CYDA 2KK1A 4I44A 2IBFA 5L0DA 1RH5B 3VN0A 2V7QH 1LWUA 3KHUA 2JEEA 5CMZA 4EOTA 3QWOC 1Q2NA 4I6MC 5AGFA 3SSUA 1MMDA 4RO0A 2FYUG 1M7LA 2I1KA 3CAXA 1N73B 2NRGA 3BVHA 1NBBA 3QVZA 4KI2A 1JY2O 5KYYA 1EZVD 3GWNA 1CGOA 1LI5A 3Q5RA 1OKKD 2KZIA 2B0HA 1KQFB 1X79B 1KD1Q 1TU3F 1W2EA 4WBAA 1VQPP 2XL8A 2FXMA 1YQ4C 1FZEA 3M0DA 1BGYG 2FFDB
chains in the Genus database with same CATH topology
3RQEA 1KNYA 1DD4A 3AJMA 3GF3A 3D71A 3AE2C 4OGQB 1ZZPA 2G8YA 3RK3E 1HJ0A 4H0LD 2L6HA 1PV3A 3LW5J 2HSBA 1OMIA 4H0LB 4H44D 2QJYC 1ZOYC 4TT3H 3Q2YA 1EXJA 1IK7A 2V7QJ 3JYYA 2E76D 4KT0J 4H13D 3AEBC 2FYNC 2YWAA 2MKVA 2G3AA 3C8VA 1NYHA 1KORA 3AE5C 2E74D 1MKMA 2ZT9B 3C8GB 4R32A 3TULA 1OW6A 4XEKA 1AJYA 3RL0g 3K7DA 3O6QA 1DIPA 4OGQD 2JO1A 2WSFJ 1FDIA 4Z1MH 4PV1B 3H25A 3L8JA 1R8EA 3G9RA 2WSCJ 1YQ3C 3AE6C 2O01J 3R4YA 2JPUA 3GM3A 2J5UA 1K40A 1VL2A 1JB0J 2YIUC 2H88C 2IDBA 1RQVA 4H44C 5KLIC 3JZ0A 1UFBA 1WTYA 3Q5SA 1Y9BA 1DD3A 2NZ2A 3AE3C 4R4MA 1S1CX 2QIWA 3FGAD 1K04A 4YXDC 5L8RJ 4XEVA 2D2CC 1VF5C 2E75C 2ZT9D 4YTPC 3C8GD 4I7ZC 3SFDC 3S9OA 2WQYC 1PIXA 3ABVC 3AECC 2JX0A 3GM2A 2Q00A 3O10A 1V4AA 1EXIA 3Q3DA 4PV1D 2KK1A 1NGMB 1WWPA 3U0CA 3EWKA 3AEAC 3BRJA 4XEFA 3GLMA 3T97B 4H0LC 2WSEJ 1WMKA 5KKZC 1GMJA 1FDOA 3L8IA 1WOLA 2P10A 1KQGB 4NQFA 2QJKC 3GMAA 3D6YA 2FXPA 2E76C 1Q90D 1OW8A 4H13C 2YMKA 1KILE 2D2CB 1VF5B 2E75B 1QVXA 2PBEA 4I7ZB 4XFJA 3RQGA 3AE4C 2L6GA 2E74C 1OW7A 2WPVB 4IL6X 1U57A 2K9YA 3Q5PA 1ZMEC 3GM1A 2BEZF 3MFNA 3Q1MA 4PV1C 2H89C 4OGQC 4GDOA 3D70A 1KTMA 3C8GA 1ZP0C 1PL5A 3SFEC 2OQQA 2QJPC 3AE1C 3B71A 2FBWC 3AE7C 4H44B 1O3UA 4U7JA 2LK4A 5F28E 3RQFA 2BEQD 3AEEC 1S5LX 3Q5RA 1HF9A 2JP3A 3AEGC 1UIXA 3AE8C 1K05A 4EBKA 2E76B 3D6ZA 1RQUA 4Y28J 3IN6A 1KQFB 1KMIZ 3IAOA 3AEFC 1ZRTE 4H13B 5M1BA 3U3FA 2D2CD 1TU3F 2QSIA 1VF5D 2E75D 3C18A 3AE9C 3GF7A 4R4LA 4RKUJ 2E74B 3AEDC 1YQ4C 2ZT9C 2L6FA 1JOGA 4EBJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RQE A;  1KNY A;  3AJM A;  3AE2 C;  1ZZP A;  2L6H A;  1PV3 A;  2HSB A;  1ZOY C;  3AEB C;  2YWA A;  2G3A A;  3AE5 C;  3C8G B;  4R32 A;  3TUL A;  1OW6 A;  4XEK A;  3K7D A;  3L8J A;  2JPU A;  1YQ3 C;  3AE6 C;  3GM3 A;  1K40 A;  2H88 C;  3JZ0 A;  1UFB A;  1WTY A;  3AE3 C;  1K04 A;  4YXD C;  4XEV A;  4YTP C;  3C8G D;  3SFD C;  3S9O A;  3AEC C;  2WQY C;  3ABV C;  2JX0 A;  3GM2 A;  2Q00 A;  3O10 A;  1V4A A;  2KK1 A;  1WWP A;  3U0C A;  3AEA C;  3BRJ A;  4XEF A;  3L8I A;  1WOL A;  4NQF A;  1OW8 A;  1QVX A;  2PBE A;  3RQG A;  3AE4 C;  2L6G A;  1OW7 A;  3GM1 A;  3MFN A;  2H89 C;  3C8G A;  1KTM A;  1ZP0 C;  3SFE C;  3AE1 C;  3B71 A;  2FBW C;  3AE7 C;  1O3U A;  2LK4 A;  5F28 E;  3RQF A;  3AEE C;  3AEG C;  3AE8 C;  1K05 A;  4EBK A;  3JYY A;  3AEF C;  3U3F A;  3C18 A;  3AE9 C;  3AED C;  1YQ4 C;  2L6F A;  1JOG A;  4EBJ A; 
#chains in the Genus database with same CATH topology
 4C7O B;  3MZW B;  2R7W A;  4BEM J;  2WMM A;  3GF3 A;  5D91 A;  4E7Z A;  3V2N A;  2P1J A;  4NPE A;  1VLS A;  1FFT C;  5EK0 A;  1HW2 A;  4B86 A;  4W80 A;  3Q2Y A;  3EH1 A;  4K35 A;  3C7J A;  3DXJ F;  1BE3 D;  3KKB A;  1D0Y A;  4O6M A;  2FYN C;  5CCH C;  1L0L J;  1GGQ A;  2P6V A;  5AC5 A;  3HNL A;  1S5L H;  2W4M A;  5AVW B;  3HD7 A;  3H1J D;  1T6A A;  3E9V A;  4PD4 E;  3EH2 A;  1FZB A;  4G0H A;  3H1K J;  4EHP A;  1QGK B;  3CCQ P;  1BBH A;  1RKE B;  1MV8 A;  3MBG A;  2WSC J;  3MP7 B;  2WZF A;  4J30 B;  1JY2 N;  3T6B A;  3A0B E;  4JYC A;  2DYR C;  1LP1 B;  3DJU B;  3S0X A;  1LT1 A;  4B6I A;  1PGO A;  3LJB A;  1YJN P;  5BVZ A;  3RK2 B;  5E79 H;  2D5R B;  2Y39 A;  3ASO C;  2J0W A;  3US6 A;  2EIJ C;  1QEX A;  5L8R J;  2LR2 A;  3JYH A;  2HSQ A;  4U5C E;  5AW8 B;  5CJ0 A;  2O9X A;  2N9Y B;  2N1T B;  2XDJ A;  2HOD A;  3BRJ A;  3T97 B;  1AVO B;  3V4W A;  3G3Z A;  3L8I A;  3N7N A;  1VYK A;  1L0N E;  3IQ6 A;  2ZXW C;  1L4A D;  3L75 J;  5B3S C;  4LDQ A;  3O8Z A;  4XFJ A;  2R25 A;  2M64 A;  1ZU4 A;  3O55 A;  1NAY A;  1VQ7 P;  5EHH A;  1VQ5 P;  2AXC A;  2KYH A;  2ICW G;  3SXZ A;  4PAC A;  4UB6 H;  4BJ5 C;  4J7Y A;  1APC A;  2OYI C;  1Z3I X;  4PJL A;  2A0U A;  4QDL A;  2BEQ D;  1LI7 A;  4EDF A;  2KSE A;  5KJ7 D;  2QM7 A;  1CGN A;  1ZHT A;  4NC3 A;  4EBK A;  2E76 B;  2YHS A;  4D6T D;  4UB8 E;  5T3W A;  1A02 J;  2WPR A;  4IJJ A;  1QLE D;  4L6R A;  3L0I A;  3OWT A;  3AG1 C;  3AJM A;  4LDK A;  2QA4 P;  3CMA P;  3RK3 E;  3L74 G;  1BSN A;  1E2X A;  2WZG A;  3OAK A;  1EZV G;  1D0X A;  3OEO A;  1ZOY C;  1A7E A;  4PK4 A;  4DRH B;  3CCS P;  5B5E E;  2VCB A;  2YXQ B;  2XLM A;  2MKV A;  2WVN A;  3WUT A;  2YLD A;  3RIP A;  3DE9 A;  2FGY A;  4P6I C;  1GD2 E;  1HWT C;  4R32 A;  2K88 A;  2ITA A;  5EGY A;  1AV1 A;  5KYW A;  4EYY Q;  3USS A;  4N78 E;  5AW2 B;  4OGQ D;  1NTM D;  2E87 A;  4D4X A;  3V4Q A;  2AU5 A;  3H2U A;  3LEV A;  4JZA A;  4DCK A;  3G9R A;  1J8M F;  1K73 Q;  1TR2 A;  2YNY A;  1URQ A;  2XLD A;  2KJG A;  3V6I A;  2J46 A;  3KPH A;  1C03 A;  4IFD K;  4DRJ B;  1G2C B;  1BE3 G;  4R4M A;  1IFP A;  1D1C A;  2B87 A;  3TQO A;  1RF0 C;  2QVA A;  3H1J G;  2Q7C A;  1IZM A;  2WT7 B;  1PIX A;  1T3U A;  5COF A;  2AXT E;  1N73 C;  3CCJ P;  1WRG A;  1E86 A;  2EPO A;  3C63 A;  3ITF A;  3WAQ A;  1BDJ B;  1WOL A;  2QJK C;  3RF3 A;  3OJA B;  5CBN A;  1PGQ A;  3FVY A;  2PBE A;  3U1C A;  3AE4 C;  4XPY A;  4JJG A;  1BCC D;  3L73 D;  1U57 A;  2PRR A;  2FFD C;  3H1J J;  3CWB E;  4JJF A;  3UMH A;  2G3V A;  2ZXX A;  2P2U A;  1M56 D;  1Z23 A;  1J1E B;  3ABM C;  3AE1 C;  1L0L K;  4ULV A;  1HTL C;  3AE7 C;  5L0C A;  3RQF A;  1HF9 A;  5CJ4 A;  3JC2 2;  3IAO A;  2W45 A;  3RK3 D;  1GL2 D;  2WZL A;  2XND H;  2N9B A;  3U2L A;  1KYO H;  2B9B A;  1NH4 A;  1BR1 A;  1XTG B;  2A06 G;  4XA4 A;  1Z7Q c;  4IAO A;  1A7D A;  2FY8 A;  3GEE A;  3MX3 A;  4JUR I;  1N2D C;  1KYO I;  5KYU B;  2XS8 A;  4NCQ A;  4U5F E;  3F89 A;  4N78 D;  3DMD A;  1DX7 A;  3V5X A;  1YZC A;  1V54 C;  4D6T G;  2Q3T A;  3K66 A;  4D4N A;  2QUP A;  1H0T B;  1MKM A;  2R9R B;  3KL4 A;  3VMZ A;  3CX5 E;  4XLP F;  5AVQ B;  5BQG A;  256B A;  2H7B A;  1RF0 A;  2Z15 A;  2J9U A;  4MTG A;  2N1T C;  4PV1 B;  4E7S A;  3CCE P;  4CPG A;  1LS4 A;  1LWU B;  2Y3G A;  3ZSU A;  1N73 A;  2KSF A;  2LSE A;  2M3B A;  2K9J A;  3TJ5 A;  2YIU C;  4DBQ A;  2WPS A;  4L73 A;  4CS9 A;  1M1K Q;  2XL4 A;  2Y0E A;  2XNX A;  1FOS F;  4AK9 A;  1U6H A;  2ZT9 D;  3C8G D;  1FDM A;  3FWN A;  3S9O A;  2X51 A;  3AEC C;  2CPB A;  4L75 A;  2P0N A;  4JCZ A;  5KYY B;  3CC2 P;  1NTM G;  5APY A;  4PFP A;  4OVN F;  2YL0 A;  1CGM E;  3J06 A;  1GK6 A;  3EHM A;  4PJJ A;  2QJY B;  1M6T A;  2L9J A;  1H88 A;  3NMJ A;  3IQT A;  2E76 C;  1S3J A;  3CXH H;  2FKW B;  1RCP A;  5APW A;  3M91 A;  2POH A;  1IO4 A;  2O3J A;  2K9Y A;  1M57 D;  2BEZ F;  3CXH I;  3MFN A;  2E42 A;  3A3Y B;  1U0B B;  1NO4 A;  1ZP0 C;  4Q7C A;  3T6J A;  5COM A;  1NTM J;  4XLN F;  2OQQ A;  3LID A;  3HNK A;  1LTI C;  2FYU E;  2W8Z A;  3AGT A;  1HMD A;  3AEE C;  2QTV A;  4N6C A;  3DM5 A;  2WVO A;  4XE5 B;  2HKV A;  3JYY A;  3HD7 B;  3CPW O;  5JRA A;  3U59 A;  4WWI A;  2OTK E;  4GIF A;  2KK7 A;  2GA0 A;  1OCZ C;  1LTB C;  1BCC G;  3L73 G;  1JOG A;  1KNY A;  3M4C A;  2W27 A;  1YZA A;  1GQA A;  2PX3 A;  3LW5 J;  1VQ4 P;  1OMI A;  2NSG A;  2Q4F A;  4O9B A;  4NPD A;  3CX5 D;  1BGY E;  3JCU E;  3NYL A;  5DS4 A;  4PD4 H;  3UIA A;  1AVO A;  1T3J A;  2KSJ A;  3AE5 C;  3K33 A;  2E74 D;  3VMY A;  4YK5 A;  3TUL A;  4PD4 I;  1LTG C;  1BCC J;  3L73 J;  2UUI A;  1PPJ G;  1QSP A;  3H25 A;  5DLJ A;  3VP8 A;  4CX9 A;  1OFC X;  2OAR A;  1JCC A;  4H4K C;  4EI2 A;  1ZHY A;  3V2R A;  3T6G B;  5DVW A;  2O01 N;  1WTY A;  2WVQ A;  2IYP A;  1ZU5 A;  3DE8 A;  1SZI A;  1FC2 C;  3TSI A;  5A6K A;  4PJN A;  3NKD A;  4WGY A;  3V5Y A;  1TWA A;  3UGO A;  4OIR F;  2ZYD A;  1DOV A;  2VRS A;  4WY4 D;  3QZC A;  1V4A A;  3L72 E;  2I15 A;  4CBE A;  3HJC A;  2DGJ A;  4ULW A;  3OA1 A;  4MND A;  3MD0 A;  1JNM A;  4JEA A;  4JPZ B;  3BCC D;  3VYW A;  2FXP A;  2KQ9 A;  3AQB A;  1OW8 A;  3BAT A;  3RW0 A;  1TFO B;  2OJE D;  5DJU B;  2JWD A;  2FYU D;  1SQV D;  1NWQ A;  4MTF A;  4CDA A;  1GW4 A;  1QVF O;  3ECS A;  1SR2 A;  2C9L Y;  2ZXE B;  1OX3 A;  4E0I A;  4P9T A;  3FAJ A;  2WTY A;  1AQ5 A;  4UB8 H;  1AVY A;  3AE8 C;  3T9O A;  2W4B A;  3IN6 A;  2L81 A;  2IBZ D;  2QSI A;  5KYW B;  3LES A;  5AVY B;  2FAP B;  1BGY D;  1URQ B;  5E3A A;  3GAN A;  3CME P;  2G8Y A;  2HFE D;  1YJ9 P;  3ZTM A;  3M0A A;  1T2K C;  2ZJS E;  2B87 B;  1ZHW A;  1TKN A;  2DW3 A;  1M8O B;  5KTB A;  2FYZ A;  2ZYG A;  3L74 E;  1ORY A;  2R5D A;  3AOU A;  2Q5U A;  5FZT A;  3C1L A;  1G1I A;  4LC1 A;  1HE1 A;  2KGO A;  4I1M A;  4XEK A;  1ORJ A;  3K7D A;  2J9V A;  4Z1M H;  1FDI A;  1VQO P;  3A0H E;  1R8E A;  4N06 A;  3PP5 A;  2KW3 C;  2JPU A;  4E17 A;  1YVI A;  1KU2 A;  4N6J A;  1GS9 A;  5KLI C;  4H44 C;  2V26 A;  1YAU O;  1JOC A;  3QW0 A;  4CS8 C;  1C17 M;  3L72 D;  3H32 A;  1LNQ A;  2AXT H;  2K3R A;  3F5H A;  1HUC A;  2CW0 F;  1KZU B;  3U8V A;  3M0D C;  2XKM A;  1FJP A;  3IQ5 A;  4YL1 A;  2YZS A;  3NMK A;  4U5B E;  1NTM K;  2Q00 A;  1BE3 E;  1N7S D;  3ZDL A;  5CHX A;  1SQB G;  2Q3E A;  4YPC A;  2KLU A;  2W6A A;  1SYQ A;  2OGU A;  2IFM A;  1VQM P;  3FMS A;  2BCC D;  1LTT C;  4ONS A;  1P84 H;  3HD7 C;  5KYU A;  5A6A A;  4ANJ A;  3IQC A;  3QMK A;  3RQG A;  4GQH A;  4JBZ A;  1A41 A;  3TGU E;  2ZD9 A;  3RKO F;  1NLX A;  2CCY A;  1Q82 Q;  1P84 I;  2WPV B;  3LS1 A;  2NPS C;  4G7O F;  1RE4 A;  1U7J A;  1H0T A;  1NTK D;  2RN0 A;  3JSV C;  4UDV A;  3KYJ A;  4G7H F;  2A45 H;  2QE7 H;  4G78 A;  2R7T A;  4G7Z F;  3BCC G;  4Y99 B;  2YO3 A;  3FXE A;  1NU1 G;  3S28 A;  2A45 I;  2AEM A;  5M1B A;  1VK5 A;  2EIK C;  3KMI A;  2YEV A;  1ZW0 A;  2IFN A;  3WU2 E;  2L6F A;  1SQV G;  5KAI E;  3CI9 A;  3I55 P;  3CD6 P;  1XWJ A;  2K9J B;  1FAP B;  1LT9 A;  4JCH A;  2HR3 A;  3HRN A;  2SPZ A;  3L74 D;  2OQM A;  4IFM A;  3DM9 B;  3PJS K;  1YA9 A;  1ZN5 A;  4ER9 A;  1UG7 A;  1T6U A;  1H6G A;  3S27 A;  1LJ2 A;  3P8C D;  3WMM 0;  2QJK B;  1OWA A;  2R44 A;  2KC3 A;  3B0P A;  2WVR A;  3BCC J;  3NMI A;  4RDA A;  2IBZ G;  2A06 E;  1BDD A;  2FFH A;  4CS8 A;  1HMO A;  2KZJ A;  3DWW A;  3SWK A;  1H7I A;  1W2B O;  2QM8 A;  3F46 A;  2FYU J;  4PJ0 H;  3UMK A;  3ZC4 A;  1D0Z A;  1NKN A;  2JJL A;  4D6T E;  3B9Q A;  4BJ1 A;  1AFO A;  2PNO A;  5HSW A;  3A11 A;  5IY5 C;  4YWQ A;  2H7H A;  5CBO A;  3W2V A;  1IFJ A;  3WG7 C;  5TIS H;  1Y9B A;  3AE3 C;  5BU8 B;  4MS2 A;  2GUS A;  3HE5 B;  1YIT P;  4YXD C;  2DB4 A;  2PF4 E;  3N24 A;  4BJT A;  2BAS A;  2I8D A;  2R03 A;  2XV5 A;  2OCC C;  3MYI A;  1NGM B;  4C46 A;  1BGY J;  2RH0 A;  1KC8 Q;  4MQ9 F;  3M9Q A;  5A69 A;  2NPS A;  3LUT B;  3E7K A;  3EQ2 A;  1G1J A;  2EPN A;  2WSE J;  1ZR4 A;  1HBW A;  1GMJ A;  3TGU D;  3V2Q A;  4PR9 A;  1SFC B;  1D7M A;  5CCH D;  4LAC B;  3L72 G;  2MHR A;  1M2V B;  5APV A;  1YAR O;  5E33 A;  1NTM E;  1WN0 A;  2Y69 C;  1KIL E;  4IL6 X;  3SP1 A;  4Q5S F;  5TJ5 E;  1SMY F;  1URQ C;  3LNR A;  3DKA A;  2ZVN B;  3PLN A;  1OIP A;  4JKV A;  2YIU B;  4I1L A;  3R7C A;  3RL0 B;  1L7C A;  2YKP A;  2BCC G;  4IL6 E;  4Y28 J;  4H13 B;  3AEF C;  3FOP A;  2Z5I A;  3L72 J;  3K6B A;  2UUH A;  3C62 A;  3UR3 C;  5BUO A;  4YT5 A;  1QPU A;  4OIO F;  3AG2 C;  1MNE A;  3SEO A;  3VMA A;  2Q9A A;  1BDC A;  3JCU H;  1NTK G;  2WSC H;  2A06 D;  4DVZ A;  5A6B A;  1I4Y A;  1YDI A;  1BCC E;  3L73 E;  5AVZ B;  2QRX A;  3TOL A;  4NPF X;  1USE A;  3H1L D;  2A69 F;  4IAQ A;  1Q0G A;  2OYO A;  2BCC J;  1LKX A;  2M0B A;  2ETS A;  1A0B A;  3II6 A;  2KNC A;  1OW6 A;  1OCC C;  3CZ6 A;  1KB9 E;  3MYF A;  1EC5 A;  2E5Y A;  3SWF A;  3CQZ A;  1OXK A;  4XPX A;  3W4Y A;  3R4Y A;  3FDQ A;  2J5U A;  4HFK B;  1CW5 A;  1E79 H;  1NTK J;  5E2Q A;  3H6P A;  3Q5S A;  4MW3 A;  2J58 A;  1PP9 E;  1DD3 A;  1BZ4 A;  1PPJ E;  3BRV B;  3IPM O;  4EKW A;  1IJD B;  3RVY A;  2YO2 A;  4X0R A;  4K3A A;  1GM5 A;  2L7A A;  3L34 A;  3NTN A;  1BR2 A;  1WWP A;  3L70 E;  2EIM C;  1N86 A;  1KIL D;  2K37 A;  2LIG A;  3GLM A;  2C03 A;  3X2Q C;  2XLH A;  1WMK A;  3MLG A;  3L74 J;  5H2F E;  4JTA B;  2V4H A;  4Y99 C;  1JY3 P;  1U89 A;  2J8W A;  1Q90 D;  1H9T A;  2P58 A;  2R3C A;  2Y3B A;  1BR4 A;  1VPC A;  1H89 A;  3EGX B;  1L4A A;  1ORS C;  2Y3H A;  1O5H A;  3SXY A;  3HNJ A;  3IEE A;  1QZX A;  3I56 P;  1FOS E;  2R3S A;  3D70 A;  3H1H D;  3HUS B;  1ZW2 A;  3U9M A;  1EI7 A;  3B71 A;  2QNL A;  3VRC A;  3TGU G;  4CS9 C;  2R7X A;  2Y9Z A;  1K05 A;  5AW7 B;  3D6Z A;  1ZRT E;  2C04 A;  4FX5 A;  4NTF A;  1BE3 J;  1SVF A;  4JW1 A;  3ZQY A;  2FYU K;  2M8R A;  1K8A Q;  2QLA A;  4CJO A;  5GTH E;  4MVS A;  3CLQ A;  3ABK C;  1JMB A;  1FS0 E;  1KFM A;  1EDJ A;  2QEX P;  1ST6 A;  1M56 C;  3H2V A;  2MWQ A;  1HJ0 A;  2Y0C A;  1S9K D;  2CNW A;  1JY3 O;  3H32 B;  1KB9 D;  2WIT A;  3TGU J;  4RJT A;  5CI8 A;  2YWA A;  5L3V A;  1HJB A;  3WHN A;  3EGD A;  3RK3 C;  1EZV I;  3EFF K;  3A0H H;  1CZQ A;  2M5A A;  4BG0 A;  1OVR A;  1QL2 A;  3L37 A;  3NYJ A;  1PP9 D;  4DOJ A;  2KB7 P;  2YL7 A;  1PPJ D;  4MVM A;  5JP7 A;  3G71 P;  4DVY P;  3WUU A;  3IFM A;  1MFT A;  2YQY A;  1AUE A;  3BAS A;  1T9K A;  5CCG C;  3VMX A;  5AVX B;  3EZI A;  1SFC C;  5AW9 B;  3L1M A;  4Z9I A;  3H1L G;  5GTI E;  3L70 D;  3B5N B;  4OWF A;  1B68 A;  3P7K A;  2YKZ A;  2W6J H;  1K9M Q;  3Q6M A;  3K1I A;  2AWC A;  1YTZ T;  3GM2 A;  1E84 A;  4PJM A;  4BEJ A;  3E70 C;  1WGW A;  3L71 E;  2NG1 A;  4C3B A;  1Z63 A;  3C9I A;  2WWW A;  5BQI A;  2B88 A;  2LCH A;  1FDO A;  1RY3 A;  2DYS C;  3V2P A;  2MJZ A;  4NQF A;  1JY3 N;  3RL0 C;  2O1J A;  1V74 B;  3A7O A;  5AVU B;  3RK2 D;  2HPC A;  1XTC C;  4LLH A;  4H13 C;  3CCM P;  2IX7 C;  3U8P A;  2D2C B;  4J7T A;  1VF5 B;  2E75 B;  1JCD A;  1SQB E;  3H1L J;  1HW1 A;  1LT9 B;  4O7G A;  4F4B A;  1HVV A;  4D6T J;  2YLG A;  1ZME C;  1M90 Q;  4CSA A;  2N1T D;  1ZHX A;  4IAR A;  3DAG A;  2H89 C;  1EDK A;  5KLV E;  1ZRT D;  2P61 A;  1JO5 A;  2QJP C;  2W90 A;  1RJ9 A;  5KLI B;  4H44 B;  4BRY A;  2LK4 A;  4U7J A;  4LLC A;  1S5L X;  1O87 A;  1JUN A;  1DEE G;  3H1I G;  3WU2 H;  4U9E A;  2XLE A;  5KAI H;  1SQQ G;  4HJG H;  4RBN A;  3U3F A;  4OIQ F;  1OQC A;  3GF7 A;  3FXH A;  3B29 A;  3VAY A;  4BPM A;  2ZXP A;  4IOI H;  3HE5 A;  3KZI E;  1VQ8 P;  3BCC E;  1NTK K;  1GL2 A;  3MUD C;  1NU1 E;  3H1H G;  4MVO A;  2HSB A;  1OZH A;  2RMZ A;  1DEB A;  2J7P D;  1AEP A;  4M63 A;  1SQV E;  3ATP A;  2E76 D;  4KT0 J;  3NKE A;  3AEB C;  1KOR A;  5CCG A;  2HV7 A;  3EFO A;  1SFC A;  1NTZ G;  4KBL A;  1M2V A;  3I4U A;  2QE9 A;  2VCC A;  3NMD A;  5E79 E;  1YJW P;  2R02 A;  4MVR A;  4NTA A;  5B3I A;  2NPS B;  2I8B A;  3GW6 A;  2CPS A;  2L5G B;  2OEX A;  1PD0 A;  2IBZ E;  3AE6 C;  2NUP A;  3H1H J;  1RKC A;  5B66 E;  1HGZ A;  1PD1 A;  4GKG A;  4DRI B;  3V5Z A;  2QIW A;  3L71 D;  4JQ0 D;  5APX A;  2LFF A;  5JT4 A;  3P8M C;  4YTP C;  1FZG A;  2WQY C;  3CSK A;  4OIN F;  3FWL A;  3TOM A;  1PP9 G;  3A0B H;  3EG9 A;  4BXL A;  3HUS C;  1AA0 A;  2HS5 A;  2IXN A;  3JCU Q;  1SQB D;  3M9B A;  2OTJ P;  3RH3 A;  1VQK P;  2RSE B;  3ZWI A;  1NG1 A;  4CDV A;  2HFI A;  3LEO A;  3PHF 2;  1PGJ A;  3L70 G;  5KLV D;  4OIP F;  2FXO A;  3M79 A;  2Y0D A;  1QVX A;  1G4W R;  1NVO A;  3FXD A;  1PZQ A;  2PAJ A;  1L3P A;  1T5O A;  2P7V A;  2X0C A;  5KYN A;  2Z5H A;  4GT1 A;  1LTS C;  4K7B A;  1JM0 A;  2P7J A;  5AW4 B;  4YT2 A;  3GEH A;  4GDO A;  4YL3 A;  3JTL O;  4IL6 H;  1PP9 J;  3LW5 H;  2XSE A;  2LFD A;  3MUD A;  1JPJ A;  1KQS O;  1S72 P;  3L35 A;  2CK3 H;  2R32 A;  2IXM A;  1RQU A;  2R7Q A;  3GOR A;  5AW0 B;  3DI5 A;  1NU1 D;  2KNC B;  4I2L C;  2IZ1 A;  1JTH A;  3B0V C;  3L70 J;  3GHG C;  3S84 A;  2M3E A;  4HYT B;  3KYI A;  1T8Z A;  2IOQ A;  3O39 A;  1DD4 A;  4C7N A;  3G4X A;  2BCC E;  4XQ1 A;  2Q6Q A;  1X0T A;  4TLF A;  1VLT A;  4QI2 A;  5EFW B;  1W5C E;  1SQX E;  4EUK B;  3GEI A;  1NU9 C;  1IC2 A;  3SWY A;  2J0X A;  1PFI A;  4PFO A;  1IK7 A;  4IB4 A;  2J59 M;  1OR2 A;  2PFX A;  3OW2 O;  3C8V A;  2G3A A;  2PP4 A;  1QKR A;  1NTK E;  2W83 C;  2JKV A;  3B5N C;  1TQG A;  4NY3 A;  2Y9Y A;  1RE4 C;  1NJI Q;  3NXS A;  4HFF B;  5BQH A;  1USD A;  3LIE A;  2JO1 A;  5AVR B;  3EGX A;  1NHL A;  1D1A A;  1ZW3 A;  3GM3 A;  1SP4 A;  1EA8 A;  4DJG A;  5B5E H;  1G4U S;  1N1C A;  1LGH B;  1JB0 J;  1M1J C;  5AW1 B;  3MTU E;  2GM4 A;  4U5E E;  2L91 A;  3HTK A;  3LLK A;  4DBR A;  3HUS A;  1YYJ A;  1JMW A;  4N4W A;  2NZ2 A;  5K0I A;  4DZO A;  4A4A A;  1L4A B;  2AVK A;  3ITK A;  3H1K D;  4IGG A;  2D2C C;  1YIJ P;  4XEV A;  1VF5 C;  2E75 C;  2H43 A;  3QVY A;  5CI9 A;  2IM8 A;  2HJM A;  3RFY A;  5DQT A;  1LT9 C;  1CPQ A;  3ABV C;  5HV9 A;  3K5B A;  4XWJ A;  3P8C E;  1EXI A;  4WB4 A;  4FAP B;  4PV1 D;  1NU7 D;  5H2F H;  4U5D E;  2A0B A;  2NUT A;  4NTB A;  4JTC B;  1NOH A;  2HMQ A;  4ZKP A;  2JR8 A;  4H0L C;  1FZC B;  3HE4 A;  1RF1 A;  1Z5Z A;  1QL1 A;  1Q0F A;  2XU6 A;  3D6Y A;  2WB7 A;  3JT1 A;  4WJ0 A;  4YXW H;  3NYM A;  2UWJ E;  3L71 G;  3JSE O;  1SLQ A;  1OW7 A;  3KDP B;  3GM1 A;  2LP4 A;  3JSZ A;  4DXW A;  4JRZ A;  1NFO A;  3GHG A;  1SF8 A;  3PMR A;  1MMA A;  1KTM A;  1Q0K A;  1EQ7 A;  3DZA A;  3SNH A;  1KYO E;  2FBW C;  4DT0 A;  3ABL C;  1O3U A;  3L4F A;  1E85 A;  1Y47 A;  3L75 D;  2YKQ A;  2AP3 A;  3EGD B;  4ASV A;  1CSB A;  2M5A B;  1G5Z A;  1LS1 A;  1VMA A;  3SYN A;  5KLV G;  1MFZ A;  1SQP E;  1SQX D;  3AE9 C;  1CI6 A;  3L71 J;  3K1H A;  3M15 A;  3TK1 A;  4W7Z A;  4I3M A;  3AGU A;  3B5N A;  2H7O A;  1W2W A;  4OGQ B;  2ZXO A;  1ZZP A;  5D92 A;  3CCU P;  1T6I A;  1FU1 A;  4GOE A;  3V5B A;  1LE2 A;  2H7V C;  4P9F A;  3PCV A;  3IF4 A;  4BJ6 C;  1SQB J;  3B4S A;  1HGV A;  1IW7 F;  3RYL A;  1M1J A;  3HD7 D;  1Z6A A;  3EPV A;  2WSS H;  3U3B A;  2BE5 F;  4CIH A;  1HH0 A;  2OJQ A;  1A02 F;  5KLV J;  2WPQ A;  2YXR B;  2NPS D;  4U5H A;  2WL8 A;  2EIL C;  3V7O A;  1DIP A;  5GPG B;  4U3F D;  3E1R A;  5TJH A;  3I5P A;  2C0X A;  4A7P A;  5GTI H;  3HKK A;  2PX0 A;  2OKU A;  4MTO A;  2HPC B;  2OYH B;  5T1D B;  5L0F A;  3AG3 C;  2B0J A;  3CX5 H;  3WOD F;  2GDC A;  3IHU A;  3ZG1 A;  5AW6 B;  1MMG A;  3ZQV A;  3FAP B;  4O6N A;  1NU1 J;  1MND A;  3CX5 I;  2JX0 A;  3G50 A;  5KAF E;  4H54 A;  4AL0 A;  3FHD A;  3M9H A;  3CXH E;  4W8K A;  4U5G A;  2YVK A;  3A5T A;  2KOG A;  1RJ9 B;  1SQV J;  4BRY B;  3H1L E;  3M1C B;  4YN0 B;  3U0C A;  1GU4 A;  2K1A A;  1A7V A;  1ZV8 A;  4XEF A;  1DOW A;  1NFN A;  5KKZ C;  3HLZ A;  2R7O A;  1L0L G;  1N7S A;  3RBZ A;  1TFK B;  4HEA J;  1X9V A;  3RK3 B;  3L36 A;  1V55 C;  2E43 A;  3H1K G;  1R5S A;  3RGU A;  1XZQ A;  1GL2 B;  2KS1 A;  3P32 A;  1KYO D;  1MQV A;  4XTK A;  5AW5 B;  2XZR A;  2CDQ A;  5A6B D;  1WAT A;  2ZPA A;  3G4Z A;  3Q1M A;  4W7Y A;  1NZE A;  1PL5 A;  3CCR P;  3SFE C;  1NSG B;  1SQP D;  3BEH A;  1Z56 A;  1LTA C;  3TDK A;  3EJN A;  1WT6 A;  1OXB A;  3VP9 A;  3EFO B;  2IXP A;  3KZI H;  4ZMD A;  4BJ6 A;  3PH0 A;  3W8I A;  3C18 A;  1J8Y F;  4ZNC A;  1R5I D;  3AED C;  3SZR A;  5APT A;  1Q0M A;  2HMZ A;  5APS A;  3T4R A;  3C8Z A;  5KYX A;  3POV A;  2NUP B;  3D71 A;  3H1I E;  5COG A;  1SQQ E;  2EPK X;  4JIO A;  1G8X A;  1Y4C A;  1FTS A;  2R7U A;  4LGD E;  3L75 G;  3W2W A;  3S4R A;  5A6J A;  1GU5 A;  2A1D D;  3S1K A;  2RD9 A;  4DJ9 A;  2YL1 A;  2YRF A;  3MHV A;  3ZTZ A;  3H1H E;  1L4A C;  2KYV A;  3M06 A;  3BRT B;  3S29 A;  4AE4 B;  5L0H A;  4MVQ A;  1SQX G;  4A2N B;  2ZT9 B;  3C8G B;  1OKK A;  1BSH A;  3EG9 B;  5JS5 A;  4C3D A;  1URQ D;  2W9Y A;  3O6Q A;  5B66 H;  4JEB A;  3L8J A;  3I5Q A;  2IBZ I;  2XXA A;  4MN4 C;  2JDI H;  1YLM A;  3SXM A;  3N4X A;  1NKZ B;  2QJP B;  1LPE A;  1NTZ E;  2WSE H;  2IDB A;  1FZC C;  2R7S A;  1Q81 Q;  3JZ0 A;  1UFB A;  1H9G A;  2JD3 A;  3UGP A;  2J9B A;  3CXH D;  5KJ7 C;  1FZA A;  1OXZ A;  2YKO A;  3PHL A;  4GOF A;  4IRU A;  2KXP B;  2C0W A;  3VM6 A;  2VAS A;  2M4E A;  1S9K E;  5JSL A;  2R05 A;  1SQX J;  4L74 A;  2Y3D A;  1EDL A;  1QLE C;  3LS0 A;  1IFN A;  3O10 A;  1TWG A;  3U1A A;  3Q3D A;  1CPR A;  4U3F G;  5BU5 A;  4YJW A;  4HH2 A;  3U9J A;  4IFF A;  1F1M A;  3DAF A;  3GOD A;  2RKL A;  1JTH B;  2CGE A;  3CCV P;  5E3C A;  3TNU A;  2LQG A;  1YBK A;  4JC7 A;  5CCH A;  4C7N B;  3R2P A;  2OEV A;  2L6G A;  2F22 A;  4CJG A;  1YJG A;  2CNW D;  1VDF A;  4KC9 A;  3WUV A;  3CL3 D;  4OGQ C;  4EIY A;  1DH3 A;  1SQB K;  4CIP A;  1LTJ C;  1KIL C;  4U3F J;  2VH3 A;  4LLE A;  1VOM A;  4PD4 D;  2PGD A;  5F28 E;  3TK0 A;  2LD6 A;  4EWC A;  5KLV K;  2GA1 A;  2EPL X;  3H1I D;  1S4X A;  3K1I C;  1SQQ D;  1S05 A;  2GWW A;  2E74 B;  2NPU A;  1T01 A;  2YMY A;  1H8A A;  1QX8 A;  2NSF A;  4YT8 A;  1OR3 A;  3RQE A;  5DJT B;  2P1A A;  1VYI A;  2W6B A;  3U5S A;  2WZ7 A;  1X8Y A;  1HY5 A;  3HTK B;  4FWV A;  2EPM X;  1SQP G;  2AEF A;  4C3E A;  5FCL A;  3AQC A;  2P67 A;  2OYH C;  2BL2 A;  4HE8 D;  2H8A A;  1J1D B;  1NU1 K;  1FZC A;  4I1O B;  4OD5 A;  2GUV A;  1XZP A;  4U9D A;  3KXD A;  4CSA C;  2IPP A;  5KJ7 A;  2ASR A;  2XS1 A;  1SQV K;  1NTZ D;  2G3K A;  2NUT B;  4E18 A;  1L0N D;  4WY4 B;  3X1O A;  1YYX A;  4MW8 A;  3HE4 B;  1RF1 B;  2IZ0 A;  2ZXR A;  4W8P A;  2H88 C;  3FX0 A;  3TYY A;  2LKM A;  4BJ5 A;  1SQP J;  2OYI A;  5AVV B;  3VTP C;  2KIK A;  3JRM O;  2KUB A;  1YTZ I;  3FGA D;  1OCR C;  2Q1K A;  1YA7 O;  5AC4 A;  3GHG B;  1GL2 C;  3CCL P;  1P84 E;  4EIJ A;  2OTL P;  2D4U A;  3TJ6 A;  4ZLC A;  3B8E B;  3MGN A;  3U2M A;  2BC5 A;  3AEA C;  5AVS B;  4JE9 A;  3PRJ A;  2VCA A;  3RBX A;  2KP8 A;  3QTH A;  4RES B;  4MVZ A;  1LTJ A;  1KIL A;  3GMA A;  1I5N A;  5APU A;  1VQ6 P;  2IXO A;  1CI6 B;  1AQT A;  2VC9 A;  1FZF A;  2XL6 A;  4GEH A;  5JUA A;  4ZLD A;  1OVV A;  1GZL A;  2J9W A;  1PGP A;  3KYQ A;  4K0D A;  3W8H A;  3PDM P;  3M4B A;  4MVU A;  2A6E F;  2G62 A;  5B1A C;  5APQ A;  3Q6N A;  4FES A;  2XLW A;  1M1J B;  5CCG D;  1IFD A;  1N8R Q;  1Q7Y Q;  1SFC D;  3G4S P;  5F5F A;  2JP3 A;  3QW1 A;  1GDT A;  4WVZ A;  5L3Q A;  3RK2 C;  2OYH A;  1RXQ A;  1PCX A;  2HV6 A;  1KQL A;  4WAB A;  4RKU J;  5C39 A;  5L0I A;  2ZT9 C;  1MUU A;  4LDR A;  2YL3 A;  3DJN B;  3JRT A;  2AEJ A;  2V3C C;  1E83 A;  2L6H A;  4L76 A;  4H0L B;  5L0J A;  1JPN A;  4PJ0 E;  3KPE A;  3E1I A;  2XLV A;  3RL0 D;  4N3Y B;  1VQ9 P;  4H13 D;  1QVG O;  1S2E A;  4M3L A;  3GWL A;  1SQX K;  2HZ8 A;  1RE3 C;  1HE9 A;  4AUW A;  4CDY A;  5TIS E;  1ZR2 A;  4QMA A;  1SS1 A;  5F5H A;  2R7R A;  1FBM A;  3RL0 g;  2XRH A;  3KH2 A;  1M57 C;  2GAQ A;  3KQG A;  2XM4 A;  1S5L E;  4KHX A;  1N7S B;  2LXC B;  1YQ3 C;  1FJK A;  5K5G B;  2FFD A;  4C7O A;  1K40 A;  1UII A;  4OD4 A;  1KN7 A;  4K1O A;  3ZDM A;  2EIN C;  3EZH A;  3A2A A;  1P84 D;  2IYO A;  3CWB D;  3N2Z B;  5KAF H;  2KS1 B;  1Q86 Q;  3H1I J;  1IK9 A;  1Y8A A;  3NFQ A;  3SFD C;  1SQQ J;  3UMI A;  2ZFC A;  1L0N G;  3VF0 A;  2OOC A;  1KV4 A;  4JTD B;  3CC4 P;  3H65 A;  4GOD A;  4EBB A;  1RKE A;  3ASN C;  2PP6 A;  2P10 A;  2Z4E A;  1ZVZ A;  3LNM B;  5AVT B;  1LP1 A;  4Q4Z F;  4CS7 A;  5KYX B;  5JVE A;  4I7Z B;  3Q7L A;  1YHQ P;  2E74 C;  1KFN A;  1L0L E;  3I5C A;  3Q5P A;  1EQ1 A;  1J2J B;  2H8P D;  4AE4 A;  1NTZ J;  1EKY A;  1YI2 P;  3FOO A;  4LER A;  3C8G A;  1GW3 A;  1L0N J;  3HTK C;  1LE4 A;  3O6X A;  1ZXG A;  3H1K E;  2N1T A;  3NG1 A;  2Q7R A;  2OU6 A;  1S7Z A;  4AYC A;  2A6H F;  1R4T A;  4WGZ A;  3AEG C;  3ZIB A;  1UIX A;  4UB6 E;  3T97 A;  1J1D C;  2YLI A;  1NAF A;  2QY9 A;  4IWB A;  1LM3 B;  4E0H A;  3OA7 A;  3O6Q B;  4C7R A;  2HOD B;  1ZYR F;  1RE3 A;  2XXA B;  4WY4 C;  3AE2 C;  1D1B A;  2Q9C A;  1SQP K;  2XM0 A;  3VYI A;  1RF1 C;  4O6Y A;  3GG2 A;  5KKZ B;  1EXJ A;  4J32 B;  1JAF A;  2HUJ A;  1VQL P;  4GYT A;  5AW3 B;  1NYH A;  2J7P A;  3F47 A;  1TWH A;  4KNV A;  3Q7G A;  2VB6 A;  2JWA A;  3L75 E;  1AJY A;  1ZHZ A;  5DS6 A;  2WSF J;  1MMN A;  1VB5 A;  3LLI A;  2B89 A;  2R5B A;  3QH9 A;  3A9C A;  2Q9I A;  2O01 J;  1J1E C;  1Y6D A;  1VL2 A;  2IYL D;  1I4Z A;  1RQV A;  1Q0D A;  3W68 A;  3TNU B;  4QI0 A;  3DD7 A;  2Q3I A;  1VQN P;  2FYN B;  1ZLL A;  1S1C X;  3EHN A;  4AQR D;  1K04 A;  1KB9 H;  5B1B C;  3B0U X;  1YYC A;  1IFI A;  4HB1 A;  3EFG A;  3NDB B;  1KB9 I;  4HKZ H;  4DOZ A;  2O1K A;  4RD9 A;  5DS5 A;  3EWK A;  1WAS A;  3TD7 A;  3EQL F;  1EDI A;  2HLO A;  1IFM A;  4KJM A;  1FNT c;  1L0L D;  1KQG B;  4XPW A;  4KNW A;  3PTZ A;  3CWB G;  2XLO A;  3LAY A;  4ZKU A;  2OG2 A;  1GK4 A;  3B5N D;  4JF7 A;  4U3F E;  1G2C A;  3G6E P;  2YMK A;  5T3T A;  4AX2 A;  1JRA A;  2AWY A;  2PFD A;  2C9N Y;  1LVK A;  3MIW A;  1E5W A;  1OVU A;  2WSF H;  4ASW A;  4PV1 C;  4Z9J A;  2WT7 A;  2A45 G;  2O01 H;  1LWU C;  3NRH A;  1OCO C;  4WY4 A;  2KLV A;  1T2K D;  4YT4 A;  4Z9H A;  1FR0 A;  3CEX A;  2J45 A;  1RHZ B;  4AL1 A;  1KMI Z;  3S90 A;  3CWB J;  2D2C D;  2I1J A;  1U7M A;  1VF5 D;  1X22 A;  1EZV E;  2E75 D;  2ZAE B;  1GTW A;  1TWC A;  4O79 A;  4R4L A;  5CIV A;  2HJ3 A;  4JYB A;  3SXK A;  1LIH A;  4EBJ A;  1T6Q A;  2LXB A;  1JEK A;  1FE6 A;  2Q9B A;  2DI3 A;  1N7S C;  4H0L D;  1PV3 A;  2OYI B;  3ZVR A;  4H44 D;  2QJY C;  2HG5 D;  5DQZ A;  4TT3 H;  1MZ9 A;  2V7Q J;  1JR8 A;  1QQ3 A;  2GFH A;  2MYS A;  5GTH H;  1SQQ K;  4N6H A;  3W67 A;  1FMV A;  1FAV A;  1N7L A;  1R5L A;  1JMM A;  3UNG C;  2TMV P;  1C02 A;  2KNH A;  2KI7 B;  3AG4 C;  4YL0 A;  4BWN A;  1FMW A;  2R7V A;  3TF5 A;  1VTM P;  1LTJ B;  3HNI A;  1KIL B;  1FFH A;  3H1J E;  2A68 F;  1RMV A;  3CC7 P;  3N0T A;  1JY2 P;  4OH8 B;  1M2O A;  5L0G A;  2HYN A;  1L2P A;  5JLI A;  4JVS A;  2QG4 A;  3IR9 A;  3RVZ A;  1NTZ K;  1IZN B;  4I7Z C;  2ZYA A;  1L0N K;  3VOP A;  2ZVO B;  2E5T A;  2CYD A;  2KK1 A;  4I44 A;  2IBF A;  5L0D A;  1RH5 B;  3VN0 A;  2V7Q H;  1LWU A;  3KHU A;  2JEE A;  5CMZ A;  4EOT A;  3QWO C;  1Q2N A;  4I6M C;  5AGF A;  3SSU A;  1MMD A;  4RO0 A;  2FYU G;  1M7L A;  2I1K A;  3CAX A;  1N73 B;  2NRG A;  3BVH A;  1NBB A;  3QVZ A;  4KI2 A;  1JY2 O;  5KYY A;  1EZV D;  3GWN A;  1CGO A;  1LI5 A;  3Q5R A;  1OKK D;  2KZI A;  2B0H A;  1KQF B;  1X79 B;  1KD1 Q;  1TU3 F;  1W2E A;  4WBA A;  1VQP P;  2XL8 A;  2FXM A;  1YQ4 C;  1FZE A;  3M0D A;  1BGY G;  2FFD B; 
#chains in the Genus database with same CATH homology
 3RQE A;  1KNY A;  1DD4 A;  3AJM A;  3GF3 A;  3D71 A;  3AE2 C;  4OGQ B;  1ZZP A;  2G8Y A;  3RK3 E;  1HJ0 A;  4H0L D;  2L6H A;  1PV3 A;  3LW5 J;  2HSB A;  1OMI A;  4H0L B;  4H44 D;  2QJY C;  1ZOY C;  4TT3 H;  3Q2Y A;  1EXJ A;  1IK7 A;  2V7Q J;  3JYY A;  2E76 D;  4KT0 J;  4H13 D;  3AEB C;  2FYN C;  2YWA A;  2MKV A;  2G3A A;  3C8V A;  1NYH A;  1KOR A;  3AE5 C;  2E74 D;  1MKM A;  2ZT9 B;  3C8G B;  4R32 A;  3TUL A;  1OW6 A;  4XEK A;  1AJY A;  3RL0 g;  3K7D A;  3O6Q A;  1DIP A;  4OGQ D;  2JO1 A;  2WSF J;  1FDI A;  4Z1M H;  4PV1 B;  3H25 A;  3L8J A;  1R8E A;  3G9R A;  2WSC J;  1YQ3 C;  3AE6 C;  2O01 J;  3R4Y A;  2JPU A;  3GM3 A;  2J5U A;  1K40 A;  1VL2 A;  1JB0 J;  2YIU C;  2H88 C;  2IDB A;  1RQV A;  4H44 C;  5KLI C;  3JZ0 A;  1UFB A;  1WTY A;  3Q5S A;  1Y9B A;  1DD3 A;  2NZ2 A;  3AE3 C;  4R4M A;  1S1C X;  2QIW A;  3FGA D;  1K04 A;  4YXD C;  5L8R J;  4XEV A;  2D2C C;  1VF5 C;  2E75 C;  2ZT9 D;  4YTP C;  3C8G D;  4I7Z C;  3SFD C;  3S9O A;  2WQY C;  1PIX A;  3ABV C;  3AEC C;  2JX0 A;  3GM2 A;  2Q00 A;  3O10 A;  1V4A A;  1EXI A;  3Q3D A;  4PV1 D;  2KK1 A;  1NGM B;  1WWP A;  3U0C A;  3EWK A;  3AEA C;  3BRJ A;  4XEF A;  3GLM A;  3T97 B;  4H0L C;  2WSE J;  1WMK A;  5KKZ C;  1GMJ A;  1FDO A;  3L8I A;  1WOL A;  2P10 A;  1KQG B;  4NQF A;  2QJK C;  3GMA A;  3D6Y A;  2FXP A;  2E76 C;  1Q90 D;  1OW8 A;  4H13 C;  2YMK A;  1KIL E;  2D2C B;  1VF5 B;  2E75 B;  1QVX A;  2PBE A;  4I7Z B;  4XFJ A;  3RQG A;  3AE4 C;  2L6G A;  2E74 C;  1OW7 A;  2WPV B;  4IL6 X;  1U57 A;  2K9Y A;  3Q5P A;  1ZME C;  3GM1 A;  2BEZ F;  3MFN A;  3Q1M A;  4PV1 C;  2H89 C;  4OGQ C;  4GDO A;  3D70 A;  1KTM A;  3C8G A;  1ZP0 C;  1PL5 A;  3SFE C;  2OQQ A;  2QJP C;  3AE1 C;  3B71 A;  2FBW C;  3AE7 C;  4H44 B;  1O3U A;  4U7J A;  2LK4 A;  5F28 E;  3RQF A;  2BEQ D;  3AEE C;  1S5L X;  3Q5R A;  1HF9 A;  2JP3 A;  3AEG C;  1UIX A;  3AE8 C;  1K05 A;  4EBK A;  2E76 B;  3D6Z A;  1RQU A;  4Y28 J;  3IN6 A;  1KQF B;  1KMI Z;  3IAO A;  3AEF C;  1ZRT E;  4H13 B;  5M1B A;  3U3F A;  2D2C D;  1TU3 F;  2QSI A;  1VF5 D;  2E75 D;  3C18 A;  3AE9 C;  3GF7 A;  4R4L A;  4RKU J;  2E74 B;  3AED C;  1YQ4 C;  2ZT9 C;  2L6F A;  1JOG A;  4EBJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...