3B71A

Cd4 endocytosis motif bound to the focal adhesion targeting (fat) domain of the focal adhesion kinase
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
134
structure length
134
Chain Sequence
NLDRSNDKVYENVTGLVKAVIEMSSKIQPAPPEEYVPMVKEVGLALRTLLATVDETIPLLPASTHREIEMAQKLLNSDLGELINKMKLAQQYVMTSLQQEYKKQMLTAAHALAVDAKNLLDVIDQARLKMLGQT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Focal adhesion kinase 1
publication title Structural basis for the interaction between focal adhesion kinase and CD4.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 56
structure length 134
sequence length 134
chains with identical sequence B, C
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2007-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03623 Focal_AT Focal adhesion targeting region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.540 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 3b71A01
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 3b71A02
3AEEC 3GM3A 3RQEA 2WQYC 2HSBA 3K7DA 3JYYA 3U0CA 3AECC 1OW7A 3SFEC 1PV3A 2FBWC 4NQFA 2JPUA 1UFBA 3MFNA 3AEBC 4XEVA 2G3AA 1ZZPA 3L8IA 4XEFA 2L6FA 3AE5C 1KNYA 1YQ3C 1YQ4C 2Q00A 2H88C 2LK4A 1WOLA 2KK1A 3AEGC 1WTYA 2PBEA 3GM1A 1ZOYC 2L6GA 3C8GD 1JOGA 2YWAA 3AJMA 1OW8A 3U3FA 3TULA 3S9OA 3GM2A 3ABVC 1OW6A 3AEAC 3O10A 3JZ0A 3L8JA 1K05A 3B71A 1V4AA 1WWPA 1K40A 3AE1C 3AE2C 1K04A 4EBJA 2H89C 3AE7C 1QVXA 3AEFC 1O3UA 4R32A 3C8GA 4YXDC 3AEDC 3RQFA 4XEKA 3AE8C 3AE3C 1ZP0C 3AE4C 5F28E 3AE6C 3C8GB 4EBKA 3SFDC 3AE9C 3RQGA 4YTPC 1KTMA 3C18A 2JX0A 2L6HA 3BRJA
chains in the Genus database with same CATH superfamily
4RKUJ 3L0IA 5B5EE 2YL1A 2WSCH 3GLMA 1JTHB 5L3VA 3MUDC 2NSFA 2KYVA 3JYYA 1Q7YQ 1I5NA 1U6HA 1Q0DA 2EPKX 3PDMP 2OTJP 3S1KA 1HH0A 3VAYA 2PX0A 2B87A 1SQXG 2KGOA 1A7DA 3Q5SA 1HBWA 1Q2NA 1AVOA 2CPBA 2R32A 2YLIA 1PIXA 1NFOA 2D5RB 4L74A 1RE3C 3BEHA 3MYIA 3U2MA 3L75J 1KNYA 3NDBB 4JCHA 3B0UX 3W4YA 3L71E 5D91A 5L0FA 2NG1A 2LCHA 2R5DA 3MZWB 3MHVA 4E0IA 1KB9I 4EOTA 4PFOA 3PH0A 1YITP 2RSEB 3LEVA 1FZCA 1S9KD 4J32B 4Q7CA 3DJUB 3FMSA 3LEOA 1FJKA 1KILB 1Q86Q 3AG1C 2Q9BA 1NU1K 1BDCA 3AEAC 2BCCD 2JJLA 1LE2A 1BR1A 1IJDB 2BEZF 3K1IA 1LT9A 5TJHA 3I5QA 1JR8A 1TFKB 1NTMD 4RESB 5APQA 5GTHH 5GPGB 3GEHA 2L91A 1SS1A 3CCRP 1R5SA 2E75D 1TQGA 1VK5A 2VRSA 4XA4A 5L0JA 1G8XA 3S0XA 2HFED 1V54C 3RGUA 2WT7A 4JC7A 3ZC4A 2DW3A 5M1BA 4BJTA 3L70E 3KZIE 1VQNP 4I1OB 4CIHA 2Y39A 3AE3C 1RH5B 2CYDA 1HGZA 4MVSA 2DYSC 4NTAA 3M79A 1OCRC 2Q9IA 4UB8E 1L0LE 3CXHD 2AWYA 2CNWD 5L0CA 4JQ0D 5KYYA 1FOSE 4EIJA 2HMQA 4YTPC 3G3ZA 3OWTA 1SQBD 1KN7A 1PPJG 2ZXXA 2H8PD 4N78D 1TKNA 2JX0A 1RQUA 1VQMP 3NMJA 3W2WA 2OJQA 3RK2B 2XDJA 4YN0B 4K35A 5DJUB 4MVMA 3CCUP 5IY5C 1CW5A 2MHRA 4WY4D 3D71A 2A6HF 5A6BD 1VOMA 3T4RA 5EHHA 2ITAA 2G3KA 2ZT9B 1KZUB 4DOZA 1GU5A 4YK5A 2XNDH 1OW7A 3HE4B 1ORYA 4PD4I 3JC22 2N1TD 4NY3A 4ZLCA 2Q1KA 2WWWA 1MMGA 1SYQA 5DJTB 2ZPAA 3B5ND 4OIRF 2CGEA 1GDTA 2Q7CA 5BU8B 1YDIA 3VMAA 5AVUB 3EJNA 4DJGA 4JTAB 2R5BA 1SR2A 3ITFA 3SWYA 4B86A 2AU5A 1N73C 3H65A 4PACA 2W6BA 2ZVNB 2LK4A 4M63A 2P67A 4WWIA 1C03A 3ZDLA 1Z56A 1E84A 3CLQA 1LVKA 3CD6P 5BQHA 1QKRA 3BVHA 1T6UA 5TISE 2XXAB 3ABVC 2WL8A 3WG7C 2L7AA 3CC4P 3RK3E 1S5LE 5L0GA 4D4NA 3O8ZA 3CMEP 4F4BA 4XE5B 3U8VA 1YJGA 2P1AA 2IYPA 2LFFA 2PRRA 4G7OF 2VASA 2KXPB 2XLDA 1FFHA 3HE5B 2LR2A 1G2CB 2KI7B 3H1JE 3G4XA 4DVYP 1H0TA 3QH9A 1SQQK 4NC3A 5COFA 2JWAA 5EFWB 3CCLP 1AA0A 1LNQA 1PGJA 3G4ZA 3NKDA 5JLIA 4YT8A 3K1HA 1ZP0C 2G8YA 2OG2A 1FMWA 2IZ0A 4EBBA 3L72J 1NGMB 1KTMA 1NU7D 4GIFA 2E75C 3ZWIA 1YYXA 4JF7A 2D2CB 3H32A 1FJPA 1VPCA 4PFPA 5E79E 4IGGA 1R5LA 2BCCG 1YTZI 2XKMA 3PLNA 3VMYA 1OKKA 4EHPA 3KQGA 1FBMA 2MYSA 5F5HA 4CDVA 1E2XA 4BJ5C 3M0AA 3TJ6A 3U0CA 3E1RA 3O6XA 1SQXE 1NTMG 3JSEO 1BE3J 3CC7P 3PP5A 5T3WA 3HTKB 2JR8A 3H1KD 1OQCA 3ZTZA 1USDA 2E43A 3QMKA 1WRGA 1GW3A 2JWDA 3GG2A 3ATPA 3CWBE 1DOWA 2YZSA 1KQLA 3DE9A 5KLVD 4IARA 5KJ7D 2DI3A 1AUEA 2L6FA 3EFFK 3AE5C 1SFCA 1JY2N 2IX7C 1YYCA 3VMXA 1S3JA 5BQGA 1ZU5A 2ZJSE 1MMDA 3MD0A 2N1TC 4RJTA 3Q5PA 1SQBG 3D6YA 4ZMDA 1HUCA 2CW0F 4N3YB 3E70C 4L75A 1VF5D 3VYWA 5BVZA 3B5NC 2GFHA 5CHXA 1LIHA 1TFOB 4MS2A 1YIJP 4JJGA 2FGYA 3H2UA 4GEHA 2WVQA 3UMHA 3LESA 1JMMA 2XLWA 2G3VA 4J7YA 4CX9A 3VRCA 2OYHA 2P1JA 2YLGA 1M57C 4JPZB 1DEBA 4MVQA 5L0DA 1HE9A 1M2VB 1LGHB 1GK4A 2Y69C 5KYXA 3AG3C 2C0XA 3GWNA 3SP1A 1E5WA 4W8KA 1SQPE 1BGYE 3EHNA 2HPCB 2R03A 3V4WA 5KYWA 3KZIH 4U9EA 2GA0A 1RKEB 1YZCA 1PPJE 4EBKA 3SFDC 3F46A 1Y4CA 4UB8H 4B6IA 1KYOE 3HD7C 1T6IA 4MW8A 5KLIC 4CPGA 3LUTB 5APYA 2B0JA 5KYNA 3N0TA 3V2RA 1VQPP 1IC2A 4BEJA 3BRJA 4Z9JA 1ZMEC 2J58A 1PZQA 3DJNB 4PJNA 2WSCJ 4PK4A 2WPVB 4Z1MH 1RJ9B 2HJ3A 2KW3C 4C46A 1H6GA 3IN6A 3A0HH 2HMZA 4OD5A 2X51A 2EIMC 4I44A 4OVNF 1L4AB 4KBLA 2WZGA 2JKVA 2W83C 4UDVA 2P2UA 2FYUK 3IHUA 5A69A 4QI2A 3KDPB 1IFMA 4PV1B 2ICWG 2RMZA 3CX5D 4JYBA 3TQOA 1R4TA 2ZXOA 2W8ZA 4XEVA 3QW1A 1OXKA 1VLTA 1ZYRF 2KNCA 2FKWB 1A02J 4JBZA 2R05A 5JT4A 3HD7B 1IK7A 1LTGC 5APUA 1G1IA 2P7VA 4E0HA 3M0DC 4JTDB 1K73Q 3O55A 3GHGA 1L7CA 5KYUB 3T97B 1SF8A 2YEVA 4PR9A 3X2QC 5JUAA 3FGAD 1DIPA 4YL1A 5TISH 2YHSA 1L2PA 3O10A 1K8AQ 2K9JA 4WBAA 2HG5D 4NPEA 2YIUC 2HFIA 3W67A 1NTMJ 1WWPA 3EGXA 2CDQA 4I7ZC 3MLGA 3EQLF 1FZGA 4MVRA 2OARA 2ZXWC 4KJMA 1FZEA 3H1KG 4JRZA 5AW3B 2NUTB 1O3UA 2B89A 1J2JB 1VF5C 2R7RA 3ITKA 4CS9A 1NTZE 2KSJA 3K66A 4JYCA 2HODA 3V6IA 5KLVG 2WITA 3JCUE 1NHLA 5FZTA 3SWKA 3FDQA 2OYIA 3LNMB 1S9KE 4C7RA 1ZW0A 3H1ID 3C8GB 4KHXA 2Y9ZA 3AE9C 1LWUA 3CCVP 2FFDA 3QVZA 3CCEP 3SZRA 2ZYAA 3A0BE 3HRNA 5CI8A 3N4XA 1RKCA 1SZIA 4U5FE 5KKZC 2BCCE 1EDLA 4PJMA 4YL0A 3A2AA 1HMDA 2WSEH 3LLIA 1LKXA 1GL2A 2XM0A 4HEAJ 2VC9A 3AEEC 1YYJA 5CCGA 5E79H 4I7ZB 1Z63A 4LLCA 3H1LE 1KILD 2WQYC 2J8WA 1NU1D 2AEJA 3JCUQ 2Q4FA 3QW0A 2RH0A 4DBRA 3K5BA 4U3FE 1FOSF 4RBNA 4W8PA 4HJGH 5EK0A 1D1CA 4AE4A 3FX0A 4NQFA 5AVSB 1RCPA 1EDJA 2HLOA 3BATA 4H4KC 4NCQA 2QTVA 4FX5A 2J59M 3K1IC 4GQHA 2KIKA 5APTA 1T6QA 2QEXP 3KKBA 2B87B 3L73D 1YVIA 4LLHA 4BG0A 1AVOB 3FWNA 3KHUA 1SQBE 2ZYGA 3GMAA 5JP7A 5KKZB 4E7ZA 3GM1A 1WT6A 1ZOYC 5DQTA 3WUVA 1E83A 4CIPA 1EDKA 3WU2E 2VCBA 3TNUA 2IPPA 1EI7A 1KORA 2IBZD 3BCCJ 1CGME 3F47A 1Q0KA 1P84D 1FZCB 1VQ7P 3RK2D 3N7NA 2R3SA 2OQMA 2A06E 4BRYB 3DMDA 3OEOA 1L0LK 1H9TA 2KLUA 1NTKE 5AW4B 1URQA 2XSEA 2XV5A 4O79A 1C02A 3DAGA 2Z15A 2ZT9D 1MUUA 1LT9B 5AC4A 3VYIA 4YPCA 1L0NE 4N06A 4M3LA 2W45A 2A1DD 1ZHYA 1VQ4P 5CIVA 2IFMA 5DVWA 4NPFX 4RDAA 3RQFA 2MKVA 2WB7A 2C03A 1MQVA 5E2QA 1JCDA 2YRFA 1YTZT 3MIWA 3RQGA 3TGUD 4O7GA 1BDJB 1QPUA 1C17M 2A0UA 1T9KA 2R9RB 1PGOA 4O6NA 1G5ZA 3JT1A 2NSGA 3WMM0 3C8ZA 2ASRA 4G78A 3V2NA 2L6HA 3DE8A 2R7OA 4IRUA 1M1JA 5AVQB 5KYYB 2M64A 1M90Q 4H54A 1YJWP 5APSA 5DS6A 2OTLP 1DX7A 1O87A 3I5CA 4PJ0E 2E76C 2HZ8A 1Q81Q 2W4BA 2J9WA 4W7ZA 1SLQA 3W8HA 1BCCD 2DB4A 3GEIA 2NPSA 2H7BA 3S29A 1GGQA 4C3DA 1N7SA 5KAFE 3GF7A 4R4MA 3U8PA 5KLVJ 1H7IA 2PF4E 5AW2B 4WGYA 5AVYB 1SQQD 1KILC 3PRJA 1RE4A 1IO4A 2J7PA 1GM5A 1JRAA 2OTKE 1NZEA 3H1IG 2VH3A 2VCCA 5CI9A 2KZJA 1HW2A 2KSEA 5AW5B 1UIXA 3PTZA 3RL0g 2E76B 1H89A 4GYTA 1FDOA 2P58A 1W5CE 4XLPF 4BJ6A 2FAPB 3IQCA 4MTGA 2D2CD 3HUSA 1EZVG 1KYOI 2POHA 1NU1G 4HB1A 3ZG1A 1D0XA 3H1KE 1USEA 3AE2C 3EZHA 3EGDA 1QQ3A 4EBJA 1PP9E 1OMIA 3H1HE 5CBOA 2WTYA 3AQCA 1JAFA 3L72G 4DOJA 1EQ1A 3H2VA 1NJIQ 4K0DA 5KLVE 3OA1A 2KB7P 2QY9A 2JO1A 3NYLA 2Q3EA 3KYQA 1NH4A 4PD4H 4C7NA 4HFFB 3B8EB 4PD4D 1UG7A 1YBKA 1HWTC 4YT2A 1EKYA 1JY2P 1X8YA 5CBNA 2LD6A 3LNRA 1RMVA 3RK2C 3L73G 3AG4C 1H0TB 4JJFA 3CL3D 2ZYDA 1TWCA 3DXJF 1KC8Q 3Q6MA 1JOCA 1BE3G 4XLNF 3A0BH 2J5UA 2A45G 2ZT9C 3TYYA 3S84A 1HTLC 2WZFA 4KC9A 3S28A 1VMAA 2Q3IA 1SFCC 2Q6QA 3VMZA 3L75E 2IBZG 2V3CC 1N1CA 1BSNA 1ZVZA 1LT1A 1J1DC 1AQTA 1HJ0A 3Q2YA 2MJZA 3H32B 3P32A 1CGNA 4RD9A 4IL6H 1PV3A 4XFJA 3L35A 3RYLA 2LIGA 2OCCC 2Z5HA 2OJED 3L74D 3AGUA 3NMIA 2HSQA 1UIIA 1EXIA 4QI0A 4LC1A 1OX3A 4O6YA 2ZD9A 3DKAA 3K6BA 3EG9A 2I15A 2J0XA 1VQ8P 4ZKUA 2C9LY 4ASVA 1X22A 3VOPA 1LTJA 1RF1A 1N86A 5TJ5E 1CGOA 2C0WA 1MNEA 2WPSA 1U89A 4BXLA 4XPYA 1WTYA 2L6GA 2HYNA 1SFCB 1J1EC 4O9BA 3HNKA 2QNLA 1NG1A 4C3EA 4I6MC 4UB6E 1SQVK 4JCZA 3S9OA 1OR2A 1J1DB 2QJYC 2YL0A 1SQPK 1GU4A 2L5GB 1HJBA 1K05A 5AVXB 4CSAC 2UUHA 4OINF 1U7JA 2OEXA 1BCCG 1M57D 1T8ZA 4YJWA 3NTNA 3EQ2A 3TOMA 1S4XA 1OCOC 1L4AD 4JVSA 2FYZA 2FYNB 3M9BA 5B66H 4EDFA 3HKKA 1T2KC 2FYUD 1OVVA 3NYMA 3ZSUA 2YXRB 1RF0C 1YJNP 3AEDC 2OYHB 4PV1D 3BCCD 4NPDA 2D2CC 1SQQG 3AE4C 1PD0A 3MTUE 2V26A 5KYXB 3H1IJ 3AE6C 1J1EB 2KUBA 2ZXEB 1CI6A 2M5AA 5CCHA 2M3BA 2QE7H 3HD7D 2QJYB 1NKZB 2R02A 5KYWB 2Q9AA 3VP9A 3V5XA 3B0VC 2OGUA 2HR3A 4ANJA 3HTKC 5E3AA 1KQGB 1OR3A 3DD7A 1JMWA 3P7KA 4P9FA 1J8MF 1NU1J 5AVVB 2K37A 4CJGA 3R7CA 1M8OB 3IR9A 4PJ0H 5K5GB 3EH1A 3A9CA 3C62A 2E5TA 3KPHA 3GHGC 1IFIA 2R7WA 3NRHA 3F5HA 2E74C 4H0LB 5H2FH 2A0BA 3GORA 3NKEA 1CZQA 2AEMA 4XEFA 3L73J 4IFDK 3H1IE 5B5EH 1ZHZA 2XL4A 1N8RQ 3TSIA 2JP3A 1J8YF 4JEAA 3NG1A 3Q6NA 5B3SC 2KC3A 1MMAA 1OCCC 2XZRA 1FAVA 3EFGA 2YO2A 3C8GD 3DWWA 3TJ5A 5APXA 2KNCB 2H7VC 4CS9C 3HLZA 1A0BA 2I1JA 1ZW2A 4GKGA 1EZVE 2AXTE 1JY3O 1NTZK 1OW6A 3G71P 4MVZA 2O1KA 2K3RA 3S4RA 1GTWA 1KFNA 1M6TA 4ULVA 2OYIC 5L3QA 2P7JA 3GHGB 1LTIC 1D0YA 1NKNA 2OYOA 4H13C 1V4AA 2O01H 2NPUA 2R7VA 3L72E 4IL6X 2E74B 1ZHTA 2WZLA 4Y99C 3FWLA 2K9JB 4JTCB 1GL2C 3AEFC 3WODF 5CJ4A 3EGXB 5CCGC 2GDCA 3L74G 1Z23A 1SQVJ 4OWFA 2O01N 4ASWA 4IJJA 2FXOA 4EKWA 5AVZB 3EFOA 2LXBA 2WMMA 1BE3E 2PNOA 4ER9A 2YKZA 3HNIA 1OXZA 2YNYA 4DZOA 3TGUJ 1GMJA 3AG2C 2HODB 4AL1A 4Z9HA 3IQTA 1MNDA 2QJPC 1A7VA 1TU3F 1L4AC 1Q0FA 1P84E 2OYIB 2Q7RA 3CQZA 4GDOA 2J0WA 1JPNA 1LWUB 4H13B 2FFDB 4I3MA 3C8VA 4PV1C 1M56D 2NRGA 4DRHB 3K7DA 4Y99B 4Y28J 2N9BA 3WAQA 4U5CE 2V7QH 3L36A 1IFNA 4DT0A 1BCCJ 1GL2B 2I1KA 4BWNA 1M1KQ 2HUJA 3LIDA 1ZRTD 1D7MA 3OW2O 1L0LD 2FXMA 5HV9A 4CS8C 1LTSC 2A68F 4C3BA 4CJOA 2R7XA 2Y3HA 4IAOA 2BC5A 2CPSA 2FYUG 2XLVA 3A5TA 3L8IA 4AE4B 5DS4A 1SQQJ 4ZNCA 1VLSA 3BCCG 4I2LC 3JSVC 1NTKK 2K88A 3RW0A 2XS8A 1MKMA 2W4MA 2QJPB 3SEOA 1N73A 3LLKA 4MVOA 3GANA 2LP4A 1KB9E 3L37A 4GOFA 2R7QA 1L0NK 2GUVA 4K3AA 2P61A 2V4HA 1VB5A 1XZQA 2L9JA 4CBEA 256BA 3M4CA 3E1IA 2XLMA 1Y47A 1SVFA 1VL2A 1W2EA 2AP3A 3TNUB 1BCCE 2P6VA 2XL8A 4DRIB 1K40A 1VQKP 5BQIA 3AOUA 1RXQA 3VM6A 4DCKA 3ZVRA 4RO0A 2GM4A 1M1JC 3RKOF 3KH2A 3LW5H 1URQB 1GW4A 3VTPC 5AGFA 3E7KA 5COMA 2HV7A 4XEKA 1S5LH 2NPSC 1NAFA 2RKLA 1N7SC 3TOLA 1G4WR 2DGJA 2TMVP 3EPVA 3C18A 4AQRD 3V7OA 4WVZA 1VDFA 3H1JD 4U5HA 4OIPF 1AVYA 3U9MA 2UWJE 1RE4C 2YL7A 3RQEA 2EINC 1YJ9P 3OJAB 3SSUA 4MTOA 2E76D 1FR0A 3V2PA 2H8AA 1M1JB 2YKOA 4BJ5A 2YO3A 1XTCC 3BRVB 3T6BA 3GEEA 1NYHA 2CNWA 3SXKA 3CCSP 3JYHA 3L74J 1A7EA 3M15A 5AW0B 4G7HF 1E85A 2NPSB 1ZZPA 1NTME 1QGKB 1JO5A 1M56C 1N7SB 5A6KA 2Q00A 3HNJA 1FZCC 2B9BA 4WY4A 3RL0C 2CCYA 5A6BA 3TK1A 1NWQA 1BDDA 2N1TA 4MW3A 1GQAA 3I5PA 2KZIA 4EWCA 4OIOF 3GM2A 1RQVA 3CWBD 1V74B 5AW6B 1LT9C 1VQ5P 3B5NA 3L8JA 3L1MA 4Q4ZF 2AEFA 1GZLA 4HFKB 4HH2A 1VQ6P 4FESA 4DRJB 5AW7B 3CXHE 3C9IA 1QVFO 2J9VA 3UIAA 5AW1B 1PGQA 4G0HA 2GAQA 3A3YB 4N78E 1NLXA 2H89C 4K7BA 1L0LG 2A6EF 1TWGA 2Z4EA 2Q9CA 1D1BA 4R32A 4DXWA 2D4UA 3RVYA 3IPMO 3PMRA 4IFMA 2FYUJ 1OKKD 3EGDB 1EQ7A 4I1MA 4H44C 3ZIBA 3ABLC 3KYJA 3W8IA 5A6AA 3RL0B 4MTFA 2YMKA 1FFTC 3O6QA 1QX8A 3GODA 2WVNA 2R44A 2J9UA 4C7NB 2R7UA 1QLEC 4ZKPA 3ABMC 1D0ZA 1LE4A 5AVRB 4PJLA 1TWAA 1WMKA 3P8CD 4J7TA 3TDKA 5JRAA 3Q3DA 1QSPA 1SFCD 1APCA 2IZ1A 2Q3TA 4LDKA 2XL6A 2QE9A 1SQVD 1ORJA 2MWQA 3RK3C 1SQPD 3T97A 5AW8B 1BGYD 4K1OA 5GTIE 3Q7LA 5F5FA 4XPXA 2M3EA 3G4SP 2WT7B 4U5GA 1YI2P 3KPEA 4U7JA 4EYYQ 2W90A 1O5HA 5DQZA 1LP1A 1KYOH 1KU2A 3MX3A 4LACB 1YLMA 1KYOD 4H44B 3WHNA 2JPUA 4D6TJ 1AEPA 1UFBA 3C7JA 3BCCE 3CCMP 3IQ5A 3M4BA 3AGTA 5AVTB 3W2VA 2PFDA 1S5LX 3RFYA 3QWOC 4MNDA 2NUPA 3NYJA 2Y9YA 3NXSA 3D6ZA 4C7OA 1A41A 2HKVA 2P0NA 2KK1A 1IFJA 2AWCA 2KOGA 5JVEA 3EG9B 2KS1A 1M2OA 3M9QA 1JOGA 2YWAA 4A2NB 1LPEA 1LTJB 1SP4A 3M0DA 1RF1B 3DM9B 3VN0A 2X0CA 3CCQP 5L0IA 3H1JG 3N24A 3ZTMA 3VP8A 3RK3B 1JY3N 1ZLLA 5E33A 1HY5A 2XRHA 1LI7A 3MYFA 3I55P 2W9YA 2VB6A 4U5DE 5KJ7A 1G1JA 2O01J 3L71J 3C1LA 1K04A 4A4AA 1ZV8A 1W2WA 4N6CA 2XLEA 2BASA 3LJBA 3F89A 3L4FA 1D1AA 5DS5A 1EA8A 1QEXA 2JD3A 1OVUA 4GOEA 1T2KD 3LIEA 4WABA 3X1OA 4H0LD 4U5EE 3JRMO 1S05A 2IFNA 2EPLX 4MQ9F 3R4YA 1LI5A 4AYCA 4IOIH 1OXBA 2OOCA 1S1CX 3B9QA 3V2QA 1ZR2A 1LM3B 4YWQA 1S72P 1FAPB 4O6MA 4E18A 3GF3A 1JM0A 1CI6B 2M5AB 2W27A 3USSA 4WB4A 3CWBG 5T1DB 1DD4A 5D92A 1NTZD 3L70J 1VQLP 2C04A 3M1CB 2XU6A 1SQXK 3JCUH 1Q0MA 1MFTA 2V7QJ 3TF5A 1BR4A 3MBGA 3WUTA 1KQSO 2FBWC 1L0LJ 3US6A 3SYNA 2WPQA 2E74D 4BRYA 2HJMA 5T3TA 4MVUA 4Z9IA 3FXDA 3VF0A 4YXWH 3U2LA 1KQFB 4W80A 3AEBC 3ZQYA 1K9MQ 3T6GB 2XLOA 3IFMA 3OAKA 1F1MA 1JCCA 5KTBA 2P10A 3H1LD 2H88C 3KYIA 3NFQA 1PD1A 2B88A 2QRXA 1KFMA 5K0IA 3AEGC 2OQQA 4U3FD 1HGVA 5E3CA 4BEMJ 2M4EA 2EPOA 2WSSH 2QVAA 2H7OA 2YQYA 4OD4A 2M0BA 3FVYA 4U9DA 4NTFA 1HW1A 1AV1A 1QL2A 4JW1A 1U0BB 1HMOA 4MN4C 2FYNC 3FAPB 1SQVG 3R2PA 1ZRTE 4H13D 1SQPG 3CXHH 1BGYG 2IXMA 2OYHC 4CDYA 2C9NY 2Y0CA 1DEEG 1OCZC 3TGUG 1JEKA 4X0RA 1BZ4A 1GL2D 1QVXA 1XTGB 2HS5A 2RN0A 2IYOA 4AL0A 3WU2H 2Z5IA 5CCGD 2CK3H 2PGDA 3LW5J 1FC2C 3PHF2 3SNHA 2Q5UA 2YVKA 3A0HE 3FOPA 2OEVA 1Y6DA 4GT1A 4DVZA 1QVGO 2KK7A 3RVZA 2FFHA 5CJ0A 5F28E 2A06D 2RD9A 5KAIE 4IWBA 1NTKD 1Q0GA 1W2BO 1BSHA 1XWJA 5B1AC 1PGPA 1YA7O 1JTHA 3CX5E 2GWWA 3EFOB 3V4QA 3G50A 4IAQA 3H1JJ 3RF3A 3T6JA 4P9TA 2KYHA 1ST6A 4H0LC 3CEXA 1L0ND 1IFDA 3U1CA 1TWHA 5AVWB 3DI5A 3LS1A 5GTIH 3SFEC 5A6JA 1NFNA 1YARO 1PCXA 1IFPA 1MV8A 2EPNA 4JZAA 3CCJP 1TR2A 4E7SA 1IW7F 1XZPA 1EDIA 1KD1Q 3JTLO 1IK9A 4XQ1A 2WVOA 4HKZH 3CXHI 2WSEJ 2ZXPA 1ZHWA 2O1JA 2JDIH 3B29A 1A02F 1NO4A 3PJSK 1URQD 1CPRA 1WASA 3UMIA 3GW6A 1JMBA 1KILA 3MUDA 4CDAA 1SQXJ 1OZHA 1VYIA 2QUPA 1KMIZ 1X79B 1Z6AA 2YLDA 1FZAA 4FWVA 3AJMA 4JE9A 2QJKC 1S2EA 5KAFH 4D6TD 1KV4A 3FXHA 3CWBJ 4WJ0A 2PAJA 1N73B 3EH2A 3LAYA 2AVKA 3JSZA 1Z3IX 1RE3A 1NTZG 1FE6A 1VYKA 1WN0A 1WGWA 4XWJA 1VQOP 3AE1C 3EWKA 2N9YB 2YMYA 1JUNA 1NSGB 3SXYA 4ONSA 3CAXA 1LTAC 1E86A 2LKMA 3G6EP 1NAYA 4W7YA 3TD7A 3Q1MA 4YT5A 3U9JA 2K1AA 1FMVA 1VTMP 4YXDC 1KILE 3ASOC 1NU1E 2QG4A 2YXQB 2WSFH 2EIJC 3J06A 2JEEA 3AE8C 2J46A 2NPSD 1LWUC 2FFDC 1ZXGA 3H1LG 2VCAA 3L71D 3ABKC 4E17A 1H88A 1N7SD 3UR3C 2QJKB 5DLJA 4YT4A 3U59A 1MFZA 5B3IA 2KSFA 4U3FG 3E9VA 4LDRA 1PFIA 2G62A 1PP9D 3H1HD 4L76A 4OGQD 4AX2A 2YKPA 4KNVA 1WATA 3FOOA 1N2DC 3HE4A 3L73E 1JNMA 1FTSA 4PJJA 2QM7A 1NTMK 4AUWA 1SMYF 1B68A 2J7PD 1LTTC 2ZVOB 1CPQA 4WY4C 1SQPJ 2PP4A 1BGYJ 2K9YA 3NMKA 1OIPA 2E75B 2IDBA 2BE5F 2IXOA 2PX3A 3O39A 3S27A 1RHZB 3DZAA 2IBZE 1BR2A 1Z7Qc 3K33A 1QZXA 2J9BA 1FDIA 1FDMA 2Y3DA 4JEBA 2SPZA 2QSIA 3SWFA 3L75D 3IQ6A 1T01A 2XM4A 2PP6A 4Q5SF 1YQ4C 2EILC 3L70D 4N6JA 4AK9A 1SQBK 3NMDA 2XXAA 3EZIA 1IZNB 2A06G 3RL0D 1VQ9P 3CC2P 3P8CE 4L6RA 3HJCA 2IBFA 1NTKG 4QMAA 1AQ5A 3ZQVA 2XNXA 3WUUA 3QVYA 2XLHA 3U3FA 2LXCB 1SQVE 1FS0E 4WY4B 1EXJA 1V55C 2BL2A 3JZ0A 3HE5A 1L0NG 3IEEA 3KXDA 1G2CA 4EIYA 3B71A 1YAUO 3DM5A 2N1TB 1URQC 5APVA 4JIOA 5EGYA 4ZLDA 3TGUE 4CSAA 1X0TA 2QA4P 2GUSA 3FAJA 4XTKA 2XS1A 2YKQA 3B5NB 4A7PA 3RBZA 3AE7C 5L8RJ 1MMNA 1FNTc 3B4SA 1L3PA 2ZFCA 2FXPA 1FZFA 2KNHA 3MGNA 3CMAP 4CS7A 4UB6H 1X9VA 3MP7B 2I8BA 4H44D 3U3BA 2Y3BA 3T9OA 1RF0A 3OA7A 1I4ZA 2E87A 4GODA 3QZCA 2BEQD 3II6A 2QM8A 4JKVA 1QLED 4G7ZF 5KAIH 2WPRA 3UGOA 4BJ1A 1FZBA 3CX5H 3L34A 2NZ2A 3JRTA 3O6QB 2IM8A 3ECSA 2B0HA 4P6IC 1JY3P 5JSLA 1FU1A 1OWAA 4D6TG 1SQQE 1NBBA 3GM3A 3HTKA 3UNGC 4HE8D 1NTZJ 1ZN5A 2GA1A 2IOQA 3RK3D 1YA9A 5KLIB 3U5SA 1PL5A 3AECC 1G4US 3UGPA 2KJGA 4BPMA 1Q90D 4EUKB 2KLVA 2WVRA 2QIWA 1ZHXA 1CSBA 1AFOA 5JS5A 4DJ9A 3QTHA 3CPWO 4OGQC 4XPWA 3I56P 2QLAA 2BCCJ 3CI9A 1NOHA 4KT0J 3W68A 5FCLA 2H7HA 1R5ID 5HSWA 5KJ7C 1LP1B 2WZ7A 3H1LJ 1AJYA 3FHDA 1R8EA 3H6PA 2DYRC 3G9RA 1YZAA 4LLEA 2O3JA 3L71G 3U1AA 4U3FJ 3FXEA 2R7TA 2NUPB 1LS4A 3GWLA 4IB4A 1PP9G 3H1HG 1OW8A 4PD4E 3N2ZB 5APWA 3CZ6A 4BJ6C 4C7OB 3RBXA 3ZDMA 1Y9BA 3HUSC 2ZXRA 2IXNA 3UMKA 4DBQA 3H25A 3M9HA 2KS1B 3KL4A 1Q82Q 2HV6A 5C39A 1H8AA 1M2VA 5CCHD 5GTHE 4YL3A 3CX5I 3BASA 4N6HA 3C63A 1S7ZA 1SQBJ 4OGQB 1SQXD 1YHQP 2HPCA 1MZ9A 2ETSA 5B1BC 2OKUA 2FY8A 5KLVK 1ORSC 1RKEA 2EPMX 1GK6A 2YIUB 1EC5A 2H43A 4IFFA 2AXTH 3POVA 1DD3A 2O9XA 1EZVD 1GS9A 4R4LA 5BUOA 3PCVA 2M8RA 3RH3A 4D4XA 3L75G 5COGA 4IL6E 3L70G 4TLFA 3A11A 1NTKJ 4WGZA 5CMZA 1IZMA 3L72D 1VF5B 3HUSB 3L74E 1RJ9A 3I4UA 4OIQF 1OFCX 1Z5ZA 3EHMA 1L0NJ 1L4AA 1NVOA 4U5BE 2A69F 5BU5A 2KQ9A 2HSBA 1OVRA 4KNWA 1H9GA 1BE3D 3V5BA 2E42A 4ULWA 2A45H 2R3CA 3M91A 4N4WA 4TT3H 3ASNC 3S90A 1T3UA 1HF9A 3D70A 3KMIA 1DH3A 1Y8AA 3HD7A 3IF4A 3P8MC 3MFNA 4LGDE 4CS8A 2LSEA 1P84H 1ZU4A 4J30B 4HYTB 2G3AA 1QL1A 1JY2O 3V5ZA 2W6AA 1LTJC 5AW9B 1RF1C 1GD2E 1YQ3C 2W6JH 5KYUA 4I1LA 1RY3A 1WOLA 2LQGA 2UUIA 3Q7GA 4LERA 2R7SA 2PBEA 1EZVI 5AC5A 1PPJD 1E79H 1HVVA 5B66E 2FYUE 1JPJA 3TULA 3A7OA 4QDLA 4FAPB 3SXZA 1T5OA 3M06A 2EIKC 3PHLA 1T3JA 2Y3GA 2NUTA 1U7MA 4EI2A 1N7LA 1HE1A 2I8DA 1ZW3A 2AXCA 3Q5RA 3DAFA 2Y0DA 3B0PA 1DOVA 2PFXA 2R25A 2F22A 3TK0A 5L0HA 2E5YA 2OU6A 1KB9H 1KB9D 3C8GA 1I4YA 3LS0A 2IYLD 2WSFJ 4JURI 1LTBC 2A45I 3IAOA 2J45A 1ZR4A 1JB0J 3AQBA 4NTBA 2YL3A 4KI2A 1BBHA 2L81A 1T6AA 4OH8B 5CCHC 3BRTB 2IBZI 3CSKA 3RIPA 2IXPA 1M7LA 1U57A 3H1KJ 4L73A 2LFDA 1P84I 2ZAEB 3SXMA 1NU9C 5H2FE 3HNLA 2Y0EA 1PP9J 4D6TE 3H1HJ 3V5YA 1LJ2A 2KP8A 1LS1A 4LDQA
chains in the Genus database with same CATH topology
4RKUJ 3AEEC 4H0LC 4H13B 3GM3A 2WSCJ 3C8VA 4I7ZB 3RQEA 1DD4A 4PV1C 2WPVB 3GLMA 4Z1MH 2WQYC 3D71A 1HJ0A 2E76C 2E76D 2K9YA 3IN6A 2HSBA 3K7DA 3JYYA 3Q2YA 4Y28J 2E75B 2IDBA 1PL5A 3AECC 3U0CA 2V7QJ 2ZT9B 1OW7A 3SFEC 1Q90D 1PV3A 2FBWC 2QIWA 4U7JA 4TT3H 4XFJA 4NQFA 1HF9A 2E74C 1NYHA 2E74D 4H0LB 3D70A 4H44B 3GF7A 3Q5SA 4R4MA 2JPUA 4PV1B 1UFBA 1KQFB 4OGQC 1FDIA 3MFNA 3AEBC 1EXIA 2WSEJ 4KT0J 1PIXA 4XEVA 2G3AA 2QSIA 1ZZPA 3L8IA 4XEFA 2L6FA 3AE5C 1S5LX 1KNYA 1YQ3C 1AJYA 1YQ4C 2JP3A 2Q00A 2P10A 1R8EA 2H88C 1IK7A 3D6ZA 1MKMA 2LK4A 3GMAA 3G9RA 1WOLA 2KK1A 3AEGC 2OQQA 1KMIZ 1WTYA 1ZOYC 2L6GA 2PBEA 3GM1A 3Q5PA 3C8GD 1JOGA 3D6YA 2YWAA 3AJMA 3T97B 2QJKC 1OW8A 3U3FA 3TULA 3FGAD 1DIPA 3S9OA 1VF5D 3GM2A 1UIXA 3ABVC 1KORA 2QJYC 1Y9BA 1OW6A 1RQVA 2E76B 3AEAC 3RL0g 1EXJA 1FDOA 3H25A 3RK3E 3O10A 3JZ0A 1VL2A 2D2CD 3L8JA 1K05A 2FYNC 2BEZF 3B71A 2YIUC 1ZRTE 4H13C 4H13D 2O01J 1V4AA 1WWPA 1K40A 4I7ZC 4IL6X 2E74B 3AE1C 3AE2C 3EWKA 1K04A 4EBJA 1OMIA 4OGQB 2E75D 2H89C 3Q5RA 2ZT9D 3AE7C 5L8RJ 3AEFC 1QVXA 1O3UA 4R32A 3Q1MA 2FXPA 3LW5J 2JO1A 3C8GA 1VF5C 4H0LD 4YXDC 1KILE 3AEDC 1DD3A 4H44C 4H44D 2WSFJ 4R4LA 4PV1D 5M1BA 3R4YA 3IAOA 3RQFA 1JB0J 2D2CC 2MKVA 4XEKA 3AE8C 2YMKA 3AE3C 1ZP0C 2G8YA 3AE4C 3O6QA 5F28E 1S1CX 3AE6C 3C8GB 2BEQD 4EBKA 3SFDC 3AE9C 1GMJA 3RQGA 1U57A 4YTPC 1NGMB 1KTMA 1VF5B 5KLIC 2E75C 3C18A 2J5UA 2QJPC 2ZT9C 2JX0A 1TU3F 1RQUA 5KKZC 1WMKA 4OGQD 2NZ2A 2L6HA 2D2CB 4GDOA 3BRJA 3Q3DA 3GF3A 1ZMEC 1KQGB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AEE C;  3GM3 A;  3RQE A;  2WQY C;  2HSB A;  3K7D A;  3JYY A;  3U0C A;  3AEC C;  1OW7 A;  3SFE C;  1PV3 A;  2FBW C;  4NQF A;  2JPU A;  1UFB A;  3MFN A;  3AEB C;  4XEV A;  2G3A A;  1ZZP A;  3L8I A;  4XEF A;  2L6F A;  3AE5 C;  1KNY A;  1YQ3 C;  1YQ4 C;  2Q00 A;  2H88 C;  2LK4 A;  1WOL A;  2KK1 A;  3AEG C;  1WTY A;  2PBE A;  3GM1 A;  1ZOY C;  2L6G A;  3C8G D;  1JOG A;  2YWA A;  3AJM A;  1OW8 A;  3U3F A;  3TUL A;  3S9O A;  3GM2 A;  3ABV C;  1OW6 A;  3AEA C;  3O10 A;  3JZ0 A;  3L8J A;  1K05 A;  3B71 A;  1V4A A;  1WWP A;  1K40 A;  3AE1 C;  3AE2 C;  1K04 A;  4EBJ A;  2H89 C;  3AE7 C;  1QVX A;  3AEF C;  1O3U A;  4R32 A;  3C8G A;  4YXD C;  3AED C;  3RQF A;  4XEK A;  3AE8 C;  3AE3 C;  1ZP0 C;  3AE4 C;  5F28 E;  3AE6 C;  3C8G B;  4EBK A;  3SFD C;  3AE9 C;  3RQG A;  4YTP C;  1KTM A;  3C18 A;  2JX0 A;  2L6H A;  3BRJ A; 
#chains in the Genus database with same CATH topology
 4RKU J;  3L0I A;  5B5E E;  2YL1 A;  2WSC H;  3GLM A;  1JTH B;  5L3V A;  3MUD C;  2NSF A;  2KYV A;  3JYY A;  1Q7Y Q;  1I5N A;  1U6H A;  1Q0D A;  2EPK X;  3PDM P;  2OTJ P;  3S1K A;  1HH0 A;  3VAY A;  2PX0 A;  2B87 A;  1SQX G;  2KGO A;  1A7D A;  3Q5S A;  1HBW A;  1Q2N A;  1AVO A;  2CPB A;  2R32 A;  2YLI A;  1PIX A;  1NFO A;  2D5R B;  4L74 A;  1RE3 C;  3BEH A;  3MYI A;  3U2M A;  3L75 J;  1KNY A;  3NDB B;  4JCH A;  3B0U X;  3W4Y A;  3L71 E;  5D91 A;  5L0F A;  2NG1 A;  2LCH A;  2R5D A;  3MZW B;  3MHV A;  4E0I A;  1KB9 I;  4EOT A;  4PFO A;  3PH0 A;  1YIT P;  2RSE B;  3LEV A;  1FZC A;  1S9K D;  4J32 B;  4Q7C A;  3DJU B;  3FMS A;  3LEO A;  1FJK A;  1KIL B;  1Q86 Q;  3AG1 C;  2Q9B A;  1NU1 K;  1BDC A;  3AEA C;  2BCC D;  2JJL A;  1LE2 A;  1BR1 A;  1IJD B;  2BEZ F;  3K1I A;  1LT9 A;  5TJH A;  3I5Q A;  1JR8 A;  1TFK B;  1NTM D;  4RES B;  5APQ A;  5GTH H;  5GPG B;  3GEH A;  2L91 A;  1SS1 A;  3CCR P;  1R5S A;  2E75 D;  1TQG A;  1VK5 A;  2VRS A;  4XA4 A;  5L0J A;  1G8X A;  3S0X A;  2HFE D;  1V54 C;  3RGU A;  2WT7 A;  4JC7 A;  3ZC4 A;  2DW3 A;  5M1B A;  4BJT A;  3L70 E;  3KZI E;  1VQN P;  4I1O B;  4CIH A;  2Y39 A;  3AE3 C;  1RH5 B;  2CYD A;  1HGZ A;  4MVS A;  2DYS C;  4NTA A;  3M79 A;  1OCR C;  2Q9I A;  4UB8 E;  1L0L E;  3CXH D;  2AWY A;  2CNW D;  5L0C A;  4JQ0 D;  5KYY A;  1FOS E;  4EIJ A;  2HMQ A;  4YTP C;  3G3Z A;  3OWT A;  1SQB D;  1KN7 A;  1PPJ G;  2ZXX A;  2H8P D;  4N78 D;  1TKN A;  2JX0 A;  1RQU A;  1VQM P;  3NMJ A;  3W2W A;  2OJQ A;  3RK2 B;  2XDJ A;  4YN0 B;  4K35 A;  5DJU B;  4MVM A;  3CCU P;  5IY5 C;  1CW5 A;  2MHR A;  4WY4 D;  3D71 A;  2A6H F;  5A6B D;  1VOM A;  3T4R A;  5EHH A;  2ITA A;  2G3K A;  2ZT9 B;  1KZU B;  4DOZ A;  1GU5 A;  4YK5 A;  2XND H;  1OW7 A;  3HE4 B;  1ORY A;  4PD4 I;  3JC2 2;  2N1T D;  4NY3 A;  4ZLC A;  2Q1K A;  2WWW A;  1MMG A;  1SYQ A;  5DJT B;  2ZPA A;  3B5N D;  4OIR F;  2CGE A;  1GDT A;  2Q7C A;  5BU8 B;  1YDI A;  3VMA A;  5AVU B;  3EJN A;  4DJG A;  4JTA B;  2R5B A;  1SR2 A;  3ITF A;  3SWY A;  4B86 A;  2AU5 A;  1N73 C;  3H65 A;  4PAC A;  2W6B A;  2ZVN B;  2LK4 A;  4M63 A;  2P67 A;  4WWI A;  1C03 A;  3ZDL A;  1Z56 A;  1E84 A;  3CLQ A;  1LVK A;  3CD6 P;  5BQH A;  1QKR A;  3BVH A;  1T6U A;  5TIS E;  2XXA B;  3ABV C;  2WL8 A;  3WG7 C;  2L7A A;  3CC4 P;  3RK3 E;  1S5L E;  5L0G A;  4D4N A;  3O8Z A;  3CME P;  4F4B A;  4XE5 B;  3U8V A;  1YJG A;  2P1A A;  2IYP A;  2LFF A;  2PRR A;  4G7O F;  2VAS A;  2KXP B;  2XLD A;  1FFH A;  3HE5 B;  2LR2 A;  1G2C B;  2KI7 B;  3H1J E;  3G4X A;  4DVY P;  1H0T A;  3QH9 A;  1SQQ K;  4NC3 A;  5COF A;  2JWA A;  5EFW B;  3CCL P;  1AA0 A;  1LNQ A;  1PGJ A;  3G4Z A;  3NKD A;  5JLI A;  4YT8 A;  3K1H A;  1ZP0 C;  2G8Y A;  2OG2 A;  1FMW A;  2IZ0 A;  4EBB A;  3L72 J;  1NGM B;  1KTM A;  1NU7 D;  4GIF A;  2E75 C;  3ZWI A;  1YYX A;  4JF7 A;  2D2C B;  3H32 A;  1FJP A;  1VPC A;  4PFP A;  5E79 E;  4IGG A;  1R5L A;  2BCC G;  1YTZ I;  2XKM A;  3PLN A;  3VMY A;  1OKK A;  4EHP A;  3KQG A;  1FBM A;  2MYS A;  5F5H A;  4CDV A;  1E2X A;  4BJ5 C;  3M0A A;  3TJ6 A;  3U0C A;  3E1R A;  3O6X A;  1SQX E;  1NTM G;  3JSE O;  1BE3 J;  3CC7 P;  3PP5 A;  5T3W A;  3HTK B;  2JR8 A;  3H1K D;  1OQC A;  3ZTZ A;  1USD A;  2E43 A;  3QMK A;  1WRG A;  1GW3 A;  2JWD A;  3GG2 A;  3ATP A;  3CWB E;  1DOW A;  2YZS A;  1KQL A;  3DE9 A;  5KLV D;  4IAR A;  5KJ7 D;  2DI3 A;  1AUE A;  2L6F A;  3EFF K;  3AE5 C;  1SFC A;  1JY2 N;  2IX7 C;  1YYC A;  3VMX A;  1S3J A;  5BQG A;  1ZU5 A;  2ZJS E;  1MMD A;  3MD0 A;  2N1T C;  4RJT A;  3Q5P A;  1SQB G;  3D6Y A;  4ZMD A;  1HUC A;  2CW0 F;  4N3Y B;  3E70 C;  4L75 A;  1VF5 D;  3VYW A;  5BVZ A;  3B5N C;  2GFH A;  5CHX A;  1LIH A;  1TFO B;  4MS2 A;  1YIJ P;  4JJG A;  2FGY A;  3H2U A;  4GEH A;  2WVQ A;  3UMH A;  3LES A;  1JMM A;  2XLW A;  2G3V A;  4J7Y A;  4CX9 A;  3VRC A;  2OYH A;  2P1J A;  2YLG A;  1M57 C;  4JPZ B;  1DEB A;  4MVQ A;  5L0D A;  1HE9 A;  1M2V B;  1LGH B;  1GK4 A;  2Y69 C;  5KYX A;  3AG3 C;  2C0X A;  3GWN A;  3SP1 A;  1E5W A;  4W8K A;  1SQP E;  1BGY E;  3EHN A;  2HPC B;  2R03 A;  3V4W A;  5KYW A;  3KZI H;  4U9E A;  2GA0 A;  1RKE B;  1YZC A;  1PPJ E;  4EBK A;  3SFD C;  3F46 A;  1Y4C A;  4UB8 H;  4B6I A;  1KYO E;  3HD7 C;  1T6I A;  4MW8 A;  5KLI C;  4CPG A;  3LUT B;  5APY A;  2B0J A;  5KYN A;  3N0T A;  3V2R A;  1VQP P;  1IC2 A;  4BEJ A;  3BRJ A;  4Z9J A;  1ZME C;  2J58 A;  1PZQ A;  3DJN B;  4PJN A;  2WSC J;  4PK4 A;  2WPV B;  4Z1M H;  1RJ9 B;  2HJ3 A;  2KW3 C;  4C46 A;  1H6G A;  3IN6 A;  3A0H H;  2HMZ A;  4OD5 A;  2X51 A;  2EIM C;  4I44 A;  4OVN F;  1L4A B;  4KBL A;  2WZG A;  2JKV A;  2W83 C;  4UDV A;  2P2U A;  2FYU K;  3IHU A;  5A69 A;  4QI2 A;  3KDP B;  1IFM A;  4PV1 B;  2ICW G;  2RMZ A;  3CX5 D;  4JYB A;  3TQO A;  1R4T A;  2ZXO A;  2W8Z A;  4XEV A;  3QW1 A;  1OXK A;  1VLT A;  1ZYR F;  2KNC A;  2FKW B;  1A02 J;  4JBZ A;  2R05 A;  5JT4 A;  3HD7 B;  1IK7 A;  1LTG C;  5APU A;  1G1I A;  2P7V A;  4E0H A;  3M0D C;  4JTD B;  1K73 Q;  3O55 A;  3GHG A;  1L7C A;  5KYU B;  3T97 B;  1SF8 A;  2YEV A;  4PR9 A;  3X2Q C;  5JUA A;  3FGA D;  1DIP A;  4YL1 A;  5TIS H;  2YHS A;  1L2P A;  3O10 A;  1K8A Q;  2K9J A;  4WBA A;  2HG5 D;  4NPE A;  2YIU C;  2HFI A;  3W67 A;  1NTM J;  1WWP A;  3EGX A;  2CDQ A;  4I7Z C;  3MLG A;  3EQL F;  1FZG A;  4MVR A;  2OAR A;  2ZXW C;  4KJM A;  1FZE A;  3H1K G;  4JRZ A;  5AW3 B;  2NUT B;  1O3U A;  2B89 A;  1J2J B;  1VF5 C;  2R7R A;  3ITK A;  4CS9 A;  1NTZ E;  2KSJ A;  3K66 A;  4JYC A;  2HOD A;  3V6I A;  5KLV G;  2WIT A;  3JCU E;  1NHL A;  5FZT A;  3SWK A;  3FDQ A;  2OYI A;  3LNM B;  1S9K E;  4C7R A;  1ZW0 A;  3H1I D;  3C8G B;  4KHX A;  2Y9Z A;  3AE9 C;  1LWU A;  3CCV P;  2FFD A;  3QVZ A;  3CCE P;  3SZR A;  2ZYA A;  3A0B E;  3HRN A;  5CI8 A;  3N4X A;  1RKC A;  1SZI A;  4U5F E;  5KKZ C;  2BCC E;  1EDL A;  4PJM A;  4YL0 A;  3A2A A;  1HMD A;  2WSE H;  3LLI A;  1LKX A;  1GL2 A;  2XM0 A;  4HEA J;  2VC9 A;  3AEE C;  1YYJ A;  5CCG A;  5E79 H;  4I7Z B;  1Z63 A;  4LLC A;  3H1L E;  1KIL D;  2WQY C;  2J8W A;  1NU1 D;  2AEJ A;  3JCU Q;  2Q4F A;  3QW0 A;  2RH0 A;  4DBR A;  3K5B A;  4U3F E;  1FOS F;  4RBN A;  4W8P A;  4HJG H;  5EK0 A;  1D1C A;  4AE4 A;  3FX0 A;  4NQF A;  5AVS B;  1RCP A;  1EDJ A;  2HLO A;  3BAT A;  4H4K C;  4NCQ A;  2QTV A;  4FX5 A;  2J59 M;  3K1I C;  4GQH A;  2KIK A;  5APT A;  1T6Q A;  2QEX P;  3KKB A;  2B87 B;  3L73 D;  1YVI A;  4LLH A;  4BG0 A;  1AVO B;  3FWN A;  3KHU A;  1SQB E;  2ZYG A;  3GMA A;  5JP7 A;  5KKZ B;  4E7Z A;  3GM1 A;  1WT6 A;  1ZOY C;  5DQT A;  3WUV A;  1E83 A;  4CIP A;  1EDK A;  3WU2 E;  2VCB A;  3TNU A;  2IPP A;  1EI7 A;  1KOR A;  2IBZ D;  3BCC J;  1CGM E;  3F47 A;  1Q0K A;  1P84 D;  1FZC B;  1VQ7 P;  3RK2 D;  3N7N A;  2R3S A;  2OQM A;  2A06 E;  4BRY B;  3DMD A;  3OEO A;  1L0L K;  1H9T A;  2KLU A;  1NTK E;  5AW4 B;  1URQ A;  2XSE A;  2XV5 A;  4O79 A;  1C02 A;  3DAG A;  2Z15 A;  2ZT9 D;  1MUU A;  1LT9 B;  5AC4 A;  3VYI A;  4YPC A;  1L0N E;  4N06 A;  4M3L A;  2W45 A;  2A1D D;  1ZHY A;  1VQ4 P;  5CIV A;  2IFM A;  5DVW A;  4NPF X;  4RDA A;  3RQF A;  2MKV A;  2WB7 A;  2C03 A;  1MQV A;  5E2Q A;  1JCD A;  2YRF A;  1YTZ T;  3MIW A;  3RQG A;  3TGU D;  4O7G A;  1BDJ B;  1QPU A;  1C17 M;  2A0U A;  1T9K A;  2R9R B;  1PGO A;  4O6N A;  1G5Z A;  3JT1 A;  2NSG A;  3WMM 0;  3C8Z A;  2ASR A;  4G78 A;  3V2N A;  2L6H A;  3DE8 A;  2R7O A;  4IRU A;  1M1J A;  5AVQ B;  5KYY B;  2M64 A;  1M90 Q;  4H54 A;  1YJW P;  5APS A;  5DS6 A;  2OTL P;  1DX7 A;  1O87 A;  3I5C A;  4PJ0 E;  2E76 C;  2HZ8 A;  1Q81 Q;  2W4B A;  2J9W A;  4W7Z A;  1SLQ A;  3W8H A;  1BCC D;  2DB4 A;  3GEI A;  2NPS A;  2H7B A;  3S29 A;  1GGQ A;  4C3D A;  1N7S A;  5KAF E;  3GF7 A;  4R4M A;  3U8P A;  5KLV J;  1H7I A;  2PF4 E;  5AW2 B;  4WGY A;  5AVY B;  1SQQ D;  1KIL C;  3PRJ A;  1RE4 A;  1IO4 A;  2J7P A;  1GM5 A;  1JRA A;  2OTK E;  1NZE A;  3H1I G;  2VH3 A;  2VCC A;  5CI9 A;  2KZJ A;  1HW2 A;  2KSE A;  5AW5 B;  1UIX A;  3PTZ A;  3RL0 g;  2E76 B;  1H89 A;  4GYT A;  1FDO A;  2P58 A;  1W5C E;  4XLP F;  4BJ6 A;  2FAP B;  3IQC A;  4MTG A;  2D2C D;  3HUS A;  1EZV G;  1KYO I;  2POH A;  1NU1 G;  4HB1 A;  3ZG1 A;  1D0X A;  3H1K E;  1USE A;  3AE2 C;  3EZH A;  3EGD A;  1QQ3 A;  4EBJ A;  1PP9 E;  1OMI A;  3H1H E;  5CBO A;  2WTY A;  3AQC A;  1JAF A;  3L72 G;  4DOJ A;  1EQ1 A;  3H2V A;  1NJI Q;  4K0D A;  5KLV E;  3OA1 A;  2KB7 P;  2QY9 A;  2JO1 A;  3NYL A;  2Q3E A;  3KYQ A;  1NH4 A;  4PD4 H;  4C7N A;  4HFF B;  3B8E B;  4PD4 D;  1UG7 A;  1YBK A;  1HWT C;  4YT2 A;  1EKY A;  1JY2 P;  1X8Y A;  5CBN A;  2LD6 A;  3LNR A;  1RMV A;  3RK2 C;  3L73 G;  3AG4 C;  1H0T B;  4JJF A;  3CL3 D;  2ZYD A;  1TWC A;  3DXJ F;  1KC8 Q;  3Q6M A;  1JOC A;  1BE3 G;  4XLN F;  3A0B H;  2J5U A;  2A45 G;  2ZT9 C;  3TYY A;  3S84 A;  1HTL C;  2WZF A;  4KC9 A;  3S28 A;  1VMA A;  2Q3I A;  1SFC C;  2Q6Q A;  3VMZ A;  3L75 E;  2IBZ G;  2V3C C;  1N1C A;  1BSN A;  1ZVZ A;  1LT1 A;  1J1D C;  1AQT A;  1HJ0 A;  3Q2Y A;  2MJZ A;  3H32 B;  3P32 A;  1CGN A;  4RD9 A;  4IL6 H;  1PV3 A;  4XFJ A;  3L35 A;  3RYL A;  2LIG A;  2OCC C;  2Z5H A;  2OJE D;  3L74 D;  3AGU A;  3NMI A;  2HSQ A;  1UII A;  1EXI A;  4QI0 A;  4LC1 A;  1OX3 A;  4O6Y A;  2ZD9 A;  3DKA A;  3K6B A;  3EG9 A;  2I15 A;  2J0X A;  1VQ8 P;  4ZKU A;  2C9L Y;  4ASV A;  1X22 A;  3VOP A;  1LTJ A;  1RF1 A;  1N86 A;  5TJ5 E;  1CGO A;  2C0W A;  1MNE A;  2WPS A;  1U89 A;  4BXL A;  4XPY A;  1WTY A;  2L6G A;  2HYN A;  1SFC B;  1J1E C;  4O9B A;  3HNK A;  2QNL A;  1NG1 A;  4C3E A;  4I6M C;  4UB6 E;  1SQV K;  4JCZ A;  3S9O A;  1OR2 A;  1J1D B;  2QJY C;  2YL0 A;  1SQP K;  1GU4 A;  2L5G B;  1HJB A;  1K05 A;  5AVX B;  4CSA C;  2UUH A;  4OIN F;  1U7J A;  2OEX A;  1BCC G;  1M57 D;  1T8Z A;  4YJW A;  3NTN A;  3EQ2 A;  3TOM A;  1S4X A;  1OCO C;  1L4A D;  4JVS A;  2FYZ A;  2FYN B;  3M9B A;  5B66 H;  4EDF A;  3HKK A;  1T2K C;  2FYU D;  1OVV A;  3NYM A;  3ZSU A;  2YXR B;  1RF0 C;  1YJN P;  3AED C;  2OYH B;  4PV1 D;  3BCC D;  4NPD A;  2D2C C;  1SQQ G;  3AE4 C;  1PD0 A;  3MTU E;  2V26 A;  5KYX B;  3H1I J;  3AE6 C;  1J1E B;  2KUB A;  2ZXE B;  1CI6 A;  2M5A A;  5CCH A;  2M3B A;  2QE7 H;  3HD7 D;  2QJY B;  1NKZ B;  2R02 A;  5KYW B;  2Q9A A;  3VP9 A;  3V5X A;  3B0V C;  2OGU A;  2HR3 A;  4ANJ A;  3HTK C;  5E3A A;  1KQG B;  1OR3 A;  3DD7 A;  1JMW A;  3P7K A;  4P9F A;  1J8M F;  1NU1 J;  5AVV B;  2K37 A;  4CJG A;  3R7C A;  1M8O B;  3IR9 A;  4PJ0 H;  5K5G B;  3EH1 A;  3A9C A;  3C62 A;  2E5T A;  3KPH A;  3GHG C;  1IFI A;  2R7W A;  3NRH A;  3F5H A;  2E74 C;  4H0L B;  5H2F H;  2A0B A;  3GOR A;  3NKE A;  1CZQ A;  2AEM A;  4XEF A;  3L73 J;  4IFD K;  3H1I E;  5B5E H;  1ZHZ A;  2XL4 A;  1N8R Q;  3TSI A;  2JP3 A;  1J8Y F;  4JEA A;  3NG1 A;  3Q6N A;  5B3S C;  2KC3 A;  1MMA A;  1OCC C;  2XZR A;  1FAV A;  3EFG A;  2YO2 A;  3C8G D;  3DWW A;  3TJ5 A;  5APX A;  2KNC B;  2H7V C;  4CS9 C;  3HLZ A;  1A0B A;  2I1J A;  1ZW2 A;  4GKG A;  1EZV E;  2AXT E;  1JY3 O;  1NTZ K;  1OW6 A;  3G71 P;  4MVZ A;  2O1K A;  2K3R A;  3S4R A;  1GTW A;  1KFN A;  1M6T A;  4ULV A;  2OYI C;  5L3Q A;  2P7J A;  3GHG B;  1LTI C;  1D0Y A;  1NKN A;  2OYO A;  4H13 C;  1V4A A;  2O01 H;  2NPU A;  2R7V A;  3L72 E;  4IL6 X;  2E74 B;  1ZHT A;  2WZL A;  4Y99 C;  3FWL A;  2K9J B;  4JTC B;  1GL2 C;  3AEF C;  3WOD F;  5CJ4 A;  3EGX B;  5CCG C;  2GDC A;  3L74 G;  1Z23 A;  1SQV J;  4OWF A;  2O01 N;  4ASW A;  4IJJ A;  2FXO A;  4EKW A;  5AVZ B;  3EFO A;  2LXB A;  2WMM A;  1BE3 E;  2PNO A;  4ER9 A;  2YKZ A;  3HNI A;  1OXZ A;  2YNY A;  4DZO A;  3TGU J;  1GMJ A;  3AG2 C;  2HOD B;  4AL1 A;  4Z9H A;  3IQT A;  1MND A;  2QJP C;  1A7V A;  1TU3 F;  1L4A C;  1Q0F A;  1P84 E;  2OYI B;  2Q7R A;  3CQZ A;  4GDO A;  2J0W A;  1JPN A;  1LWU B;  4H13 B;  2FFD B;  4I3M A;  3C8V A;  4PV1 C;  1M56 D;  2NRG A;  4DRH B;  3K7D A;  4Y99 B;  4Y28 J;  2N9B A;  3WAQ A;  4U5C E;  2V7Q H;  3L36 A;  1IFN A;  4DT0 A;  1BCC J;  1GL2 B;  2I1K A;  4BWN A;  1M1K Q;  2HUJ A;  3LID A;  1ZRT D;  1D7M A;  3OW2 O;  1L0L D;  2FXM A;  5HV9 A;  4CS8 C;  1LTS C;  2A68 F;  4C3B A;  4CJO A;  2R7X A;  2Y3H A;  4IAO A;  2BC5 A;  2CPS A;  2FYU G;  2XLV A;  3A5T A;  3L8I A;  4AE4 B;  5DS4 A;  1SQQ J;  4ZNC A;  1VLS A;  3BCC G;  4I2L C;  3JSV C;  1NTK K;  2K88 A;  3RW0 A;  2XS8 A;  1MKM A;  2W4M A;  2QJP B;  3SEO A;  1N73 A;  3LLK A;  4MVO A;  3GAN A;  2LP4 A;  1KB9 E;  3L37 A;  4GOF A;  2R7Q A;  1L0N K;  2GUV A;  4K3A A;  2P61 A;  2V4H A;  1VB5 A;  1XZQ A;  2L9J A;  4CBE A;  256B A;  3M4C A;  3E1I A;  2XLM A;  1Y47 A;  1SVF A;  1VL2 A;  1W2E A;  2AP3 A;  3TNU B;  1BCC E;  2P6V A;  2XL8 A;  4DRI B;  1K40 A;  1VQK P;  5BQI A;  3AOU A;  1RXQ A;  3VM6 A;  4DCK A;  3ZVR A;  4RO0 A;  2GM4 A;  1M1J C;  3RKO F;  3KH2 A;  3LW5 H;  1URQ B;  1GW4 A;  3VTP C;  5AGF A;  3E7K A;  5COM A;  2HV7 A;  4XEK A;  1S5L H;  2NPS C;  1NAF A;  2RKL A;  1N7S C;  3TOL A;  1G4W R;  2DGJ A;  2TMV P;  3EPV A;  3C18 A;  4AQR D;  3V7O A;  4WVZ A;  1VDF A;  3H1J D;  4U5H A;  4OIP F;  1AVY A;  3U9M A;  2UWJ E;  1RE4 C;  2YL7 A;  3RQE A;  2EIN C;  1YJ9 P;  3OJA B;  3SSU A;  4MTO A;  2E76 D;  1FR0 A;  3V2P A;  2H8A A;  1M1J B;  2YKO A;  4BJ5 A;  2YO3 A;  1XTC C;  3BRV B;  3T6B A;  3GEE A;  1NYH A;  2CNW A;  3SXK A;  3CCS P;  3JYH A;  3L74 J;  1A7E A;  3M15 A;  5AW0 B;  4G7H F;  1E85 A;  2NPS B;  1ZZP A;  1NTM E;  1QGK B;  1JO5 A;  1M56 C;  1N7S B;  5A6K A;  2Q00 A;  3HNJ A;  1FZC C;  2B9B A;  4WY4 A;  3RL0 C;  2CCY A;  5A6B A;  3TK1 A;  1NWQ A;  1BDD A;  2N1T A;  4MW3 A;  1GQA A;  3I5P A;  2KZI A;  4EWC A;  4OIO F;  3GM2 A;  1RQV A;  3CWB D;  1V74 B;  5AW6 B;  1LT9 C;  1VQ5 P;  3B5N A;  3L8J A;  3L1M A;  4Q4Z F;  2AEF A;  1GZL A;  4HFK B;  4HH2 A;  1VQ6 P;  4FES A;  4DRJ B;  5AW7 B;  3CXH E;  3C9I A;  1QVF O;  2J9V A;  3UIA A;  5AW1 B;  1PGQ A;  4G0H A;  2GAQ A;  3A3Y B;  4N78 E;  1NLX A;  2H89 C;  4K7B A;  1L0L G;  2A6E F;  1TWG A;  2Z4E A;  2Q9C A;  1D1B A;  4R32 A;  4DXW A;  2D4U A;  3RVY A;  3IPM O;  3PMR A;  4IFM A;  2FYU J;  1OKK D;  3EGD B;  1EQ7 A;  4I1M A;  4H44 C;  3ZIB A;  3ABL C;  3KYJ A;  3W8I A;  5A6A A;  3RL0 B;  4MTF A;  2YMK A;  1FFT C;  3O6Q A;  1QX8 A;  3GOD A;  2WVN A;  2R44 A;  2J9U A;  4C7N B;  2R7U A;  1QLE C;  4ZKP A;  3ABM C;  1D0Z A;  1LE4 A;  5AVR B;  4PJL A;  1TWA A;  1WMK A;  3P8C D;  4J7T A;  3TDK A;  5JRA A;  3Q3D A;  1QSP A;  1SFC D;  1APC A;  2IZ1 A;  2Q3T A;  4LDK A;  2XL6 A;  2QE9 A;  1SQV D;  1ORJ A;  2MWQ A;  3RK3 C;  1SQP D;  3T97 A;  5AW8 B;  1BGY D;  4K1O A;  5GTI E;  3Q7L A;  5F5F A;  4XPX A;  2M3E A;  3G4S P;  2WT7 B;  4U5G A;  1YI2 P;  3KPE A;  4U7J A;  4EYY Q;  2W90 A;  1O5H A;  5DQZ A;  1LP1 A;  1KYO H;  1KU2 A;  3MX3 A;  4LAC B;  1YLM A;  1KYO D;  4H44 B;  3WHN A;  2JPU A;  4D6T J;  1AEP A;  1UFB A;  3C7J A;  3BCC E;  3CCM P;  3IQ5 A;  3M4B A;  3AGT A;  5AVT B;  3W2V A;  2PFD A;  1S5L X;  3RFY A;  3QWO C;  4MND A;  2NUP A;  3NYJ A;  2Y9Y A;  3NXS A;  3D6Z A;  4C7O A;  1A41 A;  2HKV A;  2P0N A;  2KK1 A;  1IFJ A;  2AWC A;  2KOG A;  5JVE A;  3EG9 B;  2KS1 A;  1M2O A;  3M9Q A;  1JOG A;  2YWA A;  4A2N B;  1LPE A;  1LTJ B;  1SP4 A;  3M0D A;  1RF1 B;  3DM9 B;  3VN0 A;  2X0C A;  3CCQ P;  5L0I A;  3H1J G;  3N24 A;  3ZTM A;  3VP8 A;  3RK3 B;  1JY3 N;  1ZLL A;  5E33 A;  1HY5 A;  2XRH A;  1LI7 A;  3MYF A;  3I55 P;  2W9Y A;  2VB6 A;  4U5D E;  5KJ7 A;  1G1J A;  2O01 J;  3L71 J;  3C1L A;  1K04 A;  4A4A A;  1ZV8 A;  1W2W A;  4N6C A;  2XLE A;  2BAS A;  3LJB A;  3F89 A;  3L4F A;  1D1A A;  5DS5 A;  1EA8 A;  1QEX A;  2JD3 A;  1OVU A;  4GOE A;  1T2K D;  3LIE A;  4WAB A;  3X1O A;  4H0L D;  4U5E E;  3JRM O;  1S05 A;  2IFN A;  2EPL X;  4MQ9 F;  3R4Y A;  1LI5 A;  4AYC A;  4IOI H;  1OXB A;  2OOC A;  1S1C X;  3B9Q A;  3V2Q A;  1ZR2 A;  1LM3 B;  4YWQ A;  1S72 P;  1FAP B;  4O6M A;  4E18 A;  3GF3 A;  1JM0 A;  1CI6 B;  2M5A B;  2W27 A;  3USS A;  4WB4 A;  3CWB G;  5T1D B;  1DD4 A;  5D92 A;  1NTZ D;  3L70 J;  1VQL P;  2C04 A;  3M1C B;  2XU6 A;  1SQX K;  3JCU H;  1Q0M A;  1MFT A;  2V7Q J;  3TF5 A;  1BR4 A;  3MBG A;  3WUT A;  1KQS O;  2FBW C;  1L0L J;  3US6 A;  3SYN A;  2WPQ A;  2E74 D;  4BRY A;  2HJM A;  5T3T A;  4MVU A;  4Z9I A;  3FXD A;  3VF0 A;  4YXW H;  3U2L A;  1KQF B;  4W80 A;  3AEB C;  3ZQY A;  1K9M Q;  3T6G B;  2XLO A;  3IFM A;  3OAK A;  1F1M A;  1JCC A;  5KTB A;  2P10 A;  3H1L D;  2H88 C;  3KYI A;  3NFQ A;  1PD1 A;  2B88 A;  2QRX A;  1KFM A;  5K0I A;  3AEG C;  2OQQ A;  4U3F D;  1HGV A;  5E3C A;  4BEM J;  2M4E A;  2EPO A;  2WSS H;  2QVA A;  2H7O A;  2YQY A;  4OD4 A;  2M0B A;  3FVY A;  4U9D A;  4NTF A;  1HW1 A;  1AV1 A;  1QL2 A;  4JW1 A;  1U0B B;  1HMO A;  4MN4 C;  2FYN C;  3FAP B;  1SQV G;  3R2P A;  1ZRT E;  4H13 D;  1SQP G;  3CXH H;  1BGY G;  2IXM A;  2OYH C;  4CDY A;  2C9N Y;  2Y0C A;  1DEE G;  1OCZ C;  3TGU G;  1JEK A;  4X0R A;  1BZ4 A;  1GL2 D;  1QVX A;  1XTG B;  2HS5 A;  2RN0 A;  2IYO A;  4AL0 A;  3WU2 H;  2Z5I A;  5CCG D;  2CK3 H;  2PGD A;  3LW5 J;  1FC2 C;  3PHF 2;  3SNH A;  2Q5U A;  2YVK A;  3A0H E;  3FOP A;  2OEV A;  1Y6D A;  4GT1 A;  4DVZ A;  1QVG O;  2KK7 A;  3RVZ A;  2FFH A;  5CJ0 A;  5F28 E;  2A06 D;  2RD9 A;  5KAI E;  4IWB A;  1NTK D;  1Q0G A;  1W2B O;  1BSH A;  1XWJ A;  5B1A C;  1PGP A;  1YA7 O;  1JTH A;  3CX5 E;  2GWW A;  3EFO B;  3V4Q A;  3G50 A;  4IAQ A;  3H1J J;  3RF3 A;  3T6J A;  4P9T A;  2KYH A;  1ST6 A;  4H0L C;  3CEX A;  1L0N D;  1IFD A;  3U1C A;  1TWH A;  5AVW B;  3DI5 A;  3LS1 A;  5GTI H;  3SFE C;  5A6J A;  1NFN A;  1YAR O;  1PCX A;  1IFP A;  1MV8 A;  2EPN A;  4JZA A;  3CCJ P;  1TR2 A;  4E7S A;  1IW7 F;  1XZP A;  1EDI A;  1KD1 Q;  3JTL O;  1IK9 A;  4XQ1 A;  2WVO A;  4HKZ H;  3CXH I;  2WSE J;  2ZXP A;  1ZHW A;  2O1J A;  2JDI H;  3B29 A;  1A02 F;  1NO4 A;  3PJS K;  1URQ D;  1CPR A;  1WAS A;  3UMI A;  3GW6 A;  1JMB A;  1KIL A;  3MUD A;  4CDA A;  1SQX J;  1OZH A;  1VYI A;  2QUP A;  1KMI Z;  1X79 B;  1Z6A A;  2YLD A;  1FZA A;  4FWV A;  3AJM A;  4JE9 A;  2QJK C;  1S2E A;  5KAF H;  4D6T D;  1KV4 A;  3FXH A;  3CWB J;  4WJ0 A;  2PAJ A;  1N73 B;  3EH2 A;  3LAY A;  2AVK A;  3JSZ A;  1Z3I X;  1RE3 A;  1NTZ G;  1FE6 A;  1VYK A;  1WN0 A;  1WGW A;  4XWJ A;  1VQO P;  3AE1 C;  3EWK A;  2N9Y B;  2YMY A;  1JUN A;  1NSG B;  3SXY A;  4ONS A;  3CAX A;  1LTA C;  1E86 A;  2LKM A;  3G6E P;  1NAY A;  4W7Y A;  3TD7 A;  3Q1M A;  4YT5 A;  3U9J A;  2K1A A;  1FMV A;  1VTM P;  4YXD C;  1KIL E;  3ASO C;  1NU1 E;  2QG4 A;  2YXQ B;  2WSF H;  2EIJ C;  3J06 A;  2JEE A;  3AE8 C;  2J46 A;  2NPS D;  1LWU C;  2FFD C;  1ZXG A;  3H1L G;  2VCA A;  3L71 D;  3ABK C;  4E17 A;  1H88 A;  1N7S D;  3UR3 C;  2QJK B;  5DLJ A;  4YT4 A;  3U59 A;  1MFZ A;  5B3I A;  2KSF A;  4U3F G;  3E9V A;  4LDR A;  1PFI A;  2G62 A;  1PP9 D;  3H1H D;  4L76 A;  4OGQ D;  4AX2 A;  2YKP A;  4KNV A;  1WAT A;  3FOO A;  1N2D C;  3HE4 A;  3L73 E;  1JNM A;  1FTS A;  4PJJ A;  2QM7 A;  1NTM K;  4AUW A;  1SMY F;  1B68 A;  2J7P D;  1LTT C;  2ZVO B;  1CPQ A;  4WY4 C;  1SQP J;  2PP4 A;  1BGY J;  2K9Y A;  3NMK A;  1OIP A;  2E75 B;  2IDB A;  2BE5 F;  2IXO A;  2PX3 A;  3O39 A;  3S27 A;  1RHZ B;  3DZA A;  2IBZ E;  1BR2 A;  1Z7Q c;  3K33 A;  1QZX A;  2J9B A;  1FDI A;  1FDM A;  2Y3D A;  4JEB A;  2SPZ A;  2QSI A;  3SWF A;  3L75 D;  3IQ6 A;  1T01 A;  2XM4 A;  2PP6 A;  4Q5S F;  1YQ4 C;  2EIL C;  3L70 D;  4N6J A;  4AK9 A;  1SQB K;  3NMD A;  2XXA A;  3EZI A;  1IZN B;  2A06 G;  3RL0 D;  1VQ9 P;  3CC2 P;  3P8C E;  4L6R A;  3HJC A;  2IBF A;  1NTK G;  4QMA A;  1AQ5 A;  3ZQV A;  2XNX A;  3WUU A;  3QVY A;  2XLH A;  3U3F A;  2LXC B;  1SQV E;  1FS0 E;  4WY4 B;  1EXJ A;  1V55 C;  2BL2 A;  3JZ0 A;  3HE5 A;  1L0N G;  3IEE A;  3KXD A;  1G2C A;  4EIY A;  3B71 A;  1YAU O;  3DM5 A;  2N1T B;  1URQ C;  5APV A;  4JIO A;  5EGY A;  4ZLD A;  3TGU E;  4CSA A;  1X0T A;  2QA4 P;  2GUS A;  3FAJ A;  4XTK A;  2XS1 A;  2YKQ A;  3B5N B;  4A7P A;  3RBZ A;  3AE7 C;  5L8R J;  1MMN A;  1FNT c;  3B4S A;  1L3P A;  2ZFC A;  2FXP A;  1FZF A;  2KNH A;  3MGN A;  3CMA P;  4CS7 A;  4UB6 H;  1X9V A;  3MP7 B;  2I8B A;  4H44 D;  3U3B A;  2Y3B A;  3T9O A;  1RF0 A;  3OA7 A;  1I4Z A;  2E87 A;  4GOD A;  3QZC A;  2BEQ D;  3II6 A;  2QM8 A;  4JKV A;  1QLE D;  4G7Z F;  5KAI H;  2WPR A;  3UGO A;  4BJ1 A;  1FZB A;  3CX5 H;  3L34 A;  2NZ2 A;  3JRT A;  3O6Q B;  2IM8 A;  3ECS A;  2B0H A;  4P6I C;  1JY3 P;  5JSL A;  1FU1 A;  1OWA A;  4D6T G;  1SQQ E;  1NBB A;  3GM3 A;  3HTK A;  3UNG C;  4HE8 D;  1NTZ J;  1ZN5 A;  2GA1 A;  2IOQ A;  3RK3 D;  1YA9 A;  5KLI B;  3U5S A;  1PL5 A;  3AEC C;  1G4U S;  3UGP A;  2KJG A;  4BPM A;  1Q90 D;  4EUK B;  2KLV A;  2WVR A;  2QIW A;  1ZHX A;  1CSB A;  1AFO A;  5JS5 A;  4DJ9 A;  3QTH A;  3CPW O;  4OGQ C;  4XPW A;  3I56 P;  2QLA A;  2BCC J;  3CI9 A;  1NOH A;  4KT0 J;  3W68 A;  5FCL A;  2H7H A;  1R5I D;  5HSW A;  5KJ7 C;  1LP1 B;  2WZ7 A;  3H1L J;  1AJY A;  3FHD A;  1R8E A;  3H6P A;  2DYR C;  3G9R A;  1YZA A;  4LLE A;  2O3J A;  3L71 G;  3U1A A;  4U3F J;  3FXE A;  2R7T A;  2NUP B;  1LS4 A;  3GWL A;  4IB4 A;  1PP9 G;  3H1H G;  1OW8 A;  4PD4 E;  3N2Z B;  5APW A;  3CZ6 A;  4BJ6 C;  4C7O B;  3RBX A;  3ZDM A;  1Y9B A;  3HUS C;  2ZXR A;  2IXN A;  3UMK A;  4DBQ A;  3H25 A;  3M9H A;  2KS1 B;  3KL4 A;  1Q82 Q;  2HV6 A;  5C39 A;  1H8A A;  1M2V A;  5CCH D;  5GTH E;  4YL3 A;  3CX5 I;  3BAS A;  4N6H A;  3C63 A;  1S7Z A;  1SQB J;  4OGQ B;  1SQX D;  1YHQ P;  2HPC A;  1MZ9 A;  2ETS A;  5B1B C;  2OKU A;  2FY8 A;  5KLV K;  1ORS C;  1RKE A;  2EPM X;  1GK6 A;  2YIU B;  1EC5 A;  2H43 A;  4IFF A;  2AXT H;  3POV A;  1DD3 A;  2O9X A;  1EZV D;  1GS9 A;  4R4L A;  5BUO A;  3PCV A;  2M8R A;  3RH3 A;  4D4X A;  3L75 G;  5COG A;  4IL6 E;  3L70 G;  4TLF A;  3A11 A;  1NTK J;  4WGZ A;  5CMZ A;  1IZM A;  3L72 D;  1VF5 B;  3HUS B;  3L74 E;  1RJ9 A;  3I4U A;  4OIQ F;  1OFC X;  1Z5Z A;  3EHM A;  1L0N J;  1L4A A;  1NVO A;  4U5B E;  2A69 F;  5BU5 A;  2KQ9 A;  2HSB A;  1OVR A;  4KNW A;  1H9G A;  1BE3 D;  3V5B A;  2E42 A;  4ULW A;  2A45 H;  2R3C A;  3M91 A;  4N4W A;  4TT3 H;  3ASN C;  3S90 A;  1T3U A;  1HF9 A;  3D70 A;  3KMI A;  1DH3 A;  1Y8A A;  3HD7 A;  3IF4 A;  3P8M C;  3MFN A;  4LGD E;  4CS8 A;  2LSE A;  1P84 H;  1ZU4 A;  4J30 B;  4HYT B;  2G3A A;  1QL1 A;  1JY2 O;  3V5Z A;  2W6A A;  1LTJ C;  5AW9 B;  1RF1 C;  1GD2 E;  1YQ3 C;  2W6J H;  5KYU A;  4I1L A;  1RY3 A;  1WOL A;  2LQG A;  2UUI A;  3Q7G A;  4LER A;  2R7S A;  2PBE A;  1EZV I;  5AC5 A;  1PPJ D;  1E79 H;  1HVV A;  5B66 E;  2FYU E;  1JPJ A;  3TUL A;  3A7O A;  4QDL A;  4FAP B;  3SXZ A;  1T5O A;  3M06 A;  2EIK C;  3PHL A;  1T3J A;  2Y3G A;  2NUT A;  1U7M A;  4EI2 A;  1N7L A;  1HE1 A;  2I8D A;  1ZW3 A;  2AXC A;  3Q5R A;  3DAF A;  2Y0D A;  3B0P A;  1DOV A;  2PFX A;  2R25 A;  2F22 A;  3TK0 A;  5L0H A;  2E5Y A;  2OU6 A;  1KB9 H;  1KB9 D;  3C8G A;  1I4Y A;  3LS0 A;  2IYL D;  2WSF J;  4JUR I;  1LTB C;  2A45 I;  3IAO A;  2J45 A;  1ZR4 A;  1JB0 J;  3AQB A;  4NTB A;  2YL3 A;  4KI2 A;  1BBH A;  2L81 A;  1T6A A;  4OH8 B;  5CCH C;  3BRT B;  2IBZ I;  3CSK A;  3RIP A;  2IXP A;  1M7L A;  1U57 A;  3H1K J;  4L73 A;  2LFD A;  1P84 I;  2ZAE B;  3SXM A;  1NU9 C;  5H2F E;  3HNL A;  2Y0E A;  1PP9 J;  4D6T E;  3H1H J;  3V5Y A;  1LJ2 A;  2KP8 A;  1LS1 A;  4LDQ A; 
#chains in the Genus database with same CATH homology
 4RKU J;  3AEE C;  4H0L C;  4H13 B;  3GM3 A;  2WSC J;  3C8V A;  4I7Z B;  3RQE A;  1DD4 A;  4PV1 C;  2WPV B;  3GLM A;  4Z1M H;  2WQY C;  3D71 A;  1HJ0 A;  2E76 C;  2E76 D;  2K9Y A;  3IN6 A;  2HSB A;  3K7D A;  3JYY A;  3Q2Y A;  4Y28 J;  2E75 B;  2IDB A;  1PL5 A;  3AEC C;  3U0C A;  2V7Q J;  2ZT9 B;  1OW7 A;  3SFE C;  1Q90 D;  1PV3 A;  2FBW C;  2QIW A;  4U7J A;  4TT3 H;  4XFJ A;  4NQF A;  1HF9 A;  2E74 C;  1NYH A;  2E74 D;  4H0L B;  3D70 A;  4H44 B;  3GF7 A;  3Q5S A;  4R4M A;  2JPU A;  4PV1 B;  1UFB A;  1KQF B;  4OGQ C;  1FDI A;  3MFN A;  3AEB C;  1EXI A;  2WSE J;  4KT0 J;  1PIX A;  4XEV A;  2G3A A;  2QSI A;  1ZZP A;  3L8I A;  4XEF A;  2L6F A;  3AE5 C;  1S5L X;  1KNY A;  1YQ3 C;  1AJY A;  1YQ4 C;  2JP3 A;  2Q00 A;  2P10 A;  1R8E A;  2H88 C;  1IK7 A;  3D6Z A;  1MKM A;  2LK4 A;  3GMA A;  3G9R A;  1WOL A;  2KK1 A;  3AEG C;  2OQQ A;  1KMI Z;  1WTY A;  1ZOY C;  2L6G A;  2PBE A;  3GM1 A;  3Q5P A;  3C8G D;  1JOG A;  3D6Y A;  2YWA A;  3AJM A;  3T97 B;  2QJK C;  1OW8 A;  3U3F A;  3TUL A;  3FGA D;  1DIP A;  3S9O A;  1VF5 D;  3GM2 A;  1UIX A;  3ABV C;  1KOR A;  2QJY C;  1Y9B A;  1OW6 A;  1RQV A;  2E76 B;  3AEA C;  3RL0 g;  1EXJ A;  1FDO A;  3H25 A;  3RK3 E;  3O10 A;  3JZ0 A;  1VL2 A;  2D2C D;  3L8J A;  1K05 A;  2FYN C;  2BEZ F;  3B71 A;  2YIU C;  1ZRT E;  4H13 C;  4H13 D;  2O01 J;  1V4A A;  1WWP A;  1K40 A;  4I7Z C;  4IL6 X;  2E74 B;  3AE1 C;  3AE2 C;  3EWK A;  1K04 A;  4EBJ A;  1OMI A;  4OGQ B;  2E75 D;  2H89 C;  3Q5R A;  2ZT9 D;  3AE7 C;  5L8R J;  3AEF C;  1QVX A;  1O3U A;  4R32 A;  3Q1M A;  2FXP A;  3LW5 J;  2JO1 A;  3C8G A;  1VF5 C;  4H0L D;  4YXD C;  1KIL E;  3AED C;  1DD3 A;  4H44 C;  4H44 D;  2WSF J;  4R4L A;  4PV1 D;  5M1B A;  3R4Y A;  3IAO A;  3RQF A;  1JB0 J;  2D2C C;  2MKV A;  4XEK A;  3AE8 C;  2YMK A;  3AE3 C;  1ZP0 C;  2G8Y A;  3AE4 C;  3O6Q A;  5F28 E;  1S1C X;  3AE6 C;  3C8G B;  2BEQ D;  4EBK A;  3SFD C;  3AE9 C;  1GMJ A;  3RQG A;  1U57 A;  4YTP C;  1NGM B;  1KTM A;  1VF5 B;  5KLI C;  2E75 C;  3C18 A;  2J5U A;  2QJP C;  2ZT9 C;  2JX0 A;  1TU3 F;  1RQU A;  5KKZ C;  1WMK A;  4OGQ D;  2NZ2 A;  2L6H A;  2D2C B;  4GDO A;  3BRJ A;  3Q3D A;  3GF3 A;  1ZME C;  1KQG B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...