3B71A

Cd4 endocytosis motif bound to the focal adhesion targeting (fat) domain of the focal adhesion kinase
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
134
structure length
134
Chain Sequence
NLDRSNDKVYENVTGLVKAVIEMSSKIQPAPPEEYVPMVKEVGLALRTLLATVDETIPLLPASTHREIEMAQKLLNSDLGELINKMKLAQQYVMTSLQQEYKKQMLTAAHALAVDAKNLLDVIDQARLKMLGQT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis for the interaction between focal adhesion kinase and CD4.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Focal adhesion kinase 1
total genus 56
structure length 134
sequence length 134
chains with identical sequence B, C
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2007-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03623 Focal_AT Focal adhesion targeting region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.540 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 3b71A01
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 3b71A02
3C8GB 4XEFA 3K7DA 3C18A 3JYYA 3SFEC 3L8IA 2Q00A 4NQFA 4YTPC 1ZP0C 1QVXA 1UFBA 3AEEC 3B71A 3ABVC 1OW8A 1OW7A 3AE8C 1K40A 3BRJA 1KNYA 3GM1A 3GM2A 3O10A 1V4AA 1ZZPA 3AE9C 3MFNA 1KTMA 3AE2C 3AJMA 3RQFA 2HSBA 2G3AA 3AE6C 3AEDC 2KK1A 3AEFC 2LK4A 3AE3C 3C8GA 4XEVA 2YWAA 3GM3A 4EBKA 1K05A 3U0CA 1YQ4C 2WQYC 2FBWC 2H89C 4R32A 3AE5C 1WOLA 3C8GD 4XEKA 2JX0A 2JPUA 1K04A 3AE4C 3JZ0A 1O3UA 3U3FA 3AEGC 3AECC 2H88C 1ZOYC 4EBJA 1WWPA 2L6HA 1OW6A 3SFDC 3AEAC 3L8JA 3AE7C 3TULA 3RQGA 3RQEA 2PBEA 1PV3A 1WTYA 4YXDC 1JOGA 3AEBC 1YQ3C 2L6FA 5F28E 2L6GA 3S9OA 3AE1C
chains in the Genus database with same CATH superfamily
2ZD9A 3RVZA 1YJNP 4HE8D 1BR4A 2KLUA 1RE4C 5CCHC 5B1AC 3B5NB 1NTZJ 3JYYA 4JE9A 2HG5D 1KORA 2VCBA 2R9RB 3V4QA 3CXHI 2J9BA 1H0TB 3DI5A 3SYNA 3EQLF 3CMAP 4IARA 3UR3C 2YKQA 1X0TA 4D6TE 1H9TA 1C03A 1OW8A 1OW7A 1FJKA 1L0NG 2OYHA 1EA8A 1Q0GA 3QVYA 3QH9A 1BGYE 5A6AA 3DE8A 4IFFA 1FE6A 2KZJA 4PD4E 3HTKC 5KYXA 3B0VC 3M4BA 4C7OB 3AJMA 2P67A 2LFDA 2XLOA 1FZFA 2KK1A 1Z5ZA 3NTNA 1JUNA 1Q0KA 1JY2P 2R5DA 1KC8Q 4Q5SF 3KMIA 2HODB 3GLMA 3L75E 4HB1A 3A0HH 5KAIH 4DJGA 4K35A 3C8GA 3TJ6A 3SXZA 5AW6B 2XL6A 1OCOC 1ZR4A 2WSFH 3LS1A 2IYPA 3CZ6A 1L0LJ 3L73J 4XA4A 3TSIA 1GM5A 4KT0J 2HV7A 2J9VA 4GT1A 3L74J 3M0DA 1YJ9P 4CJOA 1URQC 2AXTH 2EPOA 3L70E 2Q9CA 5GTHE 4XEKA 3B29A 1JCDA 3JSVC 4OGQC 4G7ZF 3E1IA 2VASA 2Y9ZA 3K6BA 1LGHB 2J8WA 2H88C 3RF3A 1BGYD 1NTKG 2XDJA 5B5EH 3GF7A 1AVOB 2E87A 1QKRA 3S84A 2YRFA 1QPUA 2QIWA 3IQ6A 1AVOA 2FFDB 3M06A 1ZR2A 4DOZA 1NTZK 1JPNA 2M64A 2KW3C 4C7RA 1KZUB 3HE5A 4J30B 1KB9D 1SQXE 2J7PA 2IOQA 4OIRF 2H7HA 2JD3A 3K33A 4TLFA 1MFTA 2GFHA 1SQPK 1VF5D 3U9JA 3WMM0 3SP1A 1FDOA 4HFKB 3VN0A 2N1TC 2G3KA 3CLQA 4G78A 1FZCA 5L3VA 2XM0A 1GW4A 2A06D 1JEKA 1OIPA 3L72E 5TJ5E 2OYHB 1VYIA 3L71D 1NVOA 1T5OA 3KYIA 2WVQA 1KNYA 2YL7A 3GORA 1YDIA 1JY3N 5APUA 2Q5UA 1T8ZA 3AQBA 4IB4A 2AEFA 2E75C 4Y99B 1TKNA 3IPMO 1LT9C 1XTCC 3RIPA 4IL6X 1NTME 2NPSC 1FZCB 3Q3DA 2OTKE 4K1OA 1L4AD 3KYQA 1QZXA 2BC5A 4BEMJ 2ZXRA 1YBKA 4AE4A 4GEHA 3T6JA 4N78D 1EQ7A 4XTKA 4HFFB 4BXLA 1Q0DA 3V2QA 2XXAA 3RL0g 1IFIA 3RK3B 3E70C 4NPFX 1YITP 3KPHA 3HD7A 1FFTC 5KYYA 1SMYF 2D2CB 4LGDE 2CPBA 2KI7B 3AEGC 1LTTC 2Y0CA 1M2VB 1G4WR 2FYUJ 1ZOYC 2XLVA 2YKZA 3W2VA 4EBJA 3BCCD 3G6EP 4RBNA 3QMKA 1JM0A 3W68A 3CCSP 1NTMG 3X2QC 1QEXA 3H1ID 3C9IA 2O1KA 4P9TA 1VTMP 4XLNF 1NOHA 3PMRA 4BPMA 1P84I 1E85A 2EILC 1ZVZA 1T01A 3LNRA 1XZPA 4KC9A 3G50A 1T6IA 1SQVG 2K1AA 4DT0A 2LSEA 1LE4A 3UMHA 3W4YA 4GOEA 2PX3A 4JURI 1E5WA 1N73C 2KK7A 1SQXG 3AG3C 3FDQA 4H0LD 5HV9A 1OVUA 1OMIA 4MTOA 3JYHA 2NPSB 3ITFA 5AC4A 3PP5A 4J7YA 1Z7Qc 2J0XA 3MZWB 5KLVE 2XNXA 1CGNA 2JO1A 2W6JH 3TNUB 2D2CC 1JRAA 3LJBA 1VLSA 3PH0A 3ECSA 4Q7CA 4EBBA 4XFJA 2R7RA 4D6TJ 4ASWA 3O10A 2G8YA 4AL1A 1A0BA 256BA 3L35A 4JIOA 4OWFA 5AVQB 2QJPB 1HY5A 2C0XA 3RQFA 3MLGA 1DEBA 2KSFA 2ZYDA 1EZVI 2OARA 4M3LA 3UGOA 2QTVA 2OGUA 3VP9A 4H54A 3A9CA 5AW1B 5EFWB 1YYXA 3Q6MA 4DBQA 1UIIA 1YZAA 2KNCA 2C04A 3L75J 2H8AA 1LT9B 3EHMA 3AQCA 2HMQA 4BRYA 2KC3A 4K0DA 4YT5A 1JTHA 1YJGA 1CZQA 4XE5B 3KDPB 2GAQA 3IFMA 3OW2O 3H1IJ 1LTSC 1FAVA 1OKKA 3TOMA 4EDFA 1AJYA 3B9QA 3H6PA 3L74E 1O3UA 3FHDA 1X8YA 3TGUG 1BE3D 2C03A 3S28A 1ZW3A 1SLQA 3GANA 1LNQA 2PP4A 1NU1J 1NLXA 4O7GA 3EWKA 2M3EA 5CCHD 1GD2E 4EIJA 1T6UA 3C63A 3CX5I 1IW7F 4U7JA 2P7VA 1NTMK 2H7OA 1PP9E 4GIFA 2ZAEB 4YXDC 3TOLA 3AEBC 5F28E 3AG4C 3T9OA 2WSSH 3CC4P 4IAOA 2YKOA 1KFNA 1SR2A 2XLMA 3KHUA 1PCXA 4MS2A 2XLHA 1PL5A 2W8ZA 4IFMA 1VYKA 5KAIE 3L74G 1S5LH 1KYOE 1BGYG 1A7DA 1N1CA 4XQ1A 2JWAA 2AXCA 3A2AA 3GHGA 1M2OA 1MMNA 2YEVA 5DLJA 3I4UA 2KUBA 2FYUK 2IXPA 1DIPA 3B4SA 2CNWD 3AE8C 3L71J 3BRJA 3JSEO 1MZ9A 4YT4A 2FFDC 3RH3A 3DMDA 1LTJB 4OIOF 1USDA 1X9VA 1UG7A 1FJPA 4WJ0A 3ZVRA 4WY4C 1QL1A 2CGEA 1Q0MA 3NMDA 3HE5B 2XU6A 2R7QA 3GMAA 5B5EE 1QGKB 1LIHA 1OXKA 2Z15A 3H2UA 3NKDA 2OJQA 3AEFC 4D6TG 1Y8AA 1KILA 3LNMB 4ZKUA 4PJJA 1KB9E 2WZ7A 3TK0A 1GL2B 3H1KE 4W7YA 5KYYB 1S05A 1BE3G 3W8IA 3AE3C 3QW0A 1URQB 4XEVA 1GK6A 1HH0A 1CPRA 1JMBA 4H44B 4JVSA 2YLGA 1RMVA 2XLDA 2E76B 3Q5RA 3I5PA 2IBZI 3MUDA 4OINF 2BCCD 1X79B 3DE9A 2TMVP 3VF0A 4C3EA 3A0BE 3P8CE 3H2VA 3KH2A 4R4LA 3QVZA 4J7TA 1GU4A 3T6BA 2V7QJ 1PGJA 1MMDA 1RY3A 2L5GB 4PV1D 1JMWA 3EQ2A 1U6HA 1H7IA 1YI2P 3PHLA 4U3FJ 1U57A 1FU1A 2ITAA 3TF5A 1WRGA 3M91A 2A0UA 1YYJA 1P84D 1GTWA 3ZSUA 2IBZG 3M79A 1TFKB 2XS1A 3TULA 2A45G 3MYIA 1OR2A 5AC5A 1AQTA 1NTMJ 4ZMDA 1OKKD 1ST6A 2HSQA 5AW3B 5BVZA 2FYUG 3EH1A 3EGDB 3Q6NA 3GEIA 3U59A 3UIAA 5CCGD 4PJ0H 1RHZB 3VTPC 2WL8A 3M1CB 2X51A 1P84H 5DQTA 3L75D 4OH8B 4PJNA 5JT4A 1NH4A 2CYDA 3SXKA 3WUUA 2ETSA 3RVYA 2Q00A 4IJJA 1GK4A 1JNMA 4O6YA 5T3TA 2QM7A 4JYBA 4CDAA 3NYMA 3QWOC 3G71P 1OCZC 4H13C 1EXJA 2EPNA 3VMAA 3E7KA 3DZAA 3F46A 4EHPA 2YNYA 3WAQA 3M9BA 3A7OA 3NRHA 4H4KC 2VCAA 2F22A 3L70J 2XSEA 4D6TD 1CI6B 4EKWA 1AV1A 4U3FD 2EPKX 3O39A 2PNOA 2Y9YA 2P58A 3KPEA 3K66A 5C39A 2XLEA 4BJTA 3CCVP 2ZXEB 2WVNA 1E2XA 4EIYA 1HVVA 2N1TD 2QE7H 3ZC4A 3IQ5A 1WATA 4U5CE 2YO3A 1YAUO 1RJ9A 1S9KE 1ZHXA 1JY2O 4EBKA 4OIPF 4OD5A 1SQBJ 1W2BO 2HR3A 5K0IA 2O3JA 4CPGA 1BDCA 1CGOA 3N0TA 2R7TA 2BCCE 2WSFJ 2W6BA 4GDOA 4GODA 4N6HA 1N86A 2P7JA 4EOTA 4GOFA 2PF4E 3FXDA 1SVFA 2KXPB 4B86A 2C9LY 1YA7O 2OYIA 2H8PD 1H6GA 3ABMC 2J45A 4OVNF 2M8RA 3CSKA 3AE4C 4Z9JA 5APSA 2HODA 2O01J 1SQQD 2ICWG 3IN6A 1KU2A 3WU2E 3FXHA 2ZVNB 4WGZA 2IZ0A 3M9HA 2FYUD 3AEAC 3IEEA 2J5UA 1NFNA 3KKBA 4NTAA 1NU1E 4XPXA 1WASA 1PV3A 2KNHA 4NTBA 3FAPB 4N4WA 4JCHA 4LLCA 3PJSK 3HNJA 3Q7GA 4JJGA 3S29A 2N9BA 2LP4A 1VQ6P 2R25A 4IL6E 2FAPB 2W83C 1S9KD 3T6GB 3B5ND 3R4YA 3RL0B 1NHLA 1YZCA 5EHHA 5EK0A 1V74B 3NDBB 3SXMA 1Y47A 3H1IG 4KI2A 3VAYA 3BCCG 2WSEH 3VMYA 2CW0F 5KYUB 1L0LK 1EDIA 1UFBA 1NTZE 1NAYA 2WPVB 2VRSA 3DM9B 1MFZA 3L75G 4LC1A 4PFOA 4O79A 2IBZE 1WMKA 3FXEA 3SEOA 1W2EA 2P1AA 1NU1D 2OKUA 2X0CA 1FBMA 3L72D 2HJMA 3L71E 1ZYRF 1KQLA 1NO4A 2G3AA 4PJ0E 1FS0E 2G3VA 2UUIA 1S7ZA 2MWQA 1M1JB 1NG1A 1OWAA 1K9MQ 1M90Q 4PR9A 1L0NJ 2OTJP 3EZIA 4AK9A 3NG1A 3CWBE 4EYYQ 1NTZD 1KYOI 1G8XA 2YXQB 5DS5A 1KFMA 2WSEJ 3OA1A 3AE5C 4O9BA 4OIQF 2WTYA 1SF8A 4YL3A 5HSWA 3G3ZA 2Q3IA 3C8GD 2YKPA 1NU7D 3GF3A 5L0FA 2RD9A 2PFDA 2NUTA 2ZYAA 3TD7A 1SQXJ 1M1JC 5L0HA 4L74A 4MVZA 2DYRC 4UDVA 2BE5F 2PGDA 1SZIA 3HRNA 2QJPC 4L76A 1WWPA 4FAPB 2P0NA 4ZLDA 2V7QH 1E84A 1IZNB 1Q86Q 1RF0A 2WPRA 3OWTA 1Z56A 1T2KC 4ONSA 4LLEA 2ZVOB 5KYXB 4ZNCA 4NTFA 3BCCE 4C7NA 2EIMC 3V4WA 1LI5A 1GS9A 4EWCA 3HD7B 5F5HA 1VL2A 2B9BA 4NC3A 4G0HA 4U3FG 2R5BA 4WBAA 1RF1A 2JWDA 4BRYB 4A2NB 2B0HA 3C18A 2OOCA 2MKVA 1KB9H 1D1AA 3MUDC 1D0XA 2R7WA 3P32A 4NQFA 1PPJG 5APQA 1ZP0C 1QVXA 1PP9G 3S4RA 5E3AA 3W8HA 3AG1C 3WU2H 2L81A 2YL0A 2H7BA 3HTKB 4E0HA 3H1JD 3ZTZA 3U8VA 4DRHB 1SFCB 1Z3IX 3B0UX 4U5HA 1M56C 1YVIA 5AVWB 5L0JA 4YK5A 4IAQA 1JTHB 3HNKA 1MKMA 1H8AA 1M7LA 3CCEP 2LD6A 1FZGA 2NG1A 3G4ZA 4N6CA 1L4AB 3U3BA 1O87A 1G1JA 4QMAA 3RK2D 3VMZA 4MN4C 1BDJB 4DXWA 4EUKB 2NRGA 1TQGA 2EIKC 2VC9A 1R8EA 3IQCA 3TGUD 2P10A 3SWKA 1NTKD 2C0WA 1A41A 1YQ4C 1FZCC 3F89A 2HUJA 5DJUB 3RGUA 5E3CA 4R32A 1RKCA 2OYOA 3P8CD 4JC7A 4W8KA 3C1LA 2D5RB 1A02J 3CC2P 2D2CD 4JPZB 1SQXK 4Y28J 1N7LA 5KYNA 3Q1MA 4BJ5A 1JCCA 1H89A 1VQ4P 4CIPA 2W4MA 1VB5A 1VLTA 2FYNC 1KILD 1Y9BA 1D1BA 2AWCA 3EFGA 5H2FH 2WT7A 2B87A 4GQHA 4JEAA 2QG4A 2ZXOA 5IY5C 3CWBG 1VQ8P 1FTSA 4DRJB 1LWUB 2KLVA 4AUWA 1RE3A 2JDIH 3KXDA 1APCA 1G4US 1NU1G 1MMGA 1Z23A 2IDBA 3KZIE 2D4UA 1PIXA 1SS1A 1ZRTE 2E75D 2HYNA 2WZFA 2Y0DA 3K7DA 5L8RJ 2V26A 1CI6A 5CI8A 2YMKA 1Q7YQ 5FCLA 2E43A 1Q90D 5JP7A 3B5NC 2JR8A 4JW1A 5A6BD 2G62A 5JRAA 5M1BA 2WT7B 1L4AC 2WVRA 2Q7CA 3HKKA 3L73G 1BZ4A 3OAKA 2FXMA 4E18A 2WVOA 2YL3A 2J46A 4MVOA 2QJYC 3ZWIA 1UIXA 3AG2C 3NMJA 3JRMO 3OEOA 4BG0A 1DD4A 3ZDMA 3Q5SA 1G2CA 2O01N 1RE3C 3V2NA 1LTAC 3A3YB 2A0BA 3LESA 1JPJA 2GWWA 1N7SB 1VQ9P 1ZZPA 1YARO 3IHUA 5KYWA 5AVXB 3GW6A 3AE2C 1GDTA 3WUVA 1VQ5P 5KYWB 3H1LE 2XV5A 3K1IC 2Q6QA 2ASRA 3FOOA 1FDIA 3ZDLA 1LWUC 2LXBA 1WGWA 1LKXA 3QW1A 4AL0A 2WSCH 1L0NK 1ZHYA 2J58A 1VMAA 3LUTB 4CS8A 1L3PA 2Q9BA 1KQFB 2FYNB 2RSEB 3KQGA 1LT9A 2LXCB 1T3JA 4I1LA 4UB6H 5KJ7A 3U0CA 4LDQA 5F5FA 2QLAA 1T6AA 4WY4A 5AVYB 1FNTc 3QTHA 1JOCA 3B0PA 1DOVA 4WY4B 1RE4A 1D7MA 3CQZA 1HWTC 1RCPA 1S4XA 4I44A 4OGQD 2IYLD 2JX0A 1S1CX 3A5TA 2R05A 1YA9A 2YHSA 2GUVA 2R7UA 4IOIH 1Q82Q 5JSLA 4QI2A 5JLIA 1YTZT 3PTZA 1HE1A 3Q5PA 1QSPA 3AECC 3ZTMA 4BJ6A 4I7ZB 1BR2A 1LTGC 2YQYA 3T4RA 3H1HE 2QM8A 4K7BA 3CCUP 2L6HA 2QRXA 3HE4B 5KLVG 1J8MF 2GUSA 3H1LJ 1GL2C 4N06A 5AVSB 4MW3A 1J1EC 2NUTB 2PX0A 3CX5D 1W2WA 2DGJA 3M4CA 2NSGA 3B8EB 2PBEA 2Q9IA 3N24A 3VYIA 1TR2A 2YLIA 3FVYA 3E9VA 2KS1B 2A6EF 1D0YA 1NWQA 3VM6A 2QNLA 1IFNA 3MBGA 2L6FA 4C46A 3V2PA 4C3DA 3S9OA 2ZJSE 5AVVB 2QSIA 2OTLP 2R7SA 1HW2A 1T6QA 3DM5A 3U2MA 2DYSC 5CCGC 1Y4CA 4IFDK 1YIJP 3VYWA 2VB6A 1HBWA 3CCRP 3LAYA 1GZLA 4H13D 5APTA 4JF7A 1RF1C 2R32A 4U5EE 1EQ1A 1PFIA 1F1MA 1NJIQ 4CS7A 5BU8B 2M5AA 3LW5J 2L9JA 4ER9A 4W8PA 5K5GB 1DD3A 5D91A 1GU5A 1R5ID 2LFFA 1KMIZ 4CX9A 2E5TA 2P61A 5A6BA 1OZHA 1SQPG 1KN7A 1EI7A 1NTKK 4PJLA 3L36A 3AE9C 1EC5A 1RF0C 3VMXA 2GA0A 2XKMA 3JCUQ 5CI9A 3MYFA 3G4SP 4CS9A 3D71A 2J9WA 2AU5A 1PP9D 3U1CA 2M3BA 2R03A 2WWWA 1CW5A 2Q3TA 4C3BA 1J1DC 1Y6DA 1SFCA 1IZMA 1VPCA 1M1JA 1VF5B 4E0IA 4MNDA 4AX2A 3S0XA 1OQCA 4PJMA 1KV4A 1WT6A 2UUHA 2NUPA 2WQYC 4O6MA 1SQBK 5COGA 3IAOA 4JJFA 1SQQJ 2WITA 3WG7C 1SP4A 3P7KA 5KJ7C 3LW5H 4BJ5C 3CXHE 4WWIA 2WZGA 4KJMA 1OCRC 5L3QA 2YIUB 3M0AA 1LJ2A 1HMDA 4JZAA 3BATA 3U2LA 4MQ9F 2DI3A 1ZXGA 3EZHA 3TK1A 4FX5A 1EZVE 2XL4A 2HMZA 3K1HA 2KOGA 1AEPA 2YZSA 4U9DA 3UMIA 1OFCX 4U3FE 5CBOA 5GTIE 2IXMA 3JTLO 1M57D 5KAFE 2HZ8A 3CX5E 1KILE 1IFJA 3CD6P 3WUTA 2O9XA 3PCVA 2Z5IA 1HE9A 1WN0A 5T1DB 2KIKA 3PDMP 1RQVA 1S5LE 4D4NA 2L6GA 3PLNA 3AE1C 3RK3D 1URQA 4XEFA 4CJGA 2R3CA 3M0DC 1N7SA 1ZW2A 4W80A 2IZ1A 1LP1A 3V5BA 1ZHWA 1BE3E 4ULVA 3U9MA 5EGYA 1U0BB 2Q9AA 3U8PA 2O1JA 2B0JA 5DQZA 2IXNA 2W45A 4KHXA 2AXTE 2XL8A 4I6MC 2AP3A 2J7PD 3T97B 3CPWO 1A7VA 4IRUA 2HKVA 1M1KQ 2VH3A 1Q2NA 1V4AA 2XM4A 3FOPA 3F5HA 1EDLA 2KGOA 1JY3P 3BRTB 4PD4I 2J9UA 2EIJC 3POVA 4HH2A 4PV1C 4FESA 4LLHA 1PD0A 2LIGA 2BEZF 1T3UA 2ZT9B 1BBHA 2M5AB 1PGPA 2LK4A 3RK2C 3U1AA 1M57C 3JRTA 2FY8A 3U5SA 1C02A 4HEAJ 4DBRA 1YLMA 3I5CA 5D92A 4R4MA 1V54C 1FZEA 5JUAA 1GGQA 1TWGA 2A1DD 4ULWA 1PP9J 4Y99C 3HE4A 3D6ZA 3HNLA 5COMA 1FAPB 1U89A 4YWQA 1NTZG 3Q7LA 1HGZA 3MTUE 1ZLLA 2K9JB 2XLWA 1LS1A 2W6AA 1KD1Q 1MNEA 1XZQA 5B66E 2BEQD 1SQVJ 2EPLX 2E5YA 1NYHA 5DS4A 2R7VA 1VQNP 3H32B 5AW2B 1VQKP 2OQQA 4KNWA 2QVAA 1KB9I 3B5NA 1OVVA 2QY9A 4PFPA 2EPMX 3AE7C 5KLVJ 4BJ6C 1P84E 2RN0A 1ORJA 3IF4A 3HUSA 1MUUA 5BUOA 3UMKA 3MIWA 3HNIA 1NU9C 3TQOA 2Y3GA 4W7ZA 2ZXWC 5L0IA 1HTLC 4JTDB 3NMKA 2NUPB 2WPSA 3ITKA 1JO5A 3LEVA 4X0RA 2QEXP 5E2QA 2FXPA 3TDKA 4UB6E 2P2UA 4ZLCA 2QUPA 2GM4A 4I1MA 1K40A 3I56P 3TYYA 1QLED 1SQQK 5AVZB 4A4AA 4N6JA 4GYTA 4IWBA 3EG9A 1BR1A 2WB7A 3GM1A 5BQHA 1G2CB 2OEVA 3W67A 4E7SA 3N2ZB 3MFNA 1SQPE 1BCCD 1GQAA 2JJLA 4F4BA 1FZBA 3A11A 3O6XA 4M63A 5E79H 1RQUA 4JTCB 1NTKE 3D70A 1ORSC 4RD9A 3O8ZA 2P1JA 3VP8A 3L1MA 3H1JG 2VCCA 1ZW0A 5CJ0A 3CL3D 4TT3H 5GTHH 5E79E 3L72J 2RKLA 3L70D 1MV8A 4BJ1A 3ZG1A 1R5LA 5KLVD 1L0NE 2ZXPA 1NZEA 3GEHA 4JQ0D 1LI7A 3L74D 2IPPA 3BCCJ 2Q3EA 2CDQA 4H0LB 2E74C 2NPSA 3R7CA 4U5FE 1AQ5A 3SXYA 3JCUH 3MD0A 5L0DA 1BDDA 3GWLA 2POHA 2MJZA 1SQVD 2NPSD 1IO4A 1I4ZA 2Q7RA 3H25A 2E74D 4DVZA 5AW5B 1KILC 1AA0A 2XZRA 2MYSA 3NMIA 1EDJA 4FWVA 4G7HF 5TJHA 3EFFK 1DH3A 4MVSA 4JCZA 1LVKA 3K5BA 1JB0J 3GHGC 4IL6H 3JSZA 3RQGA 3TGUE 3RQEA 3UNGC 1CGME 3HD7D 1URQD 3V5XA 1H0TA 5KLIC 5BQIA 4CDYA 1USEA 4NCQA 3CCQP 3H65A 1O5HA 1M2VA 2W4BA 4JYCA 1CSBA 4JKVA 5KTBA 2FXOA 2CK3H 2IBFA 2K88A 3GEEA 3KL4A 2YXRB 1ZRTD 2Z5HA 5APXA 4PV1B 2Q4FA 1PGQA 3EJNA 1I4YA 3ABVC 1ZHTA 3II6A 2J0WA 3L72G 3TJ5A 4WVZA 1KYOD 4QI0A 1S3JA 2IM8A 5AW9B 4AE4B 2A6HF 1BCCJ 1IFMA 3USSA 1EZVD 1TWAA 2YL1A 3RL0C 3SZRA 1G1IA 2PFXA 1TU3F 1KQGB 2K37A 2HFIA 3EH2A 4YJWA 4ANJA 1FFHA 1OXZA 3AGUA 1E86A 4CS9C 4A7PA 1LPEA 2PP6A 2QE9A 2KZIA 1VQOP 3HTKA 4XPYA 4L6RA 2YLDA 2I1JA 2R7OA 5KAFH 1TWHA 3RK3E 2FBWC 2KSJA 2OCCC 2A06E 4MVUA 1OR3A 2GA1A 3L37A 3MGNA 1EZVG 3C8ZA 1FZAA 2CNWA 4QDLA 1HUCA 2R02A 4YL0A 3BRVB 1FOSE 4P9FA 1A7EA 2ZYGA 3CC7P 3NKEA 2SPZA 1GW3A 1XWJA 5APVA 3N4XA 2OU6A 2OYIB 4B6IA 3JZ0A 2I8DA 1KYOH 2ZPAA 2J59M 4G7OF 5TISH 2B87B 2BASA 3RFYA 3DWWA 3PHF2 3VOPA 2AEMA 2YIUC 2Y69C 3SFDC 3RBZA 2AEJA 3L73E 4RKUJ 3H1LG 4MTGA 2NZ2A 1LTIC 1NTMD 2DW3A 3V5YA 4O6NA 1SQVK 1OX3A 1S2EA 2PRRA 4UB8H 1R5SA 1FOSF 2HLOA 3CCJP 3CMEP 1RKEB 2I15A 5KKZB 1L0LD 3OJAB 1HF9A 4DOJA 4HJGH 1ZU5A 3IR9A 2E76D 1ZV8A 4ZKPA 1YHQP 4E7ZA 3V7OA 4PD4H 3MX3A 2IBZD 4U5DE 2IFNA 3O55A 2OYIC 2FFHA 1N7SD 1SQQE 4U5BE 2ZXXA 1SQVE 2IXOA 4U9EA 2KQ9A 3NFQA 3SSUA 2PAJA 4CSAC 3JC22 1KTMA 2K3RA 1ZMEC 3L34A 4LACB 4WABA 3AE6C 5L0GA 1JY2N 5KLIB 4PD4D 3O6QA 1L2PA 3I55P 1SQBD 4RO0A 1OCCC 5CCHA 3L71G 3EG9B 2WSCJ 5JS5A 1CPQA 4I2LC 3IQTA 4D4XA 1RKEA 1FMWA 1S5LX 1E79H 1BGYJ 5DS6A 4OGQB 1FMVA 3EPVA 4DCKA 3AGTA 4Z9HA 5B3IA 5COFA 2QA4P 2M0BA 1GL2A 1YYCA 2N9YB 5KJ7D 3BASA 2HJ3A 3ASOC 3KYJA 3NYLA 2OJED 1Z63A 3W2WA 2LKMA 4Z1MH 2KNCB 5BQGA 4NPDA 3CXHH 2QJYB 2UWJE 2Z4EA 1C17M 1PZQA 1JR8A 1QVGO 1ZU4A 1RF1B 5CBNA 4RJTA 2FGYA 4I1OB 1RH5B 3LLIA 4ASVA 1KQSO 3V2RA 3L8JA 1T9KA 4DJ9A 1ZHZA 1N73B 3R2PA 3P8MC 4YT2A 1TWCA 1NTKJ 4MW8A 1EKYA 3SWYA 2LQGA 2FYZA 2A69F 3TGUJ 1NFOA 3NYJA 4H44C 2AVKA 3ZIBA 2N1TB 2IYOA 3CX5H 3C8GB 3QZCA 5AVTB 2N1TA 4K3AA 2FKWB 3KZIH 3RBXA 3L8IA 4H13B 1NKNA 3ASNC 2R44A 1OVRA 4L73A 4MVRA 4DVYP 1L0LG 4MVMA 1SQBG 5CCGA 3DJNB 1AFOA 2RMZA 4LDRA 1LTJC 4NY3A 1M8OB 3H1JJ 1PGOA 1T2KD 1EDKA 5DJTB 1Z6AA 2R7XA 3LIDA 1BSHA 3RK3C 4E17A 4XWJA 1NAFA 1BCCE 1W5CE 4CSAA 1QVFO 3V5ZA 1TFOB 4DZOA 3AEDC 1VDFA 3LS0A 1M6TA 4RDAA 4JBZA 2HFED 3L70G 3J06A 4N78E 1MMAA 3HUSC 4RESB 1OXBA 2KSEA 2NPUA 2YWAA 3GM3A 3HJCA 5APWA 3S27A 1EXIA 5AVRB 1LM3B 3H1KD 2GDCA 1WOLA 1FR0A 2V4HA 4C7OA 3EFOB 3RL0D 1D0ZA 3BVHA 5CJ4A 1ORYA 3VRCA 2KYVA 1SFCD 1LP1B 1FC2C 2L7AA 3O6QB 3HUSB 2LCHA 4MVQA 2XRHA 1K04A 3I5QA 2DB4A 2ZT9C 4LERA 4HYTB 3ZQVA 1SFCC 3H1JE 3HLZA 3RYLA 2V3CC 1IFDA 3H32A 5AW7B 1LE2A 4AYCA 5B3SC 3A0BH 2LR2A 4YPCA 3H1LD 2H43A 5CIVA 4MTFA 3OA7A 2A06G 3A0HE 3FGAD 4J32B 1OW6A 2HPCA 3RK2B 2AWYA 5A6KA 2Y3DA 2KJGA 1LS4A 5AGFA 1AUEA 4GKGA 1S72P 3FX0A 3H1IE 3ZQYA 4XLPF 1YJWP 2KP8A 1SQPD 2E76C 4JTAB 4CDVA 1NBBA 3N7NA 1G5ZA 1JOGA 3PRJA 1RXQA 5APYA 2OEXA 2W9YA 3HD7C 5CHXA 2A45H 1V55C 5AW4B 3M9QA 1RJ9B 3ABLC 1J1DB 1K73Q 1IC2A 4Z9IA 3LIEA 4IGGA 4YN0B 5L0CA 1IJDB 1J2JB 3V6IA 3C8VA 2FFDA 3EGXB 4OD4A 2E42A 1LTBC 3C7JA 2WPQA 1NU1K 2I8BA 3AEEC 3CI9A 1MNDA 5JVEA 3H1HG 1VOMA 1N2DC 5H2FE 4NPEA 2KYHA 5FZTA 3T97A 1BE3J 2QJKC 3NXSA 3L73D 4P6IC 3CCLP 2ZFCA 3L4FA 2OQMA 1I5NA 1U7JA 1L7CA 1QX8A 3EHNA 4WB4A 1VK5A 4L75A 2HSBA 1FDMA 1R4TA 2ZT9D 2HPCB 3K1IA 5TISE 3EGXA 1HJBA 1DX7A 3DAFA 2NSFA 2P6VA 1BCCG 3JT1A 1A02F 1HMOA 3MP7B 2WZLA 1L0LE 1GL2D 1K05A 1AVYA 3DJUB 4CIHA 3CWBD 4JEBA 1VQ7P 2H89C 4WGYA 4H44D 2B89A 1IK9A 1NSGB 1X22A 1VQPP 4UB8E 2B88A 4CBEA 2YO2A 1JY3O 2XNDH 2HV6A 3FMSA 4AQRD 2Y39A 1L4AA 1IFPA 1QLEC 3G9RA 5B1BC 1QQ3A 3GODA 1QL2A 3CCMP 3L0IA 1LT1A 2BL2A 5GPGB 3FAJA 1GMJA 1IK7A 5E33A 4I3MA 3DKAA 4YT8A 2JKVA 2CCYA 5AW0B 5T3WA 2JEEA 3SWFA 3DAGA 3GWNA 2I1KA 1PPJD 4KNVA 3CWBJ 2XXAB 2R3SA 5BU5A 3FWLA 3WHNA 4XPWA 3GG2A 2A45I 2K9JA 3UGPA 2Q1KA 1PPJE 1DEEG 1JAFA 2Y3BA 4KBLA 1L0ND 5GTIH 2W90A 1H88A 1YQ3C 2OG2A 1J8YF 1PD1A 1VF5C 3WODF 2Y3HA 4WY4D 4DRIB 1VQMP 5KKZC 5KLVK 3SFEC 1B68A 1K8AQ 2H7VC 3DD7A 4PK4A 3D6YA 1SQQG 4YTPC 1HJ0A 3EFOA 3S90A 1YTZI 3TNUA 3B71A 4C7NB 3RW0A 3SNHA 1ZN5A 2W27A 2HS5A 2M4EA 2FYUE 4YXWH 3LEOA 2KB7P 3JCUE 3GM2A 3H1HD 3LLKA 1LTJA 1NKZB 3G4XA 4EI2A 2IFMA 2A68F 5DVWA 2IX7C 1KILB 4PACA 1DOWA 1SQPJ 2YVKA 3GHGB 1SQBE 1JMMA 1Q81Q 1N8RQ 3ABKC 2XS8A 4BEJA 4H0LC 1H9GA 4BWNA 2EINC 1D1CA 1HW1A 4I7ZC 5AW8B 3H1HJ 5A6JA 3BEHA 2CPSA 2RH0A 2YMYA 4JRZA 2E75B 2K9YA 4LDKA 3S1KA 3FWNA 3ATPA 5B66H 1N73A 1J1EB 3CXHD 3M15A 2MHRA 4YL1A 2E74B 1Q0FA 2JPUA 5CMZA 2O01H 4Q4ZF 5AVUB 3US6A 3U3FA 3Q2YA 4HKZH 4U5GA 2L91A 3E1RA 3H1KJ 3F47A 1XTGB 1N7SC 1M56D 1HGVA 3CEXA 2C9NY 3CAXA 1LWUA 3AOUA 3C62A 2BCCJ 2BCCG 3DXJF 5KYUA 2QJKB 1NGMB 3MHVA 3RKOF 1VQLP 1E83A 3H1KG 4CS8C 2Y0EA 3EGDA 2OYHC 1U7MA 1WTYA 1SQXD 1SYQA 2JP3A 1BSNA 1MQVA 2KS1A 4N3YB 5A69A 3X1OA 2WMMA
chains in the Genus database with same CATH topology
3R4YA 3C8GB 2QSIA 4XEFA 3K7DA 5L8RJ 5KKZC 2YMKA 4H0LD 3C18A 1Q90D 1PL5A 3JYYA 1VF5D 3SFEC 1KORA 2MKVA 1OMIA 1FDOA 5M1BA 3L8IA 4H13B 3D6YA 2Q00A 4NQFA 4PV1B 3C8VA 4YTPC 1HF9A 1ZP0C 2FXPA 1HJ0A 4H13D 2E76D 1QVXA 1UFBA 2WPVB 2QJYC 3AEEC 3B71A 1UIXA 3ABVC 3LW5J 2JO1A 1OW8A 1DD4A 4H13C 1DIPA 1OW7A 1DD3A 3AE8C 1K40A 1EXJA 2D2CC 1KMIZ 3BRJA 1WMKA 2QJKC 3Q5SA 1KNYA 3T97B 4XFJA 3GM1A 3GM2A 3O10A 2G8YA 1V4AA 1ZZPA 1TU3F 1KQGB 3AE9C 1MKMA 3MFNA 1KTMA 3AE2C 2E75C 1ZMEC 3AJMA 3RQFA 2HSBA 2G3AA 4PV1C 3D71A 2ZT9D 3AE6C 4IL6X 1FDIA 3AEDC 1RQUA 2KK1A 3Q3DA 3GMAA 2BEZF 3D70A 3O6QA 2ZT9B 3AEFC 3GLMA 2LK4A 1R8EA 4H0LC 3AE3C 1VF5B 2P10A 3C8GA 4XEVA 2WSCJ 1KQFB 2YWAA 3GM3A 1K05A 4EBKA 4TT3H 4H44B 4R4MA 3RK3E 4I7ZC 1YQ4C 3U0CA 2WQYC 2FBWC 2H89C 1EXIA 2E76B 3Q5RA 4H44D 3IAOA 2WSEJ 4R32A 1S5LX 3AE5C 1WOLA 2WSFJ 2E75B 2K9YA 4GDOA 3RL0g 4KT0J 4OGQB 3D6ZA 3C8GD 3GF3A 4H0LB 2E74C 4R4LA 4XEKA 4OGQD 2V7QJ 2JX0A 2D2CD 2E74B 3G9RA 1S1CX 2JPUA 1AJYA 4Y28J 1K04A 3AE4C 2ZT9C 4OGQC 3H25A 2D2CB 2E74D 4PV1D 3JZ0A 1GMJA 1O3UA 1IK7A 3U3FA 3AEGC 3Q1MA 2O01J 3Q5PA 3AECC 1U57A 3Q2YA 2BEQD 4Z1MH 2H88C 1ZOYC 4EBJA 1NYHA 2QJPC 4I7ZB 1WWPA 3IN6A 3GF7A 2OQQA 2FYNC 1Y9BA 2YIUC 2L6HA 3EWKA 3FGAD 2QIWA 1OW6A 3SFDC 3AEAC 2J5UA 3L8JA 4RKUJ 1JB0J 3AE7C 3TULA 3RQGA 3RQEA 2NZ2A 1NGMB 4U7JA 2PBEA 1KILE 1PV3A 5KLIC 1WTYA 2E76C 1VL2A 4YXDC 2IDBA 1JOGA 2JP3A 3AEBC 1RQVA 1YQ3C 4H44C 2L6FA 5F28E 1PIXA 1ZRTE 2L6GA 2E75D 1VF5C 3S9OA 3AE1C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C8G B;  4XEF A;  3K7D A;  3C18 A;  3JYY A;  3SFE C;  3L8I A;  2Q00 A;  4NQF A;  4YTP C;  1ZP0 C;  1QVX A;  1UFB A;  3AEE C;  3B71 A;  3ABV C;  1OW8 A;  1OW7 A;  3AE8 C;  1K40 A;  3BRJ A;  1KNY A;  3GM1 A;  3GM2 A;  3O10 A;  1V4A A;  1ZZP A;  3AE9 C;  3MFN A;  1KTM A;  3AE2 C;  3AJM A;  3RQF A;  2HSB A;  2G3A A;  3AE6 C;  3AED C;  2KK1 A;  3AEF C;  2LK4 A;  3AE3 C;  3C8G A;  4XEV A;  2YWA A;  3GM3 A;  4EBK A;  1K05 A;  3U0C A;  1YQ4 C;  2WQY C;  2FBW C;  2H89 C;  4R32 A;  3AE5 C;  1WOL A;  3C8G D;  4XEK A;  2JX0 A;  2JPU A;  1K04 A;  3AE4 C;  3JZ0 A;  1O3U A;  3U3F A;  3AEG C;  3AEC C;  2H88 C;  1ZOY C;  4EBJ A;  1WWP A;  2L6H A;  1OW6 A;  3SFD C;  3AEA C;  3L8J A;  3AE7 C;  3TUL A;  3RQG A;  3RQE A;  2PBE A;  1PV3 A;  1WTY A;  4YXD C;  1JOG A;  3AEB C;  1YQ3 C;  2L6F A;  5F28 E;  2L6G A;  3S9O A;  3AE1 C; 
#chains in the Genus database with same CATH topology
 2ZD9 A;  3RVZ A;  1YJN P;  4HE8 D;  1BR4 A;  2KLU A;  1RE4 C;  5CCH C;  5B1A C;  3B5N B;  1NTZ J;  3JYY A;  4JE9 A;  2HG5 D;  1KOR A;  2VCB A;  2R9R B;  3V4Q A;  3CXH I;  2J9B A;  1H0T B;  3DI5 A;  3SYN A;  3EQL F;  3CMA P;  4IAR A;  3UR3 C;  2YKQ A;  1X0T A;  4D6T E;  1H9T A;  1C03 A;  1OW8 A;  1OW7 A;  1FJK A;  1L0N G;  2OYH A;  1EA8 A;  1Q0G A;  3QVY A;  3QH9 A;  1BGY E;  5A6A A;  3DE8 A;  4IFF A;  1FE6 A;  2KZJ A;  4PD4 E;  3HTK C;  5KYX A;  3B0V C;  3M4B A;  4C7O B;  3AJM A;  2P67 A;  2LFD A;  2XLO A;  1FZF A;  2KK1 A;  1Z5Z A;  3NTN A;  1JUN A;  1Q0K A;  1JY2 P;  2R5D A;  1KC8 Q;  4Q5S F;  3KMI A;  2HOD B;  3GLM A;  3L75 E;  4HB1 A;  3A0H H;  5KAI H;  4DJG A;  4K35 A;  3C8G A;  3TJ6 A;  3SXZ A;  5AW6 B;  2XL6 A;  1OCO C;  1ZR4 A;  2WSF H;  3LS1 A;  2IYP A;  3CZ6 A;  1L0L J;  3L73 J;  4XA4 A;  3TSI A;  1GM5 A;  4KT0 J;  2HV7 A;  2J9V A;  4GT1 A;  3L74 J;  3M0D A;  1YJ9 P;  4CJO A;  1URQ C;  2AXT H;  2EPO A;  3L70 E;  2Q9C A;  5GTH E;  4XEK A;  3B29 A;  1JCD A;  3JSV C;  4OGQ C;  4G7Z F;  3E1I A;  2VAS A;  2Y9Z A;  3K6B A;  1LGH B;  2J8W A;  2H88 C;  3RF3 A;  1BGY D;  1NTK G;  2XDJ A;  5B5E H;  3GF7 A;  1AVO B;  2E87 A;  1QKR A;  3S84 A;  2YRF A;  1QPU A;  2QIW A;  3IQ6 A;  1AVO A;  2FFD B;  3M06 A;  1ZR2 A;  4DOZ A;  1NTZ K;  1JPN A;  2M64 A;  2KW3 C;  4C7R A;  1KZU B;  3HE5 A;  4J30 B;  1KB9 D;  1SQX E;  2J7P A;  2IOQ A;  4OIR F;  2H7H A;  2JD3 A;  3K33 A;  4TLF A;  1MFT A;  2GFH A;  1SQP K;  1VF5 D;  3U9J A;  3WMM 0;  3SP1 A;  1FDO A;  4HFK B;  3VN0 A;  2N1T C;  2G3K A;  3CLQ A;  4G78 A;  1FZC A;  5L3V A;  2XM0 A;  1GW4 A;  2A06 D;  1JEK A;  1OIP A;  3L72 E;  5TJ5 E;  2OYH B;  1VYI A;  3L71 D;  1NVO A;  1T5O A;  3KYI A;  2WVQ A;  1KNY A;  2YL7 A;  3GOR A;  1YDI A;  1JY3 N;  5APU A;  2Q5U A;  1T8Z A;  3AQB A;  4IB4 A;  2AEF A;  2E75 C;  4Y99 B;  1TKN A;  3IPM O;  1LT9 C;  1XTC C;  3RIP A;  4IL6 X;  1NTM E;  2NPS C;  1FZC B;  3Q3D A;  2OTK E;  4K1O A;  1L4A D;  3KYQ A;  1QZX A;  2BC5 A;  4BEM J;  2ZXR A;  1YBK A;  4AE4 A;  4GEH A;  3T6J A;  4N78 D;  1EQ7 A;  4XTK A;  4HFF B;  4BXL A;  1Q0D A;  3V2Q A;  2XXA A;  3RL0 g;  1IFI A;  3RK3 B;  3E70 C;  4NPF X;  1YIT P;  3KPH A;  3HD7 A;  1FFT C;  5KYY A;  1SMY F;  2D2C B;  4LGD E;  2CPB A;  2KI7 B;  3AEG C;  1LTT C;  2Y0C A;  1M2V B;  1G4W R;  2FYU J;  1ZOY C;  2XLV A;  2YKZ A;  3W2V A;  4EBJ A;  3BCC D;  3G6E P;  4RBN A;  3QMK A;  1JM0 A;  3W68 A;  3CCS P;  1NTM G;  3X2Q C;  1QEX A;  3H1I D;  3C9I A;  2O1K A;  4P9T A;  1VTM P;  4XLN F;  1NOH A;  3PMR A;  4BPM A;  1P84 I;  1E85 A;  2EIL C;  1ZVZ A;  1T01 A;  3LNR A;  1XZP A;  4KC9 A;  3G50 A;  1T6I A;  1SQV G;  2K1A A;  4DT0 A;  2LSE A;  1LE4 A;  3UMH A;  3W4Y A;  4GOE A;  2PX3 A;  4JUR I;  1E5W A;  1N73 C;  2KK7 A;  1SQX G;  3AG3 C;  3FDQ A;  4H0L D;  5HV9 A;  1OVU A;  1OMI A;  4MTO A;  3JYH A;  2NPS B;  3ITF A;  5AC4 A;  3PP5 A;  4J7Y A;  1Z7Q c;  2J0X A;  3MZW B;  5KLV E;  2XNX A;  1CGN A;  2JO1 A;  2W6J H;  3TNU B;  2D2C C;  1JRA A;  3LJB A;  1VLS A;  3PH0 A;  3ECS A;  4Q7C A;  4EBB A;  4XFJ A;  2R7R A;  4D6T J;  4ASW A;  3O10 A;  2G8Y A;  4AL1 A;  1A0B A;  256B A;  3L35 A;  4JIO A;  4OWF A;  5AVQ B;  2QJP B;  1HY5 A;  2C0X A;  3RQF A;  3MLG A;  1DEB A;  2KSF A;  2ZYD A;  1EZV I;  2OAR A;  4M3L A;  3UGO A;  2QTV A;  2OGU A;  3VP9 A;  4H54 A;  3A9C A;  5AW1 B;  5EFW B;  1YYX A;  3Q6M A;  4DBQ A;  1UII A;  1YZA A;  2KNC A;  2C04 A;  3L75 J;  2H8A A;  1LT9 B;  3EHM A;  3AQC A;  2HMQ A;  4BRY A;  2KC3 A;  4K0D A;  4YT5 A;  1JTH A;  1YJG A;  1CZQ A;  4XE5 B;  3KDP B;  2GAQ A;  3IFM A;  3OW2 O;  3H1I J;  1LTS C;  1FAV A;  1OKK A;  3TOM A;  4EDF A;  1AJY A;  3B9Q A;  3H6P A;  3L74 E;  1O3U A;  3FHD A;  1X8Y A;  3TGU G;  1BE3 D;  2C03 A;  3S28 A;  1ZW3 A;  1SLQ A;  3GAN A;  1LNQ A;  2PP4 A;  1NU1 J;  1NLX A;  4O7G A;  3EWK A;  2M3E A;  5CCH D;  1GD2 E;  4EIJ A;  1T6U A;  3C63 A;  3CX5 I;  1IW7 F;  4U7J A;  2P7V A;  1NTM K;  2H7O A;  1PP9 E;  4GIF A;  2ZAE B;  4YXD C;  3TOL A;  3AEB C;  5F28 E;  3AG4 C;  3T9O A;  2WSS H;  3CC4 P;  4IAO A;  2YKO A;  1KFN A;  1SR2 A;  2XLM A;  3KHU A;  1PCX A;  4MS2 A;  2XLH A;  1PL5 A;  2W8Z A;  4IFM A;  1VYK A;  5KAI E;  3L74 G;  1S5L H;  1KYO E;  1BGY G;  1A7D A;  1N1C A;  4XQ1 A;  2JWA A;  2AXC A;  3A2A A;  3GHG A;  1M2O A;  1MMN A;  2YEV A;  5DLJ A;  3I4U A;  2KUB A;  2FYU K;  2IXP A;  1DIP A;  3B4S A;  2CNW D;  3AE8 C;  3L71 J;  3BRJ A;  3JSE O;  1MZ9 A;  4YT4 A;  2FFD C;  3RH3 A;  3DMD A;  1LTJ B;  4OIO F;  1USD A;  1X9V A;  1UG7 A;  1FJP A;  4WJ0 A;  3ZVR A;  4WY4 C;  1QL1 A;  2CGE A;  1Q0M A;  3NMD A;  3HE5 B;  2XU6 A;  2R7Q A;  3GMA A;  5B5E E;  1QGK B;  1LIH A;  1OXK A;  2Z15 A;  3H2U A;  3NKD A;  2OJQ A;  3AEF C;  4D6T G;  1Y8A A;  1KIL A;  3LNM B;  4ZKU A;  4PJJ A;  1KB9 E;  2WZ7 A;  3TK0 A;  1GL2 B;  3H1K E;  4W7Y A;  5KYY B;  1S05 A;  1BE3 G;  3W8I A;  3AE3 C;  3QW0 A;  1URQ B;  4XEV A;  1GK6 A;  1HH0 A;  1CPR A;  1JMB A;  4H44 B;  4JVS A;  2YLG A;  1RMV A;  2XLD A;  2E76 B;  3Q5R A;  3I5P A;  2IBZ I;  3MUD A;  4OIN F;  2BCC D;  1X79 B;  3DE9 A;  2TMV P;  3VF0 A;  4C3E A;  3A0B E;  3P8C E;  3H2V A;  3KH2 A;  4R4L A;  3QVZ A;  4J7T A;  1GU4 A;  3T6B A;  2V7Q J;  1PGJ A;  1MMD A;  1RY3 A;  2L5G B;  4PV1 D;  1JMW A;  3EQ2 A;  1U6H A;  1H7I A;  1YI2 P;  3PHL A;  4U3F J;  1U57 A;  1FU1 A;  2ITA A;  3TF5 A;  1WRG A;  3M91 A;  2A0U A;  1YYJ A;  1P84 D;  1GTW A;  3ZSU A;  2IBZ G;  3M79 A;  1TFK B;  2XS1 A;  3TUL A;  2A45 G;  3MYI A;  1OR2 A;  5AC5 A;  1AQT A;  1NTM J;  4ZMD A;  1OKK D;  1ST6 A;  2HSQ A;  5AW3 B;  5BVZ A;  2FYU G;  3EH1 A;  3EGD B;  3Q6N A;  3GEI A;  3U59 A;  3UIA A;  5CCG D;  4PJ0 H;  1RHZ B;  3VTP C;  2WL8 A;  3M1C B;  2X51 A;  1P84 H;  5DQT A;  3L75 D;  4OH8 B;  4PJN A;  5JT4 A;  1NH4 A;  2CYD A;  3SXK A;  3WUU A;  2ETS A;  3RVY A;  2Q00 A;  4IJJ A;  1GK4 A;  1JNM A;  4O6Y A;  5T3T A;  2QM7 A;  4JYB A;  4CDA A;  3NYM A;  3QWO C;  3G71 P;  1OCZ C;  4H13 C;  1EXJ A;  2EPN A;  3VMA A;  3E7K A;  3DZA A;  3F46 A;  4EHP A;  2YNY A;  3WAQ A;  3M9B A;  3A7O A;  3NRH A;  4H4K C;  2VCA A;  2F22 A;  3L70 J;  2XSE A;  4D6T D;  1CI6 B;  4EKW A;  1AV1 A;  4U3F D;  2EPK X;  3O39 A;  2PNO A;  2Y9Y A;  2P58 A;  3KPE A;  3K66 A;  5C39 A;  2XLE A;  4BJT A;  3CCV P;  2ZXE B;  2WVN A;  1E2X A;  4EIY A;  1HVV A;  2N1T D;  2QE7 H;  3ZC4 A;  3IQ5 A;  1WAT A;  4U5C E;  2YO3 A;  1YAU O;  1RJ9 A;  1S9K E;  1ZHX A;  1JY2 O;  4EBK A;  4OIP F;  4OD5 A;  1SQB J;  1W2B O;  2HR3 A;  5K0I A;  2O3J A;  4CPG A;  1BDC A;  1CGO A;  3N0T A;  2R7T A;  2BCC E;  2WSF J;  2W6B A;  4GDO A;  4GOD A;  4N6H A;  1N86 A;  2P7J A;  4EOT A;  4GOF A;  2PF4 E;  3FXD A;  1SVF A;  2KXP B;  4B86 A;  2C9L Y;  1YA7 O;  2OYI A;  2H8P D;  1H6G A;  3ABM C;  2J45 A;  4OVN F;  2M8R A;  3CSK A;  3AE4 C;  4Z9J A;  5APS A;  2HOD A;  2O01 J;  1SQQ D;  2ICW G;  3IN6 A;  1KU2 A;  3WU2 E;  3FXH A;  2ZVN B;  4WGZ A;  2IZ0 A;  3M9H A;  2FYU D;  3AEA C;  3IEE A;  2J5U A;  1NFN A;  3KKB A;  4NTA A;  1NU1 E;  4XPX A;  1WAS A;  1PV3 A;  2KNH A;  4NTB A;  3FAP B;  4N4W A;  4JCH A;  4LLC A;  3PJS K;  3HNJ A;  3Q7G A;  4JJG A;  3S29 A;  2N9B A;  2LP4 A;  1VQ6 P;  2R25 A;  4IL6 E;  2FAP B;  2W83 C;  1S9K D;  3T6G B;  3B5N D;  3R4Y A;  3RL0 B;  1NHL A;  1YZC A;  5EHH A;  5EK0 A;  1V74 B;  3NDB B;  3SXM A;  1Y47 A;  3H1I G;  4KI2 A;  3VAY A;  3BCC G;  2WSE H;  3VMY A;  2CW0 F;  5KYU B;  1L0L K;  1EDI A;  1UFB A;  1NTZ E;  1NAY A;  2WPV B;  2VRS A;  3DM9 B;  1MFZ A;  3L75 G;  4LC1 A;  4PFO A;  4O79 A;  2IBZ E;  1WMK A;  3FXE A;  3SEO A;  1W2E A;  2P1A A;  1NU1 D;  2OKU A;  2X0C A;  1FBM A;  3L72 D;  2HJM A;  3L71 E;  1ZYR F;  1KQL A;  1NO4 A;  2G3A A;  4PJ0 E;  1FS0 E;  2G3V A;  2UUI A;  1S7Z A;  2MWQ A;  1M1J B;  1NG1 A;  1OWA A;  1K9M Q;  1M90 Q;  4PR9 A;  1L0N J;  2OTJ P;  3EZI A;  4AK9 A;  3NG1 A;  3CWB E;  4EYY Q;  1NTZ D;  1KYO I;  1G8X A;  2YXQ B;  5DS5 A;  1KFM A;  2WSE J;  3OA1 A;  3AE5 C;  4O9B A;  4OIQ F;  2WTY A;  1SF8 A;  4YL3 A;  5HSW A;  3G3Z A;  2Q3I A;  3C8G D;  2YKP A;  1NU7 D;  3GF3 A;  5L0F A;  2RD9 A;  2PFD A;  2NUT A;  2ZYA A;  3TD7 A;  1SQX J;  1M1J C;  5L0H A;  4L74 A;  4MVZ A;  2DYR C;  4UDV A;  2BE5 F;  2PGD A;  1SZI A;  3HRN A;  2QJP C;  4L76 A;  1WWP A;  4FAP B;  2P0N A;  4ZLD A;  2V7Q H;  1E84 A;  1IZN B;  1Q86 Q;  1RF0 A;  2WPR A;  3OWT A;  1Z56 A;  1T2K C;  4ONS A;  4LLE A;  2ZVO B;  5KYX B;  4ZNC A;  4NTF A;  3BCC E;  4C7N A;  2EIM C;  3V4W A;  1LI5 A;  1GS9 A;  4EWC A;  3HD7 B;  5F5H A;  1VL2 A;  2B9B A;  4NC3 A;  4G0H A;  4U3F G;  2R5B A;  4WBA A;  1RF1 A;  2JWD A;  4BRY B;  4A2N B;  2B0H A;  3C18 A;  2OOC A;  2MKV A;  1KB9 H;  1D1A A;  3MUD C;  1D0X A;  2R7W A;  3P32 A;  4NQF A;  1PPJ G;  5APQ A;  1ZP0 C;  1QVX A;  1PP9 G;  3S4R A;  5E3A A;  3W8H A;  3AG1 C;  3WU2 H;  2L81 A;  2YL0 A;  2H7B A;  3HTK B;  4E0H A;  3H1J D;  3ZTZ A;  3U8V A;  4DRH B;  1SFC B;  1Z3I X;  3B0U X;  4U5H A;  1M56 C;  1YVI A;  5AVW B;  5L0J A;  4YK5 A;  4IAQ A;  1JTH B;  3HNK A;  1MKM A;  1H8A A;  1M7L A;  3CCE P;  2LD6 A;  1FZG A;  2NG1 A;  3G4Z A;  4N6C A;  1L4A B;  3U3B A;  1O87 A;  1G1J A;  4QMA A;  3RK2 D;  3VMZ A;  4MN4 C;  1BDJ B;  4DXW A;  4EUK B;  2NRG A;  1TQG A;  2EIK C;  2VC9 A;  1R8E A;  3IQC A;  3TGU D;  2P10 A;  3SWK A;  1NTK D;  2C0W A;  1A41 A;  1YQ4 C;  1FZC C;  3F89 A;  2HUJ A;  5DJU B;  3RGU A;  5E3C A;  4R32 A;  1RKC A;  2OYO A;  3P8C D;  4JC7 A;  4W8K A;  3C1L A;  2D5R B;  1A02 J;  3CC2 P;  2D2C D;  4JPZ B;  1SQX K;  4Y28 J;  1N7L A;  5KYN A;  3Q1M A;  4BJ5 A;  1JCC A;  1H89 A;  1VQ4 P;  4CIP A;  2W4M A;  1VB5 A;  1VLT A;  2FYN C;  1KIL D;  1Y9B A;  1D1B A;  2AWC A;  3EFG A;  5H2F H;  2WT7 A;  2B87 A;  4GQH A;  4JEA A;  2QG4 A;  2ZXO A;  5IY5 C;  3CWB G;  1VQ8 P;  1FTS A;  4DRJ B;  1LWU B;  2KLV A;  4AUW A;  1RE3 A;  2JDI H;  3KXD A;  1APC A;  1G4U S;  1NU1 G;  1MMG A;  1Z23 A;  2IDB A;  3KZI E;  2D4U A;  1PIX A;  1SS1 A;  1ZRT E;  2E75 D;  2HYN A;  2WZF A;  2Y0D A;  3K7D A;  5L8R J;  2V26 A;  1CI6 A;  5CI8 A;  2YMK A;  1Q7Y Q;  5FCL A;  2E43 A;  1Q90 D;  5JP7 A;  3B5N C;  2JR8 A;  4JW1 A;  5A6B D;  2G62 A;  5JRA A;  5M1B A;  2WT7 B;  1L4A C;  2WVR A;  2Q7C A;  3HKK A;  3L73 G;  1BZ4 A;  3OAK A;  2FXM A;  4E18 A;  2WVO A;  2YL3 A;  2J46 A;  4MVO A;  2QJY C;  3ZWI A;  1UIX A;  3AG2 C;  3NMJ A;  3JRM O;  3OEO A;  4BG0 A;  1DD4 A;  3ZDM A;  3Q5S A;  1G2C A;  2O01 N;  1RE3 C;  3V2N A;  1LTA C;  3A3Y B;  2A0B A;  3LES A;  1JPJ A;  2GWW A;  1N7S B;  1VQ9 P;  1ZZP A;  1YAR O;  3IHU A;  5KYW A;  5AVX B;  3GW6 A;  3AE2 C;  1GDT A;  3WUV A;  1VQ5 P;  5KYW B;  3H1L E;  2XV5 A;  3K1I C;  2Q6Q A;  2ASR A;  3FOO A;  1FDI A;  3ZDL A;  1LWU C;  2LXB A;  1WGW A;  1LKX A;  3QW1 A;  4AL0 A;  2WSC H;  1L0N K;  1ZHY A;  2J58 A;  1VMA A;  3LUT B;  4CS8 A;  1L3P A;  2Q9B A;  1KQF B;  2FYN B;  2RSE B;  3KQG A;  1LT9 A;  2LXC B;  1T3J A;  4I1L A;  4UB6 H;  5KJ7 A;  3U0C A;  4LDQ A;  5F5F A;  2QLA A;  1T6A A;  4WY4 A;  5AVY B;  1FNT c;  3QTH A;  1JOC A;  3B0P A;  1DOV A;  4WY4 B;  1RE4 A;  1D7M A;  3CQZ A;  1HWT C;  1RCP A;  1S4X A;  4I44 A;  4OGQ D;  2IYL D;  2JX0 A;  1S1C X;  3A5T A;  2R05 A;  1YA9 A;  2YHS A;  2GUV A;  2R7U A;  4IOI H;  1Q82 Q;  5JSL A;  4QI2 A;  5JLI A;  1YTZ T;  3PTZ A;  1HE1 A;  3Q5P A;  1QSP A;  3AEC C;  3ZTM A;  4BJ6 A;  4I7Z B;  1BR2 A;  1LTG C;  2YQY A;  3T4R A;  3H1H E;  2QM8 A;  4K7B A;  3CCU P;  2L6H A;  2QRX A;  3HE4 B;  5KLV G;  1J8M F;  2GUS A;  3H1L J;  1GL2 C;  4N06 A;  5AVS B;  4MW3 A;  1J1E C;  2NUT B;  2PX0 A;  3CX5 D;  1W2W A;  2DGJ A;  3M4C A;  2NSG A;  3B8E B;  2PBE A;  2Q9I A;  3N24 A;  3VYI A;  1TR2 A;  2YLI A;  3FVY A;  3E9V A;  2KS1 B;  2A6E F;  1D0Y A;  1NWQ A;  3VM6 A;  2QNL A;  1IFN A;  3MBG A;  2L6F A;  4C46 A;  3V2P A;  4C3D A;  3S9O A;  2ZJS E;  5AVV B;  2QSI A;  2OTL P;  2R7S A;  1HW2 A;  1T6Q A;  3DM5 A;  3U2M A;  2DYS C;  5CCG C;  1Y4C A;  4IFD K;  1YIJ P;  3VYW A;  2VB6 A;  1HBW A;  3CCR P;  3LAY A;  1GZL A;  4H13 D;  5APT A;  4JF7 A;  1RF1 C;  2R32 A;  4U5E E;  1EQ1 A;  1PFI A;  1F1M A;  1NJI Q;  4CS7 A;  5BU8 B;  2M5A A;  3LW5 J;  2L9J A;  4ER9 A;  4W8P A;  5K5G B;  1DD3 A;  5D91 A;  1GU5 A;  1R5I D;  2LFF A;  1KMI Z;  4CX9 A;  2E5T A;  2P61 A;  5A6B A;  1OZH A;  1SQP G;  1KN7 A;  1EI7 A;  1NTK K;  4PJL A;  3L36 A;  3AE9 C;  1EC5 A;  1RF0 C;  3VMX A;  2GA0 A;  2XKM A;  3JCU Q;  5CI9 A;  3MYF A;  3G4S P;  4CS9 A;  3D71 A;  2J9W A;  2AU5 A;  1PP9 D;  3U1C A;  2M3B A;  2R03 A;  2WWW A;  1CW5 A;  2Q3T A;  4C3B A;  1J1D C;  1Y6D A;  1SFC A;  1IZM A;  1VPC A;  1M1J A;  1VF5 B;  4E0I A;  4MND A;  4AX2 A;  3S0X A;  1OQC A;  4PJM A;  1KV4 A;  1WT6 A;  2UUH A;  2NUP A;  2WQY C;  4O6M A;  1SQB K;  5COG A;  3IAO A;  4JJF A;  1SQQ J;  2WIT A;  3WG7 C;  1SP4 A;  3P7K A;  5KJ7 C;  3LW5 H;  4BJ5 C;  3CXH E;  4WWI A;  2WZG A;  4KJM A;  1OCR C;  5L3Q A;  2YIU B;  3M0A A;  1LJ2 A;  1HMD A;  4JZA A;  3BAT A;  3U2L A;  4MQ9 F;  2DI3 A;  1ZXG A;  3EZH A;  3TK1 A;  4FX5 A;  1EZV E;  2XL4 A;  2HMZ A;  3K1H A;  2KOG A;  1AEP A;  2YZS A;  4U9D A;  3UMI A;  1OFC X;  4U3F E;  5CBO A;  5GTI E;  2IXM A;  3JTL O;  1M57 D;  5KAF E;  2HZ8 A;  3CX5 E;  1KIL E;  1IFJ A;  3CD6 P;  3WUT A;  2O9X A;  3PCV A;  2Z5I A;  1HE9 A;  1WN0 A;  5T1D B;  2KIK A;  3PDM P;  1RQV A;  1S5L E;  4D4N A;  2L6G A;  3PLN A;  3AE1 C;  3RK3 D;  1URQ A;  4XEF A;  4CJG A;  2R3C A;  3M0D C;  1N7S A;  1ZW2 A;  4W80 A;  2IZ1 A;  1LP1 A;  3V5B A;  1ZHW A;  1BE3 E;  4ULV A;  3U9M A;  5EGY A;  1U0B B;  2Q9A A;  3U8P A;  2O1J A;  2B0J A;  5DQZ A;  2IXN A;  2W45 A;  4KHX A;  2AXT E;  2XL8 A;  4I6M C;  2AP3 A;  2J7P D;  3T97 B;  3CPW O;  1A7V A;  4IRU A;  2HKV A;  1M1K Q;  2VH3 A;  1Q2N A;  1V4A A;  2XM4 A;  3FOP A;  3F5H A;  1EDL A;  2KGO A;  1JY3 P;  3BRT B;  4PD4 I;  2J9U A;  2EIJ C;  3POV A;  4HH2 A;  4PV1 C;  4FES A;  4LLH A;  1PD0 A;  2LIG A;  2BEZ F;  1T3U A;  2ZT9 B;  1BBH A;  2M5A B;  1PGP A;  2LK4 A;  3RK2 C;  3U1A A;  1M57 C;  3JRT A;  2FY8 A;  3U5S A;  1C02 A;  4HEA J;  4DBR A;  1YLM A;  3I5C A;  5D92 A;  4R4M A;  1V54 C;  1FZE A;  5JUA A;  1GGQ A;  1TWG A;  2A1D D;  4ULW A;  1PP9 J;  4Y99 C;  3HE4 A;  3D6Z A;  3HNL A;  5COM A;  1FAP B;  1U89 A;  4YWQ A;  1NTZ G;  3Q7L A;  1HGZ A;  3MTU E;  1ZLL A;  2K9J B;  2XLW A;  1LS1 A;  2W6A A;  1KD1 Q;  1MNE A;  1XZQ A;  5B66 E;  2BEQ D;  1SQV J;  2EPL X;  2E5Y A;  1NYH A;  5DS4 A;  2R7V A;  1VQN P;  3H32 B;  5AW2 B;  1VQK P;  2OQQ A;  4KNW A;  2QVA A;  1KB9 I;  3B5N A;  1OVV A;  2QY9 A;  4PFP A;  2EPM X;  3AE7 C;  5KLV J;  4BJ6 C;  1P84 E;  2RN0 A;  1ORJ A;  3IF4 A;  3HUS A;  1MUU A;  5BUO A;  3UMK A;  3MIW A;  3HNI A;  1NU9 C;  3TQO A;  2Y3G A;  4W7Z A;  2ZXW C;  5L0I A;  1HTL C;  4JTD B;  3NMK A;  2NUP B;  2WPS A;  3ITK A;  1JO5 A;  3LEV A;  4X0R A;  2QEX P;  5E2Q A;  2FXP A;  3TDK A;  4UB6 E;  2P2U A;  4ZLC A;  2QUP A;  2GM4 A;  4I1M A;  1K40 A;  3I56 P;  3TYY A;  1QLE D;  1SQQ K;  5AVZ B;  4A4A A;  4N6J A;  4GYT A;  4IWB A;  3EG9 A;  1BR1 A;  2WB7 A;  3GM1 A;  5BQH A;  1G2C B;  2OEV A;  3W67 A;  4E7S A;  3N2Z B;  3MFN A;  1SQP E;  1BCC D;  1GQA A;  2JJL A;  4F4B A;  1FZB A;  3A11 A;  3O6X A;  4M63 A;  5E79 H;  1RQU A;  4JTC B;  1NTK E;  3D70 A;  1ORS C;  4RD9 A;  3O8Z A;  2P1J A;  3VP8 A;  3L1M A;  3H1J G;  2VCC A;  1ZW0 A;  5CJ0 A;  3CL3 D;  4TT3 H;  5GTH H;  5E79 E;  3L72 J;  2RKL A;  3L70 D;  1MV8 A;  4BJ1 A;  3ZG1 A;  1R5L A;  5KLV D;  1L0N E;  2ZXP A;  1NZE A;  3GEH A;  4JQ0 D;  1LI7 A;  3L74 D;  2IPP A;  3BCC J;  2Q3E A;  2CDQ A;  4H0L B;  2E74 C;  2NPS A;  3R7C A;  4U5F E;  1AQ5 A;  3SXY A;  3JCU H;  3MD0 A;  5L0D A;  1BDD A;  3GWL A;  2POH A;  2MJZ A;  1SQV D;  2NPS D;  1IO4 A;  1I4Z A;  2Q7R A;  3H25 A;  2E74 D;  4DVZ A;  5AW5 B;  1KIL C;  1AA0 A;  2XZR A;  2MYS A;  3NMI A;  1EDJ A;  4FWV A;  4G7H F;  5TJH A;  3EFF K;  1DH3 A;  4MVS A;  4JCZ A;  1LVK A;  3K5B A;  1JB0 J;  3GHG C;  4IL6 H;  3JSZ A;  3RQG A;  3TGU E;  3RQE A;  3UNG C;  1CGM E;  3HD7 D;  1URQ D;  3V5X A;  1H0T A;  5KLI C;  5BQI A;  4CDY A;  1USE A;  4NCQ A;  3CCQ P;  3H65 A;  1O5H A;  1M2V A;  2W4B A;  4JYC A;  1CSB A;  4JKV A;  5KTB A;  2FXO A;  2CK3 H;  2IBF A;  2K88 A;  3GEE A;  3KL4 A;  2YXR B;  1ZRT D;  2Z5H A;  5APX A;  4PV1 B;  2Q4F A;  1PGQ A;  3EJN A;  1I4Y A;  3ABV C;  1ZHT A;  3II6 A;  2J0W A;  3L72 G;  3TJ5 A;  4WVZ A;  1KYO D;  4QI0 A;  1S3J A;  2IM8 A;  5AW9 B;  4AE4 B;  2A6H F;  1BCC J;  1IFM A;  3USS A;  1EZV D;  1TWA A;  2YL1 A;  3RL0 C;  3SZR A;  1G1I A;  2PFX A;  1TU3 F;  1KQG B;  2K37 A;  2HFI A;  3EH2 A;  4YJW A;  4ANJ A;  1FFH A;  1OXZ A;  3AGU A;  1E86 A;  4CS9 C;  4A7P A;  1LPE A;  2PP6 A;  2QE9 A;  2KZI A;  1VQO P;  3HTK A;  4XPY A;  4L6R A;  2YLD A;  2I1J A;  2R7O A;  5KAF H;  1TWH A;  3RK3 E;  2FBW C;  2KSJ A;  2OCC C;  2A06 E;  4MVU A;  1OR3 A;  2GA1 A;  3L37 A;  3MGN A;  1EZV G;  3C8Z A;  1FZA A;  2CNW A;  4QDL A;  1HUC A;  2R02 A;  4YL0 A;  3BRV B;  1FOS E;  4P9F A;  1A7E A;  2ZYG A;  3CC7 P;  3NKE A;  2SPZ A;  1GW3 A;  1XWJ A;  5APV A;  3N4X A;  2OU6 A;  2OYI B;  4B6I A;  3JZ0 A;  2I8D A;  1KYO H;  2ZPA A;  2J59 M;  4G7O F;  5TIS H;  2B87 B;  2BAS A;  3RFY A;  3DWW A;  3PHF 2;  3VOP A;  2AEM A;  2YIU C;  2Y69 C;  3SFD C;  3RBZ A;  2AEJ A;  3L73 E;  4RKU J;  3H1L G;  4MTG A;  2NZ2 A;  1LTI C;  1NTM D;  2DW3 A;  3V5Y A;  4O6N A;  1SQV K;  1OX3 A;  1S2E A;  2PRR A;  4UB8 H;  1R5S A;  1FOS F;  2HLO A;  3CCJ P;  3CME P;  1RKE B;  2I15 A;  5KKZ B;  1L0L D;  3OJA B;  1HF9 A;  4DOJ A;  4HJG H;  1ZU5 A;  3IR9 A;  2E76 D;  1ZV8 A;  4ZKP A;  1YHQ P;  4E7Z A;  3V7O A;  4PD4 H;  3MX3 A;  2IBZ D;  4U5D E;  2IFN A;  3O55 A;  2OYI C;  2FFH A;  1N7S D;  1SQQ E;  4U5B E;  2ZXX A;  1SQV E;  2IXO A;  4U9E A;  2KQ9 A;  3NFQ A;  3SSU A;  2PAJ A;  4CSA C;  3JC2 2;  1KTM A;  2K3R A;  1ZME C;  3L34 A;  4LAC B;  4WAB A;  3AE6 C;  5L0G A;  1JY2 N;  5KLI B;  4PD4 D;  3O6Q A;  1L2P A;  3I55 P;  1SQB D;  4RO0 A;  1OCC C;  5CCH A;  3L71 G;  3EG9 B;  2WSC J;  5JS5 A;  1CPQ A;  4I2L C;  3IQT A;  4D4X A;  1RKE A;  1FMW A;  1S5L X;  1E79 H;  1BGY J;  5DS6 A;  4OGQ B;  1FMV A;  3EPV A;  4DCK A;  3AGT A;  4Z9H A;  5B3I A;  5COF A;  2QA4 P;  2M0B A;  1GL2 A;  1YYC A;  2N9Y B;  5KJ7 D;  3BAS A;  2HJ3 A;  3ASO C;  3KYJ A;  3NYL A;  2OJE D;  1Z63 A;  3W2W A;  2LKM A;  4Z1M H;  2KNC B;  5BQG A;  4NPD A;  3CXH H;  2QJY B;  2UWJ E;  2Z4E A;  1C17 M;  1PZQ A;  1JR8 A;  1QVG O;  1ZU4 A;  1RF1 B;  5CBN A;  4RJT A;  2FGY A;  4I1O B;  1RH5 B;  3LLI A;  4ASV A;  1KQS O;  3V2R A;  3L8J A;  1T9K A;  4DJ9 A;  1ZHZ A;  1N73 B;  3R2P A;  3P8M C;  4YT2 A;  1TWC A;  1NTK J;  4MW8 A;  1EKY A;  3SWY A;  2LQG A;  2FYZ A;  2A69 F;  3TGU J;  1NFO A;  3NYJ A;  4H44 C;  2AVK A;  3ZIB A;  2N1T B;  2IYO A;  3CX5 H;  3C8G B;  3QZC A;  5AVT B;  2N1T A;  4K3A A;  2FKW B;  3KZI H;  3RBX A;  3L8I A;  4H13 B;  1NKN A;  3ASN C;  2R44 A;  1OVR A;  4L73 A;  4MVR A;  4DVY P;  1L0L G;  4MVM A;  1SQB G;  5CCG A;  3DJN B;  1AFO A;  2RMZ A;  4LDR A;  1LTJ C;  4NY3 A;  1M8O B;  3H1J J;  1PGO A;  1T2K D;  1EDK A;  5DJT B;  1Z6A A;  2R7X A;  3LID A;  1BSH A;  3RK3 C;  4E17 A;  4XWJ A;  1NAF A;  1BCC E;  1W5C E;  4CSA A;  1QVF O;  3V5Z A;  1TFO B;  4DZO A;  3AED C;  1VDF A;  3LS0 A;  1M6T A;  4RDA A;  4JBZ A;  2HFE D;  3L70 G;  3J06 A;  4N78 E;  1MMA A;  3HUS C;  4RES B;  1OXB A;  2KSE A;  2NPU A;  2YWA A;  3GM3 A;  3HJC A;  5APW A;  3S27 A;  1EXI A;  5AVR B;  1LM3 B;  3H1K D;  2GDC A;  1WOL A;  1FR0 A;  2V4H A;  4C7O A;  3EFO B;  3RL0 D;  1D0Z A;  3BVH A;  5CJ4 A;  1ORY A;  3VRC A;  2KYV A;  1SFC D;  1LP1 B;  1FC2 C;  2L7A A;  3O6Q B;  3HUS B;  2LCH A;  4MVQ A;  2XRH A;  1K04 A;  3I5Q A;  2DB4 A;  2ZT9 C;  4LER A;  4HYT B;  3ZQV A;  1SFC C;  3H1J E;  3HLZ A;  3RYL A;  2V3C C;  1IFD A;  3H32 A;  5AW7 B;  1LE2 A;  4AYC A;  5B3S C;  3A0B H;  2LR2 A;  4YPC A;  3H1L D;  2H43 A;  5CIV A;  4MTF A;  3OA7 A;  2A06 G;  3A0H E;  3FGA D;  4J32 B;  1OW6 A;  2HPC A;  3RK2 B;  2AWY A;  5A6K A;  2Y3D A;  2KJG A;  1LS4 A;  5AGF A;  1AUE A;  4GKG A;  1S72 P;  3FX0 A;  3H1I E;  3ZQY A;  4XLP F;  1YJW P;  2KP8 A;  1SQP D;  2E76 C;  4JTA B;  4CDV A;  1NBB A;  3N7N A;  1G5Z A;  1JOG A;  3PRJ A;  1RXQ A;  5APY A;  2OEX A;  2W9Y A;  3HD7 C;  5CHX A;  2A45 H;  1V55 C;  5AW4 B;  3M9Q A;  1RJ9 B;  3ABL C;  1J1D B;  1K73 Q;  1IC2 A;  4Z9I A;  3LIE A;  4IGG A;  4YN0 B;  5L0C A;  1IJD B;  1J2J B;  3V6I A;  3C8V A;  2FFD A;  3EGX B;  4OD4 A;  2E42 A;  1LTB C;  3C7J A;  2WPQ A;  1NU1 K;  2I8B A;  3AEE C;  3CI9 A;  1MND A;  5JVE A;  3H1H G;  1VOM A;  1N2D C;  5H2F E;  4NPE A;  2KYH A;  5FZT A;  3T97 A;  1BE3 J;  2QJK C;  3NXS A;  3L73 D;  4P6I C;  3CCL P;  2ZFC A;  3L4F A;  2OQM A;  1I5N A;  1U7J A;  1L7C A;  1QX8 A;  3EHN A;  4WB4 A;  1VK5 A;  4L75 A;  2HSB A;  1FDM A;  1R4T A;  2ZT9 D;  2HPC B;  3K1I A;  5TIS E;  3EGX A;  1HJB A;  1DX7 A;  3DAF A;  2NSF A;  2P6V A;  1BCC G;  3JT1 A;  1A02 F;  1HMO A;  3MP7 B;  2WZL A;  1L0L E;  1GL2 D;  1K05 A;  1AVY A;  3DJU B;  4CIH A;  3CWB D;  4JEB A;  1VQ7 P;  2H89 C;  4WGY A;  4H44 D;  2B89 A;  1IK9 A;  1NSG B;  1X22 A;  1VQP P;  4UB8 E;  2B88 A;  4CBE A;  2YO2 A;  1JY3 O;  2XND H;  2HV6 A;  3FMS A;  4AQR D;  2Y39 A;  1L4A A;  1IFP A;  1QLE C;  3G9R A;  5B1B C;  1QQ3 A;  3GOD A;  1QL2 A;  3CCM P;  3L0I A;  1LT1 A;  2BL2 A;  5GPG B;  3FAJ A;  1GMJ A;  1IK7 A;  5E33 A;  4I3M A;  3DKA A;  4YT8 A;  2JKV A;  2CCY A;  5AW0 B;  5T3W A;  2JEE A;  3SWF A;  3DAG A;  3GWN A;  2I1K A;  1PPJ D;  4KNV A;  3CWB J;  2XXA B;  2R3S A;  5BU5 A;  3FWL A;  3WHN A;  4XPW A;  3GG2 A;  2A45 I;  2K9J A;  3UGP A;  2Q1K A;  1PPJ E;  1DEE G;  1JAF A;  2Y3B A;  4KBL A;  1L0N D;  5GTI H;  2W90 A;  1H88 A;  1YQ3 C;  2OG2 A;  1J8Y F;  1PD1 A;  1VF5 C;  3WOD F;  2Y3H A;  4WY4 D;  4DRI B;  1VQM P;  5KKZ C;  5KLV K;  3SFE C;  1B68 A;  1K8A Q;  2H7V C;  3DD7 A;  4PK4 A;  3D6Y A;  1SQQ G;  4YTP C;  1HJ0 A;  3EFO A;  3S90 A;  1YTZ I;  3TNU A;  3B71 A;  4C7N B;  3RW0 A;  3SNH A;  1ZN5 A;  2W27 A;  2HS5 A;  2M4E A;  2FYU E;  4YXW H;  3LEO A;  2KB7 P;  3JCU E;  3GM2 A;  3H1H D;  3LLK A;  1LTJ A;  1NKZ B;  3G4X A;  4EI2 A;  2IFM A;  2A68 F;  5DVW A;  2IX7 C;  1KIL B;  4PAC A;  1DOW A;  1SQP J;  2YVK A;  3GHG B;  1SQB E;  1JMM A;  1Q81 Q;  1N8R Q;  3ABK C;  2XS8 A;  4BEJ A;  4H0L C;  1H9G A;  4BWN A;  2EIN C;  1D1C A;  1HW1 A;  4I7Z C;  5AW8 B;  3H1H J;  5A6J A;  3BEH A;  2CPS A;  2RH0 A;  2YMY A;  4JRZ A;  2E75 B;  2K9Y A;  4LDK A;  3S1K A;  3FWN A;  3ATP A;  5B66 H;  1N73 A;  1J1E B;  3CXH D;  3M15 A;  2MHR A;  4YL1 A;  2E74 B;  1Q0F A;  2JPU A;  5CMZ A;  2O01 H;  4Q4Z F;  5AVU B;  3US6 A;  3U3F A;  3Q2Y A;  4HKZ H;  4U5G A;  2L91 A;  3E1R A;  3H1K J;  3F47 A;  1XTG B;  1N7S C;  1M56 D;  1HGV A;  3CEX A;  2C9N Y;  3CAX A;  1LWU A;  3AOU A;  3C62 A;  2BCC J;  2BCC G;  3DXJ F;  5KYU A;  2QJK B;  1NGM B;  3MHV A;  3RKO F;  1VQL P;  1E83 A;  3H1K G;  4CS8 C;  2Y0E A;  3EGD A;  2OYH C;  1U7M A;  1WTY A;  1SQX D;  1SYQ A;  2JP3 A;  1BSN A;  1MQV A;  2KS1 A;  4N3Y B;  5A69 A;  3X1O A;  2WMM A; 
#chains in the Genus database with same CATH homology
 3R4Y A;  3C8G B;  2QSI A;  4XEF A;  3K7D A;  5L8R J;  5KKZ C;  2YMK A;  4H0L D;  3C18 A;  1Q90 D;  1PL5 A;  3JYY A;  1VF5 D;  3SFE C;  1KOR A;  2MKV A;  1OMI A;  1FDO A;  5M1B A;  3L8I A;  4H13 B;  3D6Y A;  2Q00 A;  4NQF A;  4PV1 B;  3C8V A;  4YTP C;  1HF9 A;  1ZP0 C;  2FXP A;  1HJ0 A;  4H13 D;  2E76 D;  1QVX A;  1UFB A;  2WPV B;  2QJY C;  3AEE C;  3B71 A;  1UIX A;  3ABV C;  3LW5 J;  2JO1 A;  1OW8 A;  1DD4 A;  4H13 C;  1DIP A;  1OW7 A;  1DD3 A;  3AE8 C;  1K40 A;  1EXJ A;  2D2C C;  1KMI Z;  3BRJ A;  1WMK A;  2QJK C;  3Q5S A;  1KNY A;  3T97 B;  4XFJ A;  3GM1 A;  3GM2 A;  3O10 A;  2G8Y A;  1V4A A;  1ZZP A;  1TU3 F;  1KQG B;  3AE9 C;  1MKM A;  3MFN A;  1KTM A;  3AE2 C;  2E75 C;  1ZME C;  3AJM A;  3RQF A;  2HSB A;  2G3A A;  4PV1 C;  3D71 A;  2ZT9 D;  3AE6 C;  4IL6 X;  1FDI A;  3AED C;  1RQU A;  2KK1 A;  3Q3D A;  3GMA A;  2BEZ F;  3D70 A;  3O6Q A;  2ZT9 B;  3AEF C;  3GLM A;  2LK4 A;  1R8E A;  4H0L C;  3AE3 C;  1VF5 B;  2P10 A;  3C8G A;  4XEV A;  2WSC J;  1KQF B;  2YWA A;  3GM3 A;  1K05 A;  4EBK A;  4TT3 H;  4H44 B;  4R4M A;  3RK3 E;  4I7Z C;  1YQ4 C;  3U0C A;  2WQY C;  2FBW C;  2H89 C;  1EXI A;  2E76 B;  3Q5R A;  4H44 D;  3IAO A;  2WSE J;  4R32 A;  1S5L X;  3AE5 C;  1WOL A;  2WSF J;  2E75 B;  2K9Y A;  4GDO A;  3RL0 g;  4KT0 J;  4OGQ B;  3D6Z A;  3C8G D;  3GF3 A;  4H0L B;  2E74 C;  4R4L A;  4XEK A;  4OGQ D;  2V7Q J;  2JX0 A;  2D2C D;  2E74 B;  3G9R A;  1S1C X;  2JPU A;  1AJY A;  4Y28 J;  1K04 A;  3AE4 C;  2ZT9 C;  4OGQ C;  3H25 A;  2D2C B;  2E74 D;  4PV1 D;  3JZ0 A;  1GMJ A;  1O3U A;  1IK7 A;  3U3F A;  3AEG C;  3Q1M A;  2O01 J;  3Q5P A;  3AEC C;  1U57 A;  3Q2Y A;  2BEQ D;  4Z1M H;  2H88 C;  1ZOY C;  4EBJ A;  1NYH A;  2QJP C;  4I7Z B;  1WWP A;  3IN6 A;  3GF7 A;  2OQQ A;  2FYN C;  1Y9B A;  2YIU C;  2L6H A;  3EWK A;  3FGA D;  2QIW A;  1OW6 A;  3SFD C;  3AEA C;  2J5U A;  3L8J A;  4RKU J;  1JB0 J;  3AE7 C;  3TUL A;  3RQG A;  3RQE A;  2NZ2 A;  1NGM B;  4U7J A;  2PBE A;  1KIL E;  1PV3 A;  5KLI C;  1WTY A;  2E76 C;  1VL2 A;  4YXD C;  2IDB A;  1JOG A;  2JP3 A;  3AEB C;  1RQV A;  1YQ3 C;  4H44 C;  2L6F A;  5F28 E;  1PIX A;  1ZRT E;  2L6G A;  2E75 D;  1VF5 C;  3S9O A;  3AE1 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...