3B71A

Cd4 endocytosis motif bound to the focal adhesion targeting (fat) domain of the focal adhesion kinase
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
134
structure length
134
Chain Sequence
NLDRSNDKVYENVTGLVKAVIEMSSKIQPAPPEEYVPMVKEVGLALRTLLATVDETIPLLPASTHREIEMAQKLLNSDLGELINKMKLAQQYVMTSLQQEYKKQMLTAAHALAVDAKNLLDVIDQARLKMLGQT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis for the interaction between focal adhesion kinase and CD4.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Focal adhesion kinase 1
total genus 56
structure length 134
sequence length 134
chains with identical sequence B, C
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2007-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03623 Focal_AT Focal adhesion targeting region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.540 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 3b71A01
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 3b71A02
3AE2C 3AE4C 3AEGC 3AE1C 2G3AA 1QVXA 1OW6A 3B71A 3ABVC 3AEEC 3U0CA 3BRJA 3S9OA 2JPUA 4XEVA 3AE7C 3SFDC 3AJMA 1O3UA 1YQ3C 2Q00A 2L6GA 1ZZPA 3K7DA 3AE9C 3C8GB 3AECC 1KNYA 2KK1A 2FBWC 3O10A 3AE8C 2H88C 1WTYA 3C8GD 3TULA 4R32A 2WQYC 4YTPC 3SFEC 3C8GA 2PBEA 3L8IA 4XEFA 4EBJA 3RQEA 3AEFC 1OW7A 1K40A 1V4AA 1WWPA 1K04A 3RQFA 3RQGA 4EBKA 3GM2A 3AE5C 3AEDC 1PV3A 2YWAA 3JZ0A 3AE6C 3GM1A 2HSBA 3U3FA 3JYYA 2L6HA 1OW8A 1UFBA 2H89C 4YXDC 2LK4A 3MFNA 2JX0A 3L8JA 1JOGA 5F28E 2L6FA 1KTMA 4NQFA 3AEBC 3GM3A 1YQ4C 3AEAC 4XEKA 1K05A 1ZOYC 1WOLA 1ZP0C 3C18A 3AE3C
chains in the Genus database with same CATH superfamily
1SQVK 4YL1A 5B3IA 1AJYA 1NHLA 1X9VA 1NU1K 1AV1A 4ASVA 4GIFA 5EHHA 1SQQJ 5L8RJ 2I8BA 256BA 1Z63A 1HW2A 1ZHXA 2P58A 4FAPB 2B87B 5AW1B 4C7RA 2M5AA 3DE9A 1NTKE 1LTJB 2W8ZA 1BCCD 2R32A 4JBZA 4IOIH 4TT3H 3DI5A 3W8IA 1SQXK 1O3UA 2P7JA 5AW7B 2VB6A 5JLIA 2YO3A 4KC9A 1AA0A 2XL4A 2OQQA 1J1EB 1YLMA 1I4ZA 1PFIA 3PTZA 2IOQA 1BSHA 2CYDA 4U5BE 2FXOA 2Z5IA 1NGMB 1UIIA 1M57D 1RJ9A 4D6TE 2R7RA 1UIXA 1L0NE 3SEOA 2W6BA 3EHNA 3GWNA 3GWLA 2G3KA 3KDPB 1OVVA 1URQD 1T2KD 3ZWIA 1CZQA 3ITKA 2WVNA 5APUA 1M1JA 1ZR2A 3V5YA 3Q6MA 1PP9D 1SQPD 3S0XA 2O01N 3DD7A 1NU1G 4IARA 1SP4A 3T97A 2Q9AA 2X51A 4KT0J 2H7HA 1JO5A 5B66H 4J32B 3NYJA 5KYNA 4Y28J 4OD5A 1NO4A 3U9JA 4C3BA 1BGYE 2E75D 1YJ9P 5BQGA 5AW0B 3ZDLA 2UWJE 2J0XA 2A69F 1W5CE 4BRYB 2ZXXA 3RBXA 1C17M 1ZU4A 5CIVA 5T1DB 5DJUB 2JX0A 1Q86Q 2YL0A 1N7SC 1P84H 4JZAA 4PV1D 5KAIE 3LIDA 3UIAA 3VTPC 2Y3BA 3WUTA 4H54A 1BE3E 5BQHA 2M8RA 3L74J 1QQ3A 3CCJP 1E83A 1N8RQ 1YJWP 3IQ6A 4U9DA 1GK4A 3U59A 3QW0A 3B4SA 3FOPA 4I7ZC 3ZVRA 2BCCJ 2HR3A 2GA0A 3O8ZA 4LERA 2W83C 2G3AA 4MW8A 1L0NK 3NYMA 4LLHA 2W6JH 2ZJSE 3CD6P 2KC3A 2YIUB 2XLVA 1TQGA 2V7QH 4JVSA 3VMYA 1S3JA 1TU3F 4W8PA 1FTSA 2NUTA 1WATA 2GFHA 2YVKA 1CSBA 2YLDA 3EQLF 1G4WR 2WPRA 4Q4ZF 3I56P 1ST6A 3HD7C 2P6VA 3ZQYA 1FZCA 1LGHB 1HGVA 2XXAB 2QM8A 2RMZA 1PD0A 1GL2A 2EPKX 2KK1A 3B5NC 2B9BA 3IF4A 1N2DC 1JY2P 1VF5D 4XLPF 1SQVG 2QJYC 5APSA 2OCCC 2WSCJ 1PZQA 3Q1MA 1XZPA 3Q5PA 1NTZJ 2M3EA 5KLVD 1P84I 1DH3A 3NDBB 5C39A 3CPWO 3DXJF 3U8VA 1MV8A 2E76C 2KSJA 2YO2A 5AW2B 4JQ0D 1F1MA 1RF1B 1OW7A 2XNXA 3MIWA 1TWHA 2HPCA 1JAFA 1IJDB 2BCCD 2W90A 3NMKA 3RK2C 1VQPP 3V4WA 3NMIA 4NTFA 4IFFA 3FX0A 2HUJA 1G1IA 2QE9A 3B5ND 1E86A 2KI7B 3KZIH 3TSIA 3TD7A 2G8YA 2O3JA 3CAXA 1UFBA 2J58A 1LKXA 1KQGB 2FYUG 1FZCB 4DJ9A 1K73Q 1ORYA 2BCCE 4HH2A 2XDJA 3L71J 1Q0GA 3BRVB 1NTKD 2FKWB 1HW1A 1OR3A 3DE8A 1MQVA 1GDTA 2ITAA 2L91A 4AUWA 3LESA 4U5CE 4CBEA 1EDJA 1M56D 1IFIA 2IZ0A 2WTYA 2ZYGA 2A0UA 1BR4A 3VMAA 1C03A 1FMWA 5APYA 2XNDH 1V54C 2D2CD 1DIPA 5APXA 1PGOA 1OKKA 3IPMO 1L0ND 1T5OA 2OYHB 1RE4A 4W8KA 3U2MA 1MZ9A 1QVXA 2PNOA 1WRGA 2Y3HA 3TOMA 1M1JC 2YEVA 1PGQA 4BJ1A 3LS0A 3VMXA 3FDQA 2OYOA 2O01H 4DBRA 4AL0A 2RH0A 1IZMA 2VRSA 3MGNA 3H1ID 2Q4FA 5TJ5E 2Q00A 2XLOA 1Q82Q 3H1LD 3FWLA 1NU1J 2NZ2A 4DOZA 1IFPA 2J9BA 1CPQA 1RF1A 1LT1A 2O9XA 1T6QA 2FY8A 1KD1Q 1FOSF 3L73G 1OX3A 2KB7P 2K9JB 1T01A 4G78A 3HUSA 4IFMA 3PP5A 1NFOA 2DYSC 2VCAA 1VQNP 1NTKJ 2XSEA 5BQIA 1H9TA 5B66E 3LEVA 4LLCA 3V5XA 3US6A 3WUUA 2C9NY 2XV5A 3L70J 1S05A 4OH8B 1BCCE 2AEFA 3C8GA 2P67A 4P9TA 1YVIA 2NPSB 1IW7F 1Q0FA 2EPNA 1KB9E 1I5NA 1Z5ZA 3L70G 2H8AA 2AP3A 5L0FA 3HRNA 1GTWA 5K0IA 1T3JA 3G4ZA 3CCSP 3GHGC 3V2QA 1NTKG 2YWAA 2J8WA 1OCRC 4MVMA 2KLVA 3TGUJ 4AL1A 3RK2B 3I5PA 3HE4A 3RK3E 2HSBA 2HLOA 4L73A 3M0DC 1N7SD 4H0LC 2FYZA 3HTKA 3G6EP 1L0LJ 1SQPK 3ASOC 1BDCA 2YL3A 3WU2E 2WT7B 3VP8A 4NQFA 1ORSC 3GW6A 3U5SA 1K05A 1SQBE 3GHGB 4M3LA 2WVOA 2YQYA 1RHZB 4PFOA 4TLFA 3B5NB 3VP9A 1MMNA 1LM3B 4IGGA 3TDKA 3K1IA 1GS9A 3TGUE 4EYYQ 2Q9IA 3DAFA 4HFKB 4GOEA 4HKZH 4NTAA 3L73J 3BEHA 2L9JA 3VMZA 5AVSB 4ZKUA 3G4XA 1R5LA 3FAPB 3TK0A 3RL0g 3P8CD 1KFNA 2PX3A 4G7HF 3LUTB 1BZ4A 1WASA 5EK0A 3ZTMA 3ZTZA 2LP4A 2E74D 1VF5B 1KV4A 2KYVA 3TQOA 3DWWA 1GZLA 1PP9G 1SQPG 3CX5H 1O87A 3IHUA 3EQ2A 3RL0D 2DGJA 3TULA 2QRXA 2WSEH 3H1IJ 2IPPA 4IL6E 4RO0A 3JYHA 2QJKC 2RD9A 2R9RB 3JSVC 2Q7CA 1T6UA 3DKAA 1OZHA 4D4NA 3FAJA 4WJ0A 2ZVNB 5APWA 3O55A 3CXHH 1EDIA 1EKYA 2LSEA 3RK3C 1PV3A 2YXRB 3ZIBA 1X0TA 1MMGA 4M63A 3C1LA 4RDAA 1BGYG 5L0GA 1E5WA 5TISH 4WY4C 1N86A 1N1CA 1MMAA 3CLQA 4H0LB 2X0CA 1U7MA 1YITP 4PD4I 4UB8H 1L2PA 1S5LX 3SSUA 1LTIC 4OIQF 3L70D 3A5TA 5KKZC 2K3RA 3AEBC 3GANA 2QEXP 2H7BA 1RJ9B 4MN4C 1FOSE 1NLXA 2EPMX 1PPJE 4ONSA 4C3EA 2FXMA 3C8ZA 5K5GB 1EXJA 3GORA 4JTDB 1N73B 1E79H 2R05A 5A6JA 3KPHA 4YN0B 4P9FA 2Y3GA 2FFDA 3H1LJ 3EGXB 2O1KA 1MFZA 1SQQD 3EGDA 1ZV8A 4JRZA 1BCCJ 3CX5D 3JT1A 4E18A 2EIMC 5KJ7D 1CI6B 1KILD 1OCOC 1FAVA 2EINC 2ETSA 2OYHC 4C7NA 2IXNA 4JCZA 4AE4A 4PJNA 1NVOA 4WBAA 3WAQA 4H44C 1J8YF 5KLVJ 5CBOA 1DOWA 2KSEA 3KXDA 5APTA 4ASWA 2BE5F 2J0WA 2GA1A 3EHMA 3C9IA 4JPZB 2IBZI 2ZXEB 2Y3DA 3HD7D 3GLMA 1YYXA 2KP8A 3OW2O 2FAPB 3N7NA 2V26A 1KFMA 1V55C 2HS5A 2OEVA 2P61A 3B5NA 3CCLP 3PLNA 2VH3A 2XLMA 1EZVE 3H1LE 1E85A 4A4AA 1H9GA 3AOUA 3OA1A 1SLQA 5E79H 5AVVB 4H44B 1RE4C 4U5GA 5TISE 1V74B 2IXMA 3I5CA 5AVQB 5AVXB 1EDLA 3EGXA 2XLEA 1JY3O 1EZVD 2DI3A 3ATPA 4WGYA 2DB4A 2XS8A 3AE5C 2JWAA 4EWCA 3IQCA 1OXZA 3EZHA 3KYQA 1NAYA 2H7OA 1M57C 5DVWA 3HD7B 2D5RB 4JKVA 5AVUB 2NPSC 3L72D 3GM1A 2MJZA 3U3BA 4LDKA 3JYYA 1OW8A 1NU7D 2HV7A 3A0BH 1SR2A 1J2JB 1L4AB 3ZC4A 1LTJC 3S29A 2A45I 2A06E 1FNTc 1HWTC 3L73E 1JRAA 1IFJA 1LWUC 3MX3A 1ORJA 3E70C 4ZLDA 2OTJP 1RF0A 5CBNA 3L1MA 4BEMJ 1GK6A 1X8YA 4QI2A 1SQQE 2VCBA 1SFCA 3FWNA 3WMM0 1RKCA 3OJAB 1SQQG 2Y0EA 3S28A 1RKEA 4U7JA 2ZAEB 5HSWA 4BJ6A 3RYLA 3II6A 1A7EA 5KAIH 3CWBD 2E75C 1AVOB 3MBGA 5CCHD 3JC22 2IXOA 3C63A 2XU6A 3LNRA 2OKUA 3V5BA 4LGDE 3FXHA 1H8AA 4PV1C 5DS5A 4EBBA 2HMZA 3ZG1A 1P84D 2FXPA 1QPUA 2QY9A 5T3TA 4H13D 4N3YB 1Q0KA 1T6IA 4PR9A 2Q3IA 3GEEA 3AE9C 5KLVK 1QVFO 4ER9A 1ZW0A 4EI2A 4XPWA 4G0HA 3W4YA 4DOJA 3HE5A 3W2WA 4XWJA 4CS9A 2B87A 1ZHZA 2N1TC 4PJLA 4ZMDA 2GAQA 1KMIZ 2WQYC 4Y99B 2P0NA 1FDOA 3L75D 4YTPC 1NSGB 5L3QA 1PGJA 2AWCA 2WWWA 1JMBA 3TJ5A 1BCCG 2KSFA 4I6MC 3T6GB 3D6ZA 1SVFA 3V2NA 2HJ3A 3K5BA 4MVOA 1YYCA 2KZJA 3LLKA 5AVTB 3J06A 4Q7CA 1R8EA 3EG9B 1S9KD 1SQQK 3H1IG 3F89A 3IAOA 1OXBA 2E76B 1QX8A 1VQ7P 3N24A 1FZFA 1QZXA 3G9RA 3NTNA 4GKGA 2XS1A 2I1KA 3I5QA 3PMRA 4N6CA 2Y9YA 3W67A 3U3FA 1KILB 2OTKE 4WVZA 4BEJA 3RFYA 2H89C 1KORA 1QVGO 4DBQA 1LWUB 4N78E 3GODA 2QE7H 1XWJA 4H13C 3H1JJ 3FGAD 1AQTA 1TKNA 2YMKA 1JOCA 5CCGC 4C46A 1JOGA 2XLDA 3R2PA 2PGDA 3M0AA 4U3FJ 1S5LH 2LXCB 1LI5A 1EZVI 3O6QA 2HKVA 3UGPA 4AX2A 3T97B 3CXHE 3TNUA 1ZOYC 2KXPB 5KLVG 1NZEA 1VLTA 4EUKB 1JNMA 4DRHB 1USEA 1A0BA 1BBHA 2LFFA 5APQA 1M1JB 2R44A 1T6AA 1M2OA 3CSKA 4K3AA 4ZLCA 2P1JA 4YK5A 3BCCJ 5B3SC 5COGA 3WU2H 1MFTA 1RMVA 4KJMA 1GD2E 3L70E 2IYOA 5JSLA 3AEEC 3ABKC 2BC5A 3EFOB 2KNCB 2HV6A 1U57A 4G7ZF 1FZAA 5KYWB 4WY4A 4PFPA 1Y4CA 5E3CA 2DYRC 1LE4A 2QUPA 4CDAA 2A1DD 2PRRA 1PL5A 5AW3B 3CWBG 4N6HA 2L81A 2WSEJ 3SZRA 2HG5D 3VOPA 1OIPA 1VB5A 1U89A 4J7YA 3CWBE 4P6IC 4K7BA 1T9KA 2OJED 4CIPA 2IFNA 4Y99C 2BEZF 2N1TB 5A6AA 1HJBA 2XL6A 4Z9IA 4PD4E 2IYPA 1JY3P 4CS7A 3WODF 3CI9A 2OARA 1U7JA 3NKEA 3AG4C 3IQ5A 4CSAC 1NWQA 5AW6B 3B0PA 1LI7A 2WPSA 2JJLA 1K40A 2ZT9D 1K04A 2KZIA 2KK7A 4MNDA 3H1HJ 5DS4A 2KQ9A 3PRJA 2ZFCA 3SXYA 1NTMK 2R02A 1SQBG 4BRYA 1O5HA 2J9UA 5CI9A 4F4BA 2W6AA 3FVYA 3VM6A 4MTOA 3HNJA 2NUTB 2H7VC 3JCUQ 4O9BA 4C7OB 1KB9H 4DT0A 5CCGD 2VC9A 3KMIA 4AYCA 2E75B 1D0ZA 2RKLA 4H13B 1EQ1A 1ZRTD 1NYHA 1L0NJ 3KL4A 1WN0A 4U5DE 4AK9A 1GW3A 1HBWA 3L8JA 4BPMA 3H2VA 4OGQB 1RKEB 5CI8A 3WG7C 2XL8A 1NTMJ 2IBFA 4BJTA 1SQBD 1L0LG 4CS9C 3OWTA 3I55P 2N1TA 2A45G 3AQCA 3RK2D 2KW3C 1EZVG 1ZXGA 1PPJG 2EPLX 3DZAA 2WT7A 3U9MA 5BU8B 1Q90D 2SPZA 3U1AA 3HUSB 3LAYA 4EIYA 2QG4A 3C62A 2JEEA 4OGQD 4JW1A 4CPGA 4Z9JA 4GYTA 3D71A 1Y6DA 4X0RA 3MUDC 1G2CA 4KI2A 2KUBA 1KB9D 2B89A 1IO4A 3ECSA 2UUHA 3BRJA 3DJUB 3S9OA 2WITA 5FCLA 3G4SP 4LDQA 1NU9C 2NPSA 1WT6A 2FFDC 3SFDC 1VOMA 3Q5SA 1K9MQ 4YPCA 2XRHA 3HNIA 2P1AA 1HF9A 4D4XA 2W27A 4OVNF 5KKZB 1IK9A 2IBZG 1XZQA 1BE3J 3HUSC 1KNYA 3VN0A 2CW0F 3NYLA 3F46A 4J7TA 1SQVE 5CJ0A 2EPOA 1E84A 3EFFK 1JPNA 1A7DA 1NU1E 4RD9A 2ZVOB 1WTYA 3C8GD 4DCKA 2AXCA 2PFXA 2BL2A 3B9QA 1LT9C 3KQGA 4CSAA 3M4CA 1LTGC 4QDLA 1NOHA 3KYIA 3OEOA 3T6BA 5A6BD 4C7OA 4U3FE 3EFOA 3VYWA 1SQXE 1W2BO 2GM4A 2J45A 3GHGA 3VF0A 3RW0A 1SQXG 4IAQA 5GTHE 1WWPA 2Q3TA 4NPFX 3SWYA 3O6XA 1NTZG 2QJKB 1RH5B 1BDDA 3VYIA 1ZR4A 1EXIA 1YAUO 2OGUA 2C03A 3JRMO 2ASRA 1VQKP 2CCYA 4B86A 3TGUD 2R5BA 3C7JA 2NSFA 2WZFA 2WL8A 2WB7A 2WZLA 1GL2B 4JE9A 3M9QA 1NH4A 1VPCA 5CHXA 2CNWA 2AXTE 1LTSC 1KQSO 3DMDA 5CMZA 4IB4A 1M2VA 3H1KE 2AWYA 1FU1A 1Q2NA 2KJGA 4EKWA 4XEKA 1M8OB 4N4WA 1R5ID 3LW5J 1SFCD 1WOLA 2GUVA 5AVYB 2R25A 4MVSA 1BGYJ 3P8CE 1FAPB 1A7VA 4UB8E 1D1AA 3NG1A 2KNCA 2CDQA 5CCHA 3DJNB 5COFA 5KYYA 2QA4P 3JSZA 1RE3C 2E76D 5L0HA 1VQMP 3NRHA 1QL1A 3H1HE 3FOOA 2I8DA 2MYSA 2QM7A 1QSPA 2J5UA 3L35A 3L74G 5KYXA 1L0LD 3NXSA 3AJMA 3S27A 2C0XA 4JIOA 3H1LG 1IC2A 1NKZB 3M91A 5AVWB 3CCEP 1HMOA 4MVUA 2K9JA 3O39A 1IFDA 5A69A 4WY4D 1SQXJ 1S4XA 1QKRA 2WSFH 5D92A 1OFCX 1A02F 2K88A 4JYCA 5A6KA 4PJ0E 2M4EA 4CDYA 2IX7C 4D6TJ 1VK5A 1IFMA 1HTLC 3C8VA 3PJSK 1LTBC 3CX5I 1CGOA 2YMYA 3SYNA 3SP1A 3IN6A 2IZ1A 3B0UX 2P2UA 2H43A 3E1RA 2YHSA 3F47A 4XPYA 3RQEA 3CCMP 4MW3A 1URQC 2IBZD 3OAKA 5DQTA 4RBNA 3L71E 3HE5B 3B8EB 4ANJA 2GUSA 4HEAJ 3ABLC 3Q5RA 3RQGA 3GM2A 1N73C 2YKQA 3CZ6A 1L4AD 1NAFA 1L3PA 3JZ0A 5E2QA 3LJBA 1VDFA 2GDCA 4JTAB 4E0HA 2L6HA 2YLGA 1S7ZA 1HE1A 3GG2A 4HJGH 3SNHA 2ZT9C 2HZ8A 3U8PA 4CIHA 3CMEP 3EZIA 3KYJA 2D2CC 3L36A 4C7NB 4AE4B 1PCXA 2JKVA 1NTKK 5T3WA 3L75G 5B5EH 1KTMA 4JJGA 1Q0DA 3K6BA 5AGFA 1OXKA 3HNKA 4EHPA 3AEAC 3H1JE 1U0BB 3H1HD 1R4TA 4OINF 1G2CB 5KLVE 1LIHA 2JDIH 4JEAA 2LKMA 2WVQA 4DZOA 4OGQC 1HY5A 3S1KA 5BVZA 4PJJA 5EGYA 4MVRA 3TGUG 4RKUJ 3X2QC 1BGYD 3EPVA 1GM5A 1Z23A 3E7KA 1DOVA 4I3MA 4AQRD 2JD3A 3G3ZA 3I4UA 4K1OA 3GF7A 1CGNA 2V4HA 4E17A 2R7UA 3FXDA 4N78D 1RQUA 3H1KG 4L76A 3B29A 2IXPA 2TMVP 2R7TA 1VF5C 3TJ6A 2NPUA 3HTKB 4IJJA 1CPRA 2HFIA 2R3SA 1GU5A 2R3CA 4IFDK 1J1EC 2ZXPA 3HLZA 1ZW3A 3USSA 5F5FA 5E33A 1JR8A 2YLIA 1LP1B 1KYOE 3QWOC 5GPGB 1VMAA 2G3VA 1QEXA 1JMMA 5M1BA 3HNLA 2YZSA 2POHA 1FC2C 3L74E 4YXWH 1H6GA 3T4RA 1OQCA 2LIGA 3IFMA 5BU5A 1KYOH 1PGPA 2FYUJ 1Q7YQ 3AEFC 1LS1A 5COMA 4E0IA 2A6EF 3HJCA 4L75A 4KHXA 3L72G 1FDMA 1LS4A 1FS0E 4U5FE 4H0LD 4IL6X 3BCCE 2YKOA 4PJMA 5AC5A 1KN7A 3N2ZB 1KQLA 5AC4A 4OIPF 3CXHD 2D4UA 5AVRB 2KIKA 1FFHA 5JVEA 1Q81Q 4NPDA 3CC7P 1CGME 2GWWA 2E5YA 2D2CB 3V6IA 2XM4A 3A9CA 2EIKC 4FWVA 3N4XA 4N06A 2KYHA 3CCUP 1G1JA 2XLHA 3LLIA 2ZD9A 3GM3A 1BE3D 4BXLA 4GODA 2ZPAA 2AEJA 1VQ9P 1VYIA 1ZYRF 2QTVA 5E3AA 1S72P 3R7CA 1G4US 2MKVA 3V2PA 1YZAA 1S9KE 2P10A 3K66A 3D70A 4O6YA 3VAYA 3GEIA 1Y47A 3CWBJ 1PD1A 1VLSA 3O6QB 2HODA 3AE2C 1M6TA 1YYJA 5KYXB 1CI6A 2NRGA 4FESA 2E74B 2H8PD 3AEGC 3B71A 1WGWA 4I1MA 2B88A 3JTLO 3QTHA 2E42A 1U6HA 4D6TG 5DLJA 3CCQP 1L0NG 4XPXA 1IZNB 1FZGA 4MS2A 1YTZT 2Q9BA 4J30B 4JC7A 4WGZA 4DRJB 4EDFA 3HD7A 4IRUA 2Q6QA 2XKMA 1H7IA 4H4KC 1YQ3C 1JY2O 2MWQA 4I2LC 1WMKA 4DXWA 1YIJP 1Q0MA 3ITFA 1EI7A 2B0HA 1LTJA 2A06G 1D1BA 1YTZI 2WMMA 4EOTA 2R7XA 3O10A 1KYOI 1KILA 4D6TD 1SQVD 1NTME 2YL7A 1W2EA 2L5GB 3TYYA 1YJNP 1N7SA 2NG1A 1OMIA 4E7ZA 4R4LA 1W2WA 1L0LE 4CS8A 1APCA 4G7OF 3HKKA 3RKOF 4CDVA 1SZIA 2Y69C 4U3FG 3IQTA 2KLUA 2EILC 3PHLA 3A0HE 4I1LA 1G8XA 4QI0A 1VTMP 2XXAA 4JEBA 2Q3EA 4GT1A 2YL1A 1Z56A 3E9VA 3VRCA 3BVHA 3Q2YA 5HV9A 1MNEA 3LW5H 2M0BA 5AW5B 1AFOA 2HMQA 3S84A 3AE6C 1JY3N 2PP4A 1EDKA 5CCGA 3LNMB 1LVKA 1KILE 4YXDC 3AG3C 2Y0CA 1QLED 1FZCC 4O6MA 4W7ZA 1KB9I 1GU4A 3AG1C 5F28E 2L6FA 1D0XA 4UB6H 4Z1MH 3L73D 4NTBA 1XTCC 4BJ5C 1NKNA 4U5EE 1KC8Q 4NC3A 1D1CA 1RY3A 2WSSH 2E74C 1N7SB 1KZUB 1FE6A 2QLAA 1D0YA 4CJGA 1URQA 1FBMA 4UB6E 1OR2A 1XTGB 4NY3A 3CMAP 1OW6A 3RIPA 3JCUH 2PAJA 2HPCB 3EH2A 1LNQA 1VQ4P 1T8ZA 2ZYDA 1ZLLA 3MLGA 1KU2A 1R5SA 2IDBA 1BE3G 4BWNA 2WSFJ 4YWQA 4L6RA 1VYKA 4E7SA 2L6GA 1ZZPA 2L7AA 3GF3A 3UR3C 2Y9ZA 1N7LA 3AECC 4GDOA 2OYHA 3CEXA 3KKBA 3U2LA 2JWDA 1LWUA 4CS8C 5L3VA 3M79A 2LQGA 1ZU5A 2FYUD 3UNGC 3AE8C 1FR0A 2O1JA 1DD3A 4JTCB 3KZIE 1SFCC 4OIOF 1OCCC 2HSQA 1ZHWA 2R7QA 1BSNA 2Z15A 2PBEA 1HGZA 3G71P 3GEHA 1LTAC 1LJ2A 1SYQA 1AEPA 2M5AB 3MP7B 3QW1A 1H88A 4YL0A 2OYIB 4U5HA 3D6YA 4PJ0H 1V4AA 2FFHA 2AEMA 3L75J 1SQBK 4EBKA 1NTMG 3P8MC 3P32A 1G5ZA 4IWBA 3M0DA 3A11A 4U9EA 3GMAA 4KBLA 4YT5A 4HYTB 4RJTA 4DVZA 3LS1A 1SFCB 5GTHH 3RK3D 4GEHA 3POVA 5EFWB 5L0CA 2C9LY 1T3UA 1C02A 1FJKA 3MD0A 3L71D 1NBBA 3UMHA 2QVAA 1MMDA 5JS5A 1IFNA 5D91A 1SQBJ 3X1OA 3M9BA 3JCUE 4LACB 4O6NA 2JP3A 5BUOA 1GMJA 4XA4A 3BRTB 4WABA 1GW4A 3EFGA 1GGQA 1JEKA 3H25A 2PFDA 3H32A 5DQZA 1GQAA 2A0BA 1BR2A 2C0WA 3CC4P 1TFKB 5JP7A 4B6IA 4XLNF 3BCCD 3AE1C 3PDMP 2WVRA 5FZTA 3CC2P 1S2EA 1M56C 1DX7A 4H44D 3ZQVA 5AW4B 1Y8AA 3P7KA 4CJOA 2E5TA 2ZT9B 2N1TD 2OOCA 2AU5A 1NFNA 2R7VA 4IL6H 4C3DA 5TJHA 4I44A 3WHNA 2RSEB 2NUPB 4OWFA 5JRAA 2F22A 3H1IE 1FZBA 1VL2A 4HE8D 2G62A 2IYLD 5A6BA 1S1CX 1URQB 1Z6AA 3H32B 3JSEO 3H6PA 2NSGA 2ZXOA 4XQ1A 2Z4EA 3A2AA 2EIJC 3S4RA 2P7VA 2LXBA 4CX9A 1QL2A 2BASA 2YIUC 5L0IA 4XEFA 2RN0A 3AG2C 1SMYF 1B68A 3CCVP 1HMDA 2N9YB 1MKMA 3M06A 1LP1A 1YZCA 1X79B 3K1HA 3PCVA 1L7CA 1L4AA 3OA7A 2HYNA 2XLWA 2CPSA 4XFJA 3H1JG 1VQ6P 5B1AC 1Z3IX 1H89A 1M1KQ 4WY4B 1PIXA 4UDVA 4ULVA 3SWFA 2VASA 3SWKA 1USDA 4ULWA 2FYNC 3CQZA 1MUUA 5DS6A 2M64A 4Q5SF 4HB1A 1A41A 4PV1B 4W7YA 4N6JA 4GOFA 3H1JD 3BCCG 4KNVA 2OG2A 1DEBA 3MTUE 1HH0A 2V3CC 1HJ0A 2QJPB 1ZP0C 2E43A 3L37A 2Q1KA 3C18A 3RGUA 5KYWA 1RE3A 1H0TB 3DM5A 2R7OA 4JCHA 2LD6A 5B5EE 3RF3A 1LE2A 3AE4C 3UGOA 2YKZA 4PACA 2YKPA 4MTFA 2W9YA 1FDIA 1LPEA 3BASA 1M2VB 4YJWA 4Z9HA 4YT2A 3V4QA 1EA8A 3AE7C 1GL2D 4DRIB 3MZWB 3TF5A 2OYIC 4PK4A 4A2NB 2QJPC 3C8GB 5KYYB 3R4YA 1ZMEC 2Q5UA 4YL3A 2O01J 3KHUA 4GQHA 4JJFA 4LLEA 3M4BA 1YI2P 4JF7A 2MHRA 2WPQA 2KNHA 1RF1C 2LFDA 2J46A 1Y9BA 2K9YA 5L0JA 1J1DB 1LTTC 4R32A 1UG7A 3SXKA 3B0VC 4K35A 1ZVZA 3EG9A 2YNYA 1QGKB 5JT4A 3RL0B 2OU6A 3V7OA 4LDRA 3A0BE 3AGUA 4MQ9F 3RH3A 3MUDA 1YA7O 3ASNC 1YJGA 1YDIA 3Q7LA 2Z5HA 1BDJB 1P84E 1TWGA 2PF4E 5AW8B 3A7OA 1YARO 1EC5A 3RVZA 3DAGA 2J59M 1ZN5A 2LR2A 3A0HH 1QLEC 3EJNA 1H0TA 2VCCA 2QSIA 1OCZC 1RF0C 3MFNA 3BATA 5KYUB 3H1HG 3HTKC 4MTGA 1YA9A 4OD4A 3MHVA 2QNLA 3H65A 2XZRA 3L72E 3QVZA 5KAFH 2WZ7A 3RVYA 1E2XA 2Y39A 1ZHYA 2I1JA 1A02J 5APVA 3H1KJ 1AUEA 3CCRP 4BJ6C 2XM0A 3CXHI 5L0DA 3TK1A 2QJYB 1Z7Qc 2R5DA 3AE3C 3T6JA 5KAFE 2IBZE 2FYUK 2OEXA 3M15A 1KYOD 2I15A 2DW3A 3UMKA 3ZDMA 3AGTA 4WB4A 1OKKD 3LEOA 5KJ7A 1NJIQ 2NPSD 2JR8A 3EH1A 1JMWA 3L74D 4XTKA 3K1IC 4FX5A 1L4AC 1N73A 4XEVA 2UUIA 1YBKA 2OTLP 4KNWA 4QMAA 3H2UA 3QVYA 1NTZK 1AQ5A 2A45H 1TR2A 5AVZB 1NU1D 2N9BA 2FBWC 2E87A 2OJQA 2WPVB 1I4YA 2B0JA 2H88C 1J1DC 1ZW2A 1JCDA 1J8MF 4YT4A 2J7PA 2R7WA 1BR1A 2V7QJ 4JURI 1JCCA 3V5ZA 2AXTH 1JUNA 1SQVJ 2CGEA 1OWAA 1LT9A 4W80A 2WSCH 3SFEC 5CCHC 1SS1A 3L8IA 3H1KD 4EBJA 3L71G 4EIJA 4ZNCA 3QH9A 3HE4B 1OVUA 5KYUA 3RQFA 2KGOA 3A3YB 2BEQD 3AEDC 2A6HF 3T9OA 2PX0A 2R7SA 4MVZA 3QMKA 1VQLP 3G50A 3M1CB 1D7MA 3IR9A 5CJ4A 3FXEA 3L34A 2J7PD 2FYUE 1L0LK 3W8HA 2JO1A 3WUVA 1JTHB 2IM8A 1M7LA 2A06D 2OYIA 2HJMA 2LK4A 3W2VA 1JY2N 2K1AA 5E79E 1GL2C 4XE5B 3CL3D 5KTBA 3U1CA 3K33A 2ZYAA 4O7GA 1EQ7A 2FGYA 1NTZE 2J9WA 3F5HA 1DEEG 2WZGA 2KS1B 1JB0J 2K37A 2FYNB 1K8AQ 4DVYP 2CPBA 5KLIB 3E1IA 4K0DA 2LCHA 2Q9CA 1M90Q 2KOGA 1FJPA 3RBZA 2CNWD 1SQXD 1PPJD 1OVRA 2HFED 2CK3H 3NKDA 1X22A 5B1BC 5GTIH 4JYBA 2AVKA 2ZXRA 5JUAA 3ABVC 1PP9J 1SQPJ 1PP9E 1SQPE 3KH2A 2W45A 1LT9B 4NCQA 3U0CA 2JPUA 4RESB 2J9VA 1FFTC 3N0TA 2IFMA 4IAOA 1FMVA 3RL0C 3ZSUA 5F5HA 3EWKA 2ICWG 1AVOA 4MVQA 3Q6NA 1JTHA 4PD4H 1AVYA 1S5LE 3MYFA 3K7DA 1DD4A 1KQFB 1ZHTA 2A68F 3CX5E 1ZRTE 3M9HA 2BCCG 1VQOP 3MYIA 3Q3DA 4I7ZB 2R03A 1IK7A 1RXQA 3S90A 1TWCA 5H2FE 2Y0DA 3W68A 3UMIA 2QIWA 5AW9B 3TNUB 2M3BA 1HVVA 4I1OB 3TOLA 3FHDA 3LIEA 3NMJA 1NTMD 3PHF2 2FFDB 4WWIA 1VQ5P 3L72J 3NFQA 2C04A 3L4FA 4BG0A 4A7PA 5H2FH 4OIRF 1YHQP 2W4BA 2Q7RA 1HE9A 2HODB 4ZKPA 2PP6A 5DJTB 2KS1A 1HUCA 4PD4D 1RCPA 1SF8A 3L75E 3V2RA 3KPEA 1CW5A 5KJ7C 3AQBA 4LC1A 3Q7GA 2YXQB 3L0IA 3PH0A 4NPEA 1TFOB 2YRFA 4HFFB 5IY5C 1JM0A 1NG1A 4O79A 1RQVA 3ABMC 1VQ8P 1NTZD 1FZEA 1MNDA 1JPJA 4YT8A 3NMDA 4L74A 1TWAA 3RK3B 4DJGA 3JRTA 2NUPA 4U3FD 5GTIE 4BJ5A 2W4MA 3FMSA 1KILC 3IEEA 1T2KC 1YQ4C 4R4MA 5KLIC 3DM9B 3SXZA 2OQMA 3QZCA 3SXMA 2ZXWC 3EGDB
chains in the Genus database with same CATH topology
3AE2C 4I7ZC 4OGQD 4RKUJ 2E74B 3AE4C 3AEGC 2E75C 1AJYA 3AE1C 2G3AA 1QVXA 1OW6A 3D71A 2E76D 3B71A 3ABVC 5L8RJ 3AEEC 1FDIA 3U0CA 3GF7A 3BRJA 3S9OA 2JPUA 4H44D 2J5UA 1TU3F 2ZT9B 4XEVA 4PV1C 2IDBA 1RQUA 3AE7C 3SFDC 2WSFJ 1U57A 2FXPA 3EWKA 3AJMA 4TT3H 4H44C 4H13D 1VF5C 3Q5SA 1O3UA 1YQ3C 2Q00A 2L6GA 1ZZPA 1HF9A 3K7DA 2OQQA 1DD4A 2NZ2A 3GF3A 1WMKA 1KQFB 2QJPC 3AE9C 3C8GB 1ZRTE 3AECC 4GDOA 3RL0g 3R4YA 1ZMEC 3GLMA 2O01J 3Q3DA 1KNYA 2FBWC 2KK1A 3O10A 1PL5A 4I7ZB 2WPVB 1IK7A 2WSEJ 1NGMB 2E74D 1VF5D 1VF5B 3AE8C 2H88C 1VL2A 2QJYC 1WTYA 1DD3A 3C8VA 1OMIA 1UIXA 3C8GD 1S1CX 2WSCJ 1Y9BA 4R4LA 2K9YA 2BEZF 3Q1MA 2QIWA 5M1BA 3Q5PA 3TULA 4R32A 2V7QJ 1KMIZ 2WQYC 3IN6A 1FDOA 4YTPC 3SFEC 2PBEA 2QJKC 2E76C 3C8GA 4H44B 3L8IA 2YIUC 4XEFA 4EBJA 3RQEA 3AEFC 3D6ZA 1OW7A 1DIPA 3D6YA 1R8EA 1K40A 1V4AA 2ZT9D 1MKMA 1K04A 1WWPA 4H0LD 3Q5RA 3RQFA 3RQGA 4IL6X 4EBKA 3GM2A 3AE5C 3Q2YA 2BEQD 3AEDC 3IAOA 1PV3A 4XFJA 2E76B 3GMAA 2YWAA 3G9RA 4KT0J 1EXIA 3JZ0A 3AE6C 3GM1A 1PIXA 3RK3E 2HSBA 1RQVA 3JYYA 2L6HA 1OW8A 3U3FA 2G8YA 2JO1A 4Y28J 1UFBA 2D2CB 4H0LC 2E75B 1KQGB 2E75D 2H89C 4H13B 1KORA 2ZT9C 1NYHA 1KILE 2D2CC 2QSIA 4H0LB 4YXDC 2LK4A 2FYNC 4H13C 3MFNA 2JX0A 3FGAD 3L8JA 2YMKA 1JOGA 4OGQB 1S5LX 5F28E 2JP3A 2L6FA 4PV1B 4PV1D 1KTMA 4NQFA 4Z1MH 1GMJA 3O6QA 3AEBC 5KKZC 3GM3A 3T97B 1YQ4C 3AEAC 4XEKA 1K05A 4R4MA 1ZOYC 3H25A 5KLIC 3LW5J 1WOLA 1HJ0A 1JB0J 2MKVA 1ZP0C 1EXJA 2P10A 3D70A 3C18A 1Q90D 3AE3C 2E74C 4OGQC 4U7JA 2D2CD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AE2 C;  3AE4 C;  3AEG C;  3AE1 C;  2G3A A;  1QVX A;  1OW6 A;  3B71 A;  3ABV C;  3AEE C;  3U0C A;  3BRJ A;  3S9O A;  2JPU A;  4XEV A;  3AE7 C;  3SFD C;  3AJM A;  1O3U A;  1YQ3 C;  2Q00 A;  2L6G A;  1ZZP A;  3K7D A;  3AE9 C;  3C8G B;  3AEC C;  1KNY A;  2KK1 A;  2FBW C;  3O10 A;  3AE8 C;  2H88 C;  1WTY A;  3C8G D;  3TUL A;  4R32 A;  2WQY C;  4YTP C;  3SFE C;  3C8G A;  2PBE A;  3L8I A;  4XEF A;  4EBJ A;  3RQE A;  3AEF C;  1OW7 A;  1K40 A;  1V4A A;  1WWP A;  1K04 A;  3RQF A;  3RQG A;  4EBK A;  3GM2 A;  3AE5 C;  3AED C;  1PV3 A;  2YWA A;  3JZ0 A;  3AE6 C;  3GM1 A;  2HSB A;  3U3F A;  3JYY A;  2L6H A;  1OW8 A;  1UFB A;  2H89 C;  4YXD C;  2LK4 A;  3MFN A;  2JX0 A;  3L8J A;  1JOG A;  5F28 E;  2L6F A;  1KTM A;  4NQF A;  3AEB C;  3GM3 A;  1YQ4 C;  3AEA C;  4XEK A;  1K05 A;  1ZOY C;  1WOL A;  1ZP0 C;  3C18 A;  3AE3 C; 
#chains in the Genus database with same CATH topology
 1SQV K;  4YL1 A;  5B3I A;  1AJY A;  1NHL A;  1X9V A;  1NU1 K;  1AV1 A;  4ASV A;  4GIF A;  5EHH A;  1SQQ J;  5L8R J;  2I8B A;  256B A;  1Z63 A;  1HW2 A;  1ZHX A;  2P58 A;  4FAP B;  2B87 B;  5AW1 B;  4C7R A;  2M5A A;  3DE9 A;  1NTK E;  1LTJ B;  2W8Z A;  1BCC D;  2R32 A;  4JBZ A;  4IOI H;  4TT3 H;  3DI5 A;  3W8I A;  1SQX K;  1O3U A;  2P7J A;  5AW7 B;  2VB6 A;  5JLI A;  2YO3 A;  4KC9 A;  1AA0 A;  2XL4 A;  2OQQ A;  1J1E B;  1YLM A;  1I4Z A;  1PFI A;  3PTZ A;  2IOQ A;  1BSH A;  2CYD A;  4U5B E;  2FXO A;  2Z5I A;  1NGM B;  1UII A;  1M57 D;  1RJ9 A;  4D6T E;  2R7R A;  1UIX A;  1L0N E;  3SEO A;  2W6B A;  3EHN A;  3GWN A;  3GWL A;  2G3K A;  3KDP B;  1OVV A;  1URQ D;  1T2K D;  3ZWI A;  1CZQ A;  3ITK A;  2WVN A;  5APU A;  1M1J A;  1ZR2 A;  3V5Y A;  3Q6M A;  1PP9 D;  1SQP D;  3S0X A;  2O01 N;  3DD7 A;  1NU1 G;  4IAR A;  1SP4 A;  3T97 A;  2Q9A A;  2X51 A;  4KT0 J;  2H7H A;  1JO5 A;  5B66 H;  4J32 B;  3NYJ A;  5KYN A;  4Y28 J;  4OD5 A;  1NO4 A;  3U9J A;  4C3B A;  1BGY E;  2E75 D;  1YJ9 P;  5BQG A;  5AW0 B;  3ZDL A;  2UWJ E;  2J0X A;  2A69 F;  1W5C E;  4BRY B;  2ZXX A;  3RBX A;  1C17 M;  1ZU4 A;  5CIV A;  5T1D B;  5DJU B;  2JX0 A;  1Q86 Q;  2YL0 A;  1N7S C;  1P84 H;  4JZA A;  4PV1 D;  5KAI E;  3LID A;  3UIA A;  3VTP C;  2Y3B A;  3WUT A;  4H54 A;  1BE3 E;  5BQH A;  2M8R A;  3L74 J;  1QQ3 A;  3CCJ P;  1E83 A;  1N8R Q;  1YJW P;  3IQ6 A;  4U9D A;  1GK4 A;  3U59 A;  3QW0 A;  3B4S A;  3FOP A;  4I7Z C;  3ZVR A;  2BCC J;  2HR3 A;  2GA0 A;  3O8Z A;  4LER A;  2W83 C;  2G3A A;  4MW8 A;  1L0N K;  3NYM A;  4LLH A;  2W6J H;  2ZJS E;  3CD6 P;  2KC3 A;  2YIU B;  2XLV A;  1TQG A;  2V7Q H;  4JVS A;  3VMY A;  1S3J A;  1TU3 F;  4W8P A;  1FTS A;  2NUT A;  1WAT A;  2GFH A;  2YVK A;  1CSB A;  2YLD A;  3EQL F;  1G4W R;  2WPR A;  4Q4Z F;  3I56 P;  1ST6 A;  3HD7 C;  2P6V A;  3ZQY A;  1FZC A;  1LGH B;  1HGV A;  2XXA B;  2QM8 A;  2RMZ A;  1PD0 A;  1GL2 A;  2EPK X;  2KK1 A;  3B5N C;  2B9B A;  3IF4 A;  1N2D C;  1JY2 P;  1VF5 D;  4XLP F;  1SQV G;  2QJY C;  5APS A;  2OCC C;  2WSC J;  1PZQ A;  3Q1M A;  1XZP A;  3Q5P A;  1NTZ J;  2M3E A;  5KLV D;  1P84 I;  1DH3 A;  3NDB B;  5C39 A;  3CPW O;  3DXJ F;  3U8V A;  1MV8 A;  2E76 C;  2KSJ A;  2YO2 A;  5AW2 B;  4JQ0 D;  1F1M A;  1RF1 B;  1OW7 A;  2XNX A;  3MIW A;  1TWH A;  2HPC A;  1JAF A;  1IJD B;  2BCC D;  2W90 A;  3NMK A;  3RK2 C;  1VQP P;  3V4W A;  3NMI A;  4NTF A;  4IFF A;  3FX0 A;  2HUJ A;  1G1I A;  2QE9 A;  3B5N D;  1E86 A;  2KI7 B;  3KZI H;  3TSI A;  3TD7 A;  2G8Y A;  2O3J A;  3CAX A;  1UFB A;  2J58 A;  1LKX A;  1KQG B;  2FYU G;  1FZC B;  4DJ9 A;  1K73 Q;  1ORY A;  2BCC E;  4HH2 A;  2XDJ A;  3L71 J;  1Q0G A;  3BRV B;  1NTK D;  2FKW B;  1HW1 A;  1OR3 A;  3DE8 A;  1MQV A;  1GDT A;  2ITA A;  2L91 A;  4AUW A;  3LES A;  4U5C E;  4CBE A;  1EDJ A;  1M56 D;  1IFI A;  2IZ0 A;  2WTY A;  2ZYG A;  2A0U A;  1BR4 A;  3VMA A;  1C03 A;  1FMW A;  5APY A;  2XND H;  1V54 C;  2D2C D;  1DIP A;  5APX A;  1PGO A;  1OKK A;  3IPM O;  1L0N D;  1T5O A;  2OYH B;  1RE4 A;  4W8K A;  3U2M A;  1MZ9 A;  1QVX A;  2PNO A;  1WRG A;  2Y3H A;  3TOM A;  1M1J C;  2YEV A;  1PGQ A;  4BJ1 A;  3LS0 A;  3VMX A;  3FDQ A;  2OYO A;  2O01 H;  4DBR A;  4AL0 A;  2RH0 A;  1IZM A;  2VRS A;  3MGN A;  3H1I D;  2Q4F A;  5TJ5 E;  2Q00 A;  2XLO A;  1Q82 Q;  3H1L D;  3FWL A;  1NU1 J;  2NZ2 A;  4DOZ A;  1IFP A;  2J9B A;  1CPQ A;  1RF1 A;  1LT1 A;  2O9X A;  1T6Q A;  2FY8 A;  1KD1 Q;  1FOS F;  3L73 G;  1OX3 A;  2KB7 P;  2K9J B;  1T01 A;  4G78 A;  3HUS A;  4IFM A;  3PP5 A;  1NFO A;  2DYS C;  2VCA A;  1VQN P;  1NTK J;  2XSE A;  5BQI A;  1H9T A;  5B66 E;  3LEV A;  4LLC A;  3V5X A;  3US6 A;  3WUU A;  2C9N Y;  2XV5 A;  3L70 J;  1S05 A;  4OH8 B;  1BCC E;  2AEF A;  3C8G A;  2P67 A;  4P9T A;  1YVI A;  2NPS B;  1IW7 F;  1Q0F A;  2EPN A;  1KB9 E;  1I5N A;  1Z5Z A;  3L70 G;  2H8A A;  2AP3 A;  5L0F A;  3HRN A;  1GTW A;  5K0I A;  1T3J A;  3G4Z A;  3CCS P;  3GHG C;  3V2Q A;  1NTK G;  2YWA A;  2J8W A;  1OCR C;  4MVM A;  2KLV A;  3TGU J;  4AL1 A;  3RK2 B;  3I5P A;  3HE4 A;  3RK3 E;  2HSB A;  2HLO A;  4L73 A;  3M0D C;  1N7S D;  4H0L C;  2FYZ A;  3HTK A;  3G6E P;  1L0L J;  1SQP K;  3ASO C;  1BDC A;  2YL3 A;  3WU2 E;  2WT7 B;  3VP8 A;  4NQF A;  1ORS C;  3GW6 A;  3U5S A;  1K05 A;  1SQB E;  3GHG B;  4M3L A;  2WVO A;  2YQY A;  1RHZ B;  4PFO A;  4TLF A;  3B5N B;  3VP9 A;  1MMN A;  1LM3 B;  4IGG A;  3TDK A;  3K1I A;  1GS9 A;  3TGU E;  4EYY Q;  2Q9I A;  3DAF A;  4HFK B;  4GOE A;  4HKZ H;  4NTA A;  3L73 J;  3BEH A;  2L9J A;  3VMZ A;  5AVS B;  4ZKU A;  3G4X A;  1R5L A;  3FAP B;  3TK0 A;  3RL0 g;  3P8C D;  1KFN A;  2PX3 A;  4G7H F;  3LUT B;  1BZ4 A;  1WAS A;  5EK0 A;  3ZTM A;  3ZTZ A;  2LP4 A;  2E74 D;  1VF5 B;  1KV4 A;  2KYV A;  3TQO A;  3DWW A;  1GZL A;  1PP9 G;  1SQP G;  3CX5 H;  1O87 A;  3IHU A;  3EQ2 A;  3RL0 D;  2DGJ A;  3TUL A;  2QRX A;  2WSE H;  3H1I J;  2IPP A;  4IL6 E;  4RO0 A;  3JYH A;  2QJK C;  2RD9 A;  2R9R B;  3JSV C;  2Q7C A;  1T6U A;  3DKA A;  1OZH A;  4D4N A;  3FAJ A;  4WJ0 A;  2ZVN B;  5APW A;  3O55 A;  3CXH H;  1EDI A;  1EKY A;  2LSE A;  3RK3 C;  1PV3 A;  2YXR B;  3ZIB A;  1X0T A;  1MMG A;  4M63 A;  3C1L A;  4RDA A;  1BGY G;  5L0G A;  1E5W A;  5TIS H;  4WY4 C;  1N86 A;  1N1C A;  1MMA A;  3CLQ A;  4H0L B;  2X0C A;  1U7M A;  1YIT P;  4PD4 I;  4UB8 H;  1L2P A;  1S5L X;  3SSU A;  1LTI C;  4OIQ F;  3L70 D;  3A5T A;  5KKZ C;  2K3R A;  3AEB C;  3GAN A;  2QEX P;  2H7B A;  1RJ9 B;  4MN4 C;  1FOS E;  1NLX A;  2EPM X;  1PPJ E;  4ONS A;  4C3E A;  2FXM A;  3C8Z A;  5K5G B;  1EXJ A;  3GOR A;  4JTD B;  1N73 B;  1E79 H;  2R05 A;  5A6J A;  3KPH A;  4YN0 B;  4P9F A;  2Y3G A;  2FFD A;  3H1L J;  3EGX B;  2O1K A;  1MFZ A;  1SQQ D;  3EGD A;  1ZV8 A;  4JRZ A;  1BCC J;  3CX5 D;  3JT1 A;  4E18 A;  2EIM C;  5KJ7 D;  1CI6 B;  1KIL D;  1OCO C;  1FAV A;  2EIN C;  2ETS A;  2OYH C;  4C7N A;  2IXN A;  4JCZ A;  4AE4 A;  4PJN A;  1NVO A;  4WBA A;  3WAQ A;  4H44 C;  1J8Y F;  5KLV J;  5CBO A;  1DOW A;  2KSE A;  3KXD A;  5APT A;  4ASW A;  2BE5 F;  2J0W A;  2GA1 A;  3EHM A;  3C9I A;  4JPZ B;  2IBZ I;  2ZXE B;  2Y3D A;  3HD7 D;  3GLM A;  1YYX A;  2KP8 A;  3OW2 O;  2FAP B;  3N7N A;  2V26 A;  1KFM A;  1V55 C;  2HS5 A;  2OEV A;  2P61 A;  3B5N A;  3CCL P;  3PLN A;  2VH3 A;  2XLM A;  1EZV E;  3H1L E;  1E85 A;  4A4A A;  1H9G A;  3AOU A;  3OA1 A;  1SLQ A;  5E79 H;  5AVV B;  4H44 B;  1RE4 C;  4U5G A;  5TIS E;  1V74 B;  2IXM A;  3I5C A;  5AVQ B;  5AVX B;  1EDL A;  3EGX A;  2XLE A;  1JY3 O;  1EZV D;  2DI3 A;  3ATP A;  4WGY A;  2DB4 A;  2XS8 A;  3AE5 C;  2JWA A;  4EWC A;  3IQC A;  1OXZ A;  3EZH A;  3KYQ A;  1NAY A;  2H7O A;  1M57 C;  5DVW A;  3HD7 B;  2D5R B;  4JKV A;  5AVU B;  2NPS C;  3L72 D;  3GM1 A;  2MJZ A;  3U3B A;  4LDK A;  3JYY A;  1OW8 A;  1NU7 D;  2HV7 A;  3A0B H;  1SR2 A;  1J2J B;  1L4A B;  3ZC4 A;  1LTJ C;  3S29 A;  2A45 I;  2A06 E;  1FNT c;  1HWT C;  3L73 E;  1JRA A;  1IFJ A;  1LWU C;  3MX3 A;  1ORJ A;  3E70 C;  4ZLD A;  2OTJ P;  1RF0 A;  5CBN A;  3L1M A;  4BEM J;  1GK6 A;  1X8Y A;  4QI2 A;  1SQQ E;  2VCB A;  1SFC A;  3FWN A;  3WMM 0;  1RKC A;  3OJA B;  1SQQ G;  2Y0E A;  3S28 A;  1RKE A;  4U7J A;  2ZAE B;  5HSW A;  4BJ6 A;  3RYL A;  3II6 A;  1A7E A;  5KAI H;  3CWB D;  2E75 C;  1AVO B;  3MBG A;  5CCH D;  3JC2 2;  2IXO A;  3C63 A;  2XU6 A;  3LNR A;  2OKU A;  3V5B A;  4LGD E;  3FXH A;  1H8A A;  4PV1 C;  5DS5 A;  4EBB A;  2HMZ A;  3ZG1 A;  1P84 D;  2FXP A;  1QPU A;  2QY9 A;  5T3T A;  4H13 D;  4N3Y B;  1Q0K A;  1T6I A;  4PR9 A;  2Q3I A;  3GEE A;  3AE9 C;  5KLV K;  1QVF O;  4ER9 A;  1ZW0 A;  4EI2 A;  4XPW A;  4G0H A;  3W4Y A;  4DOJ A;  3HE5 A;  3W2W A;  4XWJ A;  4CS9 A;  2B87 A;  1ZHZ A;  2N1T C;  4PJL A;  4ZMD A;  2GAQ A;  1KMI Z;  2WQY C;  4Y99 B;  2P0N A;  1FDO A;  3L75 D;  4YTP C;  1NSG B;  5L3Q A;  1PGJ A;  2AWC A;  2WWW A;  1JMB A;  3TJ5 A;  1BCC G;  2KSF A;  4I6M C;  3T6G B;  3D6Z A;  1SVF A;  3V2N A;  2HJ3 A;  3K5B A;  4MVO A;  1YYC A;  2KZJ A;  3LLK A;  5AVT B;  3J06 A;  4Q7C A;  1R8E A;  3EG9 B;  1S9K D;  1SQQ K;  3H1I G;  3F89 A;  3IAO A;  1OXB A;  2E76 B;  1QX8 A;  1VQ7 P;  3N24 A;  1FZF A;  1QZX A;  3G9R A;  3NTN A;  4GKG A;  2XS1 A;  2I1K A;  3I5Q A;  3PMR A;  4N6C A;  2Y9Y A;  3W67 A;  3U3F A;  1KIL B;  2OTK E;  4WVZ A;  4BEJ A;  3RFY A;  2H89 C;  1KOR A;  1QVG O;  4DBQ A;  1LWU B;  4N78 E;  3GOD A;  2QE7 H;  1XWJ A;  4H13 C;  3H1J J;  3FGA D;  1AQT A;  1TKN A;  2YMK A;  1JOC A;  5CCG C;  4C46 A;  1JOG A;  2XLD A;  3R2P A;  2PGD A;  3M0A A;  4U3F J;  1S5L H;  2LXC B;  1LI5 A;  1EZV I;  3O6Q A;  2HKV A;  3UGP A;  4AX2 A;  3T97 B;  3CXH E;  3TNU A;  1ZOY C;  2KXP B;  5KLV G;  1NZE A;  1VLT A;  4EUK B;  1JNM A;  4DRH B;  1USE A;  1A0B A;  1BBH A;  2LFF A;  5APQ A;  1M1J B;  2R44 A;  1T6A A;  1M2O A;  3CSK A;  4K3A A;  4ZLC A;  2P1J A;  4YK5 A;  3BCC J;  5B3S C;  5COG A;  3WU2 H;  1MFT A;  1RMV A;  4KJM A;  1GD2 E;  3L70 E;  2IYO A;  5JSL A;  3AEE C;  3ABK C;  2BC5 A;  3EFO B;  2KNC B;  2HV6 A;  1U57 A;  4G7Z F;  1FZA A;  5KYW B;  4WY4 A;  4PFP A;  1Y4C A;  5E3C A;  2DYR C;  1LE4 A;  2QUP A;  4CDA A;  2A1D D;  2PRR A;  1PL5 A;  5AW3 B;  3CWB G;  4N6H A;  2L81 A;  2WSE J;  3SZR A;  2HG5 D;  3VOP A;  1OIP A;  1VB5 A;  1U89 A;  4J7Y A;  3CWB E;  4P6I C;  4K7B A;  1T9K A;  2OJE D;  4CIP A;  2IFN A;  4Y99 C;  2BEZ F;  2N1T B;  5A6A A;  1HJB A;  2XL6 A;  4Z9I A;  4PD4 E;  2IYP A;  1JY3 P;  4CS7 A;  3WOD F;  3CI9 A;  2OAR A;  1U7J A;  3NKE A;  3AG4 C;  3IQ5 A;  4CSA C;  1NWQ A;  5AW6 B;  3B0P A;  1LI7 A;  2WPS A;  2JJL A;  1K40 A;  2ZT9 D;  1K04 A;  2KZI A;  2KK7 A;  4MND A;  3H1H J;  5DS4 A;  2KQ9 A;  3PRJ A;  2ZFC A;  3SXY A;  1NTM K;  2R02 A;  1SQB G;  4BRY A;  1O5H A;  2J9U A;  5CI9 A;  4F4B A;  2W6A A;  3FVY A;  3VM6 A;  4MTO A;  3HNJ A;  2NUT B;  2H7V C;  3JCU Q;  4O9B A;  4C7O B;  1KB9 H;  4DT0 A;  5CCG D;  2VC9 A;  3KMI A;  4AYC A;  2E75 B;  1D0Z A;  2RKL A;  4H13 B;  1EQ1 A;  1ZRT D;  1NYH A;  1L0N J;  3KL4 A;  1WN0 A;  4U5D E;  4AK9 A;  1GW3 A;  1HBW A;  3L8J A;  4BPM A;  3H2V A;  4OGQ B;  1RKE B;  5CI8 A;  3WG7 C;  2XL8 A;  1NTM J;  2IBF A;  4BJT A;  1SQB D;  1L0L G;  4CS9 C;  3OWT A;  3I55 P;  2N1T A;  2A45 G;  3AQC A;  3RK2 D;  2KW3 C;  1EZV G;  1ZXG A;  1PPJ G;  2EPL X;  3DZA A;  2WT7 A;  3U9M A;  5BU8 B;  1Q90 D;  2SPZ A;  3U1A A;  3HUS B;  3LAY A;  4EIY A;  2QG4 A;  3C62 A;  2JEE A;  4OGQ D;  4JW1 A;  4CPG A;  4Z9J A;  4GYT A;  3D71 A;  1Y6D A;  4X0R A;  3MUD C;  1G2C A;  4KI2 A;  2KUB A;  1KB9 D;  2B89 A;  1IO4 A;  3ECS A;  2UUH A;  3BRJ A;  3DJU B;  3S9O A;  2WIT A;  5FCL A;  3G4S P;  4LDQ A;  1NU9 C;  2NPS A;  1WT6 A;  2FFD C;  3SFD C;  1VOM A;  3Q5S A;  1K9M Q;  4YPC A;  2XRH A;  3HNI A;  2P1A A;  1HF9 A;  4D4X A;  2W27 A;  4OVN F;  5KKZ B;  1IK9 A;  2IBZ G;  1XZQ A;  1BE3 J;  3HUS C;  1KNY A;  3VN0 A;  2CW0 F;  3NYL A;  3F46 A;  4J7T A;  1SQV E;  5CJ0 A;  2EPO A;  1E84 A;  3EFF K;  1JPN A;  1A7D A;  1NU1 E;  4RD9 A;  2ZVO B;  1WTY A;  3C8G D;  4DCK A;  2AXC A;  2PFX A;  2BL2 A;  3B9Q A;  1LT9 C;  3KQG A;  4CSA A;  3M4C A;  1LTG C;  4QDL A;  1NOH A;  3KYI A;  3OEO A;  3T6B A;  5A6B D;  4C7O A;  4U3F E;  3EFO A;  3VYW A;  1SQX E;  1W2B O;  2GM4 A;  2J45 A;  3GHG A;  3VF0 A;  3RW0 A;  1SQX G;  4IAQ A;  5GTH E;  1WWP A;  2Q3T A;  4NPF X;  3SWY A;  3O6X A;  1NTZ G;  2QJK B;  1RH5 B;  1BDD A;  3VYI A;  1ZR4 A;  1EXI A;  1YAU O;  2OGU A;  2C03 A;  3JRM O;  2ASR A;  1VQK P;  2CCY A;  4B86 A;  3TGU D;  2R5B A;  3C7J A;  2NSF A;  2WZF A;  2WL8 A;  2WB7 A;  2WZL A;  1GL2 B;  4JE9 A;  3M9Q A;  1NH4 A;  1VPC A;  5CHX A;  2CNW A;  2AXT E;  1LTS C;  1KQS O;  3DMD A;  5CMZ A;  4IB4 A;  1M2V A;  3H1K E;  2AWY A;  1FU1 A;  1Q2N A;  2KJG A;  4EKW A;  4XEK A;  1M8O B;  4N4W A;  1R5I D;  3LW5 J;  1SFC D;  1WOL A;  2GUV A;  5AVY B;  2R25 A;  4MVS A;  1BGY J;  3P8C E;  1FAP B;  1A7V A;  4UB8 E;  1D1A A;  3NG1 A;  2KNC A;  2CDQ A;  5CCH A;  3DJN B;  5COF A;  5KYY A;  2QA4 P;  3JSZ A;  1RE3 C;  2E76 D;  5L0H A;  1VQM P;  3NRH A;  1QL1 A;  3H1H E;  3FOO A;  2I8D A;  2MYS A;  2QM7 A;  1QSP A;  2J5U A;  3L35 A;  3L74 G;  5KYX A;  1L0L D;  3NXS A;  3AJM A;  3S27 A;  2C0X A;  4JIO A;  3H1L G;  1IC2 A;  1NKZ B;  3M91 A;  5AVW B;  3CCE P;  1HMO A;  4MVU A;  2K9J A;  3O39 A;  1IFD A;  5A69 A;  4WY4 D;  1SQX J;  1S4X A;  1QKR A;  2WSF H;  5D92 A;  1OFC X;  1A02 F;  2K88 A;  4JYC A;  5A6K A;  4PJ0 E;  2M4E A;  4CDY A;  2IX7 C;  4D6T J;  1VK5 A;  1IFM A;  1HTL C;  3C8V A;  3PJS K;  1LTB C;  3CX5 I;  1CGO A;  2YMY A;  3SYN A;  3SP1 A;  3IN6 A;  2IZ1 A;  3B0U X;  2P2U A;  2H43 A;  3E1R A;  2YHS A;  3F47 A;  4XPY A;  3RQE A;  3CCM P;  4MW3 A;  1URQ C;  2IBZ D;  3OAK A;  5DQT A;  4RBN A;  3L71 E;  3HE5 B;  3B8E B;  4ANJ A;  2GUS A;  4HEA J;  3ABL C;  3Q5R A;  3RQG A;  3GM2 A;  1N73 C;  2YKQ A;  3CZ6 A;  1L4A D;  1NAF A;  1L3P A;  3JZ0 A;  5E2Q A;  3LJB A;  1VDF A;  2GDC A;  4JTA B;  4E0H A;  2L6H A;  2YLG A;  1S7Z A;  1HE1 A;  3GG2 A;  4HJG H;  3SNH A;  2ZT9 C;  2HZ8 A;  3U8P A;  4CIH A;  3CME P;  3EZI A;  3KYJ A;  2D2C C;  3L36 A;  4C7N B;  4AE4 B;  1PCX A;  2JKV A;  1NTK K;  5T3W A;  3L75 G;  5B5E H;  1KTM A;  4JJG A;  1Q0D A;  3K6B A;  5AGF A;  1OXK A;  3HNK A;  4EHP A;  3AEA C;  3H1J E;  1U0B B;  3H1H D;  1R4T A;  4OIN F;  1G2C B;  5KLV E;  1LIH A;  2JDI H;  4JEA A;  2LKM A;  2WVQ A;  4DZO A;  4OGQ C;  1HY5 A;  3S1K A;  5BVZ A;  4PJJ A;  5EGY A;  4MVR A;  3TGU G;  4RKU J;  3X2Q C;  1BGY D;  3EPV A;  1GM5 A;  1Z23 A;  3E7K A;  1DOV A;  4I3M A;  4AQR D;  2JD3 A;  3G3Z A;  3I4U A;  4K1O A;  3GF7 A;  1CGN A;  2V4H A;  4E17 A;  2R7U A;  3FXD A;  4N78 D;  1RQU A;  3H1K G;  4L76 A;  3B29 A;  2IXP A;  2TMV P;  2R7T A;  1VF5 C;  3TJ6 A;  2NPU A;  3HTK B;  4IJJ A;  1CPR A;  2HFI A;  2R3S A;  1GU5 A;  2R3C A;  4IFD K;  1J1E C;  2ZXP A;  3HLZ A;  1ZW3 A;  3USS A;  5F5F A;  5E33 A;  1JR8 A;  2YLI A;  1LP1 B;  1KYO E;  3QWO C;  5GPG B;  1VMA A;  2G3V A;  1QEX A;  1JMM A;  5M1B A;  3HNL A;  2YZS A;  2POH A;  1FC2 C;  3L74 E;  4YXW H;  1H6G A;  3T4R A;  1OQC A;  2LIG A;  3IFM A;  5BU5 A;  1KYO H;  1PGP A;  2FYU J;  1Q7Y Q;  3AEF C;  1LS1 A;  5COM A;  4E0I A;  2A6E F;  3HJC A;  4L75 A;  4KHX A;  3L72 G;  1FDM A;  1LS4 A;  1FS0 E;  4U5F E;  4H0L D;  4IL6 X;  3BCC E;  2YKO A;  4PJM A;  5AC5 A;  1KN7 A;  3N2Z B;  1KQL A;  5AC4 A;  4OIP F;  3CXH D;  2D4U A;  5AVR B;  2KIK A;  1FFH A;  5JVE A;  1Q81 Q;  4NPD A;  3CC7 P;  1CGM E;  2GWW A;  2E5Y A;  2D2C B;  3V6I A;  2XM4 A;  3A9C A;  2EIK C;  4FWV A;  3N4X A;  4N06 A;  2KYH A;  3CCU P;  1G1J A;  2XLH A;  3LLI A;  2ZD9 A;  3GM3 A;  1BE3 D;  4BXL A;  4GOD A;  2ZPA A;  2AEJ A;  1VQ9 P;  1VYI A;  1ZYR F;  2QTV A;  5E3A A;  1S72 P;  3R7C A;  1G4U S;  2MKV A;  3V2P A;  1YZA A;  1S9K E;  2P10 A;  3K66 A;  3D70 A;  4O6Y A;  3VAY A;  3GEI A;  1Y47 A;  3CWB J;  1PD1 A;  1VLS A;  3O6Q B;  2HOD A;  3AE2 C;  1M6T A;  1YYJ A;  5KYX B;  1CI6 A;  2NRG A;  4FES A;  2E74 B;  2H8P D;  3AEG C;  3B71 A;  1WGW A;  4I1M A;  2B88 A;  3JTL O;  3QTH A;  2E42 A;  1U6H A;  4D6T G;  5DLJ A;  3CCQ P;  1L0N G;  4XPX A;  1IZN B;  1FZG A;  4MS2 A;  1YTZ T;  2Q9B A;  4J30 B;  4JC7 A;  4WGZ A;  4DRJ B;  4EDF A;  3HD7 A;  4IRU A;  2Q6Q A;  2XKM A;  1H7I A;  4H4K C;  1YQ3 C;  1JY2 O;  2MWQ A;  4I2L C;  1WMK A;  4DXW A;  1YIJ P;  1Q0M A;  3ITF A;  1EI7 A;  2B0H A;  1LTJ A;  2A06 G;  1D1B A;  1YTZ I;  2WMM A;  4EOT A;  2R7X A;  3O10 A;  1KYO I;  1KIL A;  4D6T D;  1SQV D;  1NTM E;  2YL7 A;  1W2E A;  2L5G B;  3TYY A;  1YJN P;  1N7S A;  2NG1 A;  1OMI A;  4E7Z A;  4R4L A;  1W2W A;  1L0L E;  4CS8 A;  1APC A;  4G7O F;  3HKK A;  3RKO F;  4CDV A;  1SZI A;  2Y69 C;  4U3F G;  3IQT A;  2KLU A;  2EIL C;  3PHL A;  3A0H E;  4I1L A;  1G8X A;  4QI0 A;  1VTM P;  2XXA A;  4JEB A;  2Q3E A;  4GT1 A;  2YL1 A;  1Z56 A;  3E9V A;  3VRC A;  3BVH A;  3Q2Y A;  5HV9 A;  1MNE A;  3LW5 H;  2M0B A;  5AW5 B;  1AFO A;  2HMQ A;  3S84 A;  3AE6 C;  1JY3 N;  2PP4 A;  1EDK A;  5CCG A;  3LNM B;  1LVK A;  1KIL E;  4YXD C;  3AG3 C;  2Y0C A;  1QLE D;  1FZC C;  4O6M A;  4W7Z A;  1KB9 I;  1GU4 A;  3AG1 C;  5F28 E;  2L6F A;  1D0X A;  4UB6 H;  4Z1M H;  3L73 D;  4NTB A;  1XTC C;  4BJ5 C;  1NKN A;  4U5E E;  1KC8 Q;  4NC3 A;  1D1C A;  1RY3 A;  2WSS H;  2E74 C;  1N7S B;  1KZU B;  1FE6 A;  2QLA A;  1D0Y A;  4CJG A;  1URQ A;  1FBM A;  4UB6 E;  1OR2 A;  1XTG B;  4NY3 A;  3CMA P;  1OW6 A;  3RIP A;  3JCU H;  2PAJ A;  2HPC B;  3EH2 A;  1LNQ A;  1VQ4 P;  1T8Z A;  2ZYD A;  1ZLL A;  3MLG A;  1KU2 A;  1R5S A;  2IDB A;  1BE3 G;  4BWN A;  2WSF J;  4YWQ A;  4L6R A;  1VYK A;  4E7S A;  2L6G A;  1ZZP A;  2L7A A;  3GF3 A;  3UR3 C;  2Y9Z A;  1N7L A;  3AEC C;  4GDO A;  2OYH A;  3CEX A;  3KKB A;  3U2L A;  2JWD A;  1LWU A;  4CS8 C;  5L3V A;  3M79 A;  2LQG A;  1ZU5 A;  2FYU D;  3UNG C;  3AE8 C;  1FR0 A;  2O1J A;  1DD3 A;  4JTC B;  3KZI E;  1SFC C;  4OIO F;  1OCC C;  2HSQ A;  1ZHW A;  2R7Q A;  1BSN A;  2Z15 A;  2PBE A;  1HGZ A;  3G71 P;  3GEH A;  1LTA C;  1LJ2 A;  1SYQ A;  1AEP A;  2M5A B;  3MP7 B;  3QW1 A;  1H88 A;  4YL0 A;  2OYI B;  4U5H A;  3D6Y A;  4PJ0 H;  1V4A A;  2FFH A;  2AEM A;  3L75 J;  1SQB K;  4EBK A;  1NTM G;  3P8M C;  3P32 A;  1G5Z A;  4IWB A;  3M0D A;  3A11 A;  4U9E A;  3GMA A;  4KBL A;  4YT5 A;  4HYT B;  4RJT A;  4DVZ A;  3LS1 A;  1SFC B;  5GTH H;  3RK3 D;  4GEH A;  3POV A;  5EFW B;  5L0C A;  2C9L Y;  1T3U A;  1C02 A;  1FJK A;  3MD0 A;  3L71 D;  1NBB A;  3UMH A;  2QVA A;  1MMD A;  5JS5 A;  1IFN A;  5D91 A;  1SQB J;  3X1O A;  3M9B A;  3JCU E;  4LAC B;  4O6N A;  2JP3 A;  5BUO A;  1GMJ A;  4XA4 A;  3BRT B;  4WAB A;  1GW4 A;  3EFG A;  1GGQ A;  1JEK A;  3H25 A;  2PFD A;  3H32 A;  5DQZ A;  1GQA A;  2A0B A;  1BR2 A;  2C0W A;  3CC4 P;  1TFK B;  5JP7 A;  4B6I A;  4XLN F;  3BCC D;  3AE1 C;  3PDM P;  2WVR A;  5FZT A;  3CC2 P;  1S2E A;  1M56 C;  1DX7 A;  4H44 D;  3ZQV A;  5AW4 B;  1Y8A A;  3P7K A;  4CJO A;  2E5T A;  2ZT9 B;  2N1T D;  2OOC A;  2AU5 A;  1NFN A;  2R7V A;  4IL6 H;  4C3D A;  5TJH A;  4I44 A;  3WHN A;  2RSE B;  2NUP B;  4OWF A;  5JRA A;  2F22 A;  3H1I E;  1FZB A;  1VL2 A;  4HE8 D;  2G62 A;  2IYL D;  5A6B A;  1S1C X;  1URQ B;  1Z6A A;  3H32 B;  3JSE O;  3H6P A;  2NSG A;  2ZXO A;  4XQ1 A;  2Z4E A;  3A2A A;  2EIJ C;  3S4R A;  2P7V A;  2LXB A;  4CX9 A;  1QL2 A;  2BAS A;  2YIU C;  5L0I A;  4XEF A;  2RN0 A;  3AG2 C;  1SMY F;  1B68 A;  3CCV P;  1HMD A;  2N9Y B;  1MKM A;  3M06 A;  1LP1 A;  1YZC A;  1X79 B;  3K1H A;  3PCV A;  1L7C A;  1L4A A;  3OA7 A;  2HYN A;  2XLW A;  2CPS A;  4XFJ A;  3H1J G;  1VQ6 P;  5B1A C;  1Z3I X;  1H89 A;  1M1K Q;  4WY4 B;  1PIX A;  4UDV A;  4ULV A;  3SWF A;  2VAS A;  3SWK A;  1USD A;  4ULW A;  2FYN C;  3CQZ A;  1MUU A;  5DS6 A;  2M64 A;  4Q5S F;  4HB1 A;  1A41 A;  4PV1 B;  4W7Y A;  4N6J A;  4GOF A;  3H1J D;  3BCC G;  4KNV A;  2OG2 A;  1DEB A;  3MTU E;  1HH0 A;  2V3C C;  1HJ0 A;  2QJP B;  1ZP0 C;  2E43 A;  3L37 A;  2Q1K A;  3C18 A;  3RGU A;  5KYW A;  1RE3 A;  1H0T B;  3DM5 A;  2R7O A;  4JCH A;  2LD6 A;  5B5E E;  3RF3 A;  1LE2 A;  3AE4 C;  3UGO A;  2YKZ A;  4PAC A;  2YKP A;  4MTF A;  2W9Y A;  1FDI A;  1LPE A;  3BAS A;  1M2V B;  4YJW A;  4Z9H A;  4YT2 A;  3V4Q A;  1EA8 A;  3AE7 C;  1GL2 D;  4DRI B;  3MZW B;  3TF5 A;  2OYI C;  4PK4 A;  4A2N B;  2QJP C;  3C8G B;  5KYY B;  3R4Y A;  1ZME C;  2Q5U A;  4YL3 A;  2O01 J;  3KHU A;  4GQH A;  4JJF A;  4LLE A;  3M4B A;  1YI2 P;  4JF7 A;  2MHR A;  2WPQ A;  2KNH A;  1RF1 C;  2LFD A;  2J46 A;  1Y9B A;  2K9Y A;  5L0J A;  1J1D B;  1LTT C;  4R32 A;  1UG7 A;  3SXK A;  3B0V C;  4K35 A;  1ZVZ A;  3EG9 A;  2YNY A;  1QGK B;  5JT4 A;  3RL0 B;  2OU6 A;  3V7O A;  4LDR A;  3A0B E;  3AGU A;  4MQ9 F;  3RH3 A;  3MUD A;  1YA7 O;  3ASN C;  1YJG A;  1YDI A;  3Q7L A;  2Z5H A;  1BDJ B;  1P84 E;  1TWG A;  2PF4 E;  5AW8 B;  3A7O A;  1YAR O;  1EC5 A;  3RVZ A;  3DAG A;  2J59 M;  1ZN5 A;  2LR2 A;  3A0H H;  1QLE C;  3EJN A;  1H0T A;  2VCC A;  2QSI A;  1OCZ C;  1RF0 C;  3MFN A;  3BAT A;  5KYU B;  3H1H G;  3HTK C;  4MTG A;  1YA9 A;  4OD4 A;  3MHV A;  2QNL A;  3H65 A;  2XZR A;  3L72 E;  3QVZ A;  5KAF H;  2WZ7 A;  3RVY A;  1E2X A;  2Y39 A;  1ZHY A;  2I1J A;  1A02 J;  5APV A;  3H1K J;  1AUE A;  3CCR P;  4BJ6 C;  2XM0 A;  3CXH I;  5L0D A;  3TK1 A;  2QJY B;  1Z7Q c;  2R5D A;  3AE3 C;  3T6J A;  5KAF E;  2IBZ E;  2FYU K;  2OEX A;  3M15 A;  1KYO D;  2I15 A;  2DW3 A;  3UMK A;  3ZDM A;  3AGT A;  4WB4 A;  1OKK D;  3LEO A;  5KJ7 A;  1NJI Q;  2NPS D;  2JR8 A;  3EH1 A;  1JMW A;  3L74 D;  4XTK A;  3K1I C;  4FX5 A;  1L4A C;  1N73 A;  4XEV A;  2UUI A;  1YBK A;  2OTL P;  4KNW A;  4QMA A;  3H2U A;  3QVY A;  1NTZ K;  1AQ5 A;  2A45 H;  1TR2 A;  5AVZ B;  1NU1 D;  2N9B A;  2FBW C;  2E87 A;  2OJQ A;  2WPV B;  1I4Y A;  2B0J A;  2H88 C;  1J1D C;  1ZW2 A;  1JCD A;  1J8M F;  4YT4 A;  2J7P A;  2R7W A;  1BR1 A;  2V7Q J;  4JUR I;  1JCC A;  3V5Z A;  2AXT H;  1JUN A;  1SQV J;  2CGE A;  1OWA A;  1LT9 A;  4W80 A;  2WSC H;  3SFE C;  5CCH C;  1SS1 A;  3L8I A;  3H1K D;  4EBJ A;  3L71 G;  4EIJ A;  4ZNC A;  3QH9 A;  3HE4 B;  1OVU A;  5KYU A;  3RQF A;  2KGO A;  3A3Y B;  2BEQ D;  3AED C;  2A6H F;  3T9O A;  2PX0 A;  2R7S A;  4MVZ A;  3QMK A;  1VQL P;  3G50 A;  3M1C B;  1D7M A;  3IR9 A;  5CJ4 A;  3FXE A;  3L34 A;  2J7P D;  2FYU E;  1L0L K;  3W8H A;  2JO1 A;  3WUV A;  1JTH B;  2IM8 A;  1M7L A;  2A06 D;  2OYI A;  2HJM A;  2LK4 A;  3W2V A;  1JY2 N;  2K1A A;  5E79 E;  1GL2 C;  4XE5 B;  3CL3 D;  5KTB A;  3U1C A;  3K33 A;  2ZYA A;  4O7G A;  1EQ7 A;  2FGY A;  1NTZ E;  2J9W A;  3F5H A;  1DEE G;  2WZG A;  2KS1 B;  1JB0 J;  2K37 A;  2FYN B;  1K8A Q;  4DVY P;  2CPB A;  5KLI B;  3E1I A;  4K0D A;  2LCH A;  2Q9C A;  1M90 Q;  2KOG A;  1FJP A;  3RBZ A;  2CNW D;  1SQX D;  1PPJ D;  1OVR A;  2HFE D;  2CK3 H;  3NKD A;  1X22 A;  5B1B C;  5GTI H;  4JYB A;  2AVK A;  2ZXR A;  5JUA A;  3ABV C;  1PP9 J;  1SQP J;  1PP9 E;  1SQP E;  3KH2 A;  2W45 A;  1LT9 B;  4NCQ A;  3U0C A;  2JPU A;  4RES B;  2J9V A;  1FFT C;  3N0T A;  2IFM A;  4IAO A;  1FMV A;  3RL0 C;  3ZSU A;  5F5H A;  3EWK A;  2ICW G;  1AVO A;  4MVQ A;  3Q6N A;  1JTH A;  4PD4 H;  1AVY A;  1S5L E;  3MYF A;  3K7D A;  1DD4 A;  1KQF B;  1ZHT A;  2A68 F;  3CX5 E;  1ZRT E;  3M9H A;  2BCC G;  1VQO P;  3MYI A;  3Q3D A;  4I7Z B;  2R03 A;  1IK7 A;  1RXQ A;  3S90 A;  1TWC A;  5H2F E;  2Y0D A;  3W68 A;  3UMI A;  2QIW A;  5AW9 B;  3TNU B;  2M3B A;  1HVV A;  4I1O B;  3TOL A;  3FHD A;  3LIE A;  3NMJ A;  1NTM D;  3PHF 2;  2FFD B;  4WWI A;  1VQ5 P;  3L72 J;  3NFQ A;  2C04 A;  3L4F A;  4BG0 A;  4A7P A;  5H2F H;  4OIR F;  1YHQ P;  2W4B A;  2Q7R A;  1HE9 A;  2HOD B;  4ZKP A;  2PP6 A;  5DJT B;  2KS1 A;  1HUC A;  4PD4 D;  1RCP A;  1SF8 A;  3L75 E;  3V2R A;  3KPE A;  1CW5 A;  5KJ7 C;  3AQB A;  4LC1 A;  3Q7G A;  2YXQ B;  3L0I A;  3PH0 A;  4NPE A;  1TFO B;  2YRF A;  4HFF B;  5IY5 C;  1JM0 A;  1NG1 A;  4O79 A;  1RQV A;  3ABM C;  1VQ8 P;  1NTZ D;  1FZE A;  1MND A;  1JPJ A;  4YT8 A;  3NMD A;  4L74 A;  1TWA A;  3RK3 B;  4DJG A;  3JRT A;  2NUP A;  4U3F D;  5GTI E;  4BJ5 A;  2W4M A;  3FMS A;  1KIL C;  3IEE A;  1T2K C;  1YQ4 C;  4R4M A;  5KLI C;  3DM9 B;  3SXZ A;  2OQM A;  3QZC A;  3SXM A;  2ZXW C;  3EGD B; 
#chains in the Genus database with same CATH homology
 3AE2 C;  4I7Z C;  4OGQ D;  4RKU J;  2E74 B;  3AE4 C;  3AEG C;  2E75 C;  1AJY A;  3AE1 C;  2G3A A;  1QVX A;  1OW6 A;  3D71 A;  2E76 D;  3B71 A;  3ABV C;  5L8R J;  3AEE C;  1FDI A;  3U0C A;  3GF7 A;  3BRJ A;  3S9O A;  2JPU A;  4H44 D;  2J5U A;  1TU3 F;  2ZT9 B;  4XEV A;  4PV1 C;  2IDB A;  1RQU A;  3AE7 C;  3SFD C;  2WSF J;  1U57 A;  2FXP A;  3EWK A;  3AJM A;  4TT3 H;  4H44 C;  4H13 D;  1VF5 C;  3Q5S A;  1O3U A;  1YQ3 C;  2Q00 A;  2L6G A;  1ZZP A;  1HF9 A;  3K7D A;  2OQQ A;  1DD4 A;  2NZ2 A;  3GF3 A;  1WMK A;  1KQF B;  2QJP C;  3AE9 C;  3C8G B;  1ZRT E;  3AEC C;  4GDO A;  3RL0 g;  3R4Y A;  1ZME C;  3GLM A;  2O01 J;  3Q3D A;  1KNY A;  2FBW C;  2KK1 A;  3O10 A;  1PL5 A;  4I7Z B;  2WPV B;  1IK7 A;  2WSE J;  1NGM B;  2E74 D;  1VF5 D;  1VF5 B;  3AE8 C;  2H88 C;  1VL2 A;  2QJY C;  1WTY A;  1DD3 A;  3C8V A;  1OMI A;  1UIX A;  3C8G D;  1S1C X;  2WSC J;  1Y9B A;  4R4L A;  2K9Y A;  2BEZ F;  3Q1M A;  2QIW A;  5M1B A;  3Q5P A;  3TUL A;  4R32 A;  2V7Q J;  1KMI Z;  2WQY C;  3IN6 A;  1FDO A;  4YTP C;  3SFE C;  2PBE A;  2QJK C;  2E76 C;  3C8G A;  4H44 B;  3L8I A;  2YIU C;  4XEF A;  4EBJ A;  3RQE A;  3AEF C;  3D6Z A;  1OW7 A;  1DIP A;  3D6Y A;  1R8E A;  1K40 A;  1V4A A;  2ZT9 D;  1MKM A;  1K04 A;  1WWP A;  4H0L D;  3Q5R A;  3RQF A;  3RQG A;  4IL6 X;  4EBK A;  3GM2 A;  3AE5 C;  3Q2Y A;  2BEQ D;  3AED C;  3IAO A;  1PV3 A;  4XFJ A;  2E76 B;  3GMA A;  2YWA A;  3G9R A;  4KT0 J;  1EXI A;  3JZ0 A;  3AE6 C;  3GM1 A;  1PIX A;  3RK3 E;  2HSB A;  1RQV A;  3JYY A;  2L6H A;  1OW8 A;  3U3F A;  2G8Y A;  2JO1 A;  4Y28 J;  1UFB A;  2D2C B;  4H0L C;  2E75 B;  1KQG B;  2E75 D;  2H89 C;  4H13 B;  1KOR A;  2ZT9 C;  1NYH A;  1KIL E;  2D2C C;  2QSI A;  4H0L B;  4YXD C;  2LK4 A;  2FYN C;  4H13 C;  3MFN A;  2JX0 A;  3FGA D;  3L8J A;  2YMK A;  1JOG A;  4OGQ B;  1S5L X;  5F28 E;  2JP3 A;  2L6F A;  4PV1 B;  4PV1 D;  1KTM A;  4NQF A;  4Z1M H;  1GMJ A;  3O6Q A;  3AEB C;  5KKZ C;  3GM3 A;  3T97 B;  1YQ4 C;  3AEA C;  4XEK A;  1K05 A;  4R4M A;  1ZOY C;  3H25 A;  5KLI C;  3LW5 J;  1WOL A;  1HJ0 A;  1JB0 J;  2MKV A;  1ZP0 C;  1EXJ A;  2P10 A;  3D70 A;  3C18 A;  1Q90 D;  3AE3 C;  2E74 C;  4OGQ C;  4U7J A;  2D2C D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...