3B71A

Cd4 endocytosis motif bound to the focal adhesion targeting (fat) domain of the focal adhesion kinase
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
134
structure length
134
Chain Sequence
NLDRSNDKVYENVTGLVKAVIEMSSKIQPAPPEEYVPMVKEVGLALRTLLATVDETIPLLPASTHREIEMAQKLLNSDLGELINKMKLAQQYVMTSLQQEYKKQMLTAAHALAVDAKNLLDVIDQARLKMLGQT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis for the interaction between focal adhesion kinase and CD4.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Focal adhesion kinase 1
total genus 56
structure length 134
sequence length 134
chains with identical sequence B, C
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2007-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03623 Focal_AT Focal adhesion targeting region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.540 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 3b71A01
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 3b71A02
1K04A 4EBJA 2KK1A 4YXDC 3SFDC 3AE7C 2H89C 1YQ3C 1WWPA 3C8GD 3GM2A 3AE6C 1V4AA 3AJMA 2Q00A 3JYYA 3L8JA 3SFEC 1OW7A 1PV3A 3JZ0A 3L8IA 3AEDC 3RQGA 3B71A 2HSBA 3AEBC 3S9OA 3U0CA 1KNYA 1WTYA 3MFNA 3AE2C 2FBWC 1OW8A 3AE9C 3C8GB 4XEFA 1WOLA 3BRJA 1K05A 2YWAA 4EBKA 3AE5C 3ABVC 3AEGC 5F28E 2G3AA 3AE3C 4XEVA 4YTPC 3AEAC 2JPUA 3GM3A 1ZZPA 3RQEA 1K40A 3RQFA 2WQYC 2H88C 1ZOYC 3GM1A 3O10A 2L6GA 3AECC 3U3FA 3K7DA 3TULA 4R32A 3AEEC 1UFBA 1ZP0C 1O3UA 4NQFA 3C18A 2PBEA 3AE1C 1YQ4C 3AEFC 2LK4A 3AE8C 3C8GA 2JX0A 2L6FA 1JOGA 1OW6A 2L6HA 1QVXA 4XEKA 3AE4C 1KTMA
chains in the Genus database with same CATH superfamily
3S1KA 1Y4CA 4MW8A 3D6ZA 4YXDC 2OU6A 3E70C 2KLVA 5EK0A 1R5ID 2OEVA 1M6TA 3WMM0 4KHXA 3TQOA 4I1MA 1BCCD 4N78D 1T2KD 3KMIA 1E2XA 1JRAA 2QTVA 4ER9A 1V55C 4O7GA 1WASA 2PF4E 4D6TJ 4JURI 5DVWA 3EFOB 2IBZE 1JY3O 2P67A 1JMBA 2A69F 3CX5H 2HPCA 3V5XA 3MYFA 3LS1A 2QM8A 3MFNA 2E76C 1NO4A 5B3SC 4XPYA 1KB9I 1A7VA 2CGEA 5KLVK 1RH5B 2JO1A 4I6MC 1LI7A 1MQVA 2A6HF 4MS2A 2I1JA 3C8GB 2R5DA 1YJNP 1T6QA 1CZQA 2LP4A 2YWAA 4M63A 3FX0A 3WHNA 2RSEB 2IFNA 3AG3C 1X8YA 1L0NK 4CX9A 3ABVC 3ZQYA 1BE3D 3V4WA 2R7WA 2GM4A 1YYJA 4LDKA 3VYIA 1GK6A 3AE3C 2SPZA 2Y9ZA 4YPCA 3N4XA 5KKZC 1NTKE 2I8BA 1AVYA 4CS7A 3BCCJ 3DM9B 1VQ6P 2L9JA 4JTCB 4IJJA 1J2JB 1J8MF 3SXYA 2XXAA 4DRHB 4WABA 3A2AA 1GL2A 4PV1C 2IX7C 2Z5IA 1URQC 1IZNB 4M3LA 3AEEC 3FAJA 4U7JA 1CI6A 4R4LA 3IQCA 5B66H 1LTJA 1TR2A 3SWFA 3FHDA 4CJOA 2HV6A 3JSEO 3Q3DA 5AVTB 5AW0B 3U2MA 1SFCB 1G4US 1LWUB 3L75D 4QI0A 2L6FA 1N73A 2BCCG 2W4BA 3KHUA 3PMRA 4J30B 4DZOA 1J8YF 1EQ1A 3H32A 4XEKA 3Q5SA 1N7SB 2Q9IA 1M2VA 4CS9C 5JS5A 1Z63A 2P10A 3MP7B 3Q2YA 4NTAA 1SFCD 1H0TB 3HUSC 3HUSB 4JTAB 1BSHA 2PNOA 3H1KE 3ECSA 1D0ZA 3SXKA 2GUSA 1Z3IX 3UMIA 1ZHZA 3C8VA 3V4QA 2A06G 1IJDB 5CJ4A 3W4YA 1RF0C 1Q0FA 3Q5PA 1YARO 1Q82Q 5COGA 3GEIA 2E74C 2N9YB 3B71A 1YZCA 2HFED 3MIWA 3U0CA 2W27A 1EZVE 2QNLA 1U7JA 1TKNA 1LT1A 2LKMA 2ZJSE 3P8CE 4JJGA 4N06A 2D4UA 4BJ1A 4WJ0A 1Q0KA 3KZIH 5DJTB 1EZVG 3A0BH 2NSGA 2XLVA 5E3CA 4LLEA 3AOUA 3FVYA 3VP9A 5KJ7A 3GF7A 1EDIA 1Z56A 4RJTA 2OYIB 4PK4A 1PL5A 2WVRA 1FFHA 4XPWA 2YMYA 1MMAA 1W2BO 3HUSA 2J9WA 5BVZA 2LIGA 2NRGA 4XE5B 1ZOYC 3UMHA 3IR9A 2JJLA 2OQQA 2OTLP 2RMZA 1HH0A 2XLMA 5JP7A 5A69A 1RQUA 3EZIA 2HR3A 1NTME 1FDMA 3H65A 3W2VA 3K1IC 2QVAA 3U9JA 3TNUB 4IAOA 2W6BA 4XLNF 1T6IA 3IQTA 2WSEH 1CW5A 3CX5I 2C03A 4PR9A 3T4RA 3H1JD 5TISE 3O39A 4YT8A 1KILE 2LFFA 3U1CA 2J5UA 2A0BA 1L4AA 1SQPK 1YYXA 2EINC 1JEKA 2IM8A 1KB9H 1OXKA 1MMDA 3L72G 1OCRC 5KYXB 2X51A 1HGZA 2H43A 3BCCD 5F5FA 2O01N 1LGHB 3B5NB 3B0PA 1L0LK 1OW6A 5AW9B 3USSA 1PGJA 2WT7A 3ZDLA 1FC2C 1KYOE 2M3BA 1OZHA 5AC5A 5KJ7C 1NVOA 1T3JA 2R9RB 4AK9A 3V5YA 1L4AD 3H25A 1ZW0A 2P1AA 3L73D 2PFDA 1FTSA 3GM2A 2BEZF 4JRZA 2Q00A 3GEHA 3HNJA 3DE9A 5L0CA 1E86A 3M06A 1TQGA 1VLSA 4N78E 1QQ3A 3RL0D 1I4YA 3HE4A 2Y9YA 3UGOA 2IDBA 5KYUA 3BCCE 1T8ZA 1ZVZA 1KC8Q 1XTGB 5JLIA 4PJMA 2YL1A 2Y39A 2IYOA 2KS1B 2FYUD 5CHXA 1KNYA 1EQ7A 2XLHA 1RF1B 1AJYA 2W4MA 1H88A 3RK2C 1ZR2A 3GF3A 1IFDA 1NTZK 1MUUA 5IY5C 3I56P 1OX3A 1ZHYA 2YKQA 3BRTB 3RVYA 1NBBA 3SSUA 3CCSP 1OR2A 1GU5A 1KQLA 4OGQC 3ABLC 5B5EH 1A02F 2NZ2A 2W8ZA 4H0LD 2VH3A 1FE6A 1SQBG 4W8PA 3AEGC 3RBXA 2WB7A 3N7NA 4MQ9F 1PPJE 2H8AA 4D6TG 3G4ZA 4E18A 3HD7A 1S9KE 3M4CA 1RF1A 4MW3A 2GFHA 5TISH 4U3FG 3LJBA 3TGUE 3NYMA 4LDQA 5COFA 2NUPA 3Q5RA 2HSQA 2R32A 3DZAA 2A68F 3W8HA 2QJYB 1HTLC 1ZW3A 2QJYC 1JY2N 1P84E 2Z4EA 3SXZA 3RH3A 1VQ8P 5KYUB 2C9LY 2R02A 2FFDC 3TD7A 4K3AA 1OXBA 3KL4A 3M15A 1URQA 4FWVA 5D92A 3GWLA 2OCCC 2DB4A 4GOEA 3ZTMA 1QX8A 3L75G 3V5BA 4MVQA 3I4UA 3EQLF 1DEEG 2A45H 1FZCC 4JJFA 4CDVA 1PFIA 1LKXA 2R7SA 3MZWB 4K35A 4ASWA 5GTHE 2R7VA 1SZIA 3C62A 3CWBG 3CZ6A 2KNHA 1M2OA 4U9DA 2OYHA 2IXMA 2KK1A 2NUTB 4EHPA 4H0LC 4C7OA 2WTYA 3TGUD 2P7JA 4OVNF 1S9KD 2ZT9C 3D6YA 3QZCA 3L8IA 1HE9A 1BSNA 1H89A 1NTMJ 1OWAA 2WPSA 1QPUA 4PD4D 5AVYB 3EQ2A 2J0WA 5JUAA 3S9OA 2K3RA 3T97A 4O6MA 5EGYA 1JB0J 2YL0A 4R4MA 4Z1MH 1YJ9P 1GZLA 4BJTA 1PZQA 3BASA 1RKCA 4AE4B 4DVZA 3ATPA 1JY3P 1SMYF 1JTHA 1VB5A 2PP6A 2KNCA 1QLED 4C7NB 1DX7A 3NG1A 1DD4A 1VQPP 1VQMP 3LAYA 5KYNA 1OR3A 1KD1Q 3O6XA 2PFXA 1E85A 3GHGA 2HMQA 4U3FE 3V2PA 3CCEP 1GK4A 2QM7A 2VCBA 4HKZH 4NPDA 1NU1K 4CS8A 1WRGA 3G50A 4P9FA 4OIQF 1LVKA 2PRRA 5KTBA 1M1JB 1K40A 3ITKA 5L3QA 1FDOA 4MN4C 3JCUH 2IOQA 4EKWA 2AXCA 5CBNA 1HW1A 2OQMA 3FMSA 1KV4A 2BC5A 3A7OA 5L0GA 4R32A 1DOWA 3RL0C 1HWTC 4MVZA 3W68A 1SQVD 1M57C 2Q9CA 1Q0DA 2YKOA 4U5CE 2QLAA 4EWCA 1LP1B 4EBBA 2E87A 1VQ7P 1ZR4A 2LXCB 1L4AC 3MLGA 4UDVA 4JBZA 2J58A 2CW0F 3OA1A 4OINF 2HFIA 1VQKP 1P84I 3S29A 1E83A 3MBGA 1JPNA 3EH1A 3BEHA 1NG1A 2H7HA 1CPRA 1K04A 3M9HA 2VASA 3NFQA 4L73A 3FOPA 5COMA 3WUTA 3CCMP 1LPEA 5L8RJ 1LP1A 2CPSA 4L6RA 3J06A 3H1JE 4H44D 3AGTA 4ZKUA 3RKOF 2BE5F 1LTIC 5JT4A 3CSKA 2XM4A 2XXAB 2XL6A 4EDFA 1JY2P 4OWFA 5AW3B 2XNDH 3CAXA 3AEDC 4JCHA 3ABMC 2GUVA 3I5CA 2HJ3A 1G2CB 2PAJA 1MV8A 1VQNP 3DI5A 1EDJA 2E74D 1BGYG 2K88A 3AE2C 2YKPA 1KQGB 3RK2B 1M1KQ 2Q5UA 3A9CA 3A5TA 3TK1A 1HVVA 1VYKA 3TOMA 3H1IJ 5BU5A 3B5NA 2E5YA 4JZAA 3L70D 1NFNA 2OG2A 4YN0B 3A0BE 1T5OA 4E17A 1FJKA 3AE5C 2A45I 5CMZA 1L0LG 1QVGO 2OTKE 3H6PA 1H8AA 1RHZB 2B87B 2GA0A 5CI8A 4YK5A 1KU2A 4BRYA 1RJ9B 3R2PA 4JPZB 2XS8A 2YRFA 2BEQD 3VP8A 5BU8B 2G62A 4LLCA 4OGQD 1RF1C 4U9EA 1XWJA 2AEJA 1ZZPA 1S5LE 2QSIA 4OIRF 3RQEA 1E5WA 3U9MA 4CDAA 2QA4P 2N9BA 1VLTA 3QVYA 2B0JA 1ZHWA 3M9BA 3DAFA 2H7OA 2VC9A 1J1EB 2OGUA 2E5TA 1TFKB 3PH0A 4BG0A 1EDLA 4O6NA 5AW4B 1L0LE 4O6YA 1UFBA 2M3EA 4PV1D 4D6TE 2F22A 2LCHA 3X1OA 2O3JA 4C46A 2BCCJ 2A1DD 3L75J 2IXPA 1EKYA 3L70G 1QLEC 3L72D 2BCCE 4AUWA 3SWYA 1W2WA 2AU5A 3CC2P 2WPVB 2G3VA 3JYHA 1BGYE 1NZEA 3HTKB 1GTWA 4MVRA 3TK0A 2A06E 1L7CA 1G2CA 1QEXA 1Q86Q 1MKMA 3KQGA 4IB4A 4H0LB 2WZFA 3TGUG 5AVSB 4JQ0D 1VK5A 3U5SA 2W6JH 1LTAC 4ULWA 1EXIA 2ZXOA 1Q0MA 1OKKD 3OA7A 2YZSA 2YXQB 3BCCG 4C3DA 1SQPG 1PV3A 1QSPA 4DOJA 5CCHD 3HKKA 3AEBC 2QJPB 2FYUG 3EH2A 1SR2A 3S0XA 3PHLA 3V2RA 1SQVJ 2WSCJ 1HW2A 3MTUE 4LGDE 2E43A 1S05A 3DKAA 2NUPB 1LIHA 4CSAC 3ASNC 4JCZA 1N73C 3KZIE 2RN0A 4LC1A 5KLVG 3HE4B 3SYNA 5L3VA 2K9JA 2ZVNB 3UR3C 4CIPA 2FYUE 3QW1A 3QVZA 1SQVG 3DE8A 4D6TD 4IGGA 2N1TC 1WGWA 4WY4A 3EPVA 4PJ0E 5JVEA 2YIUB 4KC9A 3VMAA 1T9KA 3O55A 3VMYA 4DRIB 3FOOA 5CCGD 4AQRD 1LWUC 3JCUE 4OGQB 3GODA 2O1JA 2L6GA 2D2CD 1ZN5A 2WSFH 3EFGA 5T3TA 1GW4A 1RKEA 2M8RA 4EIYA 1YYCA 2FYZA 4MVOA 4U3FD 1PP9E 1RCPA 4GDOA 3L73J 2LD6A 1LM3B 2LSEA 2C0XA 1ORSC 3CCJP 3EGDA 5KLVD 2IBZG 2L5GB 1D1CA 3L72J 3SP1A 3B0UX 3H1LG 1KILD 1AUEA 2Y3HA 1BCCJ 2ITAA 2QJKB 2WPRA 2WZ7A 4JW1A 1JOGA 2EPMX 2WL8A 3H1IE 1M57D 2E74B 3BVHA 3GWNA 4JKVA 3L74E 1TWGA 2J8WA 1IK9A 3VMXA 1L0ND 1I5NA 3ZDMA 1NTMD 3HE5A 2QJPC 2KXPB 1VF5D 3JRTA 2HMZA 2VCCA 1PGQA 2VRSA 3PCVA 1D1BA 2M4EA 2G8YA 2P6VA 1FJPA 2DGJA 3FXDA 2N1TD 4E0HA 2WVNA 5F5HA 3H1ID 3V2NA 3N24A 4RESB 3WUVA 2P1JA 2ZXRA 5M1BA 3FWLA 4GOFA 1U7MA 1WN0A 2ZYGA 3AQCA 2AWCA 1UIIA 1SQBJ 1MMGA 3UMKA 1NU1J 2R5BA 4BWNA 1FMVA 1NU1E 3L35A 3MUDC 3I55P 2KYHA 3HD7D 5L0FA 2UUIA 1JCDA 4ZMDA 2IBZI 5EFWB 4XEFA 5EHHA 2Y69C 3RL0g 1EDKA 5H2FH 2KB7P 1RXQA 2P0NA 2WPQA 3KYJA 1BGYJ 3NRHA 1D1AA 2YVKA 2NPUA 4ZLDA 2WZLA 2G3AA 4N3YB 1YIJP 3LLKA 1FR0A 4DJGA 1RMVA 3AEAC 2JPUA 3EGXB 4PD4I 1M8OB 4HYTB 3RQFA 3H1HG 3KXDA 4IFFA 3D70A 1BR1A 1P84H 2H88C 2KSJA 4DJ9A 2FFDB 1UIXA 1KZUB 1FU1A 5H2FE 1N73B 2H7BA 3KKBA 1SQXK 4GEHA 1YTZT 3U3FA 2LFDA 2EPOA 2FFHA 3H32B 5GTHH 4MVMA 3HNIA 2W90A 1GMJA 3SEOA 1BCCG 3ZSUA 2ICWG 1O3UA 1VMAA 4W80A 1B68A 5BQHA 3MX3A 1AEPA 5AW2B 1SQQK 3IQ6A 1SQPD 1YQ4C 2J7PA 3MUDA 1LE4A 1NTKD 2J9UA 2AP3A 3JCUQ 4BXLA 1LTSC 1KORA 4JVSA 2Q3TA 3GANA 3M1CB 4A4AA 4Q4ZF 1SQBD 4QI2A 4Y28J 3W67A 4K0DA 4BJ6C 3IPMO 1RJ9A 1GM5A 2WSSH 3PP5A 4OD4A 3ZG1A 2ZXXA 1YQ3C 1SQXJ 2RKLA 3SZRA 5TJHA 3C8GD 1WATA 3AE6C 1DOVA 1OVVA 2HG5D 2POHA 3HLZA 4I1OB 1LJ2A 1Y47A 2FXMA 2FFDA 3H1HE 1C02A 3HJCA 3AG1C 1DD3A 5HV9A 1AA0A 2C0WA 3L73E 2MKVA 1Y9BA 5L0HA 2Q6QA 4U5FE 3M79A 2A0UA 2LQGA 2YO2A 2LR2A 4IOIH 1BCCE 3RF3A 3U2LA 1KMIZ 1Z6AA 2IXOA 4HFFB 1G8XA 3G6EP 4I7ZC 3LW5J 2IYPA 4H4KC 3A11A 3RK3B 1JNMA 2YKZA 3JRMO 3P8MC 3RL0B 2XKMA 1IC2A 2JKVA 4MNDA 1A02J 1SQPJ 2ZFCA 1SLQA 4YL1A 2AEFA 2KZIA 5CCGC 4A7PA 1R5LA 5AW6B 3E1IA 1NU1D 1Z23A 3M0AA 1H9TA 5APVA 3NYJA 3T9OA 1PD0A 4BPMA 3G71P 2KNCB 1P84D 3JSZA 3C63A 2YNYA 1L0NE 3AECC 1VQ4P 1ZYRF 4L75A 5JRAA 5AGFA 1LT9B 4Q5SF 3CI9A 3K6BA 2OJQA 4WVZA 2KI7B 2V7QJ 1HY5A 2FXOA 1YTZI 1LI5A 2FYUK 3LNMB 1PGPA 3OJAB 1H0TA 2PBEA 5T3WA 4YXWH 3NYLA 2JWAA 2C9NY 1O87A 1C03A 3FDQA 2OTJP 3M91A 4NCQA 2HODB 4AL1A 3VAYA 3TOLA 1LE2A 1RY3A 1L0NG 3U1AA 5C39A 2YO3A 3EZHA 2XV5A 1BBHA 2EPNA 1JY3N 3N0TA 1EC5A 1AV1A 4IL6H 3G4XA 2FXPA 4O9BA 1LNQA 3AE7C 1IFJA 5FCLA 1OVRA 3JC22 3H1KG 2J9VA 3IHUA 3KPHA 2ZPAA 4NC3A 5HSWA 5GTIH 3B29A 3DJNB 1NTKJ 1J1DB 1SQQG 1GL2C 4FESA 3RQGA 2XRHA 2YLGA 3H2UA 4JIOA 5FZTA 2GA1A 2AXTE 2RH0A 3OEOA 3VYWA 1AQ5A 3FGAD 2V4HA 2B88A 3K66A 1SQVE 5A6KA 1KILC 1YDIA 2HODA 2R44A 1JOCA 3AGUA 1BE3G 3DD7A 1ZU5A 3I5QA 1X79B 2JEEA 2KUBA 1LT9A 3L71G 4IARA 3S28A 1LTTC 1KQFB 1K8AQ 4H13B 5CCHA 2MHRA 1D0YA 4EI2A 3L1MA 2O01J 1FOSE 1JMWA 2Y3DA 1JO5A 2JD3A 2RD9A 3P32A 3PRJA 2WVQA 1GU4A 1JPJA 2DW3A 4W8KA 1Q7YQ 1VOMA 3KPEA 2ZT9B 4KBLA 1S5LX 3H1KJ 1QKRA 4N6JA 3WG7C 2E75D 1I4ZA 3K7DA 2HUJA 1M2VB 4EUKB 1CGNA 3V7OA 1SQVK 3TYYA 2Q3IA 4G7HF 3U8VA 1BE3E 3POVA 3PHF2 3IQ5A 1NWQA 4NY3A 4JEBA 2K9YA 1PGOA 4Y99C 2KW3C 4DRJB 2L7AA 1N1CA 2J0XA 3PTZA 1L0LD 2L6HA 1IFPA 1N7SC 1ST6A 3NKEA 1LT9C 4I2LC 4UB6E 1R4TA 2GDCA 1S1CX 2FY8A 4ASVA 1SP4A 2O9XA 3FXHA 2YQYA 2BCCD 2R03A 1N2DC 2IZ1A 3PDMP 4YT2A 5AW5B 5DQZA 1VQ9P 3H1LD 2WITA 3L8JA 3NMIA 4ULVA 3SFEC 5AVVB 1OCCC 3RGUA 3JZ0A 2NPSD 4DVYP 5APQA 3UNGC 2WZGA 5KYWA 3HTKA 4MVUA 2XU6A 2KIKA 5B1BC 4G78A 4LDRA 3HE5B 1WTYA 3RYLA 2IPPA 3F47A 3L4FA 3RW0A 3G9RA 1EA8A 1VL2A 3KYQA 1LTJC 2QG4A 1RE3C 5AVXB 2L81A 3H1IG 1H6GA 4HH2A 3L75E 1NTKK 3A0HH 3CCQP 2TMVP 4J7TA 3VM6A 1OXZA 3NKDA 1GL2B 2A6EF 4PV1B 1GQAA 1OCOC 5BUOA 1KN7A 2M64A 1M90Q 1LS1A 1NGMB 3QWOC 5CI9A 2Y3GA 3RFYA 3CPWO 4U5BE 4YTPC 5KAFH 2Y3BA 1AVOA 4LERA 1FNTc 1S5LH 2ZXEB 5E33A 2WQYC 4I3MA 1FS0E 4N6HA 5AW8B 1C17M 2JDIH 5KJ7D 5CJ0A 3H1JG 3OW2O 1PP9D 3HTKC 1Y8AA 2HYNA 1WMKA 1NU9C 4E7SA 4H13C 3LEOA 3H1LJ 2HPCB 3C18A 1F1MA 1Y6DA 1VPCA 1AQTA 1X0TA 1FOSF 1YHQP 4DCKA 2LK4A 2KP8A 3B4SA 3K33A 5KLVE 2JX0A 1NTZG 3V5ZA 4OD5A 4BJ5C 1H9GA 3S84A 1XTCC 4JE9A 3C7JA 1LTBC 4WY4D 2Q9BA 1HF9A 2OYOA 3V2QA 2WMMA 1KTMA 3ZQVA 1MNEA 2XLEA 3Q7GA 1NTMK 1CGME 2Z15A 1CSBA 3HD7B 3HRNA 2MYSA 4AX2A 2YL3A 3X2QC 4TLFA 1U0BB 5DJUB 4IRUA 3CCVP 3H1HJ 1FZEA 1FZCB 5A6BA 5K5GB 2WSCH 2AVKA 1HMDA 1VYIA 3L71E 2D2CC 4BRYB 3W2WA 1KB9E 4DBQA 3GLMA 2R25A 3L71J 1OCZC 1NOHA 3JTLO 2NPSB 2NSFA 5AW7B 1NAYA 4CDYA 4XQ1A 4BEMJ 1G5ZA 1KILA 1SVFA 3C1LA 2X0CA 1QGKB 5KAIH 1K05A 4J32B 2Y0CA 3N2ZB 1Q90D 3WAQA 3IAOA 4Z9HA 2KGOA 5AW1B 1TFOB 1IFMA 3CC4P 4RO0A 4MTFA 1NTMG 2OYHC 4P9TA 2J9BA 3EWKA 3MD0A 2A06D 3R4YA 5CCHC 1APCA 3F5HA 1FAPB 4YT5A 2HV7A 1HMOA 5KLIB 1SQQJ 3GM3A 2DYRC 3AG2C 5E79E 5APSA 2XZRA 1IZMA 2XL4A 2EIMC 4EOTA 1WT6A 2J46A 1NJIQ 3GEEA 3ZTZA 3GG2A 4ANJA 2UWJE 2V7QH 1FZAA 3TULA 2D2CB 3DWWA 1R8EA 1DEBA 4XWJA 3M9QA 3P8CD 3Q7LA 2YMKA 4NQFA 4F4BA 4N6CA 2YIUC 3L70J 1N86A 1FMWA 2QY9A 1NH4A 3CXHH 5APUA 1M56C 2ZXPA 1UG7A 3FAPB 4U5GA 3C8GA 3CWBD 2YHSA 3HNKA 4N4WA 2I1KA 4UB8E 2Y0EA 4UB8H 4HE8D 4K1OA 5APTA 2L91A 1ZV8A 3LIDA 1PIXA 1H7IA 4WY4B 2XM0A 1HGVA 4CS9A 1IO4A 4NPEA 3L36A 3ZC4A 1WWPA 4U3FJ 5KKZB 1N8RQ 4Z9JA 1KILB 3H1HD 4YL3A 1A41A 4YWQA 4KNVA 5KAIE 3CCRP 2AWYA 4NTFA 4JEAA 2Q3EA 1U57A 4KI2A 2W45A 4K7BA 2M5AA 1ZRTD 2O01H 3L74G 1A7DA 1GGQA 2R05A 4JF7A 3GHGB 1W5CE 4C3BA 256BA 3R7CA 3CXHD 1PPJG 3OAKA 3QH9A 1OW8A 3SXMA 1JM0A 5KLVJ 1GS9A 4ONSA 2HLOA 2FAPB 5E3AA 1ORYA 1N7LA 1YA7O 1YI2P 5B1AC 3VF0A 1PP9G 3CQZA 5APYA 1YBKA 2QJKC 3LIEA 4KT0J 2W9YA 3L71D 4EBKA 3G3ZA 1J1EC 4WWIA 1TWHA 1EI7A 1RE4C 3RK3E 3T6JA 4G0HA 2H7VC 2OJED 4WY4C 1NKZB 1OVUA 2P2UA 4XEVA 5DQTA 4MTGA 4WGZA 2ETSA 2KZJA 4EYYQ 2KSFA 1ZHTA 4QMAA 4ZNCA 5DS5A 2VCAA 4C7OB 3CD6P 1DH3A 1T6UA 2IXNA 4RBNA 1JMMA 2KC3A 5GPGB 2J7PD 5K0IA 2KOGA 1OFCX 4C7NA 5KYWB 3VMZA 2PX0A 1USDA 2CNWD 3IN6A 2P7VA 1CGOA 2XSEA 2OYHB 4HFKB 2YLDA 3T97B 1FAVA 4PACA 4H44C 2N1TB 2NPSA 5JSLA 1NTZD 3H2VA 2QE7H 3CX5D 4Q7CA 3F46A 4DOZA 2CDQA 2H8PD 2EIJC 2IYLD 1YITP 1NTZE 5APXA 4H13D 3EFFK 4QDLA 1SQBK 1ZW2A 2R7QA 3K5BA 1YJWP 3EFOA 2K9JB 3VOPA 3RK3D 2CCYA 2E42A 4EBJA 1CI6B 3Q6MA 3E1RA 4P6IC 1Z5ZA 1VQLP 1V4AA 3RK2D 2ZXWC 3L34A 4DXWA 4DBRA 2XL8A 1M56D 4I7ZB 3EJNA 1GD2E 3GW6A 2EPLX 2KK7A 3CXHE 5L0IA 3ZWIA 3RK3C 1SS1A 3IFMA 1YZAA 2C04A 3O6QB 1L0LJ 1Q2NA 2W6AA 4L74A 3Q1MA 3U3BA 1EZVI 2R7RA 2A45G 2XNXA 4JTDB 2ZT9D 4FAPB 1BGYD 3RVZA 1WOLA 3SNHA 1OKKA 1SYQA 1JCCA 2CK3H 2R7XA 1NKNA 3M4BA 5DLJA 3WU2H 4XTKA 2M5AB 2FKWB 1N7SA 1ZLLA 5AVQB 1ZXGA 2AXTH 1ZRTE 1X9VA 4L76A 1GW3A 4PD4E 1JR8A 4DT0A 3H1KD 4IFMA 2P58A 1FZFA 2MWQA 3CWBE 1KYOH 2ZYDA 2I15A 2FYNC 5D91A 4BEJA 2YLIA 1NFOA 3CWBJ 3GM1A 3HNLA 1RQVA 1FDIA 2Q4FA 2HKVA 3ZIBA 1D0XA 2V3CC 1KFNA 3PJSK 4UB6H 5AVWB 4PJJA 1ZP0C 3VRCA 2E75C 4WB4A 3IF4A 3UIAA 2YEVA 3AE1C 3H1LE 1AFOA 1A0BA 2JR8A 2G3KA 3AE8C 2CYDA 5AVZB 1RE3A 3DAGA 5KYYA 1Z7Qc 3U8PA 3S27A 1EXJA 2J45A 3T6GB 4CJGA 1N7SD 5AC4A 4CIHA 1QZXA 4HEAJ 2WVOA 5CIVA 3CC7P 2CNWA 2OARA 2OYIC 3DXJF 3LEVA 1HE1A 2E76B 4LLHA 2BASA 5CBOA 1GDTA 2H89C 3A3YB 1AVOB 4CBEA 3JYYA 4OH8B 1USEA 1KQSO 3NTNA 1SQXE 1ORJA 3L74D 4PD4H 3GMAA 1SQXD 3VN0A 4D4NA 4C7RA 1BZ4A 4JYCA 1PPJD 3WU2E 2HSBA 4MVSA 3LW5H 2B87A 3TNUA 2OEXA 4WBAA 2IFMA 1X22A 2Y0DA 3WODF 4MTOA 1DIPA 1OIPA 3EGXA 4G7ZF 2PGDA 4GODA 4NPFX 1PP9J 5A6BD 1SFCC 5AVRB 1BE3J 1IFIA 4Y99B 1E84A 5GTIE 1Q0GA 3T6BA 1ZHXA 2WWWA 3L72E 2KSEA 4OIOF 3CCUP 3D71A 4YL0A 2DI3A 2QRXA 4IL6X 1KB9D 1NTKG 3MYIA 2CPBA 1URQB 3E7KA 1YJGA 2KJGA 1KYOD 2WSFJ 1BDDA 5CCGA 2NUTA 3L74J 2QIWA 4PJ0H 4PFOA 2OOCA 4AL0A 1MFTA 2R3SA 4B86A 4CS8C 1SQXG 3RIPA 1BDJB 3EG9A 3OWTA 3CMAP 4GYTA 2R7TA 3A0HE 3S4RA 4EIJA 1URQD 5L0DA 4H54A 3ASOC 2NG1A 5E79H 4XPXA 1GL2D 1L0NJ 1T6AA 4Z9IA 1FFTC 3CLQA 1ZMEC 3FXEA 3L37A 3GORA 1MFZA 3M0DA 5B66E 4JYBA 2MJZA 2LXBA 4H44B 4E0IA 2NPSC 5APWA 3L70E 2D5RB 3LESA 3LLIA 4PJLA 3C8ZA 2Q9AA 1NHLA 4X0RA 1V74B 4GIFA 1BR4A 3QMKA 3LNRA 1VQ5P 4LACB 1T01A 2V26A 5BQGA 3B0VC 2WSEJ 1TWCA 2B89A 3AE4C 4U5DE 5TJ5E 1IW7F 1PD1A 2Q1KA 1ZU4A 3DM5A 4XLPF 1JAFA 3H1JJ 3C9IA 4AE4A 3US6A 5A6JA 3AJMA 3AQBA 2ASRA 4D4XA 1FZBA 3DJUB 2E76D 3NMKA 1G1JA 1YLMA 4OIPF 1QL1A 1LWUA 1J1DC 4B6IA 1Q81Q 1LTGC 3PLNA 1M7LA 4AYCA 1YA9A 3K1IA 3UGPA 1EZVD 1JUNA 3B9QA 4GKGA 2EIKC 2PP4A 1HJ0A 3JT1A 2J59M 1LS4A 3NDBB 3F89A 1NYHA 3BATA 1MNDA 3EGDB 3TJ6A 1VF5B 3AE9C 1VF5C 1L4AB 1XZQA 3ITFA 4IAQA 1NSGB 5B5EE 2KQ9A 5KYYB 1FZCA 4IFDK 2AEMA 1XZPA 3AG4C 1S2EA 4YJWA 1RE4A 3B5ND 2P61A 3MGNA 5F28E 1TU3F 2KLUA 4IWBA 3SWKA 3RBZA 2R7UA 4PJNA 2Z5HA 2Q7CA 4XA4A 3NMDA 3DMDA 3CCLP 4I44A 3ABKC 2FYNB 3FWNA 2ZD9A 3L0IA 3O10A 2B9BA 1VTMP 1SF8A 3TDKA 1SQBE 1TWAA 2W83C 2E75B 4RKUJ 1W2EA 3O6QA 3MHVA 2JWDA 5KAFE 4YT4A 2HJMA 1SQQD 4IL6E 1K9MQ 4O79A 1T3UA 2QUPA 3AEFC 1NTZJ 1HJBA 1IFNA 3L73G 1NU7D 2XLWA 1MZ9A 3JSVC 4J7YA 1VDFA 4GT1A 3U59A 1NAFA 4U5HA 1S72P 1S7ZA 1BDCA 5BQIA 3QTHA 1S3JA 1QVXA 2HZ8A 4GQHA 1YAUO 2M0BA 4G7OF 2YL7A 4HB1A 5T1DB 3II6A 3W8IA 4NTBA 2ZYAA 1HUCA 3SFDC 3Q6NA 2HS5A 1FBMA 1SQPE 3VTPC 1OMIA 3P7KA 2XLOA 1QVFO 1YVIA 4XFJA 3KH2A 1G4WR 1M1JA 2BL2A 3O8ZA 4C3EA 1SQQE 1D7MA 1OW7A 3CEXA 1RF0A 5A6AA 4ZKPA 3BRVB 3WUUA 4PFPA 2IBFA 1HBWA 1VQOP 5AVUB 3CMEP 1U89A 3I5PA 2IBZD 3IEEA 1V54C 3TJ5A 3CX5E 2FBWC 4I1LA 1JY2O 5KLIC 5B3IA 2DYSC 2PX3A 2GAQA 3E9VA 4TT3H 4E7ZA 5DS6A 1LTJB 5DS4A 5E2QA 2GWWA 1KYOI 3ZVRA 1NLXA 1SFCA 4WGYA 4CSAA 2OKUA 3BRJA 2Q7RA 2JP3A 2FYUJ 2B0HA 3B8EB 1G1IA 4JC7A 2I8DA 1PCXA 1RKEB 1A7EA 1NU1G 2WT7B 4W7YA 3TSIA 2KS1A 1BR2A 3K1HA 1QL2A 4W7ZA 2XDJA 2QEXP 2VB6A 4BJ6A 2N1TA 4FX5A 2QE9A 2XLDA 1L2PA 3HD7C 4ZLCA 1KFMA 3CL3D 4CPGA 3CXHI 1T2KC 4A2NB 5KYXA 1O5HA 1L3PA 1JTHB 1M1JC 3TGUJ 4KNWA 2K37A 2R7OA 2YXRB 3V6IA 3G4SP 4U5EE 1U6HA 2O1KA 4KJMA 3EHNA 2KYVA 2R3CA 1S4XA 2EILC 3LS0A 3LUTB 1E79H 2UUHA 5L0JA 2K1AA 1FZGA 2EPKX 3KYIA 3NXSA 3EHMA 2FGYA 3M0DC 1R5SA 3TF5A 3EG9B 2XS1A 4BJ5A 1IK7A 4RDAA 1OQCA 1CPQA 3QW0A 3B5NC 3KDPB 3NMJA 1MMNA 4RD9A 4HJGH 2ZAEB 1K73Q 2IZ0A 2ZVOB 3GHGC 3S90A 2OYIA
chains in the Genus database with same CATH topology
2QJPC 1K04A 2P10A 4EBJA 2KK1A 3H25A 3D6ZA 2FXPA 4H0LC 3SFDC 4YXDC 1VF5D 2E76B 3Q2YA 1YQ3C 2H89C 3AE7C 1WWPA 3C8GD 1OMIA 3GM2A 5L8RJ 1EXIA 2BEZF 3AE6C 1V4AA 2G8YA 2Q00A 3AJMA 3JYYA 3L8JA 4XFJA 3C8VA 4H44D 3SFEC 2E76D 1OW7A 2ZT9C 3D6YA 1PV3A 4I7ZB 3JZ0A 3L8IA 3GMAA 2IDBA 3Q5PA 1U57A 3AEDC 5M1BA 2E74C 3RQGA 3B71A 2HSBA 1DD3A 3AEBC 2D2CC 3S9OA 3U0CA 2MKVA 1Y9BA 1HJ0A 1KNYA 2E74D 3GLMA 2WSCJ 1WTYA 3MFNA 3FGAD 3AE2C 2E76C 1JB0J 2FBWC 3Q1MA 1KQGB 5KLIC 1AJYA 1DIPA 1OW8A 4R4MA 4Z1MH 1NYHA 3G9RA 1VL2A 4TT3H 2JO1A 3GF3A 2ZT9D 1VF5B 3AE9C 1VF5C 3C8GB 1KMIZ 4XEFA 1WOLA 3BRJA 3RL0g 4I7ZC 1K05A 2JP3A 3LW5J 4OGQC 1Q90D 2QJKC 2NZ2A 3IAOA 4H0LD 4KT0J 1DD4A 3D71A 2YWAA 4EBKA 4PV1B 3AE5C 4IL6X 1KQFB 3ABVC 3AEGC 3GF7A 3RK3E 4H13B 1NGMB 5F28E 2G3AA 1ZRTE 3EWKA 2WSFJ 1TU3F 3R4YA 2QIWA 3AE3C 4XEVA 2O01J 4YTPC 2BEQD 3AEAC 1PL5A 2JPUA 3GM3A 4OGQD 1ZZPA 2QSIA 5KKZC 3Q5RA 3RQEA 1K40A 3RQFA 1FDOA 2WQYC 2FYNC 3D70A 2H88C 2QJYC 2ZT9B 4OGQB 1S5LX 4H0LB 1ZOYC 1UIXA 3GM1A 3O10A 1RQVA 2OQQA 2L6GA 2D2CD 1FDIA 3AECC 2E75D 3U3FA 1RQUA 4PV1C 3K7DA 3TULA 2D2CB 1WMKA 1GMJA 3IN6A 4R32A 1R8EA 2E75B 4RKUJ 4H13C 3O6QA 3AEEC 2V7QJ 1UFBA 1ZP0C 4PV1D 1ZMEC 2YMKA 4U7JA 4R4LA 1O3UA 2E75C 3T97B 3C18A 4GDOA 4NQFA 4H44C 2YIUC 3AE1C 2PBEA 4H44B 1KILE 1YQ4C 2J5UA 3AEFC 2LK4A 3Q3DA 3AE8C 2K9YA 3C8GA 1IK7A 2WPVB 2JX0A 4H13D 2L6FA 1JOGA 1KORA 1OW6A 1EXJA 2E74B 2L6HA 2WSEJ 1QVXA 4Y28J 1HF9A 1MKMA 3Q5SA 4XEKA 1S1CX 3AE4C 1PIXA 1KTMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K04 A;  4EBJ A;  2KK1 A;  4YXD C;  3SFD C;  3AE7 C;  2H89 C;  1YQ3 C;  1WWP A;  3C8G D;  3GM2 A;  3AE6 C;  1V4A A;  3AJM A;  2Q00 A;  3JYY A;  3L8J A;  3SFE C;  1OW7 A;  1PV3 A;  3JZ0 A;  3L8I A;  3AED C;  3RQG A;  3B71 A;  2HSB A;  3AEB C;  3S9O A;  3U0C A;  1KNY A;  1WTY A;  3MFN A;  3AE2 C;  2FBW C;  1OW8 A;  3AE9 C;  3C8G B;  4XEF A;  1WOL A;  3BRJ A;  1K05 A;  2YWA A;  4EBK A;  3AE5 C;  3ABV C;  3AEG C;  5F28 E;  2G3A A;  3AE3 C;  4XEV A;  4YTP C;  3AEA C;  2JPU A;  3GM3 A;  1ZZP A;  3RQE A;  1K40 A;  3RQF A;  2WQY C;  2H88 C;  1ZOY C;  3GM1 A;  3O10 A;  2L6G A;  3AEC C;  3U3F A;  3K7D A;  3TUL A;  4R32 A;  3AEE C;  1UFB A;  1ZP0 C;  1O3U A;  4NQF A;  3C18 A;  2PBE A;  3AE1 C;  1YQ4 C;  3AEF C;  2LK4 A;  3AE8 C;  3C8G A;  2JX0 A;  2L6F A;  1JOG A;  1OW6 A;  2L6H A;  1QVX A;  4XEK A;  3AE4 C;  1KTM A; 
#chains in the Genus database with same CATH topology
 3S1K A;  1Y4C A;  4MW8 A;  3D6Z A;  4YXD C;  2OU6 A;  3E70 C;  2KLV A;  5EK0 A;  1R5I D;  2OEV A;  1M6T A;  3WMM 0;  4KHX A;  3TQO A;  4I1M A;  1BCC D;  4N78 D;  1T2K D;  3KMI A;  1E2X A;  1JRA A;  2QTV A;  4ER9 A;  1V55 C;  4O7G A;  1WAS A;  2PF4 E;  4D6T J;  4JUR I;  5DVW A;  3EFO B;  2IBZ E;  1JY3 O;  2P67 A;  1JMB A;  2A69 F;  3CX5 H;  2HPC A;  3V5X A;  3MYF A;  3LS1 A;  2QM8 A;  3MFN A;  2E76 C;  1NO4 A;  5B3S C;  4XPY A;  1KB9 I;  1A7V A;  2CGE A;  5KLV K;  1RH5 B;  2JO1 A;  4I6M C;  1LI7 A;  1MQV A;  2A6H F;  4MS2 A;  2I1J A;  3C8G B;  2R5D A;  1YJN P;  1T6Q A;  1CZQ A;  2LP4 A;  2YWA A;  4M63 A;  3FX0 A;  3WHN A;  2RSE B;  2IFN A;  3AG3 C;  1X8Y A;  1L0N K;  4CX9 A;  3ABV C;  3ZQY A;  1BE3 D;  3V4W A;  2R7W A;  2GM4 A;  1YYJ A;  4LDK A;  3VYI A;  1GK6 A;  3AE3 C;  2SPZ A;  2Y9Z A;  4YPC A;  3N4X A;  5KKZ C;  1NTK E;  2I8B A;  1AVY A;  4CS7 A;  3BCC J;  3DM9 B;  1VQ6 P;  2L9J A;  4JTC B;  4IJJ A;  1J2J B;  1J8M F;  3SXY A;  2XXA A;  4DRH B;  4WAB A;  3A2A A;  1GL2 A;  4PV1 C;  2IX7 C;  2Z5I A;  1URQ C;  1IZN B;  4M3L A;  3AEE C;  3FAJ A;  4U7J A;  1CI6 A;  4R4L A;  3IQC A;  5B66 H;  1LTJ A;  1TR2 A;  3SWF A;  3FHD A;  4CJO A;  2HV6 A;  3JSE O;  3Q3D A;  5AVT B;  5AW0 B;  3U2M A;  1SFC B;  1G4U S;  1LWU B;  3L75 D;  4QI0 A;  2L6F A;  1N73 A;  2BCC G;  2W4B A;  3KHU A;  3PMR A;  4J30 B;  4DZO A;  1J8Y F;  1EQ1 A;  3H32 A;  4XEK A;  3Q5S A;  1N7S B;  2Q9I A;  1M2V A;  4CS9 C;  5JS5 A;  1Z63 A;  2P10 A;  3MP7 B;  3Q2Y A;  4NTA A;  1SFC D;  1H0T B;  3HUS C;  3HUS B;  4JTA B;  1BSH A;  2PNO A;  3H1K E;  3ECS A;  1D0Z A;  3SXK A;  2GUS A;  1Z3I X;  3UMI A;  1ZHZ A;  3C8V A;  3V4Q A;  2A06 G;  1IJD B;  5CJ4 A;  3W4Y A;  1RF0 C;  1Q0F A;  3Q5P A;  1YAR O;  1Q82 Q;  5COG A;  3GEI A;  2E74 C;  2N9Y B;  3B71 A;  1YZC A;  2HFE D;  3MIW A;  3U0C A;  2W27 A;  1EZV E;  2QNL A;  1U7J A;  1TKN A;  1LT1 A;  2LKM A;  2ZJS E;  3P8C E;  4JJG A;  4N06 A;  2D4U A;  4BJ1 A;  4WJ0 A;  1Q0K A;  3KZI H;  5DJT B;  1EZV G;  3A0B H;  2NSG A;  2XLV A;  5E3C A;  4LLE A;  3AOU A;  3FVY A;  3VP9 A;  5KJ7 A;  3GF7 A;  1EDI A;  1Z56 A;  4RJT A;  2OYI B;  4PK4 A;  1PL5 A;  2WVR A;  1FFH A;  4XPW A;  2YMY A;  1MMA A;  1W2B O;  3HUS A;  2J9W A;  5BVZ A;  2LIG A;  2NRG A;  4XE5 B;  1ZOY C;  3UMH A;  3IR9 A;  2JJL A;  2OQQ A;  2OTL P;  2RMZ A;  1HH0 A;  2XLM A;  5JP7 A;  5A69 A;  1RQU A;  3EZI A;  2HR3 A;  1NTM E;  1FDM A;  3H65 A;  3W2V A;  3K1I C;  2QVA A;  3U9J A;  3TNU B;  4IAO A;  2W6B A;  4XLN F;  1T6I A;  3IQT A;  2WSE H;  1CW5 A;  3CX5 I;  2C03 A;  4PR9 A;  3T4R A;  3H1J D;  5TIS E;  3O39 A;  4YT8 A;  1KIL E;  2LFF A;  3U1C A;  2J5U A;  2A0B A;  1L4A A;  1SQP K;  1YYX A;  2EIN C;  1JEK A;  2IM8 A;  1KB9 H;  1OXK A;  1MMD A;  3L72 G;  1OCR C;  5KYX B;  2X51 A;  1HGZ A;  2H43 A;  3BCC D;  5F5F A;  2O01 N;  1LGH B;  3B5N B;  3B0P A;  1L0L K;  1OW6 A;  5AW9 B;  3USS A;  1PGJ A;  2WT7 A;  3ZDL A;  1FC2 C;  1KYO E;  2M3B A;  1OZH A;  5AC5 A;  5KJ7 C;  1NVO A;  1T3J A;  2R9R B;  4AK9 A;  3V5Y A;  1L4A D;  3H25 A;  1ZW0 A;  2P1A A;  3L73 D;  2PFD A;  1FTS A;  3GM2 A;  2BEZ F;  4JRZ A;  2Q00 A;  3GEH A;  3HNJ A;  3DE9 A;  5L0C A;  1E86 A;  3M06 A;  1TQG A;  1VLS A;  4N78 E;  1QQ3 A;  3RL0 D;  1I4Y A;  3HE4 A;  2Y9Y A;  3UGO A;  2IDB A;  5KYU A;  3BCC E;  1T8Z A;  1ZVZ A;  1KC8 Q;  1XTG B;  5JLI A;  4PJM A;  2YL1 A;  2Y39 A;  2IYO A;  2KS1 B;  2FYU D;  5CHX A;  1KNY A;  1EQ7 A;  2XLH A;  1RF1 B;  1AJY A;  2W4M A;  1H88 A;  3RK2 C;  1ZR2 A;  3GF3 A;  1IFD A;  1NTZ K;  1MUU A;  5IY5 C;  3I56 P;  1OX3 A;  1ZHY A;  2YKQ A;  3BRT B;  3RVY A;  1NBB A;  3SSU A;  3CCS P;  1OR2 A;  1GU5 A;  1KQL A;  4OGQ C;  3ABL C;  5B5E H;  1A02 F;  2NZ2 A;  2W8Z A;  4H0L D;  2VH3 A;  1FE6 A;  1SQB G;  4W8P A;  3AEG C;  3RBX A;  2WB7 A;  3N7N A;  4MQ9 F;  1PPJ E;  2H8A A;  4D6T G;  3G4Z A;  4E18 A;  3HD7 A;  1S9K E;  3M4C A;  1RF1 A;  4MW3 A;  2GFH A;  5TIS H;  4U3F G;  3LJB A;  3TGU E;  3NYM A;  4LDQ A;  5COF A;  2NUP A;  3Q5R A;  2HSQ A;  2R32 A;  3DZA A;  2A68 F;  3W8H A;  2QJY B;  1HTL C;  1ZW3 A;  2QJY C;  1JY2 N;  1P84 E;  2Z4E A;  3SXZ A;  3RH3 A;  1VQ8 P;  5KYU B;  2C9L Y;  2R02 A;  2FFD C;  3TD7 A;  4K3A A;  1OXB A;  3KL4 A;  3M15 A;  1URQ A;  4FWV A;  5D92 A;  3GWL A;  2OCC C;  2DB4 A;  4GOE A;  3ZTM A;  1QX8 A;  3L75 G;  3V5B A;  4MVQ A;  3I4U A;  3EQL F;  1DEE G;  2A45 H;  1FZC C;  4JJF A;  4CDV A;  1PFI A;  1LKX A;  2R7S A;  3MZW B;  4K35 A;  4ASW A;  5GTH E;  2R7V A;  1SZI A;  3C62 A;  3CWB G;  3CZ6 A;  2KNH A;  1M2O A;  4U9D A;  2OYH A;  2IXM A;  2KK1 A;  2NUT B;  4EHP A;  4H0L C;  4C7O A;  2WTY A;  3TGU D;  2P7J A;  4OVN F;  1S9K D;  2ZT9 C;  3D6Y A;  3QZC A;  3L8I A;  1HE9 A;  1BSN A;  1H89 A;  1NTM J;  1OWA A;  2WPS A;  1QPU A;  4PD4 D;  5AVY B;  3EQ2 A;  2J0W A;  5JUA A;  3S9O A;  2K3R A;  3T97 A;  4O6M A;  5EGY A;  1JB0 J;  2YL0 A;  4R4M A;  4Z1M H;  1YJ9 P;  1GZL A;  4BJT A;  1PZQ A;  3BAS A;  1RKC A;  4AE4 B;  4DVZ A;  3ATP A;  1JY3 P;  1SMY F;  1JTH A;  1VB5 A;  2PP6 A;  2KNC A;  1QLE D;  4C7N B;  1DX7 A;  3NG1 A;  1DD4 A;  1VQP P;  1VQM P;  3LAY A;  5KYN A;  1OR3 A;  1KD1 Q;  3O6X A;  2PFX A;  1E85 A;  3GHG A;  2HMQ A;  4U3F E;  3V2P A;  3CCE P;  1GK4 A;  2QM7 A;  2VCB A;  4HKZ H;  4NPD A;  1NU1 K;  4CS8 A;  1WRG A;  3G50 A;  4P9F A;  4OIQ F;  1LVK A;  2PRR A;  5KTB A;  1M1J B;  1K40 A;  3ITK A;  5L3Q A;  1FDO A;  4MN4 C;  3JCU H;  2IOQ A;  4EKW A;  2AXC A;  5CBN A;  1HW1 A;  2OQM A;  3FMS A;  1KV4 A;  2BC5 A;  3A7O A;  5L0G A;  4R32 A;  1DOW A;  3RL0 C;  1HWT C;  4MVZ A;  3W68 A;  1SQV D;  1M57 C;  2Q9C A;  1Q0D A;  2YKO A;  4U5C E;  2QLA A;  4EWC A;  1LP1 B;  4EBB A;  2E87 A;  1VQ7 P;  1ZR4 A;  2LXC B;  1L4A C;  3MLG A;  4UDV A;  4JBZ A;  2J58 A;  2CW0 F;  3OA1 A;  4OIN F;  2HFI A;  1VQK P;  1P84 I;  3S29 A;  1E83 A;  3MBG A;  1JPN A;  3EH1 A;  3BEH A;  1NG1 A;  2H7H A;  1CPR A;  1K04 A;  3M9H A;  2VAS A;  3NFQ A;  4L73 A;  3FOP A;  5COM A;  3WUT A;  3CCM P;  1LPE A;  5L8R J;  1LP1 A;  2CPS A;  4L6R A;  3J06 A;  3H1J E;  4H44 D;  3AGT A;  4ZKU A;  3RKO F;  2BE5 F;  1LTI C;  5JT4 A;  3CSK A;  2XM4 A;  2XXA B;  2XL6 A;  4EDF A;  1JY2 P;  4OWF A;  5AW3 B;  2XND H;  3CAX A;  3AED C;  4JCH A;  3ABM C;  2GUV A;  3I5C A;  2HJ3 A;  1G2C B;  2PAJ A;  1MV8 A;  1VQN P;  3DI5 A;  1EDJ A;  2E74 D;  1BGY G;  2K88 A;  3AE2 C;  2YKP A;  1KQG B;  3RK2 B;  1M1K Q;  2Q5U A;  3A9C A;  3A5T A;  3TK1 A;  1HVV A;  1VYK A;  3TOM A;  3H1I J;  5BU5 A;  3B5N A;  2E5Y A;  4JZA A;  3L70 D;  1NFN A;  2OG2 A;  4YN0 B;  3A0B E;  1T5O A;  4E17 A;  1FJK A;  3AE5 C;  2A45 I;  5CMZ A;  1L0L G;  1QVG O;  2OTK E;  3H6P A;  1H8A A;  1RHZ B;  2B87 B;  2GA0 A;  5CI8 A;  4YK5 A;  1KU2 A;  4BRY A;  1RJ9 B;  3R2P A;  4JPZ B;  2XS8 A;  2YRF A;  2BEQ D;  3VP8 A;  5BU8 B;  2G62 A;  4LLC A;  4OGQ D;  1RF1 C;  4U9E A;  1XWJ A;  2AEJ A;  1ZZP A;  1S5L E;  2QSI A;  4OIR F;  3RQE A;  1E5W A;  3U9M A;  4CDA A;  2QA4 P;  2N9B A;  1VLT A;  3QVY A;  2B0J A;  1ZHW A;  3M9B A;  3DAF A;  2H7O A;  2VC9 A;  1J1E B;  2OGU A;  2E5T A;  1TFK B;  3PH0 A;  4BG0 A;  1EDL A;  4O6N A;  5AW4 B;  1L0L E;  4O6Y A;  1UFB A;  2M3E A;  4PV1 D;  4D6T E;  2F22 A;  2LCH A;  3X1O A;  2O3J A;  4C46 A;  2BCC J;  2A1D D;  3L75 J;  2IXP A;  1EKY A;  3L70 G;  1QLE C;  3L72 D;  2BCC E;  4AUW A;  3SWY A;  1W2W A;  2AU5 A;  3CC2 P;  2WPV B;  2G3V A;  3JYH A;  1BGY E;  1NZE A;  3HTK B;  1GTW A;  4MVR A;  3TK0 A;  2A06 E;  1L7C A;  1G2C A;  1QEX A;  1Q86 Q;  1MKM A;  3KQG A;  4IB4 A;  4H0L B;  2WZF A;  3TGU G;  5AVS B;  4JQ0 D;  1VK5 A;  3U5S A;  2W6J H;  1LTA C;  4ULW A;  1EXI A;  2ZXO A;  1Q0M A;  1OKK D;  3OA7 A;  2YZS A;  2YXQ B;  3BCC G;  4C3D A;  1SQP G;  1PV3 A;  1QSP A;  4DOJ A;  5CCH D;  3HKK A;  3AEB C;  2QJP B;  2FYU G;  3EH2 A;  1SR2 A;  3S0X A;  3PHL A;  3V2R A;  1SQV J;  2WSC J;  1HW2 A;  3MTU E;  4LGD E;  2E43 A;  1S05 A;  3DKA A;  2NUP B;  1LIH A;  4CSA C;  3ASN C;  4JCZ A;  1N73 C;  3KZI E;  2RN0 A;  4LC1 A;  5KLV G;  3HE4 B;  3SYN A;  5L3V A;  2K9J A;  2ZVN B;  3UR3 C;  4CIP A;  2FYU E;  3QW1 A;  3QVZ A;  1SQV G;  3DE8 A;  4D6T D;  4IGG A;  2N1T C;  1WGW A;  4WY4 A;  3EPV A;  4PJ0 E;  5JVE A;  2YIU B;  4KC9 A;  3VMA A;  1T9K A;  3O55 A;  3VMY A;  4DRI B;  3FOO A;  5CCG D;  4AQR D;  1LWU C;  3JCU E;  4OGQ B;  3GOD A;  2O1J A;  2L6G A;  2D2C D;  1ZN5 A;  2WSF H;  3EFG A;  5T3T A;  1GW4 A;  1RKE A;  2M8R A;  4EIY A;  1YYC A;  2FYZ A;  4MVO A;  4U3F D;  1PP9 E;  1RCP A;  4GDO A;  3L73 J;  2LD6 A;  1LM3 B;  2LSE A;  2C0X A;  1ORS C;  3CCJ P;  3EGD A;  5KLV D;  2IBZ G;  2L5G B;  1D1C A;  3L72 J;  3SP1 A;  3B0U X;  3H1L G;  1KIL D;  1AUE A;  2Y3H A;  1BCC J;  2ITA A;  2QJK B;  2WPR A;  2WZ7 A;  4JW1 A;  1JOG A;  2EPM X;  2WL8 A;  3H1I E;  1M57 D;  2E74 B;  3BVH A;  3GWN A;  4JKV A;  3L74 E;  1TWG A;  2J8W A;  1IK9 A;  3VMX A;  1L0N D;  1I5N A;  3ZDM A;  1NTM D;  3HE5 A;  2QJP C;  2KXP B;  1VF5 D;  3JRT A;  2HMZ A;  2VCC A;  1PGQ A;  2VRS A;  3PCV A;  1D1B A;  2M4E A;  2G8Y A;  2P6V A;  1FJP A;  2DGJ A;  3FXD A;  2N1T D;  4E0H A;  2WVN A;  5F5H A;  3H1I D;  3V2N A;  3N24 A;  4RES B;  3WUV A;  2P1J A;  2ZXR A;  5M1B A;  3FWL A;  4GOF A;  1U7M A;  1WN0 A;  2ZYG A;  3AQC A;  2AWC A;  1UII A;  1SQB J;  1MMG A;  3UMK A;  1NU1 J;  2R5B A;  4BWN A;  1FMV A;  1NU1 E;  3L35 A;  3MUD C;  3I55 P;  2KYH A;  3HD7 D;  5L0F A;  2UUI A;  1JCD A;  4ZMD A;  2IBZ I;  5EFW B;  4XEF A;  5EHH A;  2Y69 C;  3RL0 g;  1EDK A;  5H2F H;  2KB7 P;  1RXQ A;  2P0N A;  2WPQ A;  3KYJ A;  1BGY J;  3NRH A;  1D1A A;  2YVK A;  2NPU A;  4ZLD A;  2WZL A;  2G3A A;  4N3Y B;  1YIJ P;  3LLK A;  1FR0 A;  4DJG A;  1RMV A;  3AEA C;  2JPU A;  3EGX B;  4PD4 I;  1M8O B;  4HYT B;  3RQF A;  3H1H G;  3KXD A;  4IFF A;  3D70 A;  1BR1 A;  1P84 H;  2H88 C;  2KSJ A;  4DJ9 A;  2FFD B;  1UIX A;  1KZU B;  1FU1 A;  5H2F E;  1N73 B;  2H7B A;  3KKB A;  1SQX K;  4GEH A;  1YTZ T;  3U3F A;  2LFD A;  2EPO A;  2FFH A;  3H32 B;  5GTH H;  4MVM A;  3HNI A;  2W90 A;  1GMJ A;  3SEO A;  1BCC G;  3ZSU A;  2ICW G;  1O3U A;  1VMA A;  4W80 A;  1B68 A;  5BQH A;  3MX3 A;  1AEP A;  5AW2 B;  1SQQ K;  3IQ6 A;  1SQP D;  1YQ4 C;  2J7P A;  3MUD A;  1LE4 A;  1NTK D;  2J9U A;  2AP3 A;  3JCU Q;  4BXL A;  1LTS C;  1KOR A;  4JVS A;  2Q3T A;  3GAN A;  3M1C B;  4A4A A;  4Q4Z F;  1SQB D;  4QI2 A;  4Y28 J;  3W67 A;  4K0D A;  4BJ6 C;  3IPM O;  1RJ9 A;  1GM5 A;  2WSS H;  3PP5 A;  4OD4 A;  3ZG1 A;  2ZXX A;  1YQ3 C;  1SQX J;  2RKL A;  3SZR A;  5TJH A;  3C8G D;  1WAT A;  3AE6 C;  1DOV A;  1OVV A;  2HG5 D;  2POH A;  3HLZ A;  4I1O B;  1LJ2 A;  1Y47 A;  2FXM A;  2FFD A;  3H1H E;  1C02 A;  3HJC A;  3AG1 C;  1DD3 A;  5HV9 A;  1AA0 A;  2C0W A;  3L73 E;  2MKV A;  1Y9B A;  5L0H A;  2Q6Q A;  4U5F E;  3M79 A;  2A0U A;  2LQG A;  2YO2 A;  2LR2 A;  4IOI H;  1BCC E;  3RF3 A;  3U2L A;  1KMI Z;  1Z6A A;  2IXO A;  4HFF B;  1G8X A;  3G6E P;  4I7Z C;  3LW5 J;  2IYP A;  4H4K C;  3A11 A;  3RK3 B;  1JNM A;  2YKZ A;  3JRM O;  3P8M C;  3RL0 B;  2XKM A;  1IC2 A;  2JKV A;  4MND A;  1A02 J;  1SQP J;  2ZFC A;  1SLQ A;  4YL1 A;  2AEF A;  2KZI A;  5CCG C;  4A7P A;  1R5L A;  5AW6 B;  3E1I A;  1NU1 D;  1Z23 A;  3M0A A;  1H9T A;  5APV A;  3NYJ A;  3T9O A;  1PD0 A;  4BPM A;  3G71 P;  2KNC B;  1P84 D;  3JSZ A;  3C63 A;  2YNY A;  1L0N E;  3AEC C;  1VQ4 P;  1ZYR F;  4L75 A;  5JRA A;  5AGF A;  1LT9 B;  4Q5S F;  3CI9 A;  3K6B A;  2OJQ A;  4WVZ A;  2KI7 B;  2V7Q J;  1HY5 A;  2FXO A;  1YTZ I;  1LI5 A;  2FYU K;  3LNM B;  1PGP A;  3OJA B;  1H0T A;  2PBE A;  5T3W A;  4YXW H;  3NYL A;  2JWA A;  2C9N Y;  1O87 A;  1C03 A;  3FDQ A;  2OTJ P;  3M91 A;  4NCQ A;  2HOD B;  4AL1 A;  3VAY A;  3TOL A;  1LE2 A;  1RY3 A;  1L0N G;  3U1A A;  5C39 A;  2YO3 A;  3EZH A;  2XV5 A;  1BBH A;  2EPN A;  1JY3 N;  3N0T A;  1EC5 A;  1AV1 A;  4IL6 H;  3G4X A;  2FXP A;  4O9B A;  1LNQ A;  3AE7 C;  1IFJ A;  5FCL A;  1OVR A;  3JC2 2;  3H1K G;  2J9V A;  3IHU A;  3KPH A;  2ZPA A;  4NC3 A;  5HSW A;  5GTI H;  3B29 A;  3DJN B;  1NTK J;  1J1D B;  1SQQ G;  1GL2 C;  4FES A;  3RQG A;  2XRH A;  2YLG A;  3H2U A;  4JIO A;  5FZT A;  2GA1 A;  2AXT E;  2RH0 A;  3OEO A;  3VYW A;  1AQ5 A;  3FGA D;  2V4H A;  2B88 A;  3K66 A;  1SQV E;  5A6K A;  1KIL C;  1YDI A;  2HOD A;  2R44 A;  1JOC A;  3AGU A;  1BE3 G;  3DD7 A;  1ZU5 A;  3I5Q A;  1X79 B;  2JEE A;  2KUB A;  1LT9 A;  3L71 G;  4IAR A;  3S28 A;  1LTT C;  1KQF B;  1K8A Q;  4H13 B;  5CCH A;  2MHR A;  1D0Y A;  4EI2 A;  3L1M A;  2O01 J;  1FOS E;  1JMW A;  2Y3D A;  1JO5 A;  2JD3 A;  2RD9 A;  3P32 A;  3PRJ A;  2WVQ A;  1GU4 A;  1JPJ A;  2DW3 A;  4W8K A;  1Q7Y Q;  1VOM A;  3KPE A;  2ZT9 B;  4KBL A;  1S5L X;  3H1K J;  1QKR A;  4N6J A;  3WG7 C;  2E75 D;  1I4Z A;  3K7D A;  2HUJ A;  1M2V B;  4EUK B;  1CGN A;  3V7O A;  1SQV K;  3TYY A;  2Q3I A;  4G7H F;  3U8V A;  1BE3 E;  3POV A;  3PHF 2;  3IQ5 A;  1NWQ A;  4NY3 A;  4JEB A;  2K9Y A;  1PGO A;  4Y99 C;  2KW3 C;  4DRJ B;  2L7A A;  1N1C A;  2J0X A;  3PTZ A;  1L0L D;  2L6H A;  1IFP A;  1N7S C;  1ST6 A;  3NKE A;  1LT9 C;  4I2L C;  4UB6 E;  1R4T A;  2GDC A;  1S1C X;  2FY8 A;  4ASV A;  1SP4 A;  2O9X A;  3FXH A;  2YQY A;  2BCC D;  2R03 A;  1N2D C;  2IZ1 A;  3PDM P;  4YT2 A;  5AW5 B;  5DQZ A;  1VQ9 P;  3H1L D;  2WIT A;  3L8J A;  3NMI A;  4ULV A;  3SFE C;  5AVV B;  1OCC C;  3RGU A;  3JZ0 A;  2NPS D;  4DVY P;  5APQ A;  3UNG C;  2WZG A;  5KYW A;  3HTK A;  4MVU A;  2XU6 A;  2KIK A;  5B1B C;  4G78 A;  4LDR A;  3HE5 B;  1WTY A;  3RYL A;  2IPP A;  3F47 A;  3L4F A;  3RW0 A;  3G9R A;  1EA8 A;  1VL2 A;  3KYQ A;  1LTJ C;  2QG4 A;  1RE3 C;  5AVX B;  2L81 A;  3H1I G;  1H6G A;  4HH2 A;  3L75 E;  1NTK K;  3A0H H;  3CCQ P;  2TMV P;  4J7T A;  3VM6 A;  1OXZ A;  3NKD A;  1GL2 B;  2A6E F;  4PV1 B;  1GQA A;  1OCO C;  5BUO A;  1KN7 A;  2M64 A;  1M90 Q;  1LS1 A;  1NGM B;  3QWO C;  5CI9 A;  2Y3G A;  3RFY A;  3CPW O;  4U5B E;  4YTP C;  5KAF H;  2Y3B A;  1AVO A;  4LER A;  1FNT c;  1S5L H;  2ZXE B;  5E33 A;  2WQY C;  4I3M A;  1FS0 E;  4N6H A;  5AW8 B;  1C17 M;  2JDI H;  5KJ7 D;  5CJ0 A;  3H1J G;  3OW2 O;  1PP9 D;  3HTK C;  1Y8A A;  2HYN A;  1WMK A;  1NU9 C;  4E7S A;  4H13 C;  3LEO A;  3H1L J;  2HPC B;  3C18 A;  1F1M A;  1Y6D A;  1VPC A;  1AQT A;  1X0T A;  1FOS F;  1YHQ P;  4DCK A;  2LK4 A;  2KP8 A;  3B4S A;  3K33 A;  5KLV E;  2JX0 A;  1NTZ G;  3V5Z A;  4OD5 A;  4BJ5 C;  1H9G A;  3S84 A;  1XTC C;  4JE9 A;  3C7J A;  1LTB C;  4WY4 D;  2Q9B A;  1HF9 A;  2OYO A;  3V2Q A;  2WMM A;  1KTM A;  3ZQV A;  1MNE A;  2XLE A;  3Q7G A;  1NTM K;  1CGM E;  2Z15 A;  1CSB A;  3HD7 B;  3HRN A;  2MYS A;  4AX2 A;  2YL3 A;  3X2Q C;  4TLF A;  1U0B B;  5DJU B;  4IRU A;  3CCV P;  3H1H J;  1FZE A;  1FZC B;  5A6B A;  5K5G B;  2WSC H;  2AVK A;  1HMD A;  1VYI A;  3L71 E;  2D2C C;  4BRY B;  3W2W A;  1KB9 E;  4DBQ A;  3GLM A;  2R25 A;  3L71 J;  1OCZ C;  1NOH A;  3JTL O;  2NPS B;  2NSF A;  5AW7 B;  1NAY A;  4CDY A;  4XQ1 A;  4BEM J;  1G5Z A;  1KIL A;  1SVF A;  3C1L A;  2X0C A;  1QGK B;  5KAI H;  1K05 A;  4J32 B;  2Y0C A;  3N2Z B;  1Q90 D;  3WAQ A;  3IAO A;  4Z9H A;  2KGO A;  5AW1 B;  1TFO B;  1IFM A;  3CC4 P;  4RO0 A;  4MTF A;  1NTM G;  2OYH C;  4P9T A;  2J9B A;  3EWK A;  3MD0 A;  2A06 D;  3R4Y A;  5CCH C;  1APC A;  3F5H A;  1FAP B;  4YT5 A;  2HV7 A;  1HMO A;  5KLI B;  1SQQ J;  3GM3 A;  2DYR C;  3AG2 C;  5E79 E;  5APS A;  2XZR A;  1IZM A;  2XL4 A;  2EIM C;  4EOT A;  1WT6 A;  2J46 A;  1NJI Q;  3GEE A;  3ZTZ A;  3GG2 A;  4ANJ A;  2UWJ E;  2V7Q H;  1FZA A;  3TUL A;  2D2C B;  3DWW A;  1R8E A;  1DEB A;  4XWJ A;  3M9Q A;  3P8C D;  3Q7L A;  2YMK A;  4NQF A;  4F4B A;  4N6C A;  2YIU C;  3L70 J;  1N86 A;  1FMW A;  2QY9 A;  1NH4 A;  3CXH H;  5APU A;  1M56 C;  2ZXP A;  1UG7 A;  3FAP B;  4U5G A;  3C8G A;  3CWB D;  2YHS A;  3HNK A;  4N4W A;  2I1K A;  4UB8 E;  2Y0E A;  4UB8 H;  4HE8 D;  4K1O A;  5APT A;  2L91 A;  1ZV8 A;  3LID A;  1PIX A;  1H7I A;  4WY4 B;  2XM0 A;  1HGV A;  4CS9 A;  1IO4 A;  4NPE A;  3L36 A;  3ZC4 A;  1WWP A;  4U3F J;  5KKZ B;  1N8R Q;  4Z9J A;  1KIL B;  3H1H D;  4YL3 A;  1A41 A;  4YWQ A;  4KNV A;  5KAI E;  3CCR P;  2AWY A;  4NTF A;  4JEA A;  2Q3E A;  1U57 A;  4KI2 A;  2W45 A;  4K7B A;  2M5A A;  1ZRT D;  2O01 H;  3L74 G;  1A7D A;  1GGQ A;  2R05 A;  4JF7 A;  3GHG B;  1W5C E;  4C3B A;  256B A;  3R7C A;  3CXH D;  1PPJ G;  3OAK A;  3QH9 A;  1OW8 A;  3SXM A;  1JM0 A;  5KLV J;  1GS9 A;  4ONS A;  2HLO A;  2FAP B;  5E3A A;  1ORY A;  1N7L A;  1YA7 O;  1YI2 P;  5B1A C;  3VF0 A;  1PP9 G;  3CQZ A;  5APY A;  1YBK A;  2QJK C;  3LIE A;  4KT0 J;  2W9Y A;  3L71 D;  4EBK A;  3G3Z A;  1J1E C;  4WWI A;  1TWH A;  1EI7 A;  1RE4 C;  3RK3 E;  3T6J A;  4G0H A;  2H7V C;  2OJE D;  4WY4 C;  1NKZ B;  1OVU A;  2P2U A;  4XEV A;  5DQT A;  4MTG A;  4WGZ A;  2ETS A;  2KZJ A;  4EYY Q;  2KSF A;  1ZHT A;  4QMA A;  4ZNC A;  5DS5 A;  2VCA A;  4C7O B;  3CD6 P;  1DH3 A;  1T6U A;  2IXN A;  4RBN A;  1JMM A;  2KC3 A;  5GPG B;  2J7P D;  5K0I A;  2KOG A;  1OFC X;  4C7N A;  5KYW B;  3VMZ A;  2PX0 A;  1USD A;  2CNW D;  3IN6 A;  2P7V A;  1CGO A;  2XSE A;  2OYH B;  4HFK B;  2YLD A;  3T97 B;  1FAV A;  4PAC A;  4H44 C;  2N1T B;  2NPS A;  5JSL A;  1NTZ D;  3H2V A;  2QE7 H;  3CX5 D;  4Q7C A;  3F46 A;  4DOZ A;  2CDQ A;  2H8P D;  2EIJ C;  2IYL D;  1YIT P;  1NTZ E;  5APX A;  4H13 D;  3EFF K;  4QDL A;  1SQB K;  1ZW2 A;  2R7Q A;  3K5B A;  1YJW P;  3EFO A;  2K9J B;  3VOP A;  3RK3 D;  2CCY A;  2E42 A;  4EBJ A;  1CI6 B;  3Q6M A;  3E1R A;  4P6I C;  1Z5Z A;  1VQL P;  1V4A A;  3RK2 D;  2ZXW C;  3L34 A;  4DXW A;  4DBR A;  2XL8 A;  1M56 D;  4I7Z B;  3EJN A;  1GD2 E;  3GW6 A;  2EPL X;  2KK7 A;  3CXH E;  5L0I A;  3ZWI A;  3RK3 C;  1SS1 A;  3IFM A;  1YZA A;  2C04 A;  3O6Q B;  1L0L J;  1Q2N A;  2W6A A;  4L74 A;  3Q1M A;  3U3B A;  1EZV I;  2R7R A;  2A45 G;  2XNX A;  4JTD B;  2ZT9 D;  4FAP B;  1BGY D;  3RVZ A;  1WOL A;  3SNH A;  1OKK A;  1SYQ A;  1JCC A;  2CK3 H;  2R7X A;  1NKN A;  3M4B A;  5DLJ A;  3WU2 H;  4XTK A;  2M5A B;  2FKW B;  1N7S A;  1ZLL A;  5AVQ B;  1ZXG A;  2AXT H;  1ZRT E;  1X9V A;  4L76 A;  1GW3 A;  4PD4 E;  1JR8 A;  4DT0 A;  3H1K D;  4IFM A;  2P58 A;  1FZF A;  2MWQ A;  3CWB E;  1KYO H;  2ZYD A;  2I15 A;  2FYN C;  5D91 A;  4BEJ A;  2YLI A;  1NFO A;  3CWB J;  3GM1 A;  3HNL A;  1RQV A;  1FDI A;  2Q4F A;  2HKV A;  3ZIB A;  1D0X A;  2V3C C;  1KFN A;  3PJS K;  4UB6 H;  5AVW B;  4PJJ A;  1ZP0 C;  3VRC A;  2E75 C;  4WB4 A;  3IF4 A;  3UIA A;  2YEV A;  3AE1 C;  3H1L E;  1AFO A;  1A0B A;  2JR8 A;  2G3K A;  3AE8 C;  2CYD A;  5AVZ B;  1RE3 A;  3DAG A;  5KYY A;  1Z7Q c;  3U8P A;  3S27 A;  1EXJ A;  2J45 A;  3T6G B;  4CJG A;  1N7S D;  5AC4 A;  4CIH A;  1QZX A;  4HEA J;  2WVO A;  5CIV A;  3CC7 P;  2CNW A;  2OAR A;  2OYI C;  3DXJ F;  3LEV A;  1HE1 A;  2E76 B;  4LLH A;  2BAS A;  5CBO A;  1GDT A;  2H89 C;  3A3Y B;  1AVO B;  4CBE A;  3JYY A;  4OH8 B;  1USE A;  1KQS O;  3NTN A;  1SQX E;  1ORJ A;  3L74 D;  4PD4 H;  3GMA A;  1SQX D;  3VN0 A;  4D4N A;  4C7R A;  1BZ4 A;  4JYC A;  1PPJ D;  3WU2 E;  2HSB A;  4MVS A;  3LW5 H;  2B87 A;  3TNU A;  2OEX A;  4WBA A;  2IFM A;  1X22 A;  2Y0D A;  3WOD F;  4MTO A;  1DIP A;  1OIP A;  3EGX A;  4G7Z F;  2PGD A;  4GOD A;  4NPF X;  1PP9 J;  5A6B D;  1SFC C;  5AVR B;  1BE3 J;  1IFI A;  4Y99 B;  1E84 A;  5GTI E;  1Q0G A;  3T6B A;  1ZHX A;  2WWW A;  3L72 E;  2KSE A;  4OIO F;  3CCU P;  3D71 A;  4YL0 A;  2DI3 A;  2QRX A;  4IL6 X;  1KB9 D;  1NTK G;  3MYI A;  2CPB A;  1URQ B;  3E7K A;  1YJG A;  2KJG A;  1KYO D;  2WSF J;  1BDD A;  5CCG A;  2NUT A;  3L74 J;  2QIW A;  4PJ0 H;  4PFO A;  2OOC A;  4AL0 A;  1MFT A;  2R3S A;  4B86 A;  4CS8 C;  1SQX G;  3RIP A;  1BDJ B;  3EG9 A;  3OWT A;  3CMA P;  4GYT A;  2R7T A;  3A0H E;  3S4R A;  4EIJ A;  1URQ D;  5L0D A;  4H54 A;  3ASO C;  2NG1 A;  5E79 H;  4XPX A;  1GL2 D;  1L0N J;  1T6A A;  4Z9I A;  1FFT C;  3CLQ A;  1ZME C;  3FXE A;  3L37 A;  3GOR A;  1MFZ A;  3M0D A;  5B66 E;  4JYB A;  2MJZ A;  2LXB A;  4H44 B;  4E0I A;  2NPS C;  5APW A;  3L70 E;  2D5R B;  3LES A;  3LLI A;  4PJL A;  3C8Z A;  2Q9A A;  1NHL A;  4X0R A;  1V74 B;  4GIF A;  1BR4 A;  3QMK A;  3LNR A;  1VQ5 P;  4LAC B;  1T01 A;  2V26 A;  5BQG A;  3B0V C;  2WSE J;  1TWC A;  2B89 A;  3AE4 C;  4U5D E;  5TJ5 E;  1IW7 F;  1PD1 A;  2Q1K A;  1ZU4 A;  3DM5 A;  4XLP F;  1JAF A;  3H1J J;  3C9I A;  4AE4 A;  3US6 A;  5A6J A;  3AJM A;  3AQB A;  2ASR A;  4D4X A;  1FZB A;  3DJU B;  2E76 D;  3NMK A;  1G1J A;  1YLM A;  4OIP F;  1QL1 A;  1LWU A;  1J1D C;  4B6I A;  1Q81 Q;  1LTG C;  3PLN A;  1M7L A;  4AYC A;  1YA9 A;  3K1I A;  3UGP A;  1EZV D;  1JUN A;  3B9Q A;  4GKG A;  2EIK C;  2PP4 A;  1HJ0 A;  3JT1 A;  2J59 M;  1LS4 A;  3NDB B;  3F89 A;  1NYH A;  3BAT A;  1MND A;  3EGD B;  3TJ6 A;  1VF5 B;  3AE9 C;  1VF5 C;  1L4A B;  1XZQ A;  3ITF A;  4IAQ A;  1NSG B;  5B5E E;  2KQ9 A;  5KYY B;  1FZC A;  4IFD K;  2AEM A;  1XZP A;  3AG4 C;  1S2E A;  4YJW A;  1RE4 A;  3B5N D;  2P61 A;  3MGN A;  5F28 E;  1TU3 F;  2KLU A;  4IWB A;  3SWK A;  3RBZ A;  2R7U A;  4PJN A;  2Z5H A;  2Q7C A;  4XA4 A;  3NMD A;  3DMD A;  3CCL P;  4I44 A;  3ABK C;  2FYN B;  3FWN A;  2ZD9 A;  3L0I A;  3O10 A;  2B9B A;  1VTM P;  1SF8 A;  3TDK A;  1SQB E;  1TWA A;  2W83 C;  2E75 B;  4RKU J;  1W2E A;  3O6Q A;  3MHV A;  2JWD A;  5KAF E;  4YT4 A;  2HJM A;  1SQQ D;  4IL6 E;  1K9M Q;  4O79 A;  1T3U A;  2QUP A;  3AEF C;  1NTZ J;  1HJB A;  1IFN A;  3L73 G;  1NU7 D;  2XLW A;  1MZ9 A;  3JSV C;  4J7Y A;  1VDF A;  4GT1 A;  3U59 A;  1NAF A;  4U5H A;  1S72 P;  1S7Z A;  1BDC A;  5BQI A;  3QTH A;  1S3J A;  1QVX A;  2HZ8 A;  4GQH A;  1YAU O;  2M0B A;  4G7O F;  2YL7 A;  4HB1 A;  5T1D B;  3II6 A;  3W8I A;  4NTB A;  2ZYA A;  1HUC A;  3SFD C;  3Q6N A;  2HS5 A;  1FBM A;  1SQP E;  3VTP C;  1OMI A;  3P7K A;  2XLO A;  1QVF O;  1YVI A;  4XFJ A;  3KH2 A;  1G4W R;  1M1J A;  2BL2 A;  3O8Z A;  4C3E A;  1SQQ E;  1D7M A;  1OW7 A;  3CEX A;  1RF0 A;  5A6A A;  4ZKP A;  3BRV B;  3WUU A;  4PFP A;  2IBF A;  1HBW A;  1VQO P;  5AVU B;  3CME P;  1U89 A;  3I5P A;  2IBZ D;  3IEE A;  1V54 C;  3TJ5 A;  3CX5 E;  2FBW C;  4I1L A;  1JY2 O;  5KLI C;  5B3I A;  2DYS C;  2PX3 A;  2GAQ A;  3E9V A;  4TT3 H;  4E7Z A;  5DS6 A;  1LTJ B;  5DS4 A;  5E2Q A;  2GWW A;  1KYO I;  3ZVR A;  1NLX A;  1SFC A;  4WGY A;  4CSA A;  2OKU A;  3BRJ A;  2Q7R A;  2JP3 A;  2FYU J;  2B0H A;  3B8E B;  1G1I A;  4JC7 A;  2I8D A;  1PCX A;  1RKE B;  1A7E A;  1NU1 G;  2WT7 B;  4W7Y A;  3TSI A;  2KS1 A;  1BR2 A;  3K1H A;  1QL2 A;  4W7Z A;  2XDJ A;  2QEX P;  2VB6 A;  4BJ6 A;  2N1T A;  4FX5 A;  2QE9 A;  2XLD A;  1L2P A;  3HD7 C;  4ZLC A;  1KFM A;  3CL3 D;  4CPG A;  3CXH I;  1T2K C;  4A2N B;  5KYX A;  1O5H A;  1L3P A;  1JTH B;  1M1J C;  3TGU J;  4KNW A;  2K37 A;  2R7O A;  2YXR B;  3V6I A;  3G4S P;  4U5E E;  1U6H A;  2O1K A;  4KJM A;  3EHN A;  2KYV A;  2R3C A;  1S4X A;  2EIL C;  3LS0 A;  3LUT B;  1E79 H;  2UUH A;  5L0J A;  2K1A A;  1FZG A;  2EPK X;  3KYI A;  3NXS A;  3EHM A;  2FGY A;  3M0D C;  1R5S A;  3TF5 A;  3EG9 B;  2XS1 A;  4BJ5 A;  1IK7 A;  4RDA A;  1OQC A;  1CPQ A;  3QW0 A;  3B5N C;  3KDP B;  3NMJ A;  1MMN A;  4RD9 A;  4HJG H;  2ZAE B;  1K73 Q;  2IZ0 A;  2ZVO B;  3GHG C;  3S90 A;  2OYI A; 
#chains in the Genus database with same CATH homology
 2QJP C;  1K04 A;  2P10 A;  4EBJ A;  2KK1 A;  3H25 A;  3D6Z A;  2FXP A;  4H0L C;  3SFD C;  4YXD C;  1VF5 D;  2E76 B;  3Q2Y A;  1YQ3 C;  2H89 C;  3AE7 C;  1WWP A;  3C8G D;  1OMI A;  3GM2 A;  5L8R J;  1EXI A;  2BEZ F;  3AE6 C;  1V4A A;  2G8Y A;  2Q00 A;  3AJM A;  3JYY A;  3L8J A;  4XFJ A;  3C8V A;  4H44 D;  3SFE C;  2E76 D;  1OW7 A;  2ZT9 C;  3D6Y A;  1PV3 A;  4I7Z B;  3JZ0 A;  3L8I A;  3GMA A;  2IDB A;  3Q5P A;  1U57 A;  3AED C;  5M1B A;  2E74 C;  3RQG A;  3B71 A;  2HSB A;  1DD3 A;  3AEB C;  2D2C C;  3S9O A;  3U0C A;  2MKV A;  1Y9B A;  1HJ0 A;  1KNY A;  2E74 D;  3GLM A;  2WSC J;  1WTY A;  3MFN A;  3FGA D;  3AE2 C;  2E76 C;  1JB0 J;  2FBW C;  3Q1M A;  1KQG B;  5KLI C;  1AJY A;  1DIP A;  1OW8 A;  4R4M A;  4Z1M H;  1NYH A;  3G9R A;  1VL2 A;  4TT3 H;  2JO1 A;  3GF3 A;  2ZT9 D;  1VF5 B;  3AE9 C;  1VF5 C;  3C8G B;  1KMI Z;  4XEF A;  1WOL A;  3BRJ A;  3RL0 g;  4I7Z C;  1K05 A;  2JP3 A;  3LW5 J;  4OGQ C;  1Q90 D;  2QJK C;  2NZ2 A;  3IAO A;  4H0L D;  4KT0 J;  1DD4 A;  3D71 A;  2YWA A;  4EBK A;  4PV1 B;  3AE5 C;  4IL6 X;  1KQF B;  3ABV C;  3AEG C;  3GF7 A;  3RK3 E;  4H13 B;  1NGM B;  5F28 E;  2G3A A;  1ZRT E;  3EWK A;  2WSF J;  1TU3 F;  3R4Y A;  2QIW A;  3AE3 C;  4XEV A;  2O01 J;  4YTP C;  2BEQ D;  3AEA C;  1PL5 A;  2JPU A;  3GM3 A;  4OGQ D;  1ZZP A;  2QSI A;  5KKZ C;  3Q5R A;  3RQE A;  1K40 A;  3RQF A;  1FDO A;  2WQY C;  2FYN C;  3D70 A;  2H88 C;  2QJY C;  2ZT9 B;  4OGQ B;  1S5L X;  4H0L B;  1ZOY C;  1UIX A;  3GM1 A;  3O10 A;  1RQV A;  2OQQ A;  2L6G A;  2D2C D;  1FDI A;  3AEC C;  2E75 D;  3U3F A;  1RQU A;  4PV1 C;  3K7D A;  3TUL A;  2D2C B;  1WMK A;  1GMJ A;  3IN6 A;  4R32 A;  1R8E A;  2E75 B;  4RKU J;  4H13 C;  3O6Q A;  3AEE C;  2V7Q J;  1UFB A;  1ZP0 C;  4PV1 D;  1ZME C;  2YMK A;  4U7J A;  4R4L A;  1O3U A;  2E75 C;  3T97 B;  3C18 A;  4GDO A;  4NQF A;  4H44 C;  2YIU C;  3AE1 C;  2PBE A;  4H44 B;  1KIL E;  1YQ4 C;  2J5U A;  3AEF C;  2LK4 A;  3Q3D A;  3AE8 C;  2K9Y A;  3C8G A;  1IK7 A;  2WPV B;  2JX0 A;  4H13 D;  2L6F A;  1JOG A;  1KOR A;  1OW6 A;  1EXJ A;  2E74 B;  2L6H A;  2WSE J;  1QVX A;  4Y28 J;  1HF9 A;  1MKM A;  3Q5S A;  4XEK A;  1S1C X;  3AE4 C;  1PIX A;  1KTM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...