3B71A

Cd4 endocytosis motif bound to the focal adhesion targeting (fat) domain of the focal adhesion kinase
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
134
structure length
134
Chain Sequence
b'NLDRSNDKVYENVTGLVKAVIEMSSKIQPAPPEEYVPMVKEVGLALRTLLATVDETIPLLPASTHREIEMAQKLLNSDLGELINKMKLAQQYVMTSLQQEYKKQMLTAAHALAVDAKNLLDVIDQARLKMLGQT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Focal adhesion kinase 1
publication title Structural basis for the interaction between focal adhesion kinase and CD4.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 56
structure length 134
sequence length 134
chains with identical sequence B, C
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2007-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03623 Focal_AT Focal adhesion targeting region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.540 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 3b71A01
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 3b71A02
3AE9C 1JOGA 1KTMA 3BRJA 4YTPC 2JPUA 1ZOYC 3SFDC 1WOLA 3RQGA 1WWPA 2PBEA 3AEDC 1K04A 3AECC 3C8GA 3JYYA 2HSBA 2JX0A 3AE8C 3AJMA 3RQFA 3U0CA 1OW6A 2WQYC 4XEKA 1ZP0C 3K7DA 3AE5C 1WTYA 2H88C 2L6HA 3C8GD 3AE4C 1K05A 1QVXA 2LK4A 3AEAC 4EBJA 3ABVC 3AE6C 3SFEC 3B71A 1UFBA 1OW8A 3AE3C 1OW7A 1V4AA 3L8JA 3MFNA 3RQEA 2KK1A 3AE2C 1PV3A 3AEBC 1ZZPA 2L6FA 2FBWC 3TULA 4YXDC 3S9OA 3GM2A 1O3UA 3O10A 4R32A 4XEVA 2YWAA 4NQFA 2H89C 1K40A 3GM3A 3JZ0A 1YQ4C 4EBKA 3L8IA 5F28E 3C18A 2L6GA 3C8GB 3AE7C 3AE1C 4XEFA 2G3AA 3GM1A 1YQ3C 2Q00A 3AEFC 1KNYA 3AEEC 3AEGC 3U3FA
chains in the Genus database with same CATH superfamily
3H6PA 1YAUO 4N6JA 2WPRA 2OG2A 2JR8A 3HTKA 4CS9C 3USSA 1L2PA 3V5YA 2BCCJ 1A02J 3W8HA 1Y6DA 2IBZI 1UG7A 2ZT9D 4CDAA 5JVEA 1ZHXA 2FYUE 2CYDA 1KB9H 1G8XA 5D92A 5KJ7D 1U89A 1NTZD 2XL8A 1NH4A 1YIJP 2HG5D 3EJNA 5B66E 1GU4A 1D1CA 2CNWA 3LW5J 1LWUB 2YLGA 1JY3P 2XNDH 3NYJA 2NZ2A 1YA9A 4H0LC 5L8RJ 4DVYP 4U7JA 3TGUE 3Q7GA 1OKKD 2EPMX 2KS1B 2EIKC 2H7HA 1IFDA 4NPEA 1T8ZA 1OXBA 1JMWA 2YLIA 3GHGC 4YN0B 1X8YA 4MVRA 1ZRTD 1FE6A 3TJ5A 1U6HA 1QEXA 1QLED 2NSFA 1TKNA 3QW1A 5H2FH 1S5LX 1ZHTA 3MFNA 4I1MA 3M79A 4A7PA 5TISH 3F46A 4H44B 5AW4B 4QI2A 2B88A 4GYTA 5DQZA 4IL6E 3A5TA 1PZQA 1JTHB 2KJGA 2XS8A 2BL2A 2WVNA 3W68A 1EQ1A 3V4QA 2HFIA 4CJOA 2YVKA 3SNHA 2HODA 2RKLA 4MVQA 1GM5A 3JZ0A 1RE4C 2YMKA 5L0IA 1BCCE 4IAOA 1F1MA 1A7EA 1AVOB 1FMVA 4OD4A 1PP9J 1MFZA 3UNGC 3H1ID 1PGOA 4EHPA 3M9HA 4PR9A 1YDIA 1S3JA 2A06G 3RYLA 1GGQA 3PJSK 1SQPJ 1URQA 4PD4E 2JKVA 4ZLDA 3AEEC 2ETSA 2M3EA 3FOPA 2WSFH 1T2KD 4YL0A 3U3FA 1BZ4A 1VQOP 3U2MA 5DS4A 4H13C 1IK7A 1FOSE 2Q7RA 4JPZB 1L0ND 2JPUA 5KKZC 5AW0B 2NUTB 1S4XA 1NAFA 3IAOA 4ONSA 2N1TD 1HE9A 1FAVA 2WWWA 4IB4A 1VK5A 2NPSB 3DM9B 1SQQK 5EK0A 1SQBK 1LGHB 1OVUA 1LTJA 3RKOF 1FZCC 1T3JA 2HPCB 3Q5SA 1SQQJ 1ZW0A 4O79A 2P1AA 2VC9A 3N7NA 2H7BA 2M8RA 1WTYA 2Y3DA 3HNLA 4IOIH 3IN6A 4NC3A 2R7UA 1TU3F 1JAFA 2YL0A 1HVVA 2LKMA 2G62A 2Q7CA 3TYYA 1TWGA 1VQ5P 1MNEA 1KILA 3TK1A 1BGYJ 1S5LE 3EPVA 1YJGA 1NU1G 2WSEH 1VMAA 1TFKB 5APVA 2WPSA 4PFOA 1SQVK 4A4AA 1X79B 4QMAA 3ZSUA 4DT0A 4RKUJ 2OU6A 2KK1A 4PJ0E 3Q5PA 3V5ZA 4LERA 1LTGC 3Q3DA 2OQMA 5B3IA 1NTMG 1NKNA 1I4ZA 1SFCD 3KPHA 2E76C 3ZQYA 3NRHA 3WUVA 5APTA 4BXLA 3AGTA 4BPMA 1RQUA 2IYPA 4DCKA 3B8EB 3L8IA 2QNLA 1SQXE 3L70E 2P7JA 2XSEA 3H1JG 3V2PA 3VN0A 2HFED 1PL5A 1T6AA 1ZHZA 3SEOA 2XNXA 1N73C 3RK3D 5EGYA 2MKVA 1E83A 4HB1A 1N86A 3J06A 2HYNA 3L71E 5AW8B 3A2AA 2ZYGA 1LM3B 1LPEA 3EFFK 2KSEA 3L37A 2G8YA 1RF0A 3CCSP 1EZVD 3KDPB 2NSGA 3L73G 2MYSA 1ORJA 2A69F 2J8WA 2E87A 2HV6A 4NTFA 3UR3C 3M0DA 2BC5A 3L75D 2IYOA 1LWUC 2HV7A 1Q86Q 3CXHI 3R2PA 2H7VC 5A6KA 3AJMA 3CWBD 3CCUP 4N6HA 3P8CE 2FFHA 2ASRA 4JEBA 1VYKA 3MYIA 4PACA 4HYTB 2C9NY 5CHXA 4Y28J 3N4XA 3K7DA 4JC7A 1S1CX 2HMZA 5AVYB 1Z7Qc 3RVYA 4GOEA 1MV8A 2CCYA 2B0JA 2DB4A 3EH1A 1NU1D 2W6JH 1OR2A 4WVZA 3EGXB 3U3BA 1X9VA 3SFEC 4MVMA 3JC22 2KSJA 2KQ9A 4HH2A 3CD6P 5T3TA 2GA0A 2J9WA 2KYVA 5B5EH 1LVKA 4H44C 3UGOA 3BRVB 4BEJA 2R7VA 4UB8H 3L8JA 3PTZA 2FAPB 2PX3A 1GQAA 3JRMO 3RQEA 2IFNA 2KUBA 3L72G 3KMIA 3CX5E 1U0BB 2WB7A 3NMJA 2M3BA 1PPJG 5DS6A 4U3FE 5E3AA 1NTZK 3W8IA 1AUEA 2A1DD 3VMAA 2YWAA 3LNRA 2J59M 2O1KA 2WT7B 1S9KE 1Q0MA 1AFOA 2YRFA 4EBKA 1J1EB 2D2CC 4ANJA 5CJ0A 3KZIH 4R4MA 2Q4FA 4BJ1A 1YARO 4E0IA 3W67A 2DGJA 2OYHA 2OARA 3G50A 5AVSB 4OVNF 1BR1A 2K1AA 2LIGA 1ZLLA 1IZMA 3BCCJ 3L74D 1YQ3C 3HNJA 5AC4A 2XU6A 3RL0g 1SZIA 1JNMA 1J1DB 4LC1A 1LNQA 2YEVA 3NMKA 1D0XA 3NG1A 2GAQA 2OJED 1DX7A 1LS4A 4U5FE 1SQBG 3BRJA 2NRGA 2LSEA 2NPSC 2WITA 3EG9B 1IK9A 2O1JA 1U7MA 1GL2B 1R8EA 1NZEA 3AEDC 4ULVA 2RD9A 4I44A 2V4HA 1NFOA 4PD4I 3PRJA 1ZXGA 3OEOA 2I8BA 3MUDA 1WRGA 2GA1A 5E2QA 1OW6A 2WQYC 1L4AB 3HD7D 2V3CC 3S29A 3CC4P 1C03A 2H88C 2WPVB 5GTIH 4P9FA 4ER9A 1FOSF 2DI3A 2FYNB 1SQVG 3V5BA 1QVXA 4DZOA 3GLMA 2YLDA 1K8AQ 4D4NA 3O55A 1Y8AA 2EINC 3A9CA 3TJ6A 2QJPB 3TOLA 3RK2C 1LTBC 3H1IJ 1BE3E 3N0TA 1RMVA 2AXCA 1WGWA 2VCAA 1RKEA 1LKXA 5KYUB 1KYOH 1FZBA 5AGFA 1L0NK 2I1JA 2LFDA 3AEBC 4OGQD 3B0VC 1YA7O 4L76A 3LESA 4N6CA 1KQLA 2CK3H 4YXDC 4D6TD 2G3VA 1AVYA 3F89A 2J0WA 1N7SB 4AE4B 4MTGA 5JSLA 5APYA 3H1KD 3R4YA 4XQ1A 1K40A 4KJMA 3GM3A 4JEAA 4LDRA 3B0UX 2LCHA 5KYWA 1Z6AA 3BVHA 5KLVE 2PP4A 3C8GB 4BJTA 2E74B 3H1HG 2YHSA 1YVIA 1SYQA 2O01H 1QVFO 4U5EE 2XKMA 2XXAB 4RESB 2WZLA 4PV1D 3SYNA 4DRHB 5KYXB 1M2VA 2JWAA 1VQ9P 2E75C 3VP8A 2L91A 5KAIH 3LEVA 1Z23A 3S1KA 2P10A 2W4BA 3P32A 1FDMA 1H6GA 3HUSB 3VF0A 3AE9C 1OFCX 3WUTA 3LJBA 4KI2A 5L0JA 5K5GB 2Y9ZA 2KXPB 3RBXA 1M2OA 3V2QA 4JJGA 2BCCE 4JKVA 1BR2A 3NTNA 4DOJA 3B5NC 4C3DA 1ZU5A 3KYJA 3L0IA 2M5AB 5A6AA 2QUPA 4G7ZF 4O9BA 2O9XA 3DJUB 1KYOD 5KJ7A 2FYUD 1VYIA 1G4US 2WSFJ 2EPOA 4KNWA 1AQTA 1LP1A 1M1JA 1GU5A 5KLIC 5D91A 3PLNA 5BVZA 4H13D 3AE4C 1I5NA 4WGYA 1ORYA 1VOMA 1OKKA 3C8ZA 3B71A 2XZRA 1VQ7P 1Z63A 1H9GA 1GW4A 5COFA 1DOVA 4CX9A 2PF4E 3L4FA 4E0HA 2FY8A 4JF7A 5B5EE 3QVYA 1NTZG 1P84H 4EBBA 1HJBA 4UB8E 4EKWA 3AG2C 5DJTB 3B29A 1D1BA 4P9TA 1JOCA 2EIMC 1YBKA 3L35A 2ZYDA 2R3CA 1Q0FA 1J1EC 5JLIA 2JEEA 3POVA 1RHZB 2IOQA 3Q1MA 2WSEJ 2OJQA 2R02A 5KYYB 1EKYA 2QLAA 3O6XA 3KZIE 3U1AA 3NYMA 4EIJA 3I55P 1J1DC 2A0UA 2JDIH 1BCCD 1YZCA 3U9MA 1NU1K 2PFDA 4H54A 3O39A 4XPXA 3AEFC 4M63A 1SQPE 3V2NA 2H8PD 3H2UA 3IQCA 1A7VA 1NU1J 2CPBA 1LT9C 1JM0A 1EDLA 4E17A 2E76D 1JOGA 1GL2C 2J45A 4WY4B 3ITFA 2CW0F 3MP7B 1FU1A 3D70A 4EIYA 1BSNA 1NTMJ 3CL3D 4YPCA 2X0CA 2R44A 2P7VA 2PBEA 4YWQA 2DYSC 3DM5A 2LFFA 3GF3A 3AECC 1L4AC 1PIXA 2N1TA 4NTBA 1OQCA 3GF7A 4ASVA 2LP4A 3VOPA 3NMIA 1G4WR 1DD4A 1SQQE 2R5BA 2FYNC 3T6BA 5E79H 1JUNA 4RBNA 2WMMA 4W7ZA 4ZLCA 1NO4A 2OTKE 3FWLA 3H1JJ 2OYIB 3TD7A 1CPQA 2W45A 1MMGA 5GTIE 4OINF 3TNUA 1RE3C 2Z5IA 4NPDA 3AE6C 1AA0A 3AQCA 3C62A 1L0NG 3L1MA 1XZPA 1LE4A 1BGYE 1MMDA 4XE5B 3HLZA 1ST6A 3L73J 1GK4A 3KHUA 3CCQP 3WMM0 3QW0A 4IRUA 2ZT9B 3AE2C 1PV3A 2HLOA 2OOCA 3II6A 3GW6A 1N7SC 5AVTB 4XFJA 1IO4A 1CSBA 2HSQA 4BJ6C 3SXMA 2IXMA 1SLQA 3QZCA 1ZMEC 1OIPA 1SFCA 2JD3A 1NAYA 3T6GB 1FDOA 1ZN5A 2ICWG 4DRJB 1C02A 2QM7A 2LD6A 3QH9A 3M91A 3S4RA 4WWIA 2LQGA 2VASA 3Q2YA 3LS1A 1DH3A 3US6A 3BATA 4D4XA 1QPUA 1XTCC 4CJGA 1TWCA 1M57C 3HUSC 1SQXD 3L70D 2NUPB 3HE4A 4I3MA 4Z9JA 4WABA 4AK9A 2R3SA 3SWYA 1PGJA 3L34A 3CAXA 4GQHA 1GK6A 3JT1A 3L71D 2IYLD 2KYHA 3L36A 4YT2A 3L72J 5BQGA 3JYHA 1QKRA 1Y9BA 2D2CD 1RXQA 2QEXP 2K9JB 1X0TA 3MHVA 5APWA 5DVWA 3E1IA 4O7GA 3HE5B 1L7CA 4C7OA 4QDLA 1RF1B 3K33A 4U5GA 5CJ4A 4EUKB 3PCVA 1RKCA 1LI7A 2AP3A 3NDBB 4PK4A 4JCZA 5APUA 2E43A 1FJPA 4LACB 2ZXWC 3VYWA 3S90A 2L6HA 2KZIA 1YJ9P 5HV9A 3P8CD 3VYIA 1HGZA 3RBZA 1JY2O 3WG7C 5APXA 1OCRC 1EZVG 3NKDA 2A45G 2NPSD 1HY5A 3H1LG 2XLHA 4TLFA 5COGA 2FFDB 5AVXB 2LR2A 1UFBA 2MHRA 2Y3HA 3SZRA 2QIWA 4DRIB 3B9QA 3KYIA 1WT6A 2I15A 2EPKX 3Q6MA 3L75G 2R7QA 4XPYA 3LEOA 3IQ6A 1SQBJ 3DMDA 3K1IC 2A68F 5CI9A 3VRCA 1OWAA 1GDTA 1PD0A 3EFOA 2ZFCA 3K6BA 3OA7A 1Q0DA 3K1HA 2QJYB 3CWBG 5JS5A 2A45H 1P84E 1CI6A 2D4UA 2R7RA 1DD3A 3C9IA 3ABKC 3DXJF 3NKEA 3C1LA 1GD2E 3HTKB 3DJNB 2W83C 3IPMO 3CX5D 5E33A 3FGAD 1IFPA 1YQ4C 2R25A 4U3FD 1PFIA 1GZLA 2FYUK 3CZ6A 4O6NA 1YITP 3RK2D 3WU2H 1VF5B 3S84A 1LJ2A 1LTTC 4YK5A 5AC5A 1SS1A 1SQVJ 1S9KD 3IF4A 3AE1C 2XDJA 2HS5A 3JCUH 3GM1A 3BCCE 1ZHYA 3I5PA 2KNCA 1L0LG 4FWVA 4CS8A 2J0XA 1LE2A 1YLMA 3P7KA 1Q2NA 1KNYA 2L9JA 4IWBA 2K9YA 2VB6A 1JRAA 1ZU4A 3LIDA 2XM4A 4MVSA 1FBMA 1RH5B 3H32A 4Q5SF 5KAFE 5CCHC 4N78E 1JR8A 1OMIA 2I8DA 4HFFB 1DEBA 3ATPA 2PNOA 4KHXA 2YKZA 4JBZA 1WWPA 3ZDMA 5BUOA 1NTKG 2O01J 4JTAB 4MNDA 5BU5A 2HZ8A 2JO1A 4LDQA 2IBZD 3EHMA 2OYIC 2W9YA 1NOHA 1KV4A 3A0HE 4CSAC 3L74G 2K37A 3N2ZB 1LTSC 2E75D 5APQA 4NY3A 3H1LD 1LT1A 1HW1A 3HE4B 3CMEP 4GT1A 2YL3A 3DWWA 4YJWA 3HD7A 3SXZA 3H1HJ 1JMMA 3D6ZA 2GDCA 3RK3B 4BJ5A 1L3PA 4DOZA 1H88A 3KPEA 4HEAJ 2HODB 4CS9A 3B5ND 2XLDA 1KB9E 2XLEA 4I1LA 1FZGA 3H1IE 1FS0E 2ZT9C 1KQSO 3ABLC 4HE8D 5APSA 1MMNA 4L74A 1EQ7A 4GKGA 1E2XA 3AOUA 2C0WA 4GEHA 1BE3D 1EDIA 1E84A 5HSWA 2YXRB 4KT0J 4IFFA 1URQB 2JJLA 4DXWA 1EXJA 2R9RB 3LAYA 2QJKB 3S27A 1JY3O 1RQVA 1L0NE 1YJWP 4R32A 1RJ9A 1V55C 4LGDE 1FDIA 1OCCC 4O6MA 2L7AA 1L0LD 1AV1A 2J46A 3WUUA 2WL8A 4ZMDA 5H2FE 3GHGA 4XEFA 1LTJB 3GG2A 3JTLO 3M15A 2OTLP 5TISE 4EYYQ 2Q00A 4W8PA 4CDYA 3VP9A 2V26A 4OIRF 3ZQVA 5L0FA 2A6HF 1QZXA 4NCQA 2BEZF 4Z1MH 4BG0A 3DZAA 5CCGC 4B86A 3SWFA 2R7OA 1VQNP 3EGDA 1NTKD 1NTZJ 4D6TG 5DS5A 4C3EA 3ZTMA 1KILB 3RFYA 3TOMA 3RQGA 3H1KG 3PHLA 1RF1C 1YYXA 1J8YF 3QVZA 4AX2A 3EQLF 3O6QA 1T6QA 3JYYA 1RE4A 2JX0A 3AE8C 1BDDA 2IXOA 1S05A 2C9LY 1MNDA 5GPGB 1M56C 2RH0A 4Q7CA 1CGNA 1D1AA 2YNYA 3G4ZA 1ORSC 1LTAC 2KNCB 1YYCA 2R7XA 1ZW3A 1H9TA 2FFDC 2H8AA 1T2KC 2LK4A 2IXPA 1E85A 4Z9HA 2ZD9A 2A06E 3VTPC 3S28A 3PMRA 4OWFA 2EPLX 1H0TA 4GODA 2A0BA 2QJYC 3JSEO 3T97A 1L4AD 3CI9A 1VLSA 1Z3IX 1SMYF 3GEIA 1OCZC 3S0XA 2YMYA 1PGPA 1BSHA 4UDVA 3HTKC 3KQGA 3NMDA 2NG1A 2PGDA 4EOTA 2Q5UA 4R4LA 2FYUG 1FZCA 3E7KA 3TULA 3FDQA 1MKMA 1O3UA 2IBFA 3O10A 1VF5C 1QX8A 3OA1A 1APCA 2HKVA 4JRZA 2P0NA 1IZNB 3TGUG 3H25A 2W8ZA 4OD5A 1P84I 1USDA 1USEA 1KFNA 4K7BA 4H0LD 1LS1A 3LLKA 4U5DE 1L0NJ 1BBHA 2WVOA 5AW5B 4FESA 1PP9D 2M4EA 3I4UA 3PDMP 2J5UA 1NU1E 3I5CA 3RH3A 3SXKA 3B4SA 2XLOA 2YQYA 4YTPC 1JPJA 5EHHA 2YKOA 1Y47A 4E18A 4P6IC 4M3LA 2YO2A 5AW9B 1SQPD 5AVQB 1NU7D 4OGQB 1TWHA 4BRYA 1WOLA 2J7PD 3GANA 1CGME 1RJ9B 1NTME 1QL2A 4H4KC 1G1JA 2GUVA 3ABMC 2Q9IA 1UIIA 2YZSA 1QL1A 3X1OA 3U5SA 1KILE 3A7OA 1M57D 1TR2A 3K5BA 5JT4A 4XEKA 1ZP0C 4J30B 2QA4P 1BCCG 2FKWB 4HKZH 1N73A 1D0YA 2XRHA 1QGKB 3CXHD 3OAKA 1X22A 4WB4A 3H1JE 4IL6H 1VLTA 2XS1A 1SQQD 3W4YA 3A0BH 1HBWA 3Q5RA 3F47A 4PV1B 1AEPA 2P6VA 3G71P 1J2JB 4CIPA 2FYZA 3EGDB 4J7TA 4NPFX 1OW8A 2IDBA 4ZKPA 1YJNP 2H7OA 4U5HA 1OW7A 3PH0A 1LTIC 3LUTB 2OYHB 5CMZA 1URQC 1ZR2A 3RVZA 3CC2P 3L73E 2A6EF 2WSCH 5AVWB 5GTHH 1LWUA 1R5ID 1BGYD 2Q9AA 1VQKP 3GEHA 2KW3C 3GWLA 1VQPP 1U57A 3RL0B 2EIJC 4RO0A 4EWCA 4WJ0A 1E5WA 3S9OA 2KS1A 1OVRA 3TGUD 1KB9I 1D0ZA 3TK0A 4EDFA 2H89C 1EC5A 3M9QA 3IQTA 3Q7LA 1V54C 1S2EA 3G9RA 3UIAA 4Y99B 1HUCA 1LTJC 3N24A 2PRRA 5B1AC 2POHA 2YO3A 5M1BA 1T9KA 4CDVA 3QMKA 1Q0KA 4H13B 3E9VA 2QVAA 3PP5A 5E3CA 2IM8A 2IXNA 2B0HA 2Y39A 3H1LJ 5AW2B 4I2LC 3FAPB 3TF5A 2JP3A 1CGOA 4DVZA 3MX3A 1T01A 1IJDB 2HJ3A 3C8VA 1KILC 1JTHA 1NGMB 3L75J 1KN7A 2HJMA 4PFPA 1J8MF 1DOWA 2YL7A 4TT3H 5TJ5E 2QE9A 3CWBJ 3L72E 1WMKA 1IFIA 3IFMA 3OW2O 5T3WA 3CMAP 1PPJE 4OIQF 4GDOA 5A69A 4E7ZA 4JQ0D 1RKEB 1FMWA 5BU8B 2K3RA 4C7RA 1EA8A 4PJ0H 1HMDA 4A2NB 1SQXG 3L70G 2GUSA 3VMYA 3CCMP 3JSZA 1KU2A 2KC3A 4U5BE 4PD4D 2QSIA 1L0LK 2FXPA 3RW0A 2M0BA 1TFOB 1Q0GA 1JY2N 5CCHD 1KC8Q 4MS2A 2NUTA 3AEAC 1GMJA 1ZYRF 1L0LJ 5A6BD 3L71G 5FZTA 4MTFA 4LLHA 4NTAA 3EQ2A 3HJCA 2YXQB 3RGUA 1A7DA 4C46A 5KYWB 2NPSA 3RIPA 3IEEA 2IZ0A 3FXHA 5K0IA 2IPPA 1N8RQ 4MVOA 4KNVA 2KLVA 4JYCA 1SQBE 2HPCA 1ZR4A 1ZVZA 2AVKA 1RF0C 1NTKK 1S7ZA 4O6YA 1W2EA 1M2VB 5AVRB 2L5GB 1ZZPA 3VAYA 1VQ8P 2QJPC 3KYQA 2P61A 2C04A 3CLQA 3KL4A 1NTKJ 3NYLA 3GM2A 3M0DC 2KIKA 4K1OA 2WSSH 2AWCA 1ZW2A 4NQFA 2O01N 3GODA 1NYHA 3L74J 4WBAA 5F28E 1W2BO 3SWKA 1SVFA 3ZG1A 5FCLA 3SXYA 2EPNA 3MLGA 4K0DA 2L6GA 1H8AA 2OEXA 1D7MA 4XA4A 1KYOE 1HF9A 4K35A 2VRSA 1SQVE 2G3AA 1EZVI 3U1CA 2A45I 2B87A 4MQ9F 1HW2A 3Q6NA 2WZFA 3IR9A 1KD1Q 3IQ5A 3QWOC 3NXSA 2TMVP 1LP1B 1M1JB 2OEVA 3FHDA 4OGQC 2QY9A 2E74C 3BCCD 2OKUA 1OZHA 3BASA 2ZXXA 1FFTC 1NG1A 4XWJA 4H44D 3GMAA 4MVUA 1B68A 2FGYA 4IAQA 3EFGA 4N78D 4U3FG 1HWTC 2QG4A 1Q82Q 1RCPA 1XTGB 1TWAA 1YI2P 3H2VA 2PFXA 1QVGO 4JTDB 4UB6H 1VQLP 1OR3A 4KC9A 3KH2A 3RQFA 2SPZA 4DJ9A 2AXTH 5KAIE 3ITKA 3QTHA 3UGPA 3CX5H 3MTUE 4PV1C 2R7WA 2V7QH 2XLWA 1I4YA 3WAQA 3H1HE 5CCGD 3ASOC 3ZC4A 4MN4C 3ABVC 1OXZA 2OYHC 2VCCA 3A0BE 2OTJP 1T6UA 5CI8A 3D71A 2XLVA 3EZIA 1R5SA 4IFDK 3AGUA 2B89A 4GIFA 3VMZA 4EI2A 3G4SP 2KNHA 3B5NA 2F22A 1LI5A 3RL0C 1T5OA 4JW1A 4D6TJ 3FMSA 2PAJA 1GTWA 1KB9D 2IBZG 1R4TA 3T4RA 2L81A 1SQPK 2D2CB 3H1KJ 2L6FA 5GTHE 1A02F 3DI5A 1M56D 3D6YA 1N7LA 1DIPA 3RF3A 2R5DA 2ZPAA 1NHLA 4Y99C 1JY3N 2R7SA 3EGXA 2YKPA 2O3JA 1JPNA 4YT8A 4JYBA 5AVVB 1ZV8A 2Y3GA 3AG4C 3V2RA 2YIUB 3ASNC 3MUDC 2J9UA 3CCJP 3AE7C 2N1TB 3DE9A 3JRTA 1YTZI 4MW3A 2Z5HA 3CCRP 2Q3TA 3G4XA 2KOGA 2RMZA 1VQMP 3TQOA 5TJHA 3OWTA 2WTYA 4K3AA 1BE3G 2KI7B 3HNKA 1N1CA 3DD7A 2WZGA 1XWJA 1VDFA 3BEHA 3HKKA 2OGUA 1FJKA 3CCVP 5L3VA 3T6JA 3TNUB 2CPSA 1NTZE 1N2DC 2KLUA 2WT7A 1VF5D 4DJGA 2Y0CA 1S72P 1IFJA 2DYRC 2H43A 4Q4ZF 4AL0A 4AL1A 2FYUJ 2CNWD 1JO5A 1Y4CA 1K04A 1VB5A 3UMKA 3HRNA 2G3KA 1AJYA 4YT5A 2R03A 2Z15A 1BDJB 1PD1A 4WY4C 3ZTZA 5IY5C 1HTLC 5CBOA 3HNIA 3RK2B 3TGUJ 2HMQA 2B87B 5KLVG 1VPCA 1NSGB 4JCHA 3W2WA 3V5XA 1GS9A 3FOOA 1ZRTE 1SFCB 5L0GA 3EG9A 1LT9A 2Q9CA 1GL2A 4C7NA 2P1JA 4XLPF 3K66A 5KTBA 3G6EP 5JP7A 2AEJA 1NLXA 1V4AA 3WODF 2A06D 2AU5A 4JZAA 3UMIA 3V4WA 1Z56A 2BCCG 2KGOA 1E86A 1FTSA 1IFMA 1L4AA 2BEQD 5E79E 3AG3C 2VCBA 3KXDA 2JWDA 2R7TA 5AW1B 1NFNA 3E1RA 3LLIA 1MZ9A 1V74B 1EDJA 1CPRA 4G0HA 1EDKA 1VL2A 2XL4A 3T9OA 5F5FA 2LXBA 2NPUA 4JE9A 2HR3A 3CSKA 4DBRA 2UUHA 4XEVA 4WGZA 2CGEA 2R32A 2W6AA 1G2CA 2WVQA 1BCCJ 1Q81Q 2E75B 2N9BA 1PGQA 3C18A 1RE3A 5KJ7C 2AWYA 2M64A 4C7OB 2RSEB 2WSCJ 2R05A 4KBLA 1URQD 5KYUA 1M1JC 4CIHA 2ZJSE 3LW5H 3B5NB 2I1KA 1FC2C 3GEEA 5L3QA 1GW3A 2N9YB 1KZUB 1JMBA 2C03A 2GM4A 4J7YA 1N7SA 4AE4A 2Y69C 1G5ZA 1CZQA 2QRXA 1NU9C 1ZOYC 3SFDC 1FZAA 4BJ6A 4E7SA 3SSUA 4RD9A 2Q3EA 1A41A 2PP6A 1KYOI 3I56P 5KLIB 3C8GA 5JUAA 4JIOA 2J7PA 1T3UA 1QLEC 1MUUA 5KLVD 1Z5ZA 3EFOB 4DBQA 3CC7P 4N06A 2XXAA 2VH3A 1NTMD 3U59A 2P2UA 2W4MA 2XLMA 5T1DB 5KYXA 4UB6E 5EFWB 1OVVA 4X0RA 1CI6B 1JCCA 2Q6QA 4I1OB 2OYOA 1XZQA 3DAGA 2AXTE 1T6IA 1FZEA 3HUSA 1PP9G 1KILD 4LLCA 2Q1KA 3FXEA 1R5LA 2D5RB 2E5TA 3AQBA 2ZXRA 3P8MC 4F4BA 4L6RA 4PJJA 3H1JD 2BCCD 1SQPG 4U5CE 4I6MC 2Y9YA 3M0AA 3JCUQ 1YTZT 1CW5A 3AE3C 2X51A 5DQTA 4I7ZB 5BQHA 2IX7C 2M5AA 4PJLA 3TSIA 4GOFA 1KQGB 4IGGA 3U9JA 1U7JA 4ULWA 2CDQA 3A3YB 1GL2D 2K88A 5B1BC 3MBGA 2FBWC 3ZWIA 3L73D 2AEMA 2YIUC 3H32B 4PJMA 4W80A 4AUWA 4W8KA 1SQXK 3MZWB 1TQGA 1SQQG 2AEFA 2N1TC 5C39A 4OIOF 3RK3E 4N3YB 3ECSA 1KMIZ 1SQXJ 2WZ7A 3L70J 5AVZB 3EHNA 1LT9B 2QTVA 2IBZE 4HFKB 3ZDLA 4C7NB 4XLNF 2FXMA 1ZHWA 4W7YA 3W2VA 3CXHH 3OJAB 2Q3IA 1EZVE 3EWKA 1DEEG 3L71J 1BR4A 3H1LE 5CIVA 3K1IA 3C7JA 1BGYG 1VQ4P 3GORA 3HD7B 2HUJA 1KTMA 4G7HF 1WASA 3L75E 2IFMA 1M90Q 4LDKA 3DE8A 1SP4A 3CQZA 3EH2A 3M4BA 2W6BA 1BDCA 1OCOC 4LLEA 3CWBE 3U2LA 2W90A 3WU2E 1NKZB 5KYYA 3M9BA 1YZAA 5AW7B 5B66H 3WHNA 1G1IA 1G2CB 2B9BA 3JCUE 2HSBA 1IW7F 1N7SD 3L72D 1YYJA 4IFMA 1PPJD 1KORA 2BASA 1M6TA 1SFCC 1FZFA 4U9DA 2Y3BA 1Q7YQ 3U8PA 1SR2A 1FNTc 3C8GD 2E74D 3AG1C 5B3SC 1MQVA 1K05A 4H0LB 2ITAA 1OXKA 4WY4A 5L0DA 2PX0A 3LS0A 5KYNA 1K9MQ 1L0LE 2QM8A 3CPWO 3JSVC 4HJGH 5CCHA 4MVZA 3ZVRA 2DW3A 2XM0A 2ZVOB 5A6BA 3FWNA 4JURI 1FFHA 3RK3C 3F5HA 1HMOA 3O8ZA 5AVUB 2QE7H 3GHGB 4AQRD 2KSFA 3FX0A 1HGVA 2P67A 3E70C 1NWQA 2GFHA 2FXOA 2E42A 1MMAA 3U8VA 3B0PA 2V7QJ 1YHQP 1O87A 1JCDA 1QSPA 3IHUA 5JRAA 1IC2A 2KZJA 2OYIA 1SQBD 2ZVNB 4U3FJ 4MW8A 1NTKE 4YL3A 4CSAA 2YL1A 4RDAA 3GWNA 3UMHA 1EXIA 1NJIQ 1AQ5A 2RN0A 4C3BA 5COMA 3L74E 2ZXPA 1H7IA 2ZAEB 2XV5A 1PCXA 2QJKC 4ZKUA 3O6QB 2OQQA 1KQFB 4N4WA 4PJNA 4FAPB 3DAFA 3RL0D 1WATA 4PD4H 1KFMA 4YL1A 4G7OF 4B6IA 1JY2P 5L0HA 3X2QC 1HJ0A 3AEGC 2WVRA 1SQVD 2IZ1A 4FX5A 3LNMB 4CBEA 3G3ZA 3M4CA 4G78A 2GWWA 5DLJA 3MYFA 2Q9BA 2MWQA 3R7CA 1H0TB 1FAPB 5KKZB 3ZIBA 2E5YA 1HE1A 3CEXA 3FAJA 3T97B 3M1CB 2EILC 1IFNA 2MJZA 4OH8B 2J58A 3BRTB 3LIEA 5AW6B 3V6IA 4ZNCA 3U0CA 2UUIA 4OIPF 2NUPA 1M8OB 4XPWA 2KB7P 3CCEP 3H65A 2P58A 2J9VA 3AE5C 5DJUB 1FZCB 1M1KQ 3MIWA 1RY3A 1HH0A 1WN0A 1A0BA 3CCLP 4Z9IA 2Z4EA 4ASWA 3NFQA 256BA 1FR0A 1SF8A 1MFTA 3BCCG 3PHF2 4L75A 4EBJA 4I7ZC 1AVOA 1S5LH 3FVYA 2WPQA 5CCGA 4L73A 3TDKA 1BE3J 2W27A 2K9JA 2Y0DA 3MGNA 3A11A 3C63A 3H1HD 1W5CE 5AW3B 3HE5A 3EZHA 5F5HA 4CS8C 1VQ6P 4JTCB 5BQIA 1RF1A 4U9EA 1OX3A 4D6TE 4WY4D 1PP9E 3CX5I 4JJFA 3VMXA 3H1KE 1C17M 2LXCB 1EI7A 2KP8A 4YT4A 1H89A 1LIHA 4CPGA 2Y0EA 5KAFH 4CS7A 1NVOA 5KLVK 3V7OA 4XTKA 3M06A 4IL6X 2C0XA 2E76B 3MD0A 1O5HA 5L0CA 4BRYB 3SP1A 1UIXA 1NTMK 4BWNA 1W2WA 2FFDA 3FXDA 5A6JA 1QQ3A 3I5QA 4IJJA 5KLVJ 2XL6A 2J9BA 1E79H 2ZXOA 3KKBA 2ZYAA 2KK7A 2BE5F 1JEKA 2YKQA 4BEMJ 1VTMP 4RJTA 2OCCC 2ZXEB 1K73Q 4IARA 3DKAA 4YXWH 3HD7C 4J32B 3A0HH 4BJ5C 3CXHE 1N73B 4AYCA 1M7LA 2UWJE 3H1IG 1NBBA 4QI0A 1P84D 1JB0J 1Q90D 4MTOA 4JVSA 3VM6A 5CBNA
chains in the Genus database with same CATH topology
2BEZF 4Z1MH 3AE9C 1NGMB 2E74C 2E76D 1JOGA 1KTMA 4H13C 3BRJA 1IK7A 4YTPC 2JPUA 1ZOYC 3SFDC 5KKZC 4TT3H 1OMIA 3IAOA 1VF5D 4OGQB 2ZT9D 1WOLA 3RQGA 4H44D 3D70A 1WMKA 3GMAA 1R8EA 1Y9BA 2D2CD 1WWPA 2PBEA 3AEDC 3GF3A 1K04A 3AECC 3C8GA 1PIXA 3O6QA 2O01J 3T97B 4GDOA 1AJYA 3JYYA 2JO1A 2HSBA 3GF7A 2JX0A 3AE8C 3AJMA 2J5UA 3LW5J 3Q5SA 3RQFA 3U0CA 1KILE 1OW6A 2WQYC 1DD4A 4XEKA 1ZP0C 2FYNC 1KORA 2WSFJ 2NZ2A 4H0LC 4Y28J 2E75D 3K7DA 3AE5C 5L8RJ 4PV1C 4U7JA 1S1CX 2H88C 2WPVB 3IN6A 1WTYA 5KLIC 2L6HA 2QSIA 1TU3F 2FXPA 3D6ZA 3C8GD 2E74D 4H13D 3AE4C 1K05A 4H0LB 1QVXA 1ZRTE 2LK4A 3Q5RA 3GLMA 3AEAC 4PV1B 4EBJA 1GMJA 3ABVC 3AE6C 4I7ZC 3SFEC 4EBKA 3D71A 3B71A 1UFBA 1OW8A 2IDBA 2QIWA 3AE3C 1OW7A 2ZT9C 2QJYC 4H44C 4I7ZB 1V4AA 3L8JA 4RKUJ 1S5LX 3MFNA 3RQEA 2KK1A 2ZT9B 3AE2C 1PV3A 2BEQD 3Q5PA 4H44B 1KQGB 3AEBC 4KT0J 4OGQD 1ZZPA 2D2CB 3Q3DA 2L6FA 1U57A 2V7QJ 2QJPC 4R4LA 4XFJA 1EXJA 3D6YA 2FBWC 1DD3A 3TULA 1DIPA 2E76C 4YXDC 1RQVA 3S9OA 2YIUC 3GM2A 1VL2A 1MKMA 1ZMEC 1O3UA 1EXIA 3O10A 4R32A 4XEVA 2YWAA 1VF5C 2H89C 3R4YA 1RQUA 3FGAD 4IL6X 3Q1MA 4NQFA 1K40A 1FDOA 2E76B 3RK3E 1FDIA 1NYHA 3G9RA 1YQ4C 3GM3A 2E75B 1UIXA 2D2CC 1KMIZ 2YMKA 2WSEJ 3JZ0A 3L8IA 5F28E 5M1BA 4R4MA 3C18A 2L6GA 1PL5A 2QJKC 1VF5B 3H25A 3C8GB 2E74B 2OQQA 3AE7C 1KQFB 4H13B 2WSCJ 3Q2YA 1HF9A 3AE1C 4XEFA 2G3AA 2MKVA 3GM1A 4H0LD 1YQ3C 2Q00A 3EWKA 4PV1D 2JP3A 3RL0g 2E75C 3AEFC 1KNYA 3U3FA 2K9YA 3AEEC 1HJ0A 2P10A 3AEGC 1JB0J 1Q90D 3C8VA 4OGQC 2G8YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AE9 C;  1JOG A;  1KTM A;  3BRJ A;  4YTP C;  2JPU A;  1ZOY C;  3SFD C;  1WOL A;  3RQG A;  1WWP A;  2PBE A;  3AED C;  1K04 A;  3AEC C;  3C8G A;  3JYY A;  2HSB A;  2JX0 A;  3AE8 C;  3AJM A;  3RQF A;  3U0C A;  1OW6 A;  2WQY C;  4XEK A;  1ZP0 C;  3K7D A;  3AE5 C;  1WTY A;  2H88 C;  2L6H A;  3C8G D;  3AE4 C;  1K05 A;  1QVX A;  2LK4 A;  3AEA C;  4EBJ A;  3ABV C;  3AE6 C;  3SFE C;  3B71 A;  1UFB A;  1OW8 A;  3AE3 C;  1OW7 A;  1V4A A;  3L8J A;  3MFN A;  3RQE A;  2KK1 A;  3AE2 C;  1PV3 A;  3AEB C;  1ZZP A;  2L6F A;  2FBW C;  3TUL A;  4YXD C;  3S9O A;  3GM2 A;  1O3U A;  3O10 A;  4R32 A;  4XEV A;  2YWA A;  4NQF A;  2H89 C;  1K40 A;  3GM3 A;  3JZ0 A;  1YQ4 C;  4EBK A;  3L8I A;  5F28 E;  3C18 A;  2L6G A;  3C8G B;  3AE7 C;  3AE1 C;  4XEF A;  2G3A A;  3GM1 A;  1YQ3 C;  2Q00 A;  3AEF C;  1KNY A;  3AEE C;  3AEG C;  3U3F A; 
#chains in the Genus database with same CATH topology
 3H6P A;  1YAU O;  4N6J A;  2WPR A;  2OG2 A;  2JR8 A;  3HTK A;  4CS9 C;  3USS A;  1L2P A;  3V5Y A;  2BCC J;  1A02 J;  3W8H A;  1Y6D A;  2IBZ I;  1UG7 A;  2ZT9 D;  4CDA A;  5JVE A;  1ZHX A;  2FYU E;  2CYD A;  1KB9 H;  1G8X A;  5D92 A;  5KJ7 D;  1U89 A;  1NTZ D;  2XL8 A;  1NH4 A;  1YIJ P;  2HG5 D;  3EJN A;  5B66 E;  1GU4 A;  1D1C A;  2CNW A;  3LW5 J;  1LWU B;  2YLG A;  1JY3 P;  2XND H;  3NYJ A;  2NZ2 A;  1YA9 A;  4H0L C;  5L8R J;  4DVY P;  4U7J A;  3TGU E;  3Q7G A;  1OKK D;  2EPM X;  2KS1 B;  2EIK C;  2H7H A;  1IFD A;  4NPE A;  1T8Z A;  1OXB A;  1JMW A;  2YLI A;  3GHG C;  4YN0 B;  1X8Y A;  4MVR A;  1ZRT D;  1FE6 A;  3TJ5 A;  1U6H A;  1QEX A;  1QLE D;  2NSF A;  1TKN A;  3QW1 A;  5H2F H;  1S5L X;  1ZHT A;  3MFN A;  4I1M A;  3M79 A;  4A7P A;  5TIS H;  3F46 A;  4H44 B;  5AW4 B;  4QI2 A;  2B88 A;  4GYT A;  5DQZ A;  4IL6 E;  3A5T A;  1PZQ A;  1JTH B;  2KJG A;  2XS8 A;  2BL2 A;  2WVN A;  3W68 A;  1EQ1 A;  3V4Q A;  2HFI A;  4CJO A;  2YVK A;  3SNH A;  2HOD A;  2RKL A;  4MVQ A;  1GM5 A;  3JZ0 A;  1RE4 C;  2YMK A;  5L0I A;  1BCC E;  4IAO A;  1F1M A;  1A7E A;  1AVO B;  1FMV A;  4OD4 A;  1PP9 J;  1MFZ A;  3UNG C;  3H1I D;  1PGO A;  4EHP A;  3M9H A;  4PR9 A;  1YDI A;  1S3J A;  2A06 G;  3RYL A;  1GGQ A;  3PJS K;  1SQP J;  1URQ A;  4PD4 E;  2JKV A;  4ZLD A;  3AEE C;  2ETS A;  2M3E A;  3FOP A;  2WSF H;  1T2K D;  4YL0 A;  3U3F A;  1BZ4 A;  1VQO P;  3U2M A;  5DS4 A;  4H13 C;  1IK7 A;  1FOS E;  2Q7R A;  4JPZ B;  1L0N D;  2JPU A;  5KKZ C;  5AW0 B;  2NUT B;  1S4X A;  1NAF A;  3IAO A;  4ONS A;  2N1T D;  1HE9 A;  1FAV A;  2WWW A;  4IB4 A;  1VK5 A;  2NPS B;  3DM9 B;  1SQQ K;  5EK0 A;  1SQB K;  1LGH B;  1OVU A;  1LTJ A;  3RKO F;  1FZC C;  1T3J A;  2HPC B;  3Q5S A;  1SQQ J;  1ZW0 A;  4O79 A;  2P1A A;  2VC9 A;  3N7N A;  2H7B A;  2M8R A;  1WTY A;  2Y3D A;  3HNL A;  4IOI H;  3IN6 A;  4NC3 A;  2R7U A;  1TU3 F;  1JAF A;  2YL0 A;  1HVV A;  2LKM A;  2G62 A;  2Q7C A;  3TYY A;  1TWG A;  1VQ5 P;  1MNE A;  1KIL A;  3TK1 A;  1BGY J;  1S5L E;  3EPV A;  1YJG A;  1NU1 G;  2WSE H;  1VMA A;  1TFK B;  5APV A;  2WPS A;  4PFO A;  1SQV K;  4A4A A;  1X79 B;  4QMA A;  3ZSU A;  4DT0 A;  4RKU J;  2OU6 A;  2KK1 A;  4PJ0 E;  3Q5P A;  3V5Z A;  4LER A;  1LTG C;  3Q3D A;  2OQM A;  5B3I A;  1NTM G;  1NKN A;  1I4Z A;  1SFC D;  3KPH A;  2E76 C;  3ZQY A;  3NRH A;  3WUV A;  5APT A;  4BXL A;  3AGT A;  4BPM A;  1RQU A;  2IYP A;  4DCK A;  3B8E B;  3L8I A;  2QNL A;  1SQX E;  3L70 E;  2P7J A;  2XSE A;  3H1J G;  3V2P A;  3VN0 A;  2HFE D;  1PL5 A;  1T6A A;  1ZHZ A;  3SEO A;  2XNX A;  1N73 C;  3RK3 D;  5EGY A;  2MKV A;  1E83 A;  4HB1 A;  1N86 A;  3J06 A;  2HYN A;  3L71 E;  5AW8 B;  3A2A A;  2ZYG A;  1LM3 B;  1LPE A;  3EFF K;  2KSE A;  3L37 A;  2G8Y A;  1RF0 A;  3CCS P;  1EZV D;  3KDP B;  2NSG A;  3L73 G;  2MYS A;  1ORJ A;  2A69 F;  2J8W A;  2E87 A;  2HV6 A;  4NTF A;  3UR3 C;  3M0D A;  2BC5 A;  3L75 D;  2IYO A;  1LWU C;  2HV7 A;  1Q86 Q;  3CXH I;  3R2P A;  2H7V C;  5A6K A;  3AJM A;  3CWB D;  3CCU P;  4N6H A;  3P8C E;  2FFH A;  2ASR A;  4JEB A;  1VYK A;  3MYI A;  4PAC A;  4HYT B;  2C9N Y;  5CHX A;  4Y28 J;  3N4X A;  3K7D A;  4JC7 A;  1S1C X;  2HMZ A;  5AVY B;  1Z7Q c;  3RVY A;  4GOE A;  1MV8 A;  2CCY A;  2B0J A;  2DB4 A;  3EH1 A;  1NU1 D;  2W6J H;  1OR2 A;  4WVZ A;  3EGX B;  3U3B A;  1X9V A;  3SFE C;  4MVM A;  3JC2 2;  2KSJ A;  2KQ9 A;  4HH2 A;  3CD6 P;  5T3T A;  2GA0 A;  2J9W A;  2KYV A;  5B5E H;  1LVK A;  4H44 C;  3UGO A;  3BRV B;  4BEJ A;  2R7V A;  4UB8 H;  3L8J A;  3PTZ A;  2FAP B;  2PX3 A;  1GQA A;  3JRM O;  3RQE A;  2IFN A;  2KUB A;  3L72 G;  3KMI A;  3CX5 E;  1U0B B;  2WB7 A;  3NMJ A;  2M3B A;  1PPJ G;  5DS6 A;  4U3F E;  5E3A A;  1NTZ K;  3W8I A;  1AUE A;  2A1D D;  3VMA A;  2YWA A;  3LNR A;  2J59 M;  2O1K A;  2WT7 B;  1S9K E;  1Q0M A;  1AFO A;  2YRF A;  4EBK A;  1J1E B;  2D2C C;  4ANJ A;  5CJ0 A;  3KZI H;  4R4M A;  2Q4F A;  4BJ1 A;  1YAR O;  4E0I A;  3W67 A;  2DGJ A;  2OYH A;  2OAR A;  3G50 A;  5AVS B;  4OVN F;  1BR1 A;  2K1A A;  2LIG A;  1ZLL A;  1IZM A;  3BCC J;  3L74 D;  1YQ3 C;  3HNJ A;  5AC4 A;  2XU6 A;  3RL0 g;  1SZI A;  1JNM A;  1J1D B;  4LC1 A;  1LNQ A;  2YEV A;  3NMK A;  1D0X A;  3NG1 A;  2GAQ A;  2OJE D;  1DX7 A;  1LS4 A;  4U5F E;  1SQB G;  3BRJ A;  2NRG A;  2LSE A;  2NPS C;  2WIT A;  3EG9 B;  1IK9 A;  2O1J A;  1U7M A;  1GL2 B;  1R8E A;  1NZE A;  3AED C;  4ULV A;  2RD9 A;  4I44 A;  2V4H A;  1NFO A;  4PD4 I;  3PRJ A;  1ZXG A;  3OEO A;  2I8B A;  3MUD A;  1WRG A;  2GA1 A;  5E2Q A;  1OW6 A;  2WQY C;  1L4A B;  3HD7 D;  2V3C C;  3S29 A;  3CC4 P;  1C03 A;  2H88 C;  2WPV B;  5GTI H;  4P9F A;  4ER9 A;  1FOS F;  2DI3 A;  2FYN B;  1SQV G;  3V5B A;  1QVX A;  4DZO A;  3GLM A;  2YLD A;  1K8A Q;  4D4N A;  3O55 A;  1Y8A A;  2EIN C;  3A9C A;  3TJ6 A;  2QJP B;  3TOL A;  3RK2 C;  1LTB C;  3H1I J;  1BE3 E;  3N0T A;  1RMV A;  2AXC A;  1WGW A;  2VCA A;  1RKE A;  1LKX A;  5KYU B;  1KYO H;  1FZB A;  5AGF A;  1L0N K;  2I1J A;  2LFD A;  3AEB C;  4OGQ D;  3B0V C;  1YA7 O;  4L76 A;  3LES A;  4N6C A;  1KQL A;  2CK3 H;  4YXD C;  4D6T D;  2G3V A;  1AVY A;  3F89 A;  2J0W A;  1N7S B;  4AE4 B;  4MTG A;  5JSL A;  5APY A;  3H1K D;  3R4Y A;  4XQ1 A;  1K40 A;  4KJM A;  3GM3 A;  4JEA A;  4LDR A;  3B0U X;  2LCH A;  5KYW A;  1Z6A A;  3BVH A;  5KLV E;  2PP4 A;  3C8G B;  4BJT A;  2E74 B;  3H1H G;  2YHS A;  1YVI A;  1SYQ A;  2O01 H;  1QVF O;  4U5E E;  2XKM A;  2XXA B;  4RES B;  2WZL A;  4PV1 D;  3SYN A;  4DRH B;  5KYX B;  1M2V A;  2JWA A;  1VQ9 P;  2E75 C;  3VP8 A;  2L91 A;  5KAI H;  3LEV A;  1Z23 A;  3S1K A;  2P10 A;  2W4B A;  3P32 A;  1FDM A;  1H6G A;  3HUS B;  3VF0 A;  3AE9 C;  1OFC X;  3WUT A;  3LJB A;  4KI2 A;  5L0J A;  5K5G B;  2Y9Z A;  2KXP B;  3RBX A;  1M2O A;  3V2Q A;  4JJG A;  2BCC E;  4JKV A;  1BR2 A;  3NTN A;  4DOJ A;  3B5N C;  4C3D A;  1ZU5 A;  3KYJ A;  3L0I A;  2M5A B;  5A6A A;  2QUP A;  4G7Z F;  4O9B A;  2O9X A;  3DJU B;  1KYO D;  5KJ7 A;  2FYU D;  1VYI A;  1G4U S;  2WSF J;  2EPO A;  4KNW A;  1AQT A;  1LP1 A;  1M1J A;  1GU5 A;  5KLI C;  5D91 A;  3PLN A;  5BVZ A;  4H13 D;  3AE4 C;  1I5N A;  4WGY A;  1ORY A;  1VOM A;  1OKK A;  3C8Z A;  3B71 A;  2XZR A;  1VQ7 P;  1Z63 A;  1H9G A;  1GW4 A;  5COF A;  1DOV A;  4CX9 A;  2PF4 E;  3L4F A;  4E0H A;  2FY8 A;  4JF7 A;  5B5E E;  3QVY A;  1NTZ G;  1P84 H;  4EBB A;  1HJB A;  4UB8 E;  4EKW A;  3AG2 C;  5DJT B;  3B29 A;  1D1B A;  4P9T A;  1JOC A;  2EIM C;  1YBK A;  3L35 A;  2ZYD A;  2R3C A;  1Q0F A;  1J1E C;  5JLI A;  2JEE A;  3POV A;  1RHZ B;  2IOQ A;  3Q1M A;  2WSE J;  2OJQ A;  2R02 A;  5KYY B;  1EKY A;  2QLA A;  3O6X A;  3KZI E;  3U1A A;  3NYM A;  4EIJ A;  3I55 P;  1J1D C;  2A0U A;  2JDI H;  1BCC D;  1YZC A;  3U9M A;  1NU1 K;  2PFD A;  4H54 A;  3O39 A;  4XPX A;  3AEF C;  4M63 A;  1SQP E;  3V2N A;  2H8P D;  3H2U A;  3IQC A;  1A7V A;  1NU1 J;  2CPB A;  1LT9 C;  1JM0 A;  1EDL A;  4E17 A;  2E76 D;  1JOG A;  1GL2 C;  2J45 A;  4WY4 B;  3ITF A;  2CW0 F;  3MP7 B;  1FU1 A;  3D70 A;  4EIY A;  1BSN A;  1NTM J;  3CL3 D;  4YPC A;  2X0C A;  2R44 A;  2P7V A;  2PBE A;  4YWQ A;  2DYS C;  3DM5 A;  2LFF A;  3GF3 A;  3AEC C;  1L4A C;  1PIX A;  2N1T A;  4NTB A;  1OQC A;  3GF7 A;  4ASV A;  2LP4 A;  3VOP A;  3NMI A;  1G4W R;  1DD4 A;  1SQQ E;  2R5B A;  2FYN C;  3T6B A;  5E79 H;  1JUN A;  4RBN A;  2WMM A;  4W7Z A;  4ZLC A;  1NO4 A;  2OTK E;  3FWL A;  3H1J J;  2OYI B;  3TD7 A;  1CPQ A;  2W45 A;  1MMG A;  5GTI E;  4OIN F;  3TNU A;  1RE3 C;  2Z5I A;  4NPD A;  3AE6 C;  1AA0 A;  3AQC A;  3C62 A;  1L0N G;  3L1M A;  1XZP A;  1LE4 A;  1BGY E;  1MMD A;  4XE5 B;  3HLZ A;  1ST6 A;  3L73 J;  1GK4 A;  3KHU A;  3CCQ P;  3WMM 0;  3QW0 A;  4IRU A;  2ZT9 B;  3AE2 C;  1PV3 A;  2HLO A;  2OOC A;  3II6 A;  3GW6 A;  1N7S C;  5AVT B;  4XFJ A;  1IO4 A;  1CSB A;  2HSQ A;  4BJ6 C;  3SXM A;  2IXM A;  1SLQ A;  3QZC A;  1ZME C;  1OIP A;  1SFC A;  2JD3 A;  1NAY A;  3T6G B;  1FDO A;  1ZN5 A;  2ICW G;  4DRJ B;  1C02 A;  2QM7 A;  2LD6 A;  3QH9 A;  3M91 A;  3S4R A;  4WWI A;  2LQG A;  2VAS A;  3Q2Y A;  3LS1 A;  1DH3 A;  3US6 A;  3BAT A;  4D4X A;  1QPU A;  1XTC C;  4CJG A;  1TWC A;  1M57 C;  3HUS C;  1SQX D;  3L70 D;  2NUP B;  3HE4 A;  4I3M A;  4Z9J A;  4WAB A;  4AK9 A;  2R3S A;  3SWY A;  1PGJ A;  3L34 A;  3CAX A;  4GQH A;  1GK6 A;  3JT1 A;  3L71 D;  2IYL D;  2KYH A;  3L36 A;  4YT2 A;  3L72 J;  5BQG A;  3JYH A;  1QKR A;  1Y9B A;  2D2C D;  1RXQ A;  2QEX P;  2K9J B;  1X0T A;  3MHV A;  5APW A;  5DVW A;  3E1I A;  4O7G A;  3HE5 B;  1L7C A;  4C7O A;  4QDL A;  1RF1 B;  3K33 A;  4U5G A;  5CJ4 A;  4EUK B;  3PCV A;  1RKC A;  1LI7 A;  2AP3 A;  3NDB B;  4PK4 A;  4JCZ A;  5APU A;  2E43 A;  1FJP A;  4LAC B;  2ZXW C;  3VYW A;  3S90 A;  2L6H A;  2KZI A;  1YJ9 P;  5HV9 A;  3P8C D;  3VYI A;  1HGZ A;  3RBZ A;  1JY2 O;  3WG7 C;  5APX A;  1OCR C;  1EZV G;  3NKD A;  2A45 G;  2NPS D;  1HY5 A;  3H1L G;  2XLH A;  4TLF A;  5COG A;  2FFD B;  5AVX B;  2LR2 A;  1UFB A;  2MHR A;  2Y3H A;  3SZR A;  2QIW A;  4DRI B;  3B9Q A;  3KYI A;  1WT6 A;  2I15 A;  2EPK X;  3Q6M A;  3L75 G;  2R7Q A;  4XPY A;  3LEO A;  3IQ6 A;  1SQB J;  3DMD A;  3K1I C;  2A68 F;  5CI9 A;  3VRC A;  1OWA A;  1GDT A;  1PD0 A;  3EFO A;  2ZFC A;  3K6B A;  3OA7 A;  1Q0D A;  3K1H A;  2QJY B;  3CWB G;  5JS5 A;  2A45 H;  1P84 E;  1CI6 A;  2D4U A;  2R7R A;  1DD3 A;  3C9I A;  3ABK C;  3DXJ F;  3NKE A;  3C1L A;  1GD2 E;  3HTK B;  3DJN B;  2W83 C;  3IPM O;  3CX5 D;  5E33 A;  3FGA D;  1IFP A;  1YQ4 C;  2R25 A;  4U3F D;  1PFI A;  1GZL A;  2FYU K;  3CZ6 A;  4O6N A;  1YIT P;  3RK2 D;  3WU2 H;  1VF5 B;  3S84 A;  1LJ2 A;  1LTT C;  4YK5 A;  5AC5 A;  1SS1 A;  1SQV J;  1S9K D;  3IF4 A;  3AE1 C;  2XDJ A;  2HS5 A;  3JCU H;  3GM1 A;  3BCC E;  1ZHY A;  3I5P A;  2KNC A;  1L0L G;  4FWV A;  4CS8 A;  2J0X A;  1LE2 A;  1YLM A;  3P7K A;  1Q2N A;  1KNY A;  2L9J A;  4IWB A;  2K9Y A;  2VB6 A;  1JRA A;  1ZU4 A;  3LID A;  2XM4 A;  4MVS A;  1FBM A;  1RH5 B;  3H32 A;  4Q5S F;  5KAF E;  5CCH C;  4N78 E;  1JR8 A;  1OMI A;  2I8D A;  4HFF B;  1DEB A;  3ATP A;  2PNO A;  4KHX A;  2YKZ A;  4JBZ A;  1WWP A;  3ZDM A;  5BUO A;  1NTK G;  2O01 J;  4JTA B;  4MND A;  5BU5 A;  2HZ8 A;  2JO1 A;  4LDQ A;  2IBZ D;  3EHM A;  2OYI C;  2W9Y A;  1NOH A;  1KV4 A;  3A0H E;  4CSA C;  3L74 G;  2K37 A;  3N2Z B;  1LTS C;  2E75 D;  5APQ A;  4NY3 A;  3H1L D;  1LT1 A;  1HW1 A;  3HE4 B;  3CME P;  4GT1 A;  2YL3 A;  3DWW A;  4YJW A;  3HD7 A;  3SXZ A;  3H1H J;  1JMM A;  3D6Z A;  2GDC A;  3RK3 B;  4BJ5 A;  1L3P A;  4DOZ A;  1H88 A;  3KPE A;  4HEA J;  2HOD B;  4CS9 A;  3B5N D;  2XLD A;  1KB9 E;  2XLE A;  4I1L A;  1FZG A;  3H1I E;  1FS0 E;  2ZT9 C;  1KQS O;  3ABL C;  4HE8 D;  5APS A;  1MMN A;  4L74 A;  1EQ7 A;  4GKG A;  1E2X A;  3AOU A;  2C0W A;  4GEH A;  1BE3 D;  1EDI A;  1E84 A;  5HSW A;  2YXR B;  4KT0 J;  4IFF A;  1URQ B;  2JJL A;  4DXW A;  1EXJ A;  2R9R B;  3LAY A;  2QJK B;  3S27 A;  1JY3 O;  1RQV A;  1L0N E;  1YJW P;  4R32 A;  1RJ9 A;  1V55 C;  4LGD E;  1FDI A;  1OCC C;  4O6M A;  2L7A A;  1L0L D;  1AV1 A;  2J46 A;  3WUU A;  2WL8 A;  4ZMD A;  5H2F E;  3GHG A;  4XEF A;  1LTJ B;  3GG2 A;  3JTL O;  3M15 A;  2OTL P;  5TIS E;  4EYY Q;  2Q00 A;  4W8P A;  4CDY A;  3VP9 A;  2V26 A;  4OIR F;  3ZQV A;  5L0F A;  2A6H F;  1QZX A;  4NCQ A;  2BEZ F;  4Z1M H;  4BG0 A;  3DZA A;  5CCG C;  4B86 A;  3SWF A;  2R7O A;  1VQN P;  3EGD A;  1NTK D;  1NTZ J;  4D6T G;  5DS5 A;  4C3E A;  3ZTM A;  1KIL B;  3RFY A;  3TOM A;  3RQG A;  3H1K G;  3PHL A;  1RF1 C;  1YYX A;  1J8Y F;  3QVZ A;  4AX2 A;  3EQL F;  3O6Q A;  1T6Q A;  3JYY A;  1RE4 A;  2JX0 A;  3AE8 C;  1BDD A;  2IXO A;  1S05 A;  2C9L Y;  1MND A;  5GPG B;  1M56 C;  2RH0 A;  4Q7C A;  1CGN A;  1D1A A;  2YNY A;  3G4Z A;  1ORS C;  1LTA C;  2KNC B;  1YYC A;  2R7X A;  1ZW3 A;  1H9T A;  2FFD C;  2H8A A;  1T2K C;  2LK4 A;  2IXP A;  1E85 A;  4Z9H A;  2ZD9 A;  2A06 E;  3VTP C;  3S28 A;  3PMR A;  4OWF A;  2EPL X;  1H0T A;  4GOD A;  2A0B A;  2QJY C;  3JSE O;  3T97 A;  1L4A D;  3CI9 A;  1VLS A;  1Z3I X;  1SMY F;  3GEI A;  1OCZ C;  3S0X A;  2YMY A;  1PGP A;  1BSH A;  4UDV A;  3HTK C;  3KQG A;  3NMD A;  2NG1 A;  2PGD A;  4EOT A;  2Q5U A;  4R4L A;  2FYU G;  1FZC A;  3E7K A;  3TUL A;  3FDQ A;  1MKM A;  1O3U A;  2IBF A;  3O10 A;  1VF5 C;  1QX8 A;  3OA1 A;  1APC A;  2HKV A;  4JRZ A;  2P0N A;  1IZN B;  3TGU G;  3H25 A;  2W8Z A;  4OD5 A;  1P84 I;  1USD A;  1USE A;  1KFN A;  4K7B A;  4H0L D;  1LS1 A;  3LLK A;  4U5D E;  1L0N J;  1BBH A;  2WVO A;  5AW5 B;  4FES A;  1PP9 D;  2M4E A;  3I4U A;  3PDM P;  2J5U A;  1NU1 E;  3I5C A;  3RH3 A;  3SXK A;  3B4S A;  2XLO A;  2YQY A;  4YTP C;  1JPJ A;  5EHH A;  2YKO A;  1Y47 A;  4E18 A;  4P6I C;  4M3L A;  2YO2 A;  5AW9 B;  1SQP D;  5AVQ B;  1NU7 D;  4OGQ B;  1TWH A;  4BRY A;  1WOL A;  2J7P D;  3GAN A;  1CGM E;  1RJ9 B;  1NTM E;  1QL2 A;  4H4K C;  1G1J A;  2GUV A;  3ABM C;  2Q9I A;  1UII A;  2YZS A;  1QL1 A;  3X1O A;  3U5S A;  1KIL E;  3A7O A;  1M57 D;  1TR2 A;  3K5B A;  5JT4 A;  4XEK A;  1ZP0 C;  4J30 B;  2QA4 P;  1BCC G;  2FKW B;  4HKZ H;  1N73 A;  1D0Y A;  2XRH A;  1QGK B;  3CXH D;  3OAK A;  1X22 A;  4WB4 A;  3H1J E;  4IL6 H;  1VLT A;  2XS1 A;  1SQQ D;  3W4Y A;  3A0B H;  1HBW A;  3Q5R A;  3F47 A;  4PV1 B;  1AEP A;  2P6V A;  3G71 P;  1J2J B;  4CIP A;  2FYZ A;  3EGD B;  4J7T A;  4NPF X;  1OW8 A;  2IDB A;  4ZKP A;  1YJN P;  2H7O A;  4U5H A;  1OW7 A;  3PH0 A;  1LTI C;  3LUT B;  2OYH B;  5CMZ A;  1URQ C;  1ZR2 A;  3RVZ A;  3CC2 P;  3L73 E;  2A6E F;  2WSC H;  5AVW B;  5GTH H;  1LWU A;  1R5I D;  1BGY D;  2Q9A A;  1VQK P;  3GEH A;  2KW3 C;  3GWL A;  1VQP P;  1U57 A;  3RL0 B;  2EIJ C;  4RO0 A;  4EWC A;  4WJ0 A;  1E5W A;  3S9O A;  2KS1 A;  1OVR A;  3TGU D;  1KB9 I;  1D0Z A;  3TK0 A;  4EDF A;  2H89 C;  1EC5 A;  3M9Q A;  3IQT A;  3Q7L A;  1V54 C;  1S2E A;  3G9R A;  3UIA A;  4Y99 B;  1HUC A;  1LTJ C;  3N24 A;  2PRR A;  5B1A C;  2POH A;  2YO3 A;  5M1B A;  1T9K A;  4CDV A;  3QMK A;  1Q0K A;  4H13 B;  3E9V A;  2QVA A;  3PP5 A;  5E3C A;  2IM8 A;  2IXN A;  2B0H A;  2Y39 A;  3H1L J;  5AW2 B;  4I2L C;  3FAP B;  3TF5 A;  2JP3 A;  1CGO A;  4DVZ A;  3MX3 A;  1T01 A;  1IJD B;  2HJ3 A;  3C8V A;  1KIL C;  1JTH A;  1NGM B;  3L75 J;  1KN7 A;  2HJM A;  4PFP A;  1J8M F;  1DOW A;  2YL7 A;  4TT3 H;  5TJ5 E;  2QE9 A;  3CWB J;  3L72 E;  1WMK A;  1IFI A;  3IFM A;  3OW2 O;  5T3W A;  3CMA P;  1PPJ E;  4OIQ F;  4GDO A;  5A69 A;  4E7Z A;  4JQ0 D;  1RKE B;  1FMW A;  5BU8 B;  2K3R A;  4C7R A;  1EA8 A;  4PJ0 H;  1HMD A;  4A2N B;  1SQX G;  3L70 G;  2GUS A;  3VMY A;  3CCM P;  3JSZ A;  1KU2 A;  2KC3 A;  4U5B E;  4PD4 D;  2QSI A;  1L0L K;  2FXP A;  3RW0 A;  2M0B A;  1TFO B;  1Q0G A;  1JY2 N;  5CCH D;  1KC8 Q;  4MS2 A;  2NUT A;  3AEA C;  1GMJ A;  1ZYR F;  1L0L J;  5A6B D;  3L71 G;  5FZT A;  4MTF A;  4LLH A;  4NTA A;  3EQ2 A;  3HJC A;  2YXQ B;  3RGU A;  1A7D A;  4C46 A;  5KYW B;  2NPS A;  3RIP A;  3IEE A;  2IZ0 A;  3FXH A;  5K0I A;  2IPP A;  1N8R Q;  4MVO A;  4KNV A;  2KLV A;  4JYC A;  1SQB E;  2HPC A;  1ZR4 A;  1ZVZ A;  2AVK A;  1RF0 C;  1NTK K;  1S7Z A;  4O6Y A;  1W2E A;  1M2V B;  5AVR B;  2L5G B;  1ZZP A;  3VAY A;  1VQ8 P;  2QJP C;  3KYQ A;  2P61 A;  2C04 A;  3CLQ A;  3KL4 A;  1NTK J;  3NYL A;  3GM2 A;  3M0D C;  2KIK A;  4K1O A;  2WSS H;  2AWC A;  1ZW2 A;  4NQF A;  2O01 N;  3GOD A;  1NYH A;  3L74 J;  4WBA A;  5F28 E;  1W2B O;  3SWK A;  1SVF A;  3ZG1 A;  5FCL A;  3SXY A;  2EPN A;  3MLG A;  4K0D A;  2L6G A;  1H8A A;  2OEX A;  1D7M A;  4XA4 A;  1KYO E;  1HF9 A;  4K35 A;  2VRS A;  1SQV E;  2G3A A;  1EZV I;  3U1C A;  2A45 I;  2B87 A;  4MQ9 F;  1HW2 A;  3Q6N A;  2WZF A;  3IR9 A;  1KD1 Q;  3IQ5 A;  3QWO C;  3NXS A;  2TMV P;  1LP1 B;  1M1J B;  2OEV A;  3FHD A;  4OGQ C;  2QY9 A;  2E74 C;  3BCC D;  2OKU A;  1OZH A;  3BAS A;  2ZXX A;  1FFT C;  1NG1 A;  4XWJ A;  4H44 D;  3GMA A;  4MVU A;  1B68 A;  2FGY A;  4IAQ A;  3EFG A;  4N78 D;  4U3F G;  1HWT C;  2QG4 A;  1Q82 Q;  1RCP A;  1XTG B;  1TWA A;  1YI2 P;  3H2V A;  2PFX A;  1QVG O;  4JTD B;  4UB6 H;  1VQL P;  1OR3 A;  4KC9 A;  3KH2 A;  3RQF A;  2SPZ A;  4DJ9 A;  2AXT H;  5KAI E;  3ITK A;  3QTH A;  3UGP A;  3CX5 H;  3MTU E;  4PV1 C;  2R7W A;  2V7Q H;  2XLW A;  1I4Y A;  3WAQ A;  3H1H E;  5CCG D;  3ASO C;  3ZC4 A;  4MN4 C;  3ABV C;  1OXZ A;  2OYH C;  2VCC A;  3A0B E;  2OTJ P;  1T6U A;  5CI8 A;  3D71 A;  2XLV A;  3EZI A;  1R5S A;  4IFD K;  3AGU A;  2B89 A;  4GIF A;  3VMZ A;  4EI2 A;  3G4S P;  2KNH A;  3B5N A;  2F22 A;  1LI5 A;  3RL0 C;  1T5O A;  4JW1 A;  4D6T J;  3FMS A;  2PAJ A;  1GTW A;  1KB9 D;  2IBZ G;  1R4T A;  3T4R A;  2L81 A;  1SQP K;  2D2C B;  3H1K J;  2L6F A;  5GTH E;  1A02 F;  3DI5 A;  1M56 D;  3D6Y A;  1N7L A;  1DIP A;  3RF3 A;  2R5D A;  2ZPA A;  1NHL A;  4Y99 C;  1JY3 N;  2R7S A;  3EGX A;  2YKP A;  2O3J A;  1JPN A;  4YT8 A;  4JYB A;  5AVV B;  1ZV8 A;  2Y3G A;  3AG4 C;  3V2R A;  2YIU B;  3ASN C;  3MUD C;  2J9U A;  3CCJ P;  3AE7 C;  2N1T B;  3DE9 A;  3JRT A;  1YTZ I;  4MW3 A;  2Z5H A;  3CCR P;  2Q3T A;  3G4X A;  2KOG A;  2RMZ A;  1VQM P;  3TQO A;  5TJH A;  3OWT A;  2WTY A;  4K3A A;  1BE3 G;  2KI7 B;  3HNK A;  1N1C A;  3DD7 A;  2WZG A;  1XWJ A;  1VDF A;  3BEH A;  3HKK A;  2OGU A;  1FJK A;  3CCV P;  5L3V A;  3T6J A;  3TNU B;  2CPS A;  1NTZ E;  1N2D C;  2KLU A;  2WT7 A;  1VF5 D;  4DJG A;  2Y0C A;  1S72 P;  1IFJ A;  2DYR C;  2H43 A;  4Q4Z F;  4AL0 A;  4AL1 A;  2FYU J;  2CNW D;  1JO5 A;  1Y4C A;  1K04 A;  1VB5 A;  3UMK A;  3HRN A;  2G3K A;  1AJY A;  4YT5 A;  2R03 A;  2Z15 A;  1BDJ B;  1PD1 A;  4WY4 C;  3ZTZ A;  5IY5 C;  1HTL C;  5CBO A;  3HNI A;  3RK2 B;  3TGU J;  2HMQ A;  2B87 B;  5KLV G;  1VPC A;  1NSG B;  4JCH A;  3W2W A;  3V5X A;  1GS9 A;  3FOO A;  1ZRT E;  1SFC B;  5L0G A;  3EG9 A;  1LT9 A;  2Q9C A;  1GL2 A;  4C7N A;  2P1J A;  4XLP F;  3K66 A;  5KTB A;  3G6E P;  5JP7 A;  2AEJ A;  1NLX A;  1V4A A;  3WOD F;  2A06 D;  2AU5 A;  4JZA A;  3UMI A;  3V4W A;  1Z56 A;  2BCC G;  2KGO A;  1E86 A;  1FTS A;  1IFM A;  1L4A A;  2BEQ D;  5E79 E;  3AG3 C;  2VCB A;  3KXD A;  2JWD A;  2R7T A;  5AW1 B;  1NFN A;  3E1R A;  3LLI A;  1MZ9 A;  1V74 B;  1EDJ A;  1CPR A;  4G0H A;  1EDK A;  1VL2 A;  2XL4 A;  3T9O A;  5F5F A;  2LXB A;  2NPU A;  4JE9 A;  2HR3 A;  3CSK A;  4DBR A;  2UUH A;  4XEV A;  4WGZ A;  2CGE A;  2R32 A;  2W6A A;  1G2C A;  2WVQ A;  1BCC J;  1Q81 Q;  2E75 B;  2N9B A;  1PGQ A;  3C18 A;  1RE3 A;  5KJ7 C;  2AWY A;  2M64 A;  4C7O B;  2RSE B;  2WSC J;  2R05 A;  4KBL A;  1URQ D;  5KYU A;  1M1J C;  4CIH A;  2ZJS E;  3LW5 H;  3B5N B;  2I1K A;  1FC2 C;  3GEE A;  5L3Q A;  1GW3 A;  2N9Y B;  1KZU B;  1JMB A;  2C03 A;  2GM4 A;  4J7Y A;  1N7S A;  4AE4 A;  2Y69 C;  1G5Z A;  1CZQ A;  2QRX A;  1NU9 C;  1ZOY C;  3SFD C;  1FZA A;  4BJ6 A;  4E7S A;  3SSU A;  4RD9 A;  2Q3E A;  1A41 A;  2PP6 A;  1KYO I;  3I56 P;  5KLI B;  3C8G A;  5JUA A;  4JIO A;  2J7P A;  1T3U A;  1QLE C;  1MUU A;  5KLV D;  1Z5Z A;  3EFO B;  4DBQ A;  3CC7 P;  4N06 A;  2XXA A;  2VH3 A;  1NTM D;  3U59 A;  2P2U A;  2W4M A;  2XLM A;  5T1D B;  5KYX A;  4UB6 E;  5EFW B;  1OVV A;  4X0R A;  1CI6 B;  1JCC A;  2Q6Q A;  4I1O B;  2OYO A;  1XZQ A;  3DAG A;  2AXT E;  1T6I A;  1FZE A;  3HUS A;  1PP9 G;  1KIL D;  4LLC A;  2Q1K A;  3FXE A;  1R5L A;  2D5R B;  2E5T A;  3AQB A;  2ZXR A;  3P8M C;  4F4B A;  4L6R A;  4PJJ A;  3H1J D;  2BCC D;  1SQP G;  4U5C E;  4I6M C;  2Y9Y A;  3M0A A;  3JCU Q;  1YTZ T;  1CW5 A;  3AE3 C;  2X51 A;  5DQT A;  4I7Z B;  5BQH A;  2IX7 C;  2M5A A;  4PJL A;  3TSI A;  4GOF A;  1KQG B;  4IGG A;  3U9J A;  1U7J A;  4ULW A;  2CDQ A;  3A3Y B;  1GL2 D;  2K88 A;  5B1B C;  3MBG A;  2FBW C;  3ZWI A;  3L73 D;  2AEM A;  2YIU C;  3H32 B;  4PJM A;  4W80 A;  4AUW A;  4W8K A;  1SQX K;  3MZW B;  1TQG A;  1SQQ G;  2AEF A;  2N1T C;  5C39 A;  4OIO F;  3RK3 E;  4N3Y B;  3ECS A;  1KMI Z;  1SQX J;  2WZ7 A;  3L70 J;  5AVZ B;  3EHN A;  1LT9 B;  2QTV A;  2IBZ E;  4HFK B;  3ZDL A;  4C7N B;  4XLN F;  2FXM A;  1ZHW A;  4W7Y A;  3W2V A;  3CXH H;  3OJA B;  2Q3I A;  1EZV E;  3EWK A;  1DEE G;  3L71 J;  1BR4 A;  3H1L E;  5CIV A;  3K1I A;  3C7J A;  1BGY G;  1VQ4 P;  3GOR A;  3HD7 B;  2HUJ A;  1KTM A;  4G7H F;  1WAS A;  3L75 E;  2IFM A;  1M90 Q;  4LDK A;  3DE8 A;  1SP4 A;  3CQZ A;  3EH2 A;  3M4B A;  2W6B A;  1BDC A;  1OCO C;  4LLE A;  3CWB E;  3U2L A;  2W90 A;  3WU2 E;  1NKZ B;  5KYY A;  3M9B A;  1YZA A;  5AW7 B;  5B66 H;  3WHN A;  1G1I A;  1G2C B;  2B9B A;  3JCU E;  2HSB A;  1IW7 F;  1N7S D;  3L72 D;  1YYJ A;  4IFM A;  1PPJ D;  1KOR A;  2BAS A;  1M6T A;  1SFC C;  1FZF A;  4U9D A;  2Y3B A;  1Q7Y Q;  3U8P A;  1SR2 A;  1FNT c;  3C8G D;  2E74 D;  3AG1 C;  5B3S C;  1MQV A;  1K05 A;  4H0L B;  2ITA A;  1OXK A;  4WY4 A;  5L0D A;  2PX0 A;  3LS0 A;  5KYN A;  1K9M Q;  1L0L E;  2QM8 A;  3CPW O;  3JSV C;  4HJG H;  5CCH A;  4MVZ A;  3ZVR A;  2DW3 A;  2XM0 A;  2ZVO B;  5A6B A;  3FWN A;  4JUR I;  1FFH A;  3RK3 C;  3F5H A;  1HMO A;  3O8Z A;  5AVU B;  2QE7 H;  3GHG B;  4AQR D;  2KSF A;  3FX0 A;  1HGV A;  2P67 A;  3E70 C;  1NWQ A;  2GFH A;  2FXO A;  2E42 A;  1MMA A;  3U8V A;  3B0P A;  2V7Q J;  1YHQ P;  1O87 A;  1JCD A;  1QSP A;  3IHU A;  5JRA A;  1IC2 A;  2KZJ A;  2OYI A;  1SQB D;  2ZVN B;  4U3F J;  4MW8 A;  1NTK E;  4YL3 A;  4CSA A;  2YL1 A;  4RDA A;  3GWN A;  3UMH A;  1EXI A;  1NJI Q;  1AQ5 A;  2RN0 A;  4C3B A;  5COM A;  3L74 E;  2ZXP A;  1H7I A;  2ZAE B;  2XV5 A;  1PCX A;  2QJK C;  4ZKU A;  3O6Q B;  2OQQ A;  1KQF B;  4N4W A;  4PJN A;  4FAP B;  3DAF A;  3RL0 D;  1WAT A;  4PD4 H;  1KFM A;  4YL1 A;  4G7O F;  4B6I A;  1JY2 P;  5L0H A;  3X2Q C;  1HJ0 A;  3AEG C;  2WVR A;  1SQV D;  2IZ1 A;  4FX5 A;  3LNM B;  4CBE A;  3G3Z A;  3M4C A;  4G78 A;  2GWW A;  5DLJ A;  3MYF A;  2Q9B A;  2MWQ A;  3R7C A;  1H0T B;  1FAP B;  5KKZ B;  3ZIB A;  2E5Y A;  1HE1 A;  3CEX A;  3FAJ A;  3T97 B;  3M1C B;  2EIL C;  1IFN A;  2MJZ A;  4OH8 B;  2J58 A;  3BRT B;  3LIE A;  5AW6 B;  3V6I A;  4ZNC A;  3U0C A;  2UUI A;  4OIP F;  2NUP A;  1M8O B;  4XPW A;  2KB7 P;  3CCE P;  3H65 A;  2P58 A;  2J9V A;  3AE5 C;  5DJU B;  1FZC B;  1M1K Q;  3MIW A;  1RY3 A;  1HH0 A;  1WN0 A;  1A0B A;  3CCL P;  4Z9I A;  2Z4E A;  4ASW A;  3NFQ A;  256B A;  1FR0 A;  1SF8 A;  1MFT A;  3BCC G;  3PHF 2;  4L75 A;  4EBJ A;  4I7Z C;  1AVO A;  1S5L H;  3FVY A;  2WPQ A;  5CCG A;  4L73 A;  3TDK A;  1BE3 J;  2W27 A;  2K9J A;  2Y0D A;  3MGN A;  3A11 A;  3C63 A;  3H1H D;  1W5C E;  5AW3 B;  3HE5 A;  3EZH A;  5F5H A;  4CS8 C;  1VQ6 P;  4JTC B;  5BQI A;  1RF1 A;  4U9E A;  1OX3 A;  4D6T E;  4WY4 D;  1PP9 E;  3CX5 I;  4JJF A;  3VMX A;  3H1K E;  1C17 M;  2LXC B;  1EI7 A;  2KP8 A;  4YT4 A;  1H89 A;  1LIH A;  4CPG A;  2Y0E A;  5KAF H;  4CS7 A;  1NVO A;  5KLV K;  3V7O A;  4XTK A;  3M06 A;  4IL6 X;  2C0X A;  2E76 B;  3MD0 A;  1O5H A;  5L0C A;  4BRY B;  3SP1 A;  1UIX A;  1NTM K;  4BWN A;  1W2W A;  2FFD A;  3FXD A;  5A6J A;  1QQ3 A;  3I5Q A;  4IJJ A;  5KLV J;  2XL6 A;  2J9B A;  1E79 H;  2ZXO A;  3KKB A;  2ZYA A;  2KK7 A;  2BE5 F;  1JEK A;  2YKQ A;  4BEM J;  1VTM P;  4RJT A;  2OCC C;  2ZXE B;  1K73 Q;  4IAR A;  3DKA A;  4YXW H;  3HD7 C;  4J32 B;  3A0H H;  4BJ5 C;  3CXH E;  1N73 B;  4AYC A;  1M7L A;  2UWJ E;  3H1I G;  1NBB A;  4QI0 A;  1P84 D;  1JB0 J;  1Q90 D;  4MTO A;  4JVS A;  3VM6 A;  5CBN A; 
#chains in the Genus database with same CATH homology
 2BEZ F;  4Z1M H;  3AE9 C;  1NGM B;  2E74 C;  2E76 D;  1JOG A;  1KTM A;  4H13 C;  3BRJ A;  1IK7 A;  4YTP C;  2JPU A;  1ZOY C;  3SFD C;  5KKZ C;  4TT3 H;  1OMI A;  3IAO A;  1VF5 D;  4OGQ B;  2ZT9 D;  1WOL A;  3RQG A;  4H44 D;  3D70 A;  1WMK A;  3GMA A;  1R8E A;  1Y9B A;  2D2C D;  1WWP A;  2PBE A;  3AED C;  3GF3 A;  1K04 A;  3AEC C;  3C8G A;  1PIX A;  3O6Q A;  2O01 J;  3T97 B;  4GDO A;  1AJY A;  3JYY A;  2JO1 A;  2HSB A;  3GF7 A;  2JX0 A;  3AE8 C;  3AJM A;  2J5U A;  3LW5 J;  3Q5S A;  3RQF A;  3U0C A;  1KIL E;  1OW6 A;  2WQY C;  1DD4 A;  4XEK A;  1ZP0 C;  2FYN C;  1KOR A;  2WSF J;  2NZ2 A;  4H0L C;  4Y28 J;  2E75 D;  3K7D A;  3AE5 C;  5L8R J;  4PV1 C;  4U7J A;  1S1C X;  2H88 C;  2WPV B;  3IN6 A;  1WTY A;  5KLI C;  2L6H A;  2QSI A;  1TU3 F;  2FXP A;  3D6Z A;  3C8G D;  2E74 D;  4H13 D;  3AE4 C;  1K05 A;  4H0L B;  1QVX A;  1ZRT E;  2LK4 A;  3Q5R A;  3GLM A;  3AEA C;  4PV1 B;  4EBJ A;  1GMJ A;  3ABV C;  3AE6 C;  4I7Z C;  3SFE C;  4EBK A;  3D71 A;  3B71 A;  1UFB A;  1OW8 A;  2IDB A;  2QIW A;  3AE3 C;  1OW7 A;  2ZT9 C;  2QJY C;  4H44 C;  4I7Z B;  1V4A A;  3L8J A;  4RKU J;  1S5L X;  3MFN A;  3RQE A;  2KK1 A;  2ZT9 B;  3AE2 C;  1PV3 A;  2BEQ D;  3Q5P A;  4H44 B;  1KQG B;  3AEB C;  4KT0 J;  4OGQ D;  1ZZP A;  2D2C B;  3Q3D A;  2L6F A;  1U57 A;  2V7Q J;  2QJP C;  4R4L A;  4XFJ A;  1EXJ A;  3D6Y A;  2FBW C;  1DD3 A;  3TUL A;  1DIP A;  2E76 C;  4YXD C;  1RQV A;  3S9O A;  2YIU C;  3GM2 A;  1VL2 A;  1MKM A;  1ZME C;  1O3U A;  1EXI A;  3O10 A;  4R32 A;  4XEV A;  2YWA A;  1VF5 C;  2H89 C;  3R4Y A;  1RQU A;  3FGA D;  4IL6 X;  3Q1M A;  4NQF A;  1K40 A;  1FDO A;  2E76 B;  3RK3 E;  1FDI A;  1NYH A;  3G9R A;  1YQ4 C;  3GM3 A;  2E75 B;  1UIX A;  2D2C C;  1KMI Z;  2YMK A;  2WSE J;  3JZ0 A;  3L8I A;  5F28 E;  5M1B A;  4R4M A;  3C18 A;  2L6G A;  1PL5 A;  2QJK C;  1VF5 B;  3H25 A;  3C8G B;  2E74 B;  2OQQ A;  3AE7 C;  1KQF B;  4H13 B;  2WSC J;  3Q2Y A;  1HF9 A;  3AE1 C;  4XEF A;  2G3A A;  2MKV A;  3GM1 A;  4H0L D;  1YQ3 C;  2Q00 A;  3EWK A;  4PV1 D;  2JP3 A;  3RL0 g;  2E75 C;  3AEF C;  1KNY A;  3U3F A;  2K9Y A;  3AEE C;  1HJ0 A;  2P10 A;  3AEG C;  1JB0 J;  1Q90 D;  3C8V A;  4OGQ C;  2G8Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...