3B71A

Cd4 endocytosis motif bound to the focal adhesion targeting (fat) domain of the focal adhesion kinase
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
134
structure length
134
Chain Sequence
NLDRSNDKVYENVTGLVKAVIEMSSKIQPAPPEEYVPMVKEVGLALRTLLATVDETIPLLPASTHREIEMAQKLLNSDLGELINKMKLAQQYVMTSLQQEYKKQMLTAAHALAVDAKNLLDVIDQARLKMLGQT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Focal adhesion kinase 1
publication title Structural basis for the interaction between focal adhesion kinase and CD4.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 56
structure length 134
sequence length 134
chains with identical sequence B, C
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2007-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03623 Focal_AT Focal adhesion targeting region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.540 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 3b71A01
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 3b71A02
5F28E 1WOLA 1YQ4C 3AECC 3SFDC 3C18A 2WQYC 2YWAA 2FBWC 4XEKA 3C8GA 3GM1A 4XEFA 3RQFA 3AEEC 3GM3A 3AE4C 1K04A 3S9OA 1QVXA 3AE5C 3AEGC 3AE3C 2L6HA 2JPUA 2KK1A 3O10A 4YTPC 3JZ0A 1K05A 2JX0A 3RQEA 1K40A 4NQFA 3AE6C 2L6FA 1KNYA 2LK4A 3B71A 2Q00A 3AE9C 1WTYA 1O3UA 1YQ3C 3C8GB 1PV3A 4XEVA 3SFEC 3JYYA 1OW7A 3L8JA 4EBKA 3K7DA 2G3AA 3GM2A 3AEDC 3BRJA 3AJMA 1V4AA 1OW8A 3AE8C 3L8IA 3RQGA 1UFBA 3MFNA 3AEFC 3AE7C 1ZZPA 3AEAC 1KTMA 3TULA 1ZOYC 3AEBC 2L6GA 3U0CA 4R32A 1JOGA 1OW6A 2H88C 3AE2C 1WWPA 2HSBA 2H89C 4EBJA 2PBEA 3AE1C 4YXDC 3C8GD 3U3FA 3ABVC 1ZP0C
chains in the Genus database with same CATH superfamily
2JJLA 5CMZA 4H44B 1QGKB 3CCJP 1LTJB 1V54C 4G7HF 5L0HA 2HYNA 3AG2C 4DXWA 2NUPA 2GUVA 5CCGA 4MVMA 2HLOA 1MKMA 2EPKX 1L4AD 5A6JA 3P7KA 4WJ0A 2KNCB 2OQMA 1JCCA 2GWWA 3K66A 2SPZA 1L0LG 2R7SA 1LP1B 1IJDB 3VYIA 4IAQA 1SQQD 4DRHB 5BUOA 3AEGC 4C7NB 4YT5A 2CCYA 1GL2C 2Z5IA 2KW3C 5KTBA 4LLCA 4QMAA 1LWUC 2MHRA 5K5GB 5KAIH 3H1ID 3T97B 4OGQB 1LT9B 3JZ0A 4BJ5C 2GA1A 2DW3A 1M56C 4Y28J 1N2DC 1CPQA 1H7IA 3C7JA 1JO5A 1Z6AA 3O6QA 1SYQA 4H13C 2KYVA 3HUSB 2FYUK 2ZXEB 2IBZE 3AE6C 3ZDMA 5KJ7C 1SQXJ 5JUAA 4D6TG 1LTIC 2A06D 3VP9A 1Z5ZA 1N86A 3SXMA 3A2AA 3FGAD 4B6IA 4GT1A 3US6A 1GK4A 3J06A 4HE8D 3AGTA 4C3DA 1HMOA 2XRHA 2LSEA 1EDJA 4XA4A 3NFQA 4IFFA 1KV4A 4FAPB 3N2ZB 3L70D 1HH0A 3EHNA 2P10A 2B87B 3MUDC 3FXHA 4BJ6A 4JF7A 1SQVG 3RK2B 1UFBA 2IM8A 3ZTMA 1N7SB 3AEFC 3ZDLA 2L91A 2M8RA 5KLVD 2R7RA 3F46A 2A69F 4XLNF 2EIMC 1M1JA 2HSQA 1N73B 1EQ1A 4N6CA 5AW7B 2R32A 5GTIE 3AG3C 1LTBC 4E0IA 4O79A 3F89A 5E2QA 2Q9BA 3NYMA 2HG5D 1HGZA 1HGVA 3DWWA 4UDVA 5E3CA 4KHXA 2ZFCA 2IYOA 3U3FA 4BPMA 3PMRA 1NLXA 2R7XA 5B1AC 5FCLA 3IAOA 4GEHA 1SQBK 2WWWA 2E76C 2GAQA 3BCCD 1JMBA 4U3FG 2K3RA 1IW7F 3ABKC 1HJ0A 2FYNC 1LTAC 3C18A 3GLMA 4PJ0H 3L75G 3LS0A 5KYUA 1YJGA 2EIJC 1NTMD 3GHGA 4BRYB 4OD4A 3Q3DA 4XPWA 2HMQA 1KQGB 1NAYA 3TNUB 4EI2A 4I6MC 4KJMA 3B5NB 2HODA 1S4XA 4MW3A 3H1HE 3PLNA 4C3EA 2B88A 1VQPP 3B0PA 1NTKD 1KD1Q 3L72E 5CCHD 1NVOA 3G4XA 3TGUD 3FAPB 4HFFB 2OYIB 1VDFA 2FYZA 1IO4A 4ULVA 2AP3A 2LCHA 2XL4A 3V4WA 4ASWA 5L3QA 3ZQVA 4OGQD 3E70C 2NPSA 3AE9C 2VASA 2YXRB 4JURI 3G50A 2NUPB 3C62A 4YT8A 1OCRC 1YA7O 3B4SA 3H1LJ 2WTYA 3S29A 2A6EF 5EK0A 3NDBB 4NY3A 3I5QA 1OW7A 2EPOA 1HE1A 2OOCA 3X1OA 3U3BA 2YKPA 1JRAA 4F4BA 4JQ0D 4FWVA 2XLEA 3AJMA 4D4XA 1MMDA 3I5PA 2VCAA 4GYTA 3L74J 3JSVC 3M79A 3E1RA 4OWFA 3KH2A 1IZNB 1EDKA 1NTZK 3MBGA 4CS9A 1SQPD 2L6GA 2QE9A 5KLIC 1G4WR 3K33A 1N7SD 1YTZT 1ORJA 1KILC 1S1CX 3EGXA 2I1JA 4OIQF 3UGPA 4NCQA 2WZ7A 4H0LC 5AVWB 3VMAA 3EQLF 4U5CE 5JRAA 4CX9A 2KSEA 1USEA 2RN0A 4Q4ZF 1NSGB 2HV6A 1EI7A 2IZ0A 1MZ9A 1BGYJ 4RO0A 3SFDC 2YWAA 3CCUP 3SXYA 4HJGH 2YO3A 1KB9E 2LD6A 2ZPAA 4W8KA 2OARA 4YK5A 4PFPA 1L0LK 3RK3E 4OH8B 1S9KE 1M1JB 4MTGA 3IR9A 2FYUJ 2YRFA 2YLIA 1WT6A 2XLMA 3GW6A 1M2VA 2ASRA 2L81A 5C39A 2XLHA 4HH2A 1A7DA 1WATA 3WU2E 1PP9E 3FX0A 4Q5SF 2QEXP 1I4YA 1GL2A 4N78E 1PIXA 1VF5D 1LWUA 5AVXB 3CCVP 4HFKB 3UNGC 2YMYA 1HMDA 3VAYA 2KI7B 4CIPA 4BJ5A 2YZSA 1JY2N 1DEBA 1BDDA 2XM0A 2OJED 4JRZA 5AVSB 2PNOA 3GHGB 2C9NY 2KQ9A 2XLDA 4HYTB 3NYLA 3CCLP 2G3AA 1A02F 3GODA 2K88A 3TDKA 1AV1A 3L4FA 1ZHZA 2A06E 5AW4B 5APSA 1IK9A 2IBZG 4OVNF 4BJTA 2C9LY 3GEHA 4N4WA 1SQVK 1D0YA 4CDYA 2IDBA 2BE5F 2B0JA 1SVFA 3QW0A 3EH2A 3LJBA 1K8AQ 2PFXA 3MUDA 3CX5I 1PFIA 2D2CC 1XZQA 1J2JB 2QE7H 1Q0DA 5HV9A 1KC8Q 1W2WA 3NMJA 2KS1B 3TULA 3V2PA 1JB0J 1SQBJ 2IXOA 2E74B 1K9MQ 3X2QC 3D6ZA 2PGDA 1KQFB 1L0NG 2E87A 1C17M 2H88C 3V6IA 1LT1A 3G71P 4RJTA 2R05A 2PAJA 3FOOA 4YXDC 2VRSA 4XQ1A 1SQXD 1RE4C 4NTAA 2KK7A 1DX7A 2QJPC 1HUCA 3OWTA 2K9JB 4ZKPA 1JNMA 2L9JA 3DAFA 2RSEB 4BXLA 3LNMB 3E1IA 1CW5A 2QJKB 2W6JH 5AW9B 4TT3H 1TWHA 1YTZI 2EINC 4OIRF 4XEKA 1VQOP 1F1MA 4WB4A 1E83A 2BCCJ 2A68F 1R5SA 3B8EB 2DYSC 4M63A 3B29A 4MVOA 5DJUB 3LLIA 1MNDA 3H1KE 2XLVA 3BCCE 2FKWB 1NZEA 4RKUJ 5CCGC 4WABA 4WY4D 4JCZA 1RHZB 5GPGB 1KILE 3SEOA 2Q6QA 1FMWA 2NG1A 1VQ7P 3U8VA 2XLOA 2JX0A 1NHLA 2Y9YA 2H7VC 3DI5A 3RQEA 3HLZA 4I3MA 2YKZA 4JKVA 5KKZB 2ZXRA 4HKZH 1EKYA 2DI3A 1DD3A 4C3BA 1ORSC 3A0HE 3L72G 4EUKB 2ZYDA 1BE3E 2Y39A 3OW2O 2XS1A 1Z63A 1OR2A 3KQGA 3N0TA 3QZCA 3JRTA 3V7OA 2JEEA 1NTZJ 1TFOB 1FTSA 2Q3TA 2KZIA 1TWGA 3G9RA 1FE6A 2J46A 3ITKA 3JCUQ 3CI9A 1M57C 5CJ4A 2P2UA 1YBKA 1JOCA 5JVEA 2MKVA 2Q3IA 2ZT9C 5B66H 5KYXA 3SXKA 1Y8AA 3EH1A 4DOJA 3OEOA 1G1IA 2YIUC 3V4QA 2E5YA 1D7MA 1UIIA 4W80A 1LWUB 2IXMA 4U5DE 3ZSUA 3V2RA 1RCPA 5DS4A 2IX7C 3VN0A 3EPVA 2R44A 3L36A 4YPCA 1Z56A 1JOGA 2YKQA 4PJLA 2QY9A 4Z9JA 4H13B 5CI9A 2DGJA 5COFA 3D6YA 1L0LJ 1BDJB 3WAQA 1LTTC 4CS8C 5COGA 1KILA 4AUWA 1X9VA 3NTNA 3FWLA 2W90A 4CJGA 2IBZI 3PHF2 3TQOA 1OIPA 3H1LD 5AVYB 3CCQP 2P67A 4E7ZA 5L0IA 3N4XA 5DVWA 3WUTA 1KYOE 1M90Q 5B3SC 3TYYA 1OQCA 3H32B 3D71A 2PP4A 3WUVA 4O9BA 2WVOA 3HTKA 1RJ9A 5AVQB 1KN7A 1QLEC 4D6TJ 3GF3A 3L74D 1BDCA 1EC5A 1FZFA 4A4AA 1HTLC 4JTCB 4MTOA 3RVYA 2IFMA 3L73J 1GTWA 1CGOA 3MX3A 4DCKA 2ZJSE 1MMNA 4A2NB 1Z3IX 2Z15A 4DRIB 1OWAA 2X51A 3DKAA 3W8HA 5JP7A 3SYNA 1J1DC 3RW0A 1RH5B 1YYCA 5B5EH 3RL0D 3DE8A 3QH9A 2O3JA 4ZLCA 1RE3C 4WGYA 2JO1A 1E2XA 4DBQA 3CPWO 1ZR4A 3DJNB 1SQVJ 2Y9ZA 5JLIA 1NYHA 3L37A 3H1JE 3R4YA 3O55A 1PP9G 4IARA 4W8PA 1BGYD 2E76B 5APXA 5GTHE 2JWDA 4OINF 1QSPA 3AEDC 3JT1A 2RD9A 1U7MA 3T9OA 1MMGA 5T3TA 4CDAA 3A11A 3CXHD 1H0TA 1RY3A 2N1TB 3EFFK 4OIPF 2YEVA 3O6XA 3POVA 2WZFA 3I5CA 1ZHYA 4RDAA 2FYUD 4HB1A 3Q5SA 1OVRA 2WVQA 1YZAA 1E5WA 4MVRA 1ST6A 4W7ZA 2J9VA 2OYOA 2Q1KA 1UG7A 2CPSA 2KNHA 3C63A 4U3FJ 2QJYC 1L0NK 2YXQB 4N06A 4I7ZC 2VCBA 3SSUA 3L75J 2Q4FA 4NTBA 1OZHA 1PL5A 5E79E 2P6VA 1WGWA 2HFED 4PD4I 2CNWD 1TU3F 4XE5B 3FMSA 3IHUA 4FX5A 5F28E 2W4BA 4NPEA 5AW5B 4PR9A 1XWJA 4IFMA 5KJ7D 5KYXB 1SFCC 1FOSE 1RE4A 3CXHH 5AVUB 3ECSA 4CS7A 4PD4H 4I44A 3W2WA 1AVOA 3BRVB 4JCHA 1ZHWA 3ZVRA 4AYCA 3R7CA 3S9OA 5KAFH 3VMXA 1JCDA 1FZBA 3HD7D 3B9QA 1G5ZA 4CJOA 1S3JA 1T3UA 3CWBE 2H8AA 3ASNC 3LEOA 1OR3A 2G62A 3O10A 4NC3A 3A0BE 4MS2A 1LJ2A 4PJNA 1ZU4A 2JKVA 5L0CA 2OKUA 5TJ5E 4BWNA 2IBFA 4PV1C 1SQBD 2QUPA 3M0DC 2WSSH 1HWTC 1VMAA 5H2FE 2AXTH 2QNLA 1M7LA 3H1KG 2CK3H 2WZGA 1R8EA 3WODF 3U9MA 4H0LB 3E7KA 2H7HA 2J58A 2YNYA 4MN4C 3I55P 1PV3A 4I1OB 2M4EA 2W83C 2ETSA 4JYBA 3RBXA 1CGNA 1YA9A 1RJ9B 2AU5A 2XS8A 3W2VA 1MNEA 4OD5A 2E75D 4IRUA 3KPEA 2XXAA 3SWFA 2B9BA 2KYHA 2Y0EA 2BCCD 3SNHA 3VOPA 3CQZA 2ICWG 1GM5A 2A0UA 1BE3G 3O8ZA 2AWYA 1BCCE 2YMKA 4CIHA 2PP6A 3DXJF 1URQC 3L73G 2QTVA 3AEAC 1KTMA 1A02J 3TJ6A 1S5LX 1W5CE 4U9DA 1NU1E 2N1TD 3A5TA 4PACA 1XZPA 4JPZB 3EFOA 2BEZF 2P0NA 2ZVOB 1JEKA 1NAFA 2WT7A 1YVIA 1RQVA 3S90A 3L34A 3PTZA 4XPXA 4UB8H 5TISE 4U5FE 1ZP0C 1FU1A 3CL3D 3QVZA 1VQ9P 3RK3C 1H0TB 3DM9B 2Y3HA 4DBRA 3NXSA 1NTZD 1N7LA 3C8GA 4CS8A 3GM1A 1P84E 4XEFA 2Y0DA 4GKGA 2R03A 3P32A 1L4AC 1QVXA 3H2UA 3KZIH 2I15A 4PK4A 5D92A 2V3CC 1H88A 1OMIA 1LE4A 1S5LH 3CMAP 1A41A 2D2CB 1KFNA 3OAKA 2C03A 4IL6E 3GANA 4KT0J 1YYXA 3JYHA 5L3VA 3KPHA 1NU7D 2M64A 3SXZA 3EG9B 1VLTA 4YL1A 2R5DA 3M15A 1VK5A 5L0FA 4XTKA 4H44D 3V5BA 4JC7A 3QW1A 2FFDC 3U2LA 1ZRTE 5F5FA 1JY2O 3SP1A 1L0LD 2KLVA 2O9XA 2Q9IA 4U5BE 3CCEP 2M3BA 2QJPB 4U7JA 1RE3A 3L8JA 1LIHA 4AL1A 3CMEP 3BRTB 3GORA 1YYJA 1OKKA 2OCCC 1L0NJ 4JW1A 5DQTA 3M9QA 2IPPA 2WL8A 3FDQA 2YL0A 4WBAA 2Q5UA 2J7PD 2YL7A 3CSKA 4Y99C 1QPUA 3ATPA 3H1JG 2Y69C 1XTGB 1B68A 4D6TD 4MW8A 3Q7LA 3DMDA 2EPMX 2YL1A 1PGPA 2C0WA 4RBNA 2PBEA 4CPGA 2R7TA 3Q6MA 2OG2A 2W6BA 2UUIA 3ABMC 4YL0A 3SWKA 1SQVD 1YI2P 1T9KA 1PPJG 2WSEJ 4WGZA 3O6QB 2VB6A 4MVQA 1YQ4C 1U57A 1AQTA 2D5RB 1ZN5A 1FZAA 4U5HA 3RK2D 2AVKA 1FDIA 3GG2A 2HKVA 3GEEA 1DEEG 2QIWA 5CIVA 3B0VC 3BVHA 1QL1A 3KL4A 3V2NA 3KKBA 2ZT9B 4R4MA 1SFCA 3H1HJ 5KAIE 1AA0A 3FOPA 3A0HH 3UGOA 1G8XA 3L72J 4JVSA 3EFOB 2XNDH 2ZXXA 2EILC 2YIUB 3JSEO 3L71E 4PFOA 1Q86Q 3P8CD 3HTKC 2J5UA 2WT7B 3MYFA 2XSEA 2NSFA 1GD2E 1O87A 1K40A 2L6FA 3U5SA 2LK4A 3EFGA 3L75D 1EZVE 3NYJA 1ZU5A 3HJCA 5A6AA 2B0HA 5BU5A 2D2CD 3TSIA 2OTLP 2IXNA 5KYYA 3CWBG 2NSGA 5AW0B 2N9BA 4H54A 2YLGA 5E33A 4OGQC 1H9TA 3M0DA 3RYLA 4AK9A 1VQ8P 3C8GB 3JTLO 4EBBA 2D4UA 1Y9BA 3M4BA 1S7ZA 2CGEA 1U7JA 1O5HA 2R7QA 3TD7A 4E7SA 3IQTA 2L7AA 2YKOA 2WPRA 3U2MA 2PX0A 3B5ND 2HFIA 3LLKA 3MLGA 3PHLA 3P8MC 2NRGA 1E86A 1SQQE 1T6IA 3CZ6A 3RQGA 3HNLA 1RMVA 4YWQA 3H1IE 1KYOI 4N6JA 2OTKE 5KYUB 2W4MA 4O6YA 1YJWP 4GIFA 3RF3A 1NFOA 1FAVA 1J1DB 3CLQA 2BCCE 3HE5A 3H65A 4MNDA 2HODB 2XL8A 4KBLA 1URQA 5CCGD 1FOSF 256BA 2ZXWC 3F47A 1KMIZ 1M1KQ 1JM0A 1BCCG 5FZTA 3RBZA 1H89A 1SMYF 3FWNA 2HPCA 3IQ5A 1T3JA 1NU1G 3L70E 1S72P 4PJ0E 4FESA 3HRNA 2XNXA 1OXKA 1M8OB 2NPSB 1T6UA 3USSA 3OA7A 1AVYA 4MTFA 5A6BA 5TJHA 3MYIA 3CX5H 2EPNA 5KLVE 5IY5C 2W8ZA 5JS5A 2WSFH 4CSAA 2Q7CA 2OYHC 4XLPF 5BQGA 4WVZA 3I4UA 1PZQA 1IK7A 1L4AA 5T3WA 4DRJB 3QTHA 1PP9J 1JTHA 1LE2A 2QJYB 3WHNA 4I7ZB 3BEHA 1E79H 1GU4A 5AGFA 3L35A 3UMHA 1IFIA 1LI5A 1LM3B 1ZLLA 1VF5C 1KFMA 3HNJA 1O3UA 2YHSA 4QI2A 1J8MF 2V7QH 2Y3DA 2KXPB 2LR2A 4CBEA 3EGXB 3K7DA 3W67A 1NTME 1J1EC 4AL0A 2WMMA 2FFDA 4J7YA 1V4AA 3NKEA 1T01A 4AX2A 2A1DD 1ZHTA 3L8IA 2R25A 2AEFA 1NTKE 3H1HG 3TGUE 1YJNP 2BASA 4X0RA 2IOQA 1KU2A 4U5GA 2R7OA 3UMKA 1GW4A 1BR1A 4L74A 5L0DA 5KYYB 2X0CA 3VM6A 4I2LC 3PP5A 4PV1B 2UUHA 2YQYA 1N8RQ 1PGOA 1M2VB 4NPFX 2DB4A 3T6BA 3WG7C 1T5OA 3QMKA 3L0IA 2IXPA 1GL2B 5CBOA 1GQAA 3AECC 1OCZC 1VYIA 2WB7A 2BC5A 3A0BH 1RXQA 4BG0A 2WQYC 2QVAA 3W68A 1X0TA 4EOTA 1DOVA 3VF0A 3IPMO 2JR8A 1NO4A 4L76A 1A0BA 2C04A 2M5AA 3AE4C 1L0ND 1H6GA 1Z23A 3EWKA 2OU6A 2ZXPA 2FGYA 3MHVA 1W2EA 1FZGA 4I1LA 2LQGA 3H1KJ 3IQ6A 2E74D 3JC22 2NPSD 1SQPE 2ZYAA 3HE5B 1ZW0A 1URQB 4WY4C 2WPVB 2HJMA 4DOZA 3BATA 2GUSA 4XPYA 3LS1A 3C1LA 3TK0A 1T2KC 4BEMJ 3MGNA 3M9HA 3OJAB 1QEXA 4NQFA 4TLFA 3W4YA 2HPCB 1I4ZA 1Q82Q 2PFDA 3ZIBA 1U6HA 3KXDA 2XDJA 5DJTB 5CCHA 1RF0C 3G4SP 1C02A 2KNCA 5APTA 5KYWA 2KGOA 1BE3J 2P7VA 2HV7A 1S2EA 5B1BC 3L71G 4BJ1A 1CPRA 3GM2A 3RK3B 3QWOC 2R02A 2OGUA 5AW8B 4ZMDA 4P9TA 4CDVA 3FXDA 2WPSA 1Q0GA 2L5GB 1PD0A 2FXMA 1LT9A 1OCCC 1EZVG 2XU6A 1T8ZA 4IL6X 1AJYA 1PD1A 1L4AB 3MZWB 2Q9CA 3M1CB 4E18A 2O01H 3AE7C 1JTHB 3HUSA 2BL2A 2IYPA 3LW5J 3CC4P 3NMIA 4LACB 1P84I 5EFWB 3Q5RA 1BSNA 2H43A 3KDPB 2AXCA 2FYNB 4E0HA 4Z9HA 5GTIH 1OW6A 1YJ9P 3AE2C 3ITFA 1SQQG 3S4RA 4PD4D 1QVGO 1P84H 5AC4A 1VQ4P 1KQSO 3FVYA 4U9EA 1USDA 3U9JA 3H1IG 2V4HA 2E43A 2B87A 1ZHXA 2FFDB 1JY3N 5APWA 1NU1K 2WSEH 4ZKUA 1TR2A 1N7SA 1FNTc 2AEMA 5L0JA 5AW1B 4P9FA 1VQKP 3V5XA 1EXJA 2FBWC 2A06G 5JT4A 1N73A 2WSCJ 3I56P 2FY8A 1RKEA 3EZHA 3GM3A 1HY5A 2XV5A 1GL2D 1Q0FA 3EJNA 1M2OA 3DAGA 4G7ZF 2PRRA 4HEAJ 4ASVA 1NG1A 1QL2A 2XKMA 1GS9A 1M56D 3L70G 4N3YB 1A7VA 4RD9A 2QJKC 4H13D 2QLAA 2HR3A 3H6PA 1LTSC 2J45A 2OYHA 4G7OF 3PJSK 5AVZB 1KNYA 1SQXE 3B71A 5KLVG 1NFNA 2Y0CA 3MP7B 3VTPC 5F5HA 3RL0C 1CI6A 3A9CA 2WSFJ 1Q81Q 1Q90D 3HNIA 1VL2A 1U0BB 4L75A 1QX8A 3H1JJ 3RL0g 1Q2NA 4ER9A 3V5YA 3TNUA 2M5AB 4KNVA 3SZRA 2ZVNB 2O1JA 4LLEA 3BRJA 4A7PA 1LS1A 3CCMP 4NPDA 5KLIB 1HF9A 1MQVA 3S1KA 3LNRA 1RF1C 1NKNA 5B66E 2OYIA 2YLDA 4IAOA 1DH3A 1KILB 5EGYA 5APVA 3DD7A 3Q5PA 2RH0A 4GDOA 3BCCG 4OIOF 1S9KD 3KHUA 5BQHA 1BR4A 3RH3A 2JP3A 2V7QJ 2Q9AA 3U1AA 3FXEA 1ZZPA 3JSZA 1JMWA 3TJ5A 1NTMG 3LESA 1MMAA 4XFJA 4DJ9A 4P6IC 3GWNA 4K35A 4KNWA 4G78A 1FR0A 3HTKB 1GW3A 1PP9D 1FJKA 3UIAA 5KYWB 4MVSA 2HSBA 1WN0A 3S27A 3AE1C 4K3AA 3TOMA 5AC5A 1NTKG 4N78D 4YXWH 1LS4A 1D0XA 2XLWA 2E76D 3TGUG 1JUNA 3NMDA 5CI8A 3RFYA 1KB9I 4UB6E 2M0BA 3ZTZA 3H2VA 3JRMO 1AFOA 2HJ3A 1NU9C 1EZVI 3II6A 2KIKA 2VC9A 5AW6B 1JMMA 3A7OA 5L0GA 3R2PA 3V2QA 1KB9H 1K73Q 3AEEC 4E17A 1OFCX 2IFNA 2J0XA 1CSBA 1MFZA 1IFPA 1R5LA 3AE5C 1VQ6P 3VMZA 3KYQA 1DIPA 5AVVB 2L6HA 2A45G 3CWBJ 3HD7C 1AUEA 2AEJA 1LVKA 1VQMP 3F5HA 4YTPC 2MYSA 2Y3BA 3AQBA 1L0NE 3WU2H 5B5EE 2IZ1A 1VB5A 1TQGA 4CSAC 3LIDA 1ZW3A 2W6AA 4LGDE 5AVRB 2LP4A 2KJGA 3GWLA 3NG1A 2R7VA 2KZJA 3AOUA 2QA4P 3HNKA 2FXOA 4WY4A 2P61A 1Y47A 4L6RA 3HKKA 4IFDK 1HE9A 2VH3A 1SQPG 3M0AA 5B3IA 1KZUB 4LLHA 3H1LE 1WASA 2J9UA 3JCUE 1IZMA 5DLJA 1OXZA 4XEVA 2WVNA 3SFEC 1RKEB 1LNQA 4IOIH 1FS0E 1RF0A 4AQRD 5JSLA 4GOEA 1UIXA 5HSWA 1TWAA 3GMAA 4JZAA 2J59M 4IB4A 3GF7A 1ZVZA 3LUTB 3L74E 1NOHA 1X8YA 4JBZA 1SF8A 2E75C 2CYDA 1BR2A 4RESB 1G2CA 2FXPA 1BCCJ 3EQ2A 3H1KD 2K9YA 3IN6A 3SWYA 2F22A 4LDQA 2OYHB 3S0XA 1GU5A 3AEBC 2KOGA 1AVOB 1KILD 1NU1J 1CI6B 1YITP 4WWIA 4GQHA 3G6EP 1SQQK 4JEAA 2N1TC 4H0LD 5EHHA 1ZR2A 2E42A 2EIKC 1GMJA 1E84A 1T6AA 3K6BA 3T6JA 3B0UX 3CEXA 2O01J 1M6TA 4JEBA 1VF5B 1VPCA 2POHA 3DE9A 1BGYE 1APCA 3E9VA 3DZAA 2FAPB 3IF4A 2M3EA 3KMIA 4JYCA 1WOLA 1D0ZA 5D91A 1BE3D 5KYNA 1Y4CA 3CXHE 3L73D 2J9WA 5DQZA 2B89A 4PD4E 1L3PA 4C7RA 1J1EB 1KORA 5KAFE 5CBNA 2A6HF 2KS1A 3U1CA 1YIJP 2DYRC 1K04A 1CGME 2FYUE 1YHQP 1AEPA 1JPNA 4QDLA 2P1AA 5BU8B 1LKXA 1FMVA 2GA0A 4J30B 4YT2A 1FZCC 2NPUA 3GEIA 3O39A 3ZWIA 2XXAB 1TFKB 3NKDA 2K9JA 4ANJA 2AXTE 4IJJA 1DD4A 5KLVK 3MTUE 1QKRA 2Q00A 1LTGC 3CCSP 3NMKA 3VP8A 3EZIA 2V26A 1WTYA 4KI2A 1ZW2A 1X22A 1GGQA 4JJGA 4H44C 3RIPA 4GOFA 1LTJC 2RMZA 1U89A 1FC2C 1OCOC 3IQCA 5CCHC 5APUA 4DT0A 4U3FD 1SQXG 4MVZA 2A45I 1PGQA 1HJBA 2W9YA 4DVZA 1KYOD 2W45A 2H7BA 3N24A 1X79B 2IYLD 3LIEA 1G1JA 1VQLP 1NWQA 1IC2A 4R4LA 1Y6DA 2R3CA 1DOWA 1JY3P 3LW5H 1I5NA 1LT9C 4EKWA 2QM7A 1RF1A 2A45H 1NTMK 1SQBE 1ZOYC 1KQLA 3H25A 3KYIA 1ZYRF 4WY4B 3K1IA 3WMM0 4K7BA 2QG4A 5K0IA 3HUSC 1WWPA 1MFTA 1VYKA 1IFDA 4LDRA 3HE4A 1JPJA 1NTKK 4AE4A 1OVUA 1NGMB 3CX5D 2QM8A 4UB8E 3ABVC 2GM4A 2NUTA 3G3ZA 5A6KA 4K0DA 1C03A 2H7OA 3AQCA 1WMKA 2G3KA 1FDOA 1SLQA 4LERA 1NKZB 3H1JD 3M06A 3Q7GA 1BBHA 1FAPB 4C7OA 1G2CB 3KZIE 1KYOH 2E5TA 2KSJA 3RK2C 2PX3A 2WSCH 1N7SC 2KP8A 3ZC4A 2CNWA 1EDLA 4JTDB 1EA8A 2HMZA 1S5LE 4EWCA 3PCVA 2MJZA 2J0WA 3AG4C 2XL6A 1SS1A 2R7UA 1N73C 3OA1A 2Q3EA 5KJ7A 1V74B 4EIJA 4YT4A 4IGGA 3PH0A 3L71J 1K05A 1PPJD 5APQA 1SZIA 1ZMEC 1XTCC 2YVKA 3HD7A 2EPLX 3RKOF 3ASOC 2ITAA 5L8RJ 5APYA 4ULWA 5AW3B 1ZV8A 1SQPK 2W27A 3FHDA 1E85A 2Z4EA 2ZAEB 2H8PD 4EIYA 1QVFO 3H32A 1YQ3C 3IEEA 3AG1C 4PJMA 1G4US 3L1MA 3RGUA 3S28A 1NTZE 5T1DB 4IWBA 2Q7RA 2Y3GA 1IFJA 1M57D 5GTHH 1YZCA 1Z7Qc 1LI7A 2ZT9D 4ONSA 5DS5A 1IFMA 2J8WA 2P1JA 3PDMP 1SQQJ 3B5NC 2WVRA 1GK6A 2RKLA 2NZ2A 3WUUA 1CZQA 3H1LG 1R5ID 3H1IJ 4DZOA 4Z1MH 3CWBD 5BQIA 3RVZA 2OYIC 2WZLA 1PGJA 2KLUA 3FAJA 5M1BA 1QZXA 3AGUA 4R32A 1RKCA 4YJWA 4J7TA 4ZNCA 3UR3C 3Q2YA 3NRHA 4EBJA 1SFCB 3D70A 3L74G 2XZRA 5E3AA 3C8GD 1A7EA 1J8YF 1L0LE 3LAYA 1EQ7A 5E79H 3RL0B 3PRJA 1VQNP 1JY3O 2N1TA 1V55C 1TWCA 3UMIA 1T2KD 3CC2P 1HBWA 1L7CA 4B86A 2OJQA 3L70J 2LKMA 1FBMA 1S05A 3G4ZA 3Q6NA 4QI0A 4N6HA 3MD0A 2OEXA 3RQFA 1QLED 2JDIH 3DJUB 2O01N 1RF1B 1W2BO 3V5ZA 4D6TE 5KLVJ 1T6QA 2IBZD 4M3LA 1VTMP 1BGYG 2LFFA 3TK1A 2KK1A 3DM5A 3L73E 2ZXOA 4K1OA 1BCCD 3HE4B 2LXBA 4AE4B 3EGDA 4JIOA 1NH4A 2GFHA 1FJPA 3KYJA 2XM4A 1NU1D 1Q7YQ 4LDKA 4DVYP 2PF4E 1NBBA 3VYWA 2KB7P 2NUTB 1FZCA 2FYUG 1OKKD 4O6MA 3TOLA 1N1CA 5H2FH 1SQVE 2J9BA 3CAXA 1D1AA 4Z9IA 1H8AA 3BCCJ 2WPQA 3IFMA 2R5BA 2YO2A 1SR2A 3C8ZA 2OEVA 4BJ6C 1HVVA 5AVTB 3ZQYA 4C7OB 4JJFA 2JWAA 2O1KA 1OXBA 3JYYA 4EBKA 1LGHB 1VLSA 4L73A 3T6GB 1NTMJ 2QSIA 2KUBA 1SQXK 3K1HA 1M1JC 1LTJA 3AE8C 3VMYA 1EXIA 3CC7P 1P84D 2K1AA 1ORYA 5COMA 1NTKJ 3ZG1A 1VOMA 3LEVA 3C9IA 3QVYA 3T4RA 1GZLA 4ZLDA 3TGUJ 2MWQA 1L2PA 4UB6H 3HD7B 4JE9A 4O6NA 5CHXA 3P8CE 1LP1A 4C46A 4MVUA 4U3FE 3U8PA 2Z5HA 4C7NA 3U0CA 5BVZA 1YARO 2R3SA 3A3YB 4LC1A 3L75E 1GDTA 4BEJA 4EHPA 2J7PA 2H89C 3T97A 2VCCA 5CJ0A 2AWCA 2R9RB 3N7NA 2I8BA 4H4KC 2K37A 1IFNA 3K5BA 3GHGC 1FFTC 2OQQA 2LIGA 1HW2A 2KSFA 1EDIA 1FDMA 1ZRTD 1Q0MA 1SQBG 3H1HD 1SFCD 4YL3A 2P7JA 5DS6A 5TISH 1RQUA 3L72D 1OVVA 1JAFA 2LXCB 2CW0F 4JTAB 3M4CA 1NJIQ 2GDCA 3CX5E 2UWJE 1LPEA 2TMVP 2I1KA 1Q0KA 3VRCA 4U5EE 2G3VA 3AE3C 2E75B 1AQ5A 1WRGA 2JPUA 2G8YA 1YLMA 3C8VA 2YL3A 4Q7CA 3Q1MA 1FFHA 1SQPJ 2LFDA 2JD3A 4NTFA 4YN0B 4PV1D 2QRXA 3JCUH 3M91A 2E74C 2NPSC 1TKNA 2R7WA 2N9YB 2I8DA 4PJJA 1QQ3A 1BSHA 2BCCG 2ZYGA 2A0BA 4IL6H 2OTJP 3TF5A 4J32B 1OX3A 2HZ8A 5A69A 4EDFA 3S84A 3M9BA 1YDIA 2CPBA 2P58A 1FZEA 4W7YA 4Y99B 3U59A 3ABLC 2BEQD 3BASA 1PPJE 2HS5A 2CDQA 3EHMA 1ZXGA 4GODA 2HUJA 3MIWA 1BZ4A 4O7GA 1VQ5P 1OW8A 4CS9C 3MFNA 1URQD 3W8IA 3CXHI 3EGDB 2ZD9A 4BRYA 3EG9A 1SP4A 1NTZG 4MQ9F 1FZCB 1HW1A 3CCRP 3B5NA 1JR8A 1MV8A 2C0XA 1D1CA 1R4TA 2KC3A 4G0HA 1D1BA 3L71D 1H9GA 4XWJA 2WITA 5KKZC 1KB9D 2FFHA 4KC9A 5AW2B 1PCXA 5A6BD 3K1IC 1JY2P 4D4NA 4I1MA 1EZVD 3RK3D 1YAUO 3CD6P 4EYYQ 1MUUA 4DJGA
chains in the Genus database with same CATH topology
2WSEJ 2E76C 5F28E 4H44B 1FDOA 1WOLA 1YQ4C 3AECC 1U57A 1HJ0A 2FYNC 1RQUA 3SFDC 3C18A 3GLMA 2WQYC 2YWAA 4TT3H 1MKMA 1FDIA 1EXJA 2FBWC 4XEKA 3C8GA 1KORA 3Q3DA 3GM1A 4XEFA 2QIWA 2WSCJ 3AEEC 3RQFA 3GM3A 3AE4C 3RK3E 1K04A 3S9OA 3D71A 1QVXA 3EWKA 1KQGB 3AE5C 1DIPA 3AEGC 2ZT9B 3GF3A 4RKUJ 3AE3C 2E75B 4R4MA 1OMIA 2E74D 2JPUA 2G8YA 2L6HA 3C8VA 2KK1A 3Q1MA 1KILE 3O10A 4PV1D 3T97B 4OGQB 2QJKC 4YTPC 1IK7A 2E74C 2D2CB 2WPVB 3JZ0A 4H13D 1K05A 2JX0A 2J5UA 4PV1C 4Y28J 1ZMEC 3O6QA 4KT0J 1DD4A 1K40A 3RQEA 4I7ZB 4H13C 1PIXA 4NQFA 1VF5D 5L8RJ 3AE6C 2L6FA 1KNYA 2LK4A 3B71A 2Q00A 2JO1A 4H44D 4OGQD 3AE9C 2D2CD 1WTYA 1VF5C 1R8EA 3FGAD 1DD3A 2WSFJ 1ZRTE 1O3UA 4H0LB 1NYHA 1Q90D 4OGQC 1VL2A 3R4YA 4H44C 2BEQD 1YQ3C 3RL0g 3C8GB 1PV3A 1Y9BA 4XEVA 3SFEC 4U7JA 3JYYA 2E76B 1OW7A 3L8JA 4EBKA 3K7DA 2G3AA 3GM2A 3AEDC 2QSIA 3BRJA 1UIXA 1HF9A 2P10A 3G9RA 2ZT9D 3AJMA 1V4AA 2E75D 3GMAA 1OW8A 3AE8C 3GF7A 4IL6X 1EXIA 3L8IA 1AJYA 3RQGA 1UFBA 2MKVA 2IDBA 3MFNA 2ZT9C 3Q5PA 4GDOA 2E75C 2NZ2A 3AEFC 3AE7C 3Q5SA 2JP3A 3LW5J 2V7QJ 2YMKA 4R4LA 2FXPA 3IN6A 2K9YA 2YIUC 1ZZPA 4Z1MH 2D2CC 3AEAC 1KTMA 3TULA 3Q5RA 1ZOYC 3AEBC 1S5LX 3H25A 1JB0J 2L6GA 4XFJA 5M1BA 2QJYC 2E74B 5KLIC 3U0CA 3D6ZA 1KQFB 4R32A 4I7ZC 1JOGA 1OW6A 2H88C 3AE2C 4PV1B 1WWPA 3Q2YA 1S1CX 4H0LD 2BEZF 2H89C 2HSBA 4EBJA 2PBEA 5KKZC 3D70A 3AE1C 1PL5A 4H13B 4YXDC 3C8GD 1GMJA 1NGMB 3U3FA 1KMIZ 4H0LC 3D6YA 1RQVA 2E76D 2O01J 3ABVC 3IAOA 1VF5B 1TU3F 2OQQA 2QJPC 1ZP0C 1WMKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5F28 E;  1WOL A;  1YQ4 C;  3AEC C;  3SFD C;  3C18 A;  2WQY C;  2YWA A;  2FBW C;  4XEK A;  3C8G A;  3GM1 A;  4XEF A;  3RQF A;  3AEE C;  3GM3 A;  3AE4 C;  1K04 A;  3S9O A;  1QVX A;  3AE5 C;  3AEG C;  3AE3 C;  2L6H A;  2JPU A;  2KK1 A;  3O10 A;  4YTP C;  3JZ0 A;  1K05 A;  2JX0 A;  3RQE A;  1K40 A;  4NQF A;  3AE6 C;  2L6F A;  1KNY A;  2LK4 A;  3B71 A;  2Q00 A;  3AE9 C;  1WTY A;  1O3U A;  1YQ3 C;  3C8G B;  1PV3 A;  4XEV A;  3SFE C;  3JYY A;  1OW7 A;  3L8J A;  4EBK A;  3K7D A;  2G3A A;  3GM2 A;  3AED C;  3BRJ A;  3AJM A;  1V4A A;  1OW8 A;  3AE8 C;  3L8I A;  3RQG A;  1UFB A;  3MFN A;  3AEF C;  3AE7 C;  1ZZP A;  3AEA C;  1KTM A;  3TUL A;  1ZOY C;  3AEB C;  2L6G A;  3U0C A;  4R32 A;  1JOG A;  1OW6 A;  2H88 C;  3AE2 C;  1WWP A;  2HSB A;  2H89 C;  4EBJ A;  2PBE A;  3AE1 C;  4YXD C;  3C8G D;  3U3F A;  3ABV C;  1ZP0 C; 
#chains in the Genus database with same CATH topology
 2JJL A;  5CMZ A;  4H44 B;  1QGK B;  3CCJ P;  1LTJ B;  1V54 C;  4G7H F;  5L0H A;  2HYN A;  3AG2 C;  4DXW A;  2NUP A;  2GUV A;  5CCG A;  4MVM A;  2HLO A;  1MKM A;  2EPK X;  1L4A D;  5A6J A;  3P7K A;  4WJ0 A;  2KNC B;  2OQM A;  1JCC A;  2GWW A;  3K66 A;  2SPZ A;  1L0L G;  2R7S A;  1LP1 B;  1IJD B;  3VYI A;  4IAQ A;  1SQQ D;  4DRH B;  5BUO A;  3AEG C;  4C7N B;  4YT5 A;  2CCY A;  1GL2 C;  2Z5I A;  2KW3 C;  5KTB A;  4LLC A;  4QMA A;  1LWU C;  2MHR A;  5K5G B;  5KAI H;  3H1I D;  3T97 B;  4OGQ B;  1LT9 B;  3JZ0 A;  4BJ5 C;  2GA1 A;  2DW3 A;  1M56 C;  4Y28 J;  1N2D C;  1CPQ A;  1H7I A;  3C7J A;  1JO5 A;  1Z6A A;  3O6Q A;  1SYQ A;  4H13 C;  2KYV A;  3HUS B;  2FYU K;  2ZXE B;  2IBZ E;  3AE6 C;  3ZDM A;  5KJ7 C;  1SQX J;  5JUA A;  4D6T G;  1LTI C;  2A06 D;  3VP9 A;  1Z5Z A;  1N86 A;  3SXM A;  3A2A A;  3FGA D;  4B6I A;  4GT1 A;  3US6 A;  1GK4 A;  3J06 A;  4HE8 D;  3AGT A;  4C3D A;  1HMO A;  2XRH A;  2LSE A;  1EDJ A;  4XA4 A;  3NFQ A;  4IFF A;  1KV4 A;  4FAP B;  3N2Z B;  3L70 D;  1HH0 A;  3EHN A;  2P10 A;  2B87 B;  3MUD C;  3FXH A;  4BJ6 A;  4JF7 A;  1SQV G;  3RK2 B;  1UFB A;  2IM8 A;  3ZTM A;  1N7S B;  3AEF C;  3ZDL A;  2L91 A;  2M8R A;  5KLV D;  2R7R A;  3F46 A;  2A69 F;  4XLN F;  2EIM C;  1M1J A;  2HSQ A;  1N73 B;  1EQ1 A;  4N6C A;  5AW7 B;  2R32 A;  5GTI E;  3AG3 C;  1LTB C;  4E0I A;  4O79 A;  3F89 A;  5E2Q A;  2Q9B A;  3NYM A;  2HG5 D;  1HGZ A;  1HGV A;  3DWW A;  4UDV A;  5E3C A;  4KHX A;  2ZFC A;  2IYO A;  3U3F A;  4BPM A;  3PMR A;  1NLX A;  2R7X A;  5B1A C;  5FCL A;  3IAO A;  4GEH A;  1SQB K;  2WWW A;  2E76 C;  2GAQ A;  3BCC D;  1JMB A;  4U3F G;  2K3R A;  1IW7 F;  3ABK C;  1HJ0 A;  2FYN C;  1LTA C;  3C18 A;  3GLM A;  4PJ0 H;  3L75 G;  3LS0 A;  5KYU A;  1YJG A;  2EIJ C;  1NTM D;  3GHG A;  4BRY B;  4OD4 A;  3Q3D A;  4XPW A;  2HMQ A;  1KQG B;  1NAY A;  3TNU B;  4EI2 A;  4I6M C;  4KJM A;  3B5N B;  2HOD A;  1S4X A;  4MW3 A;  3H1H E;  3PLN A;  4C3E A;  2B88 A;  1VQP P;  3B0P A;  1NTK D;  1KD1 Q;  3L72 E;  5CCH D;  1NVO A;  3G4X A;  3TGU D;  3FAP B;  4HFF B;  2OYI B;  1VDF A;  2FYZ A;  1IO4 A;  4ULV A;  2AP3 A;  2LCH A;  2XL4 A;  3V4W A;  4ASW A;  5L3Q A;  3ZQV A;  4OGQ D;  3E70 C;  2NPS A;  3AE9 C;  2VAS A;  2YXR B;  4JUR I;  3G50 A;  2NUP B;  3C62 A;  4YT8 A;  1OCR C;  1YA7 O;  3B4S A;  3H1L J;  2WTY A;  3S29 A;  2A6E F;  5EK0 A;  3NDB B;  4NY3 A;  3I5Q A;  1OW7 A;  2EPO A;  1HE1 A;  2OOC A;  3X1O A;  3U3B A;  2YKP A;  1JRA A;  4F4B A;  4JQ0 D;  4FWV A;  2XLE A;  3AJM A;  4D4X A;  1MMD A;  3I5P A;  2VCA A;  4GYT A;  3L74 J;  3JSV C;  3M79 A;  3E1R A;  4OWF A;  3KH2 A;  1IZN B;  1EDK A;  1NTZ K;  3MBG A;  4CS9 A;  1SQP D;  2L6G A;  2QE9 A;  5KLI C;  1G4W R;  3K33 A;  1N7S D;  1YTZ T;  1ORJ A;  1KIL C;  1S1C X;  3EGX A;  2I1J A;  4OIQ F;  3UGP A;  4NCQ A;  2WZ7 A;  4H0L C;  5AVW B;  3VMA A;  3EQL F;  4U5C E;  5JRA A;  4CX9 A;  2KSE A;  1USE A;  2RN0 A;  4Q4Z F;  1NSG B;  2HV6 A;  1EI7 A;  2IZ0 A;  1MZ9 A;  1BGY J;  4RO0 A;  3SFD C;  2YWA A;  3CCU P;  3SXY A;  4HJG H;  2YO3 A;  1KB9 E;  2LD6 A;  2ZPA A;  4W8K A;  2OAR A;  4YK5 A;  4PFP A;  1L0L K;  3RK3 E;  4OH8 B;  1S9K E;  1M1J B;  4MTG A;  3IR9 A;  2FYU J;  2YRF A;  2YLI A;  1WT6 A;  2XLM A;  3GW6 A;  1M2V A;  2ASR A;  2L81 A;  5C39 A;  2XLH A;  4HH2 A;  1A7D A;  1WAT A;  3WU2 E;  1PP9 E;  3FX0 A;  4Q5S F;  2QEX P;  1I4Y A;  1GL2 A;  4N78 E;  1PIX A;  1VF5 D;  1LWU A;  5AVX B;  3CCV P;  4HFK B;  3UNG C;  2YMY A;  1HMD A;  3VAY A;  2KI7 B;  4CIP A;  4BJ5 A;  2YZS A;  1JY2 N;  1DEB A;  1BDD A;  2XM0 A;  2OJE D;  4JRZ A;  5AVS B;  2PNO A;  3GHG B;  2C9N Y;  2KQ9 A;  2XLD A;  4HYT B;  3NYL A;  3CCL P;  2G3A A;  1A02 F;  3GOD A;  2K88 A;  3TDK A;  1AV1 A;  3L4F A;  1ZHZ A;  2A06 E;  5AW4 B;  5APS A;  1IK9 A;  2IBZ G;  4OVN F;  4BJT A;  2C9L Y;  3GEH A;  4N4W A;  1SQV K;  1D0Y A;  4CDY A;  2IDB A;  2BE5 F;  2B0J A;  1SVF A;  3QW0 A;  3EH2 A;  3LJB A;  1K8A Q;  2PFX A;  3MUD A;  3CX5 I;  1PFI A;  2D2C C;  1XZQ A;  1J2J B;  2QE7 H;  1Q0D A;  5HV9 A;  1KC8 Q;  1W2W A;  3NMJ A;  2KS1 B;  3TUL A;  3V2P A;  1JB0 J;  1SQB J;  2IXO A;  2E74 B;  1K9M Q;  3X2Q C;  3D6Z A;  2PGD A;  1KQF B;  1L0N G;  2E87 A;  1C17 M;  2H88 C;  3V6I A;  1LT1 A;  3G71 P;  4RJT A;  2R05 A;  2PAJ A;  3FOO A;  4YXD C;  2VRS A;  4XQ1 A;  1SQX D;  1RE4 C;  4NTA A;  2KK7 A;  1DX7 A;  2QJP C;  1HUC A;  3OWT A;  2K9J B;  4ZKP A;  1JNM A;  2L9J A;  3DAF A;  2RSE B;  4BXL A;  3LNM B;  3E1I A;  1CW5 A;  2QJK B;  2W6J H;  5AW9 B;  4TT3 H;  1TWH A;  1YTZ I;  2EIN C;  4OIR F;  4XEK A;  1VQO P;  1F1M A;  4WB4 A;  1E83 A;  2BCC J;  2A68 F;  1R5S A;  3B8E B;  2DYS C;  4M63 A;  3B29 A;  4MVO A;  5DJU B;  3LLI A;  1MND A;  3H1K E;  2XLV A;  3BCC E;  2FKW B;  1NZE A;  4RKU J;  5CCG C;  4WAB A;  4WY4 D;  4JCZ A;  1RHZ B;  5GPG B;  1KIL E;  3SEO A;  2Q6Q A;  1FMW A;  2NG1 A;  1VQ7 P;  3U8V A;  2XLO A;  2JX0 A;  1NHL A;  2Y9Y A;  2H7V C;  3DI5 A;  3RQE A;  3HLZ A;  4I3M A;  2YKZ A;  4JKV A;  5KKZ B;  2ZXR A;  4HKZ H;  1EKY A;  2DI3 A;  1DD3 A;  4C3B A;  1ORS C;  3A0H E;  3L72 G;  4EUK B;  2ZYD A;  1BE3 E;  2Y39 A;  3OW2 O;  2XS1 A;  1Z63 A;  1OR2 A;  3KQG A;  3N0T A;  3QZC A;  3JRT A;  3V7O A;  2JEE A;  1NTZ J;  1TFO B;  1FTS A;  2Q3T A;  2KZI A;  1TWG A;  3G9R A;  1FE6 A;  2J46 A;  3ITK A;  3JCU Q;  3CI9 A;  1M57 C;  5CJ4 A;  2P2U A;  1YBK A;  1JOC A;  5JVE A;  2MKV A;  2Q3I A;  2ZT9 C;  5B66 H;  5KYX A;  3SXK A;  1Y8A A;  3EH1 A;  4DOJ A;  3OEO A;  1G1I A;  2YIU C;  3V4Q A;  2E5Y A;  1D7M A;  1UII A;  4W80 A;  1LWU B;  2IXM A;  4U5D E;  3ZSU A;  3V2R A;  1RCP A;  5DS4 A;  2IX7 C;  3VN0 A;  3EPV A;  2R44 A;  3L36 A;  4YPC A;  1Z56 A;  1JOG A;  2YKQ A;  4PJL A;  2QY9 A;  4Z9J A;  4H13 B;  5CI9 A;  2DGJ A;  5COF A;  3D6Y A;  1L0L J;  1BDJ B;  3WAQ A;  1LTT C;  4CS8 C;  5COG A;  1KIL A;  4AUW A;  1X9V A;  3NTN A;  3FWL A;  2W90 A;  4CJG A;  2IBZ I;  3PHF 2;  3TQO A;  1OIP A;  3H1L D;  5AVY B;  3CCQ P;  2P67 A;  4E7Z A;  5L0I A;  3N4X A;  5DVW A;  3WUT A;  1KYO E;  1M90 Q;  5B3S C;  3TYY A;  1OQC A;  3H32 B;  3D71 A;  2PP4 A;  3WUV A;  4O9B A;  2WVO A;  3HTK A;  1RJ9 A;  5AVQ B;  1KN7 A;  1QLE C;  4D6T J;  3GF3 A;  3L74 D;  1BDC A;  1EC5 A;  1FZF A;  4A4A A;  1HTL C;  4JTC B;  4MTO A;  3RVY A;  2IFM A;  3L73 J;  1GTW A;  1CGO A;  3MX3 A;  4DCK A;  2ZJS E;  1MMN A;  4A2N B;  1Z3I X;  2Z15 A;  4DRI B;  1OWA A;  2X51 A;  3DKA A;  3W8H A;  5JP7 A;  3SYN A;  1J1D C;  3RW0 A;  1RH5 B;  1YYC A;  5B5E H;  3RL0 D;  3DE8 A;  3QH9 A;  2O3J A;  4ZLC A;  1RE3 C;  4WGY A;  2JO1 A;  1E2X A;  4DBQ A;  3CPW O;  1ZR4 A;  3DJN B;  1SQV J;  2Y9Z A;  5JLI A;  1NYH A;  3L37 A;  3H1J E;  3R4Y A;  3O55 A;  1PP9 G;  4IAR A;  4W8P A;  1BGY D;  2E76 B;  5APX A;  5GTH E;  2JWD A;  4OIN F;  1QSP A;  3AED C;  3JT1 A;  2RD9 A;  1U7M A;  3T9O A;  1MMG A;  5T3T A;  4CDA A;  3A11 A;  3CXH D;  1H0T A;  1RY3 A;  2N1T B;  3EFF K;  4OIP F;  2YEV A;  3O6X A;  3POV A;  2WZF A;  3I5C A;  1ZHY A;  4RDA A;  2FYU D;  4HB1 A;  3Q5S A;  1OVR A;  2WVQ A;  1YZA A;  1E5W A;  4MVR A;  1ST6 A;  4W7Z A;  2J9V A;  2OYO A;  2Q1K A;  1UG7 A;  2CPS A;  2KNH A;  3C63 A;  4U3F J;  2QJY C;  1L0N K;  2YXQ B;  4N06 A;  4I7Z C;  2VCB A;  3SSU A;  3L75 J;  2Q4F A;  4NTB A;  1OZH A;  1PL5 A;  5E79 E;  2P6V A;  1WGW A;  2HFE D;  4PD4 I;  2CNW D;  1TU3 F;  4XE5 B;  3FMS A;  3IHU A;  4FX5 A;  5F28 E;  2W4B A;  4NPE A;  5AW5 B;  4PR9 A;  1XWJ A;  4IFM A;  5KJ7 D;  5KYX B;  1SFC C;  1FOS E;  1RE4 A;  3CXH H;  5AVU B;  3ECS A;  4CS7 A;  4PD4 H;  4I44 A;  3W2W A;  1AVO A;  3BRV B;  4JCH A;  1ZHW A;  3ZVR A;  4AYC A;  3R7C A;  3S9O A;  5KAF H;  3VMX A;  1JCD A;  1FZB A;  3HD7 D;  3B9Q A;  1G5Z A;  4CJO A;  1S3J A;  1T3U A;  3CWB E;  2H8A A;  3ASN C;  3LEO A;  1OR3 A;  2G62 A;  3O10 A;  4NC3 A;  3A0B E;  4MS2 A;  1LJ2 A;  4PJN A;  1ZU4 A;  2JKV A;  5L0C A;  2OKU A;  5TJ5 E;  4BWN A;  2IBF A;  4PV1 C;  1SQB D;  2QUP A;  3M0D C;  2WSS H;  1HWT C;  1VMA A;  5H2F E;  2AXT H;  2QNL A;  1M7L A;  3H1K G;  2CK3 H;  2WZG A;  1R8E A;  3WOD F;  3U9M A;  4H0L B;  3E7K A;  2H7H A;  2J58 A;  2YNY A;  4MN4 C;  3I55 P;  1PV3 A;  4I1O B;  2M4E A;  2W83 C;  2ETS A;  4JYB A;  3RBX A;  1CGN A;  1YA9 A;  1RJ9 B;  2AU5 A;  2XS8 A;  3W2V A;  1MNE A;  4OD5 A;  2E75 D;  4IRU A;  3KPE A;  2XXA A;  3SWF A;  2B9B A;  2KYH A;  2Y0E A;  2BCC D;  3SNH A;  3VOP A;  3CQZ A;  2ICW G;  1GM5 A;  2A0U A;  1BE3 G;  3O8Z A;  2AWY A;  1BCC E;  2YMK A;  4CIH A;  2PP6 A;  3DXJ F;  1URQ C;  3L73 G;  2QTV A;  3AEA C;  1KTM A;  1A02 J;  3TJ6 A;  1S5L X;  1W5C E;  4U9D A;  1NU1 E;  2N1T D;  3A5T A;  4PAC A;  1XZP A;  4JPZ B;  3EFO A;  2BEZ F;  2P0N A;  2ZVO B;  1JEK A;  1NAF A;  2WT7 A;  1YVI A;  1RQV A;  3S90 A;  3L34 A;  3PTZ A;  4XPX A;  4UB8 H;  5TIS E;  4U5F E;  1ZP0 C;  1FU1 A;  3CL3 D;  3QVZ A;  1VQ9 P;  3RK3 C;  1H0T B;  3DM9 B;  2Y3H A;  4DBR A;  3NXS A;  1NTZ D;  1N7L A;  3C8G A;  4CS8 A;  3GM1 A;  1P84 E;  4XEF A;  2Y0D A;  4GKG A;  2R03 A;  3P32 A;  1L4A C;  1QVX A;  3H2U A;  3KZI H;  2I15 A;  4PK4 A;  5D92 A;  2V3C C;  1H88 A;  1OMI A;  1LE4 A;  1S5L H;  3CMA P;  1A41 A;  2D2C B;  1KFN A;  3OAK A;  2C03 A;  4IL6 E;  3GAN A;  4KT0 J;  1YYX A;  3JYH A;  5L3V A;  3KPH A;  1NU7 D;  2M64 A;  3SXZ A;  3EG9 B;  1VLT A;  4YL1 A;  2R5D A;  3M15 A;  1VK5 A;  5L0F A;  4XTK A;  4H44 D;  3V5B A;  4JC7 A;  3QW1 A;  2FFD C;  3U2L A;  1ZRT E;  5F5F A;  1JY2 O;  3SP1 A;  1L0L D;  2KLV A;  2O9X A;  2Q9I A;  4U5B E;  3CCE P;  2M3B A;  2QJP B;  4U7J A;  1RE3 A;  3L8J A;  1LIH A;  4AL1 A;  3CME P;  3BRT B;  3GOR A;  1YYJ A;  1OKK A;  2OCC C;  1L0N J;  4JW1 A;  5DQT A;  3M9Q A;  2IPP A;  2WL8 A;  3FDQ A;  2YL0 A;  4WBA A;  2Q5U A;  2J7P D;  2YL7 A;  3CSK A;  4Y99 C;  1QPU A;  3ATP A;  3H1J G;  2Y69 C;  1XTG B;  1B68 A;  4D6T D;  4MW8 A;  3Q7L A;  3DMD A;  2EPM X;  2YL1 A;  1PGP A;  2C0W A;  4RBN A;  2PBE A;  4CPG A;  2R7T A;  3Q6M A;  2OG2 A;  2W6B A;  2UUI A;  3ABM C;  4YL0 A;  3SWK A;  1SQV D;  1YI2 P;  1T9K A;  1PPJ G;  2WSE J;  4WGZ A;  3O6Q B;  2VB6 A;  4MVQ A;  1YQ4 C;  1U57 A;  1AQT A;  2D5R B;  1ZN5 A;  1FZA A;  4U5H A;  3RK2 D;  2AVK A;  1FDI A;  3GG2 A;  2HKV A;  3GEE A;  1DEE G;  2QIW A;  5CIV A;  3B0V C;  3BVH A;  1QL1 A;  3KL4 A;  3V2N A;  3KKB A;  2ZT9 B;  4R4M A;  1SFC A;  3H1H J;  5KAI E;  1AA0 A;  3FOP A;  3A0H H;  3UGO A;  1G8X A;  3L72 J;  4JVS A;  3EFO B;  2XND H;  2ZXX A;  2EIL C;  2YIU B;  3JSE O;  3L71 E;  4PFO A;  1Q86 Q;  3P8C D;  3HTK C;  2J5U A;  2WT7 B;  3MYF A;  2XSE A;  2NSF A;  1GD2 E;  1O87 A;  1K40 A;  2L6F A;  3U5S A;  2LK4 A;  3EFG A;  3L75 D;  1EZV E;  3NYJ A;  1ZU5 A;  3HJC A;  5A6A A;  2B0H A;  5BU5 A;  2D2C D;  3TSI A;  2OTL P;  2IXN A;  5KYY A;  3CWB G;  2NSG A;  5AW0 B;  2N9B A;  4H54 A;  2YLG A;  5E33 A;  4OGQ C;  1H9T A;  3M0D A;  3RYL A;  4AK9 A;  1VQ8 P;  3C8G B;  3JTL O;  4EBB A;  2D4U A;  1Y9B A;  3M4B A;  1S7Z A;  2CGE A;  1U7J A;  1O5H A;  2R7Q A;  3TD7 A;  4E7S A;  3IQT A;  2L7A A;  2YKO A;  2WPR A;  3U2M A;  2PX0 A;  3B5N D;  2HFI A;  3LLK A;  3MLG A;  3PHL A;  3P8M C;  2NRG A;  1E86 A;  1SQQ E;  1T6I A;  3CZ6 A;  3RQG A;  3HNL A;  1RMV A;  4YWQ A;  3H1I E;  1KYO I;  4N6J A;  2OTK E;  5KYU B;  2W4M A;  4O6Y A;  1YJW P;  4GIF A;  3RF3 A;  1NFO A;  1FAV A;  1J1D B;  3CLQ A;  2BCC E;  3HE5 A;  3H65 A;  4MND A;  2HOD B;  2XL8 A;  4KBL A;  1URQ A;  5CCG D;  1FOS F;  256B A;  2ZXW C;  3F47 A;  1KMI Z;  1M1K Q;  1JM0 A;  1BCC G;  5FZT A;  3RBZ A;  1H89 A;  1SMY F;  3FWN A;  2HPC A;  3IQ5 A;  1T3J A;  1NU1 G;  3L70 E;  1S72 P;  4PJ0 E;  4FES A;  3HRN A;  2XNX A;  1OXK A;  1M8O B;  2NPS B;  1T6U A;  3USS A;  3OA7 A;  1AVY A;  4MTF A;  5A6B A;  5TJH A;  3MYI A;  3CX5 H;  2EPN A;  5KLV E;  5IY5 C;  2W8Z A;  5JS5 A;  2WSF H;  4CSA A;  2Q7C A;  2OYH C;  4XLP F;  5BQG A;  4WVZ A;  3I4U A;  1PZQ A;  1IK7 A;  1L4A A;  5T3W A;  4DRJ B;  3QTH A;  1PP9 J;  1JTH A;  1LE2 A;  2QJY B;  3WHN A;  4I7Z B;  3BEH A;  1E79 H;  1GU4 A;  5AGF A;  3L35 A;  3UMH A;  1IFI A;  1LI5 A;  1LM3 B;  1ZLL A;  1VF5 C;  1KFM A;  3HNJ A;  1O3U A;  2YHS A;  4QI2 A;  1J8M F;  2V7Q H;  2Y3D A;  2KXP B;  2LR2 A;  4CBE A;  3EGX B;  3K7D A;  3W67 A;  1NTM E;  1J1E C;  4AL0 A;  2WMM A;  2FFD A;  4J7Y A;  1V4A A;  3NKE A;  1T01 A;  4AX2 A;  2A1D D;  1ZHT A;  3L8I A;  2R25 A;  2AEF A;  1NTK E;  3H1H G;  3TGU E;  1YJN P;  2BAS A;  4X0R A;  2IOQ A;  1KU2 A;  4U5G A;  2R7O A;  3UMK A;  1GW4 A;  1BR1 A;  4L74 A;  5L0D A;  5KYY B;  2X0C A;  3VM6 A;  4I2L C;  3PP5 A;  4PV1 B;  2UUH A;  2YQY A;  1N8R Q;  1PGO A;  1M2V B;  4NPF X;  2DB4 A;  3T6B A;  3WG7 C;  1T5O A;  3QMK A;  3L0I A;  2IXP A;  1GL2 B;  5CBO A;  1GQA A;  3AEC C;  1OCZ C;  1VYI A;  2WB7 A;  2BC5 A;  3A0B H;  1RXQ A;  4BG0 A;  2WQY C;  2QVA A;  3W68 A;  1X0T A;  4EOT A;  1DOV A;  3VF0 A;  3IPM O;  2JR8 A;  1NO4 A;  4L76 A;  1A0B A;  2C04 A;  2M5A A;  3AE4 C;  1L0N D;  1H6G A;  1Z23 A;  3EWK A;  2OU6 A;  2ZXP A;  2FGY A;  3MHV A;  1W2E A;  1FZG A;  4I1L A;  2LQG A;  3H1K J;  3IQ6 A;  2E74 D;  3JC2 2;  2NPS D;  1SQP E;  2ZYA A;  3HE5 B;  1ZW0 A;  1URQ B;  4WY4 C;  2WPV B;  2HJM A;  4DOZ A;  3BAT A;  2GUS A;  4XPY A;  3LS1 A;  3C1L A;  3TK0 A;  1T2K C;  4BEM J;  3MGN A;  3M9H A;  3OJA B;  1QEX A;  4NQF A;  4TLF A;  3W4Y A;  2HPC B;  1I4Z A;  1Q82 Q;  2PFD A;  3ZIB A;  1U6H A;  3KXD A;  2XDJ A;  5DJT B;  5CCH A;  1RF0 C;  3G4S P;  1C02 A;  2KNC A;  5APT A;  5KYW A;  2KGO A;  1BE3 J;  2P7V A;  2HV7 A;  1S2E A;  5B1B C;  3L71 G;  4BJ1 A;  1CPR A;  3GM2 A;  3RK3 B;  3QWO C;  2R02 A;  2OGU A;  5AW8 B;  4ZMD A;  4P9T A;  4CDV A;  3FXD A;  2WPS A;  1Q0G A;  2L5G B;  1PD0 A;  2FXM A;  1LT9 A;  1OCC C;  1EZV G;  2XU6 A;  1T8Z A;  4IL6 X;  1AJY A;  1PD1 A;  1L4A B;  3MZW B;  2Q9C A;  3M1C B;  4E18 A;  2O01 H;  3AE7 C;  1JTH B;  3HUS A;  2BL2 A;  2IYP A;  3LW5 J;  3CC4 P;  3NMI A;  4LAC B;  1P84 I;  5EFW B;  3Q5R A;  1BSN A;  2H43 A;  3KDP B;  2AXC A;  2FYN B;  4E0H A;  4Z9H A;  5GTI H;  1OW6 A;  1YJ9 P;  3AE2 C;  3ITF A;  1SQQ G;  3S4R A;  4PD4 D;  1QVG O;  1P84 H;  5AC4 A;  1VQ4 P;  1KQS O;  3FVY A;  4U9E A;  1USD A;  3U9J A;  3H1I G;  2V4H A;  2E43 A;  2B87 A;  1ZHX A;  2FFD B;  1JY3 N;  5APW A;  1NU1 K;  2WSE H;  4ZKU A;  1TR2 A;  1N7S A;  1FNT c;  2AEM A;  5L0J A;  5AW1 B;  4P9F A;  1VQK P;  3V5X A;  1EXJ A;  2FBW C;  2A06 G;  5JT4 A;  1N73 A;  2WSC J;  3I56 P;  2FY8 A;  1RKE A;  3EZH A;  3GM3 A;  1HY5 A;  2XV5 A;  1GL2 D;  1Q0F A;  3EJN A;  1M2O A;  3DAG A;  4G7Z F;  2PRR A;  4HEA J;  4ASV A;  1NG1 A;  1QL2 A;  2XKM A;  1GS9 A;  1M56 D;  3L70 G;  4N3Y B;  1A7V A;  4RD9 A;  2QJK C;  4H13 D;  2QLA A;  2HR3 A;  3H6P A;  1LTS C;  2J45 A;  2OYH A;  4G7O F;  3PJS K;  5AVZ B;  1KNY A;  1SQX E;  3B71 A;  5KLV G;  1NFN A;  2Y0C A;  3MP7 B;  3VTP C;  5F5H A;  3RL0 C;  1CI6 A;  3A9C A;  2WSF J;  1Q81 Q;  1Q90 D;  3HNI A;  1VL2 A;  1U0B B;  4L75 A;  1QX8 A;  3H1J J;  3RL0 g;  1Q2N A;  4ER9 A;  3V5Y A;  3TNU A;  2M5A B;  4KNV A;  3SZR A;  2ZVN B;  2O1J A;  4LLE A;  3BRJ A;  4A7P A;  1LS1 A;  3CCM P;  4NPD A;  5KLI B;  1HF9 A;  1MQV A;  3S1K A;  3LNR A;  1RF1 C;  1NKN A;  5B66 E;  2OYI A;  2YLD A;  4IAO A;  1DH3 A;  1KIL B;  5EGY A;  5APV A;  3DD7 A;  3Q5P A;  2RH0 A;  4GDO A;  3BCC G;  4OIO F;  1S9K D;  3KHU A;  5BQH A;  1BR4 A;  3RH3 A;  2JP3 A;  2V7Q J;  2Q9A A;  3U1A A;  3FXE A;  1ZZP A;  3JSZ A;  1JMW A;  3TJ5 A;  1NTM G;  3LES A;  1MMA A;  4XFJ A;  4DJ9 A;  4P6I C;  3GWN A;  4K35 A;  4KNW A;  4G78 A;  1FR0 A;  3HTK B;  1GW3 A;  1PP9 D;  1FJK A;  3UIA A;  5KYW B;  4MVS A;  2HSB A;  1WN0 A;  3S27 A;  3AE1 C;  4K3A A;  3TOM A;  5AC5 A;  1NTK G;  4N78 D;  4YXW H;  1LS4 A;  1D0X A;  2XLW A;  2E76 D;  3TGU G;  1JUN A;  3NMD A;  5CI8 A;  3RFY A;  1KB9 I;  4UB6 E;  2M0B A;  3ZTZ A;  3H2V A;  3JRM O;  1AFO A;  2HJ3 A;  1NU9 C;  1EZV I;  3II6 A;  2KIK A;  2VC9 A;  5AW6 B;  1JMM A;  3A7O A;  5L0G A;  3R2P A;  3V2Q A;  1KB9 H;  1K73 Q;  3AEE C;  4E17 A;  1OFC X;  2IFN A;  2J0X A;  1CSB A;  1MFZ A;  1IFP A;  1R5L A;  3AE5 C;  1VQ6 P;  3VMZ A;  3KYQ A;  1DIP A;  5AVV B;  2L6H A;  2A45 G;  3CWB J;  3HD7 C;  1AUE A;  2AEJ A;  1LVK A;  1VQM P;  3F5H A;  4YTP C;  2MYS A;  2Y3B A;  3AQB A;  1L0N E;  3WU2 H;  5B5E E;  2IZ1 A;  1VB5 A;  1TQG A;  4CSA C;  3LID A;  1ZW3 A;  2W6A A;  4LGD E;  5AVR B;  2LP4 A;  2KJG A;  3GWL A;  3NG1 A;  2R7V A;  2KZJ A;  3AOU A;  2QA4 P;  3HNK A;  2FXO A;  4WY4 A;  2P61 A;  1Y47 A;  4L6R A;  3HKK A;  4IFD K;  1HE9 A;  2VH3 A;  1SQP G;  3M0A A;  5B3I A;  1KZU B;  4LLH A;  3H1L E;  1WAS A;  2J9U A;  3JCU E;  1IZM A;  5DLJ A;  1OXZ A;  4XEV A;  2WVN A;  3SFE C;  1RKE B;  1LNQ A;  4IOI H;  1FS0 E;  1RF0 A;  4AQR D;  5JSL A;  4GOE A;  1UIX A;  5HSW A;  1TWA A;  3GMA A;  4JZA A;  2J59 M;  4IB4 A;  3GF7 A;  1ZVZ A;  3LUT B;  3L74 E;  1NOH A;  1X8Y A;  4JBZ A;  1SF8 A;  2E75 C;  2CYD A;  1BR2 A;  4RES B;  1G2C A;  2FXP A;  1BCC J;  3EQ2 A;  3H1K D;  2K9Y A;  3IN6 A;  3SWY A;  2F22 A;  4LDQ A;  2OYH B;  3S0X A;  1GU5 A;  3AEB C;  2KOG A;  1AVO B;  1KIL D;  1NU1 J;  1CI6 B;  1YIT P;  4WWI A;  4GQH A;  3G6E P;  1SQQ K;  4JEA A;  2N1T C;  4H0L D;  5EHH A;  1ZR2 A;  2E42 A;  2EIK C;  1GMJ A;  1E84 A;  1T6A A;  3K6B A;  3T6J A;  3B0U X;  3CEX A;  2O01 J;  1M6T A;  4JEB A;  1VF5 B;  1VPC A;  2POH A;  3DE9 A;  1BGY E;  1APC A;  3E9V A;  3DZA A;  2FAP B;  3IF4 A;  2M3E A;  3KMI A;  4JYC A;  1WOL A;  1D0Z A;  5D91 A;  1BE3 D;  5KYN A;  1Y4C A;  3CXH E;  3L73 D;  2J9W A;  5DQZ A;  2B89 A;  4PD4 E;  1L3P A;  4C7R A;  1J1E B;  1KOR A;  5KAF E;  5CBN A;  2A6H F;  2KS1 A;  3U1C A;  1YIJ P;  2DYR C;  1K04 A;  1CGM E;  2FYU E;  1YHQ P;  1AEP A;  1JPN A;  4QDL A;  2P1A A;  5BU8 B;  1LKX A;  1FMV A;  2GA0 A;  4J30 B;  4YT2 A;  1FZC C;  2NPU A;  3GEI A;  3O39 A;  3ZWI A;  2XXA B;  1TFK B;  3NKD A;  2K9J A;  4ANJ A;  2AXT E;  4IJJ A;  1DD4 A;  5KLV K;  3MTU E;  1QKR A;  2Q00 A;  1LTG C;  3CCS P;  3NMK A;  3VP8 A;  3EZI A;  2V26 A;  1WTY A;  4KI2 A;  1ZW2 A;  1X22 A;  1GGQ A;  4JJG A;  4H44 C;  3RIP A;  4GOF A;  1LTJ C;  2RMZ A;  1U89 A;  1FC2 C;  1OCO C;  3IQC A;  5CCH C;  5APU A;  4DT0 A;  4U3F D;  1SQX G;  4MVZ A;  2A45 I;  1PGQ A;  1HJB A;  2W9Y A;  4DVZ A;  1KYO D;  2W45 A;  2H7B A;  3N24 A;  1X79 B;  2IYL D;  3LIE A;  1G1J A;  1VQL P;  1NWQ A;  1IC2 A;  4R4L A;  1Y6D A;  2R3C A;  1DOW A;  1JY3 P;  3LW5 H;  1I5N A;  1LT9 C;  4EKW A;  2QM7 A;  1RF1 A;  2A45 H;  1NTM K;  1SQB E;  1ZOY C;  1KQL A;  3H25 A;  3KYI A;  1ZYR F;  4WY4 B;  3K1I A;  3WMM 0;  4K7B A;  2QG4 A;  5K0I A;  3HUS C;  1WWP A;  1MFT A;  1VYK A;  1IFD A;  4LDR A;  3HE4 A;  1JPJ A;  1NTK K;  4AE4 A;  1OVU A;  1NGM B;  3CX5 D;  2QM8 A;  4UB8 E;  3ABV C;  2GM4 A;  2NUT A;  3G3Z A;  5A6K A;  4K0D A;  1C03 A;  2H7O A;  3AQC A;  1WMK A;  2G3K A;  1FDO A;  1SLQ A;  4LER A;  1NKZ B;  3H1J D;  3M06 A;  3Q7G A;  1BBH A;  1FAP B;  4C7O A;  1G2C B;  3KZI E;  1KYO H;  2E5T A;  2KSJ A;  3RK2 C;  2PX3 A;  2WSC H;  1N7S C;  2KP8 A;  3ZC4 A;  2CNW A;  1EDL A;  4JTD B;  1EA8 A;  2HMZ A;  1S5L E;  4EWC A;  3PCV A;  2MJZ A;  2J0W A;  3AG4 C;  2XL6 A;  1SS1 A;  2R7U A;  1N73 C;  3OA1 A;  2Q3E A;  5KJ7 A;  1V74 B;  4EIJ A;  4YT4 A;  4IGG A;  3PH0 A;  3L71 J;  1K05 A;  1PPJ D;  5APQ A;  1SZI A;  1ZME C;  1XTC C;  2YVK A;  3HD7 A;  2EPL X;  3RKO F;  3ASO C;  2ITA A;  5L8R J;  5APY A;  4ULW A;  5AW3 B;  1ZV8 A;  1SQP K;  2W27 A;  3FHD A;  1E85 A;  2Z4E A;  2ZAE B;  2H8P D;  4EIY A;  1QVF O;  3H32 A;  1YQ3 C;  3IEE A;  3AG1 C;  4PJM A;  1G4U S;  3L1M A;  3RGU A;  3S28 A;  1NTZ E;  5T1D B;  4IWB A;  2Q7R A;  2Y3G A;  1IFJ A;  1M57 D;  5GTH H;  1YZC A;  1Z7Q c;  1LI7 A;  2ZT9 D;  4ONS A;  5DS5 A;  1IFM A;  2J8W A;  2P1J A;  3PDM P;  1SQQ J;  3B5N C;  2WVR A;  1GK6 A;  2RKL A;  2NZ2 A;  3WUU A;  1CZQ A;  3H1L G;  1R5I D;  3H1I J;  4DZO A;  4Z1M H;  3CWB D;  5BQI A;  3RVZ A;  2OYI C;  2WZL A;  1PGJ A;  2KLU A;  3FAJ A;  5M1B A;  1QZX A;  3AGU A;  4R32 A;  1RKC A;  4YJW A;  4J7T A;  4ZNC A;  3UR3 C;  3Q2Y A;  3NRH A;  4EBJ A;  1SFC B;  3D70 A;  3L74 G;  2XZR A;  5E3A A;  3C8G D;  1A7E A;  1J8Y F;  1L0L E;  3LAY A;  1EQ7 A;  5E79 H;  3RL0 B;  3PRJ A;  1VQN P;  1JY3 O;  2N1T A;  1V55 C;  1TWC A;  3UMI A;  1T2K D;  3CC2 P;  1HBW A;  1L7C A;  4B86 A;  2OJQ A;  3L70 J;  2LKM A;  1FBM A;  1S05 A;  3G4Z A;  3Q6N A;  4QI0 A;  4N6H A;  3MD0 A;  2OEX A;  3RQF A;  1QLE D;  2JDI H;  3DJU B;  2O01 N;  1RF1 B;  1W2B O;  3V5Z A;  4D6T E;  5KLV J;  1T6Q A;  2IBZ D;  4M3L A;  1VTM P;  1BGY G;  2LFF A;  3TK1 A;  2KK1 A;  3DM5 A;  3L73 E;  2ZXO A;  4K1O A;  1BCC D;  3HE4 B;  2LXB A;  4AE4 B;  3EGD A;  4JIO A;  1NH4 A;  2GFH A;  1FJP A;  3KYJ A;  2XM4 A;  1NU1 D;  1Q7Y Q;  4LDK A;  4DVY P;  2PF4 E;  1NBB A;  3VYW A;  2KB7 P;  2NUT B;  1FZC A;  2FYU G;  1OKK D;  4O6M A;  3TOL A;  1N1C A;  5H2F H;  1SQV E;  2J9B A;  3CAX A;  1D1A A;  4Z9I A;  1H8A A;  3BCC J;  2WPQ A;  3IFM A;  2R5B A;  2YO2 A;  1SR2 A;  3C8Z A;  2OEV A;  4BJ6 C;  1HVV A;  5AVT B;  3ZQY A;  4C7O B;  4JJF A;  2JWA A;  2O1K A;  1OXB A;  3JYY A;  4EBK A;  1LGH B;  1VLS A;  4L73 A;  3T6G B;  1NTM J;  2QSI A;  2KUB A;  1SQX K;  3K1H A;  1M1J C;  1LTJ A;  3AE8 C;  3VMY A;  1EXI A;  3CC7 P;  1P84 D;  2K1A A;  1ORY A;  5COM A;  1NTK J;  3ZG1 A;  1VOM A;  3LEV A;  3C9I A;  3QVY A;  3T4R A;  1GZL A;  4ZLD A;  3TGU J;  2MWQ A;  1L2P A;  4UB6 H;  3HD7 B;  4JE9 A;  4O6N A;  5CHX A;  3P8C E;  1LP1 A;  4C46 A;  4MVU A;  4U3F E;  3U8P A;  2Z5H A;  4C7N A;  3U0C A;  5BVZ A;  1YAR O;  2R3S A;  3A3Y B;  4LC1 A;  3L75 E;  1GDT A;  4BEJ A;  4EHP A;  2J7P A;  2H89 C;  3T97 A;  2VCC A;  5CJ0 A;  2AWC A;  2R9R B;  3N7N A;  2I8B A;  4H4K C;  2K37 A;  1IFN A;  3K5B A;  3GHG C;  1FFT C;  2OQQ A;  2LIG A;  1HW2 A;  2KSF A;  1EDI A;  1FDM A;  1ZRT D;  1Q0M A;  1SQB G;  3H1H D;  1SFC D;  4YL3 A;  2P7J A;  5DS6 A;  5TIS H;  1RQU A;  3L72 D;  1OVV A;  1JAF A;  2LXC B;  2CW0 F;  4JTA B;  3M4C A;  1NJI Q;  2GDC A;  3CX5 E;  2UWJ E;  1LPE A;  2TMV P;  2I1K A;  1Q0K A;  3VRC A;  4U5E E;  2G3V A;  3AE3 C;  2E75 B;  1AQ5 A;  1WRG A;  2JPU A;  2G8Y A;  1YLM A;  3C8V A;  2YL3 A;  4Q7C A;  3Q1M A;  1FFH A;  1SQP J;  2LFD A;  2JD3 A;  4NTF A;  4YN0 B;  4PV1 D;  2QRX A;  3JCU H;  3M91 A;  2E74 C;  2NPS C;  1TKN A;  2R7W A;  2N9Y B;  2I8D A;  4PJJ A;  1QQ3 A;  1BSH A;  2BCC G;  2ZYG A;  2A0B A;  4IL6 H;  2OTJ P;  3TF5 A;  4J32 B;  1OX3 A;  2HZ8 A;  5A69 A;  4EDF A;  3S84 A;  3M9B A;  1YDI A;  2CPB A;  2P58 A;  1FZE A;  4W7Y A;  4Y99 B;  3U59 A;  3ABL C;  2BEQ D;  3BAS A;  1PPJ E;  2HS5 A;  2CDQ A;  3EHM A;  1ZXG A;  4GOD A;  2HUJ A;  3MIW A;  1BZ4 A;  4O7G A;  1VQ5 P;  1OW8 A;  4CS9 C;  3MFN A;  1URQ D;  3W8I A;  3CXH I;  3EGD B;  2ZD9 A;  4BRY A;  3EG9 A;  1SP4 A;  1NTZ G;  4MQ9 F;  1FZC B;  1HW1 A;  3CCR P;  3B5N A;  1JR8 A;  1MV8 A;  2C0X A;  1D1C A;  1R4T A;  2KC3 A;  4G0H A;  1D1B A;  3L71 D;  1H9G A;  4XWJ A;  2WIT A;  5KKZ C;  1KB9 D;  2FFH A;  4KC9 A;  5AW2 B;  1PCX A;  5A6B D;  3K1I C;  1JY2 P;  4D4N A;  4I1M A;  1EZV D;  3RK3 D;  1YAU O;  3CD6 P;  4EYY Q;  1MUU A;  4DJG A; 
#chains in the Genus database with same CATH homology
 2WSE J;  2E76 C;  5F28 E;  4H44 B;  1FDO A;  1WOL A;  1YQ4 C;  3AEC C;  1U57 A;  1HJ0 A;  2FYN C;  1RQU A;  3SFD C;  3C18 A;  3GLM A;  2WQY C;  2YWA A;  4TT3 H;  1MKM A;  1FDI A;  1EXJ A;  2FBW C;  4XEK A;  3C8G A;  1KOR A;  3Q3D A;  3GM1 A;  4XEF A;  2QIW A;  2WSC J;  3AEE C;  3RQF A;  3GM3 A;  3AE4 C;  3RK3 E;  1K04 A;  3S9O A;  3D71 A;  1QVX A;  3EWK A;  1KQG B;  3AE5 C;  1DIP A;  3AEG C;  2ZT9 B;  3GF3 A;  4RKU J;  3AE3 C;  2E75 B;  4R4M A;  1OMI A;  2E74 D;  2JPU A;  2G8Y A;  2L6H A;  3C8V A;  2KK1 A;  3Q1M A;  1KIL E;  3O10 A;  4PV1 D;  3T97 B;  4OGQ B;  2QJK C;  4YTP C;  1IK7 A;  2E74 C;  2D2C B;  2WPV B;  3JZ0 A;  4H13 D;  1K05 A;  2JX0 A;  2J5U A;  4PV1 C;  4Y28 J;  1ZME C;  3O6Q A;  4KT0 J;  1DD4 A;  1K40 A;  3RQE A;  4I7Z B;  4H13 C;  1PIX A;  4NQF A;  1VF5 D;  5L8R J;  3AE6 C;  2L6F A;  1KNY A;  2LK4 A;  3B71 A;  2Q00 A;  2JO1 A;  4H44 D;  4OGQ D;  3AE9 C;  2D2C D;  1WTY A;  1VF5 C;  1R8E A;  3FGA D;  1DD3 A;  2WSF J;  1ZRT E;  1O3U A;  4H0L B;  1NYH A;  1Q90 D;  4OGQ C;  1VL2 A;  3R4Y A;  4H44 C;  2BEQ D;  1YQ3 C;  3RL0 g;  3C8G B;  1PV3 A;  1Y9B A;  4XEV A;  3SFE C;  4U7J A;  3JYY A;  2E76 B;  1OW7 A;  3L8J A;  4EBK A;  3K7D A;  2G3A A;  3GM2 A;  3AED C;  2QSI A;  3BRJ A;  1UIX A;  1HF9 A;  2P10 A;  3G9R A;  2ZT9 D;  3AJM A;  1V4A A;  2E75 D;  3GMA A;  1OW8 A;  3AE8 C;  3GF7 A;  4IL6 X;  1EXI A;  3L8I A;  1AJY A;  3RQG A;  1UFB A;  2MKV A;  2IDB A;  3MFN A;  2ZT9 C;  3Q5P A;  4GDO A;  2E75 C;  2NZ2 A;  3AEF C;  3AE7 C;  3Q5S A;  2JP3 A;  3LW5 J;  2V7Q J;  2YMK A;  4R4L A;  2FXP A;  3IN6 A;  2K9Y A;  2YIU C;  1ZZP A;  4Z1M H;  2D2C C;  3AEA C;  1KTM A;  3TUL A;  3Q5R A;  1ZOY C;  3AEB C;  1S5L X;  3H25 A;  1JB0 J;  2L6G A;  4XFJ A;  5M1B A;  2QJY C;  2E74 B;  5KLI C;  3U0C A;  3D6Z A;  1KQF B;  4R32 A;  4I7Z C;  1JOG A;  1OW6 A;  2H88 C;  3AE2 C;  4PV1 B;  1WWP A;  3Q2Y A;  1S1C X;  4H0L D;  2BEZ F;  2H89 C;  2HSB A;  4EBJ A;  2PBE A;  5KKZ C;  3D70 A;  3AE1 C;  1PL5 A;  4H13 B;  4YXD C;  3C8G D;  1GMJ A;  1NGM B;  3U3F A;  1KMI Z;  4H0L C;  3D6Y A;  1RQV A;  2E76 D;  2O01 J;  3ABV C;  3IAO A;  1VF5 B;  1TU3 F;  2OQQ A;  2QJP C;  1ZP0 C;  1WMK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...