1T6UA

Nickel superoxide dismutase (nisod) native 1.30 a structure
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
117
structure length
117
Chain Sequence
HCDLPCGVYDPAQARIEAESVKAVQEKMAGNDDPHFQTRATVIKEQRAELAKHHVSVLWSDYFKPPHFEKYPELHQLVNDTLKAMSAAKGSKDPATGQKALDYIAQIDKIFWETKKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide dismutase [Ni]
publication title Nickel superoxide dismutase structure and mechanism.
pubmed doi rcsb
source organism Streptomyces coelicolor
molecule tags Oxidoreductase
total genus 50
structure length 117
sequence length 117
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2004-05-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.400 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nickel-containing superoxide dismutase 1t6uA00
3G50A 1Q0FA 4NCQA 1T6QA 1Q0DA 1Q0KA 3G4XA 3G4ZA 1T6UA 1T6IA 1Q0GA 1Q0MA
chains in the Genus database with same CATH superfamily
2IBFA 2Q00A 1FFHA 3Q6NA 5B1BC 4ANJA 4CBEA 1TFKB 3CEXA 1ZYRF 5DLJA 3AQCA 1TWHA 5E33A 1W2WA 4IRUA 1RKEA 3VF0A 5KYYB 2EIKC 3PMRA 1VOMA 1U6HA 2G3KA 2P1AA 3L8JA 4YWQA 2ETSA 2D4UA 2EINC 2VCBA 3TJ6A 1VK5A 3DXJF 1A41A 4E7SA 2B0HA 3HNLA 4FESA 2WL8A 3W8HA 3HLZA 3JT1A 3KYJA 3B71A 4HEAJ 1QPUA 3MYIA 1M56C 3V5XA 2C04A 2MWQA 1NSGB 4YT5A 3BRJA 4NCQA 1YAUO 4YT8A 3AOUA 4HFKB 2LQGA 3DM5A 4I1OB 5EHHA 4E0HA 2J9WA 4U5FE 3VYWA 4ULVA 4XTKA 5JUAA 1Y4CA 2IYLD 2ZD9A 2FGYA 4EWCA 1TFOB 5T3TA 1Q0FA 5EK0A 2NUTA 3ZIBA 1QVXA 2VASA 4DOZA 3JCUQ 1EA8A 1OCCC 2ZXPA 3AGTA 3PHF2 3ASOC 1WATA 1VMAA 2L6GA 1LI7A 3AGUA 1JOGA 2L7AA 4HFFB 3EGDA 3UGPA 1T6UA 3DJNB 3LEOA 1AEPA 2KW3C 4E7ZA 2YLIA 5L3QA 2GDCA 3ZTZA 1UFBA 2YL1A 3RF3A 3LEVA 2IOQA 5E3CA 3WODF 1RJ9A 2R7TA 1A7VA 4CS8C 3M79A 3NYJA 4IB4A 4YT4A 3K33A 4PK4A 3B0PA 4P9TA 4B6IA 3S0XA 1M2VA 3U2MA 3F46A 5AC4A 1GS9A 2A0UA 1UG7A 4G0HA 1S05A 2ZXWC 3FXHA 3GORA 4LLEA 1WGWA 3QVYA 2H7BA 4BG0A 3SEOA 3UR3C 1IW7F 2LFDA 3RH3A 5COGA 3W2VA 4CS8A 1HMOA 1NU9C 3JYHA 2FFHA 4NQFA 5CI9A 2XLVA 1R5ID 3U8VA 3E9VA 5L0GA 3SXYA 4MVQA 3EHMA 3O39A 2HFIA 2IXOA 2Q9BA 2KSFA 1CGME 4XLPF 4WGYA 2M64A 1L7CA 2OQMA 3DD7A 3B0VC 3LS1A 4U5CE 2QTVA 2YL0A 3SP1A 2OKUA 2EPLX 3GODA 1MMNA 4MNDA 5A69A 3NKEA 3FOOA 3GEHA 4GYTA 1YYXA 1JMWA 4GEHA 1LE4A 3ZVRA 4G7ZF 2D5RB 3GM2A 3N2ZB 3QZCA 4KNWA 1OCZC 2YLGA 3UMIA 4C3DA 1Z23A 1OCOC 4IJJA 5DS4A 2G3VA 4XEFA 3C8GB 4G7HF 1FFTC 4JTDB 4PFOA 4D4XA 4DBQA 1K05A 4JJFA 3A11A 3C18A 1FMVA 1NZEA 2H7OA 4A4AA 1A7EA 1AVOB 2JD3A 3TOMA 2NUPA 3M4BA 1NFNA 3FAJA 4MTFA 3EH2A 1NLXA 4U5BE 2KQ9A 1ZW3A 5BQHA 1ZHZA 3AG4C 5KYUA 4AK9A 3I5PA 2XM0A 2OCCC 2PFDA 1OXKA 1ZHTA 3IQ6A 2UUHA 3ASNC 3TK0A 1C03A 5A6JA 3DKAA 3UMKA 2XXAA 2R03A 3A9CA 4YL3A 5T1DB 3RQEA 2CGEA 5DS5A 4PJLA 3O55A 3RW0A 3WAQA 2MYSA 2EPKX 4XEKA 3MX3A 4KC9A 4IAQA 2TMVP 2Q3TA 3M4CA 3RYLA 3QVZA 4FWVA 3EH1A 4N6CA 2ZPAA 4O6YA 1U0BB 1LIHA 1NU7D 2NUTB 1NG1A 3V5YA 3IEEA 4JJGA 2MHRA 2PF4E 4KNVA 4L6RA 2R05A 4CDVA 2EIJC 1E2XA 1D0YA 1EI7A 3VAYA 4CJOA 1TWCA 4XEVA 4LERA 1TR2A 2L6FA 3HNIA 3EGDB 3M1CB 1RMVA 2EIMC 3FDQA 4O79A 1CPQA 3S84A 2G62A 4ZLCA 5A6KA 1GM5A 3RVZA 1JRAA 1XZQA 1RJ9B 3JZ0A 4UDVA 4K1OA 3WHNA 2HJ3A 3ZG1A 1SR2A 3ZWIA 4U5HA 1YLMA 4BJ6A 2DYRC 1BR1A 3K1HA 3GM1A 1S7ZA 3RQFA 3ABKC 1VYKA 2XLWA 4XQ1A 1M2VB 2J9BA 2YEVA 4K0DA 3C8GA 5F5HA 5A6BD 5KYWA 4I3MA 2WZGA 1NFOA 1OW6A 2OOCA 5E2QA 1O87A 1BBHA 1BR2A 2YZSA 1SF8A 2XLEA 1GQAA 5JLIA 4NC3A 4JVSA 4AE4A 1OKKA 2P6VA 4CX9A 4Z9HA 2R7QA 2J9VA 2R7SA 1EKYA 4IWBA 5E3AA 1L3PA 3EPVA 4PFPA 3UGOA 1LE2A 2AVKA 3GEEA 4U5GA 1WTYA 1VYIA 4U9DA 4E17A 4YJWA 2BL2A 2RSEB 3TOLA 1H6GA 1WASA 3FMSA 4E18A 5L0IA 2YRFA 256BA 2R7WA 2AP3A 2IXPA 2NPUA 3GEIA 1HE9A 4MS2A 3I4UA 3U3BA 3H65A 5K0IA 1OW8A 3GWNA 1YARO 4PR9A 5DS6A 5JRAA 3JRTA 1SMYF 3ATPA 1BR4A 5D92A 1G4US 1PD0A 3KPHA 4I44A 1H9GA 1D1AA 3IQCA 4ONSA 3K6BA 2R9RB 2NUPB 1PCXA 1J8YF 3CSKA 3RKOF 1V54C 4MVZA 5EGYA 3GANA 5KYUB 3DE8A 4CJGA 3NYMA 2Y69C 1YZAA 3NG1A 2XM4A 3EFOB 4MVMA 4CIHA 1MQVA 2Q7RA 2KNHA 5L0DA 2W45A 4LDKA 4Q7CA 2XXAB 1QLEC 3OA1A 2J0WA 4AL1A 3HJCA 3O10A 3QW1A 2R7OA 4CSAC 2AWYA 2NG1A 3HNKA 4U5EE 2XS8A 3OEOA 1LM3B 4JC7A 4BJTA 1CGNA 1TKNA 3TQOA 2PBEA 4RBNA 4XLNF 1G8XA 1T6IA 2AU5A 3Q7GA 1JR8A 2V26A 3J06A 2EPNA 3RIPA 1ZHYA 1D0XA 2J46A 3C8GD 4EUKB 4IAOA 2L9JA 1LI5A 4KBLA 2X0CA 2Y3DA 2P61A 3X2QC 5DVWA 2W4BA 2A6HF 4IARA 4MVSA 4A2NB 3VRCA 3LESA 2WZLA 4PJMA 4CSAA 2Y3HA 3F47A 1YVIA 1R4TA 3U5SA 3FHDA 3LS0A 3MYFA 1OKKD 4JE9A 3X1OA 4D4NA 1HMDA 2XLHA 3W4YA 3NDBB 2R7XA 2GWWA 3IPMO 3ECSA 2BC5A 3ZC4A 2VC9A 5AC5A 4PACA 5KYWB 4AL0A 2CNWA 4QI0A 1T6QA 3TD7A 4XPYA 5B3IA 4DXWA 1E84A 5COFA 1KTMA 4MW8A 2H8AA 1OW7A 2R25A 4DVZA 2UUIA 4MTOA 1APCA 1I4ZA 4AE4B 2J9UA 4U9EA 4YT2A 4NY3A 1B68A 1OCRC 4QI2A 3SYNA 1VB5A 3SXZA 5BUOA 3EFOA 1C17M 2VCAA 4JTCB 1K04A 2QY9A 3GM3A 3VM6A 5CI8A 1M6TA 4FX5A 5KYNA 4GQHA 5F28E 3U9JA 3B29A 3EHNA 3DZAA 3JRMO 3NMJA 3TJ5A 4G78A 4F4BA 2PX3A 1Z6AA 2VH3A 4K7BA 3L1MA 2ICWG 4MTGA 3H2VA 1JAFA 2PP4A 1EQ1A 3N24A 3DI5A 3BEHA 1PV3A 5L0HA 2EPOA 2IM8A 5GPGB 1XWJA 2OEXA 3KMIA 5BQGA 2PX0A 4BJ1A 3S90A 3W2WA 2HMZA 4I1MA 1JPJA 3JSZA 5A6AA 4CDAA 4BPMA 1E86A 2IXNA 2HMQA 2XS1A 1MNEA 2QUPA 3Q6MA 2A68F 4PJJA 2YL7A 3U8PA 1LS4A 1QSPA 1V74B 2Y3GA 1V4AA 1ZU5A 3AG2C 2XLDA 2OJED 3LNMB 4W8KA 3RVYA 3TULA 2I15A 3B0UX 4MVRA 1K40A 1KU2A 3EGXA 5KYXA 5DQTA 3DE9A 2YKZA 4EBJA 3KYIA 1JPNA 2QLAA 1OQCA 4OINF 2YVKA 3ZSUA 1J8MF 4X0RA 4YL0A 3EG9A 4ULWA 4WJ0A 2KC3A 1TQGA 1Q0GA 2WVNA 2XSEA 4NTAA 4CDYA 3R2PA 3RFYA 3OWTA 4NTFA 1Q0KA 3G4ZA 3LUTB 3MFNA 5FZTA 4OD5A 1XZPA 1LPEA 1H7IA 1YJGA 4PJNA 4KI2A 2VCCA 2Q4FA 3S28A 2E87A 2XL8A 3LLKA 1Z7Qc 1D1BA 1QZXA 4MW3A 4EBBA 1E85A 3C8ZA 2KJGA 2V3CC 4P6IC 3EQLF 2LIGA 4EHPA 1LKXA 4C7OA 2CDQA 3NYLA 1LVKA 4OIOF 4JRZA 1Z3IX 2XLMA 3ABMC 1MMGA 5B1AC 3ZQYA 2XL4A 1ORYA 3UMHA 3T6JA 3ZDLA 5D91A 3V7OA 5DQZA 4DRHB 1O5HA 1OXBA 3LLIA 2R7UA 3HTKC 2Y3BA 3O6XA 4HE8D 3U9MA 4DRIB 4ZLDA 1N1CA 4C3EA 1ZZPA 1CGOA 3U0CA 3CAXA 3Q7LA 2HV7A 4LLCA 2ASRA 3IQTA 2L81A 4U5DE 3T6BA 1Y6DA 2FAPB 3JSEO 3K7DA 2PNOA 5FCLA 1KNYA 1T01A 3AG1C 3E70C 3FOPA 4Z9IA 4P9FA 4O6MA 4YK5A 4OIRF 1T5OA 3G4XA 2CW0F 3B9QA 4MVUA 4N4WA 4JURI 1TWGA 2GAQA 3DJUB 5IY5C 2A1DD 1VLSA 1YA7O 2WVOA 3U3FA 4DJ9A 1ZHXA 2QE9A 1DOVA 3FAPB 4XPXA 3K66A 3MBGA 3WG7C 4JCHA 1LS1A 2HV6A 3KH2A 1C02A 3NRHA 1ORJA 4C3BA 5JVEA 2GA0A 2GFHA 2LD6A 2QNLA 3M15A 1YZCA 4M63A 4OIQF 2BE5F 3S9OA 1H9TA 2YQYA 5B3SC 2DI3A 2B0JA 2Z15A 5CIVA 2R02A 2DYSC 1ORSC 3ZQVA 1QQ3A 3LAYA 2A6EF 1RCPA 2NSGA 3QMKA 3S27A 3POVA 1D0ZA 2RD9A 2W4MA 3V5ZA 1HE1A 2A69F 2J0XA 3IQ5A 2ZXRA 3ZTMA 4DRJB 4Q5SF 1FMWA 1M2OA 2Q9CA 2M4EA 2YLDA 1BDJB 2P0NA 4LDQA 2J8WA 4QDLA 2KYHA 1OR2A 2ZXOA 2OEVA 2J7PA 3RQGA 5L0FA 3R7CA 4CS9C 1PD1A 2H7VC 2HSQA 1SZIA 2O9XA 2Y39A 1FR0A 1Z63A 1VTMP 1FAPB 2EILC 1CPRA 2WVQA 3EGXB 2KK1A 5KYXB 1O3UA 2KGOA 1ZU4A 2LP4A 2YWAA 1FTSA 2CCYA 5BQIA 2R7RA 2Q9AA 3L0IA 1I5NA 4WGZA 4MQ9F 3EG9B 5HSWA 3KKBA 3MLGA 3AQBA 1DOWA 3K1IC 4XWJA 5KYYA 1RKCA 1ST6A 4G7OF 1VLTA 5AGFA 4CS9A 4JEBA 4EKWA 3NKDA 3SZRA 2J45A 2F22A 3AJMA 5A6BA 4JIOA 3JTLO 1U89A 1MNDA 4RD9A 2CYDA 1GGQA 3ABLC 1HW2A 4LACB 4LDRA 4J7TA 1RXQA 3LNRA 1ZVZA 3AG3C 2W9YA 2HZ8A 4JEAA 3I5QA 4C7OB 2P7VA 2C03A 2XLOA 3H2UA 3K1IA 4O6NA 1Z5ZA 3CQZA 3S29A 4ER9A 4BEMJ 2OU6A 3W8IA 2DB4A 5F5FA 4CIPA 1QKRA 1HY5A 2HSBA 4JKVA 5COMA 4BJ5C 1ZHWA 3G50A 1D1CA 4WABA 2LCHA 3EZHA 3C7JA 4Z9JA 3T6GB 4DBRA 4JZAA 3US6A 4OD4A 3C62A 1ZW2A 1I4YA 1Q0MA 2A0BA 2AWCA 2L6HA 4MVOA 1SYQA 2LK4A 1RKEB 2OJQA 1F1MA 1WWPA 2JPUA 1YYJA 3CZ6A 3KL4A 2LSEA 3SNHA 1WN0A 4N6HA 1A0BA 5HV9A 1Q0DA 4BJ5A 4W8PA 4JTAB 3DAGA 2HUJA 5JT4A 4R32A 3DAFA 4EIYA 1YA9A 3PDMP 2WB7A 5JSLA 3IHUA 1T9KA 5TJ5E 3EZIA 2YL3A 4J30B 3L8IA 3PCVA 4DVYP 4YL1A 3LJBA 4J7YA 5T3WA 4JCZA 1V55C 1M57C 1MMDA 4AX2A 1BZ4A 5JP7A 4BEJA 3DWWA 1E83A 3QW0A 3N0TA 4RDAA 3HNJA 1YDIA 2VB6A 1OR3A 4O7GA 2J7PD 4BJ6C 1WOLA 2X51A 2R7VA 1NBBA 1AUEA 1TWAA 3EJNA 2NSFA 4H4KC 1A7DA 3U2LA 4E0IA 3DM9B 4XPWA 2EPMX 3GWLA 4FAPB 2IXMA 2WZFA 5L3VA 1G5ZA 5L0CA 4NTBA 2YHSA 4YN0B 2JX0A 3NMIA 3QTHA 1FNTc 3DMDA 1IZMA 4N06A 5JS5A 2OG2A 4Q4ZF 3HKKA 4JW1A 3L34A 4J32B 3T4RA 4OIPF 4IGGA 2CNWD 1HW1A 2HJMA 2XL6A 3UNGC 4CS7A 4EBKA 3T9OA 3NMKA 5L0JA 2LFFA 3FVYA 2HS5A 2DGJA 2I8BA 3ITFA 4H54A 3JYYA 1MMAA 2HKVA 1G4WR 3SXMA 3SXKA 2XRHA 3C63A
chains in the Genus database with same CATH topology
3G50A 1Q0FA 4NCQA 1T6QA 1Q0DA 1Q0KA 3G4XA 3G4ZA 1T6UA 1T6IA 1Q0GA 1Q0MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G50 A;  1Q0F A;  4NCQ A;  1T6Q A;  1Q0D A;  1Q0K A;  3G4X A;  3G4Z A;  1T6U A;  1T6I A;  1Q0G A;  1Q0M A; 
#chains in the Genus database with same CATH topology
 2IBF A;  2Q00 A;  1FFH A;  3Q6N A;  5B1B C;  4ANJ A;  4CBE A;  1TFK B;  3CEX A;  1ZYR F;  5DLJ A;  3AQC A;  1TWH A;  5E33 A;  1W2W A;  4IRU A;  1RKE A;  3VF0 A;  5KYY B;  2EIK C;  3PMR A;  1VOM A;  1U6H A;  2G3K A;  2P1A A;  3L8J A;  4YWQ A;  2ETS A;  2D4U A;  2EIN C;  2VCB A;  3TJ6 A;  1VK5 A;  3DXJ F;  1A41 A;  4E7S A;  2B0H A;  3HNL A;  4FES A;  2WL8 A;  3W8H A;  3HLZ A;  3JT1 A;  3KYJ A;  3B71 A;  4HEA J;  1QPU A;  3MYI A;  1M56 C;  3V5X A;  2C04 A;  2MWQ A;  1NSG B;  4YT5 A;  3BRJ A;  4NCQ A;  1YAU O;  4YT8 A;  3AOU A;  4HFK B;  2LQG A;  3DM5 A;  4I1O B;  5EHH A;  4E0H A;  2J9W A;  4U5F E;  3VYW A;  4ULV A;  4XTK A;  5JUA A;  1Y4C A;  2IYL D;  2ZD9 A;  2FGY A;  4EWC A;  1TFO B;  5T3T A;  1Q0F A;  5EK0 A;  2NUT A;  3ZIB A;  1QVX A;  2VAS A;  4DOZ A;  3JCU Q;  1EA8 A;  1OCC C;  2ZXP A;  3AGT A;  3PHF 2;  3ASO C;  1WAT A;  1VMA A;  2L6G A;  1LI7 A;  3AGU A;  1JOG A;  2L7A A;  4HFF B;  3EGD A;  3UGP A;  1T6U A;  3DJN B;  3LEO A;  1AEP A;  2KW3 C;  4E7Z A;  2YLI A;  5L3Q A;  2GDC A;  3ZTZ A;  1UFB A;  2YL1 A;  3RF3 A;  3LEV A;  2IOQ A;  5E3C A;  3WOD F;  1RJ9 A;  2R7T A;  1A7V A;  4CS8 C;  3M79 A;  3NYJ A;  4IB4 A;  4YT4 A;  3K33 A;  4PK4 A;  3B0P A;  4P9T A;  4B6I A;  3S0X A;  1M2V A;  3U2M A;  3F46 A;  5AC4 A;  1GS9 A;  2A0U A;  1UG7 A;  4G0H A;  1S05 A;  2ZXW C;  3FXH A;  3GOR A;  4LLE A;  1WGW A;  3QVY A;  2H7B A;  4BG0 A;  3SEO A;  3UR3 C;  1IW7 F;  2LFD A;  3RH3 A;  5COG A;  3W2V A;  4CS8 A;  1HMO A;  1NU9 C;  3JYH A;  2FFH A;  4NQF A;  5CI9 A;  2XLV A;  1R5I D;  3U8V A;  3E9V A;  5L0G A;  3SXY A;  4MVQ A;  3EHM A;  3O39 A;  2HFI A;  2IXO A;  2Q9B A;  2KSF A;  1CGM E;  4XLP F;  4WGY A;  2M64 A;  1L7C A;  2OQM A;  3DD7 A;  3B0V C;  3LS1 A;  4U5C E;  2QTV A;  2YL0 A;  3SP1 A;  2OKU A;  2EPL X;  3GOD A;  1MMN A;  4MND A;  5A69 A;  3NKE A;  3FOO A;  3GEH A;  4GYT A;  1YYX A;  1JMW A;  4GEH A;  1LE4 A;  3ZVR A;  4G7Z F;  2D5R B;  3GM2 A;  3N2Z B;  3QZC A;  4KNW A;  1OCZ C;  2YLG A;  3UMI A;  4C3D A;  1Z23 A;  1OCO C;  4IJJ A;  5DS4 A;  2G3V A;  4XEF A;  3C8G B;  4G7H F;  1FFT C;  4JTD B;  4PFO A;  4D4X A;  4DBQ A;  1K05 A;  4JJF A;  3A11 A;  3C18 A;  1FMV A;  1NZE A;  2H7O A;  4A4A A;  1A7E A;  1AVO B;  2JD3 A;  3TOM A;  2NUP A;  3M4B A;  1NFN A;  3FAJ A;  4MTF A;  3EH2 A;  1NLX A;  4U5B E;  2KQ9 A;  1ZW3 A;  5BQH A;  1ZHZ A;  3AG4 C;  5KYU A;  4AK9 A;  3I5P A;  2XM0 A;  2OCC C;  2PFD A;  1OXK A;  1ZHT A;  3IQ6 A;  2UUH A;  3ASN C;  3TK0 A;  1C03 A;  5A6J A;  3DKA A;  3UMK A;  2XXA A;  2R03 A;  3A9C A;  4YL3 A;  5T1D B;  3RQE A;  2CGE A;  5DS5 A;  4PJL A;  3O55 A;  3RW0 A;  3WAQ A;  2MYS A;  2EPK X;  4XEK A;  3MX3 A;  4KC9 A;  4IAQ A;  2TMV P;  2Q3T A;  3M4C A;  3RYL A;  3QVZ A;  4FWV A;  3EH1 A;  4N6C A;  2ZPA A;  4O6Y A;  1U0B B;  1LIH A;  1NU7 D;  2NUT B;  1NG1 A;  3V5Y A;  3IEE A;  4JJG A;  2MHR A;  2PF4 E;  4KNV A;  4L6R A;  2R05 A;  4CDV A;  2EIJ C;  1E2X A;  1D0Y A;  1EI7 A;  3VAY A;  4CJO A;  1TWC A;  4XEV A;  4LER A;  1TR2 A;  2L6F A;  3HNI A;  3EGD B;  3M1C B;  1RMV A;  2EIM C;  3FDQ A;  4O79 A;  1CPQ A;  3S84 A;  2G62 A;  4ZLC A;  5A6K A;  1GM5 A;  3RVZ A;  1JRA A;  1XZQ A;  1RJ9 B;  3JZ0 A;  4UDV A;  4K1O A;  3WHN A;  2HJ3 A;  3ZG1 A;  1SR2 A;  3ZWI A;  4U5H A;  1YLM A;  4BJ6 A;  2DYR C;  1BR1 A;  3K1H A;  3GM1 A;  1S7Z A;  3RQF A;  3ABK C;  1VYK A;  2XLW A;  4XQ1 A;  1M2V B;  2J9B A;  2YEV A;  4K0D A;  3C8G A;  5F5H A;  5A6B D;  5KYW A;  4I3M A;  2WZG A;  1NFO A;  1OW6 A;  2OOC A;  5E2Q A;  1O87 A;  1BBH A;  1BR2 A;  2YZS A;  1SF8 A;  2XLE A;  1GQA A;  5JLI A;  4NC3 A;  4JVS A;  4AE4 A;  1OKK A;  2P6V A;  4CX9 A;  4Z9H A;  2R7Q A;  2J9V A;  2R7S A;  1EKY A;  4IWB A;  5E3A A;  1L3P A;  3EPV A;  4PFP A;  3UGO A;  1LE2 A;  2AVK A;  3GEE A;  4U5G A;  1WTY A;  1VYI A;  4U9D A;  4E17 A;  4YJW A;  2BL2 A;  2RSE B;  3TOL A;  1H6G A;  1WAS A;  3FMS A;  4E18 A;  5L0I A;  2YRF A;  256B A;  2R7W A;  2AP3 A;  2IXP A;  2NPU A;  3GEI A;  1HE9 A;  4MS2 A;  3I4U A;  3U3B A;  3H65 A;  5K0I A;  1OW8 A;  3GWN A;  1YAR O;  4PR9 A;  5DS6 A;  5JRA A;  3JRT A;  1SMY F;  3ATP A;  1BR4 A;  5D92 A;  1G4U S;  1PD0 A;  3KPH A;  4I44 A;  1H9G A;  1D1A A;  3IQC A;  4ONS A;  3K6B A;  2R9R B;  2NUP B;  1PCX A;  1J8Y F;  3CSK A;  3RKO F;  1V54 C;  4MVZ A;  5EGY A;  3GAN A;  5KYU B;  3DE8 A;  4CJG A;  3NYM A;  2Y69 C;  1YZA A;  3NG1 A;  2XM4 A;  3EFO B;  4MVM A;  4CIH A;  1MQV A;  2Q7R A;  2KNH A;  5L0D A;  2W45 A;  4LDK A;  4Q7C A;  2XXA B;  1QLE C;  3OA1 A;  2J0W A;  4AL1 A;  3HJC A;  3O10 A;  3QW1 A;  2R7O A;  4CSA C;  2AWY A;  2NG1 A;  3HNK A;  4U5E E;  2XS8 A;  3OEO A;  1LM3 B;  4JC7 A;  4BJT A;  1CGN A;  1TKN A;  3TQO A;  2PBE A;  4RBN A;  4XLN F;  1G8X A;  1T6I A;  2AU5 A;  3Q7G A;  1JR8 A;  2V26 A;  3J06 A;  2EPN A;  3RIP A;  1ZHY A;  1D0X A;  2J46 A;  3C8G D;  4EUK B;  4IAO A;  2L9J A;  1LI5 A;  4KBL A;  2X0C A;  2Y3D A;  2P61 A;  3X2Q C;  5DVW A;  2W4B A;  2A6H F;  4IAR A;  4MVS A;  4A2N B;  3VRC A;  3LES A;  2WZL A;  4PJM A;  4CSA A;  2Y3H A;  3F47 A;  1YVI A;  1R4T A;  3U5S A;  3FHD A;  3LS0 A;  3MYF A;  1OKK D;  4JE9 A;  3X1O A;  4D4N A;  1HMD A;  2XLH A;  3W4Y A;  3NDB B;  2R7X A;  2GWW A;  3IPM O;  3ECS A;  2BC5 A;  3ZC4 A;  2VC9 A;  5AC5 A;  4PAC A;  5KYW B;  4AL0 A;  2CNW A;  4QI0 A;  1T6Q A;  3TD7 A;  4XPY A;  5B3I A;  4DXW A;  1E84 A;  5COF A;  1KTM A;  4MW8 A;  2H8A A;  1OW7 A;  2R25 A;  4DVZ A;  2UUI A;  4MTO A;  1APC A;  1I4Z A;  4AE4 B;  2J9U A;  4U9E A;  4YT2 A;  4NY3 A;  1B68 A;  1OCR C;  4QI2 A;  3SYN A;  1VB5 A;  3SXZ A;  5BUO A;  3EFO A;  1C17 M;  2VCA A;  4JTC B;  1K04 A;  2QY9 A;  3GM3 A;  3VM6 A;  5CI8 A;  1M6T A;  4FX5 A;  5KYN A;  4GQH A;  5F28 E;  3U9J A;  3B29 A;  3EHN A;  3DZA A;  3JRM O;  3NMJ A;  3TJ5 A;  4G78 A;  4F4B A;  2PX3 A;  1Z6A A;  2VH3 A;  4K7B A;  3L1M A;  2ICW G;  4MTG A;  3H2V A;  1JAF A;  2PP4 A;  1EQ1 A;  3N24 A;  3DI5 A;  3BEH A;  1PV3 A;  5L0H A;  2EPO A;  2IM8 A;  5GPG B;  1XWJ A;  2OEX A;  3KMI A;  5BQG A;  2PX0 A;  4BJ1 A;  3S90 A;  3W2W A;  2HMZ A;  4I1M A;  1JPJ A;  3JSZ A;  5A6A A;  4CDA A;  4BPM A;  1E86 A;  2IXN A;  2HMQ A;  2XS1 A;  1MNE A;  2QUP A;  3Q6M A;  2A68 F;  4PJJ A;  2YL7 A;  3U8P A;  1LS4 A;  1QSP A;  1V74 B;  2Y3G A;  1V4A A;  1ZU5 A;  3AG2 C;  2XLD A;  2OJE D;  3LNM B;  4W8K A;  3RVY A;  3TUL A;  2I15 A;  3B0U X;  4MVR A;  1K40 A;  1KU2 A;  3EGX A;  5KYX A;  5DQT A;  3DE9 A;  2YKZ A;  4EBJ A;  3KYI A;  1JPN A;  2QLA A;  1OQC A;  4OIN F;  2YVK A;  3ZSU A;  1J8M F;  4X0R A;  4YL0 A;  3EG9 A;  4ULW A;  4WJ0 A;  2KC3 A;  1TQG A;  1Q0G A;  2WVN A;  2XSE A;  4NTA A;  4CDY A;  3R2P A;  3RFY A;  3OWT A;  4NTF A;  1Q0K A;  3G4Z A;  3LUT B;  3MFN A;  5FZT A;  4OD5 A;  1XZP A;  1LPE A;  1H7I A;  1YJG A;  4PJN A;  4KI2 A;  2VCC A;  2Q4F A;  3S28 A;  2E87 A;  2XL8 A;  3LLK A;  1Z7Q c;  1D1B A;  1QZX A;  4MW3 A;  4EBB A;  1E85 A;  3C8Z A;  2KJG A;  2V3C C;  4P6I C;  3EQL F;  2LIG A;  4EHP A;  1LKX A;  4C7O A;  2CDQ A;  3NYL A;  1LVK A;  4OIO F;  4JRZ A;  1Z3I X;  2XLM A;  3ABM C;  1MMG A;  5B1A C;  3ZQY A;  2XL4 A;  1ORY A;  3UMH A;  3T6J A;  3ZDL A;  5D91 A;  3V7O A;  5DQZ A;  4DRH B;  1O5H A;  1OXB A;  3LLI A;  2R7U A;  3HTK C;  2Y3B A;  3O6X A;  4HE8 D;  3U9M A;  4DRI B;  4ZLD A;  1N1C A;  4C3E A;  1ZZP A;  1CGO A;  3U0C A;  3CAX A;  3Q7L A;  2HV7 A;  4LLC A;  2ASR A;  3IQT A;  2L81 A;  4U5D E;  3T6B A;  1Y6D A;  2FAP B;  3JSE O;  3K7D A;  2PNO A;  5FCL A;  1KNY A;  1T01 A;  3AG1 C;  3E70 C;  3FOP A;  4Z9I A;  4P9F A;  4O6M A;  4YK5 A;  4OIR F;  1T5O A;  3G4X A;  2CW0 F;  3B9Q A;  4MVU A;  4N4W A;  4JUR I;  1TWG A;  2GAQ A;  3DJU B;  5IY5 C;  2A1D D;  1VLS A;  1YA7 O;  2WVO A;  3U3F A;  4DJ9 A;  1ZHX A;  2QE9 A;  1DOV A;  3FAP B;  4XPX A;  3K66 A;  3MBG A;  3WG7 C;  4JCH A;  1LS1 A;  2HV6 A;  3KH2 A;  1C02 A;  3NRH A;  1ORJ A;  4C3B A;  5JVE A;  2GA0 A;  2GFH A;  2LD6 A;  2QNL A;  3M15 A;  1YZC A;  4M63 A;  4OIQ F;  2BE5 F;  3S9O A;  1H9T A;  2YQY A;  5B3S C;  2DI3 A;  2B0J A;  2Z15 A;  5CIV A;  2R02 A;  2DYS C;  1ORS C;  3ZQV A;  1QQ3 A;  3LAY A;  2A6E F;  1RCP A;  2NSG A;  3QMK A;  3S27 A;  3POV A;  1D0Z A;  2RD9 A;  2W4M A;  3V5Z A;  1HE1 A;  2A69 F;  2J0X A;  3IQ5 A;  2ZXR A;  3ZTM A;  4DRJ B;  4Q5S F;  1FMW A;  1M2O A;  2Q9C A;  2M4E A;  2YLD A;  1BDJ B;  2P0N A;  4LDQ A;  2J8W A;  4QDL A;  2KYH A;  1OR2 A;  2ZXO A;  2OEV A;  2J7P A;  3RQG A;  5L0F A;  3R7C A;  4CS9 C;  1PD1 A;  2H7V C;  2HSQ A;  1SZI A;  2O9X A;  2Y39 A;  1FR0 A;  1Z63 A;  1VTM P;  1FAP B;  2EIL C;  1CPR A;  2WVQ A;  3EGX B;  2KK1 A;  5KYX B;  1O3U A;  2KGO A;  1ZU4 A;  2LP4 A;  2YWA A;  1FTS A;  2CCY A;  5BQI A;  2R7R A;  2Q9A A;  3L0I A;  1I5N A;  4WGZ A;  4MQ9 F;  3EG9 B;  5HSW A;  3KKB A;  3MLG A;  3AQB A;  1DOW A;  3K1I C;  4XWJ A;  5KYY A;  1RKC A;  1ST6 A;  4G7O F;  1VLT A;  5AGF A;  4CS9 A;  4JEB A;  4EKW A;  3NKD A;  3SZR A;  2J45 A;  2F22 A;  3AJM A;  5A6B A;  4JIO A;  3JTL O;  1U89 A;  1MND A;  4RD9 A;  2CYD A;  1GGQ A;  3ABL C;  1HW2 A;  4LAC B;  4LDR A;  4J7T A;  1RXQ A;  3LNR A;  1ZVZ A;  3AG3 C;  2W9Y A;  2HZ8 A;  4JEA A;  3I5Q A;  4C7O B;  2P7V A;  2C03 A;  2XLO A;  3H2U A;  3K1I A;  4O6N A;  1Z5Z A;  3CQZ A;  3S29 A;  4ER9 A;  4BEM J;  2OU6 A;  3W8I A;  2DB4 A;  5F5F A;  4CIP A;  1QKR A;  1HY5 A;  2HSB A;  4JKV A;  5COM A;  4BJ5 C;  1ZHW A;  3G50 A;  1D1C A;  4WAB A;  2LCH A;  3EZH A;  3C7J A;  4Z9J A;  3T6G B;  4DBR A;  4JZA A;  3US6 A;  4OD4 A;  3C62 A;  1ZW2 A;  1I4Y A;  1Q0M A;  2A0B A;  2AWC A;  2L6H A;  4MVO A;  1SYQ A;  2LK4 A;  1RKE B;  2OJQ A;  1F1M A;  1WWP A;  2JPU A;  1YYJ A;  3CZ6 A;  3KL4 A;  2LSE A;  3SNH A;  1WN0 A;  4N6H A;  1A0B A;  5HV9 A;  1Q0D A;  4BJ5 A;  4W8P A;  4JTA B;  3DAG A;  2HUJ A;  5JT4 A;  4R32 A;  3DAF A;  4EIY A;  1YA9 A;  3PDM P;  2WB7 A;  5JSL A;  3IHU A;  1T9K A;  5TJ5 E;  3EZI A;  2YL3 A;  4J30 B;  3L8I A;  3PCV A;  4DVY P;  4YL1 A;  3LJB A;  4J7Y A;  5T3W A;  4JCZ A;  1V55 C;  1M57 C;  1MMD A;  4AX2 A;  1BZ4 A;  5JP7 A;  4BEJ A;  3DWW A;  1E83 A;  3QW0 A;  3N0T A;  4RDA A;  3HNJ A;  1YDI A;  2VB6 A;  1OR3 A;  4O7G A;  2J7P D;  4BJ6 C;  1WOL A;  2X51 A;  2R7V A;  1NBB A;  1AUE A;  1TWA A;  3EJN A;  2NSF A;  4H4K C;  1A7D A;  3U2L A;  4E0I A;  3DM9 B;  4XPW A;  2EPM X;  3GWL A;  4FAP B;  2IXM A;  2WZF A;  5L3V A;  1G5Z A;  5L0C A;  4NTB A;  2YHS A;  4YN0 B;  2JX0 A;  3NMI A;  3QTH A;  1FNT c;  3DMD A;  1IZM A;  4N06 A;  5JS5 A;  2OG2 A;  4Q4Z F;  3HKK A;  4JW1 A;  3L34 A;  4J32 B;  3T4R A;  4OIP F;  4IGG A;  2CNW D;  1HW1 A;  2HJM A;  2XL6 A;  3UNG C;  4CS7 A;  4EBK A;  3T9O A;  3NMK A;  5L0J A;  2LFF A;  3FVY A;  2HS5 A;  2DGJ A;  2I8B A;  3ITF A;  4H54 A;  3JYY A;  1MMA A;  2HKV A;  1G4W R;  3SXM A;  3SXK A;  2XRH A;  3C63 A; 
#chains in the Genus database with same CATH homology
 3G50 A;  1Q0F A;  4NCQ A;  1T6Q A;  1Q0D A;  1Q0K A;  3G4X A;  3G4Z A;  1T6U A;  1T6I A;  1Q0G A;  1Q0M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...