1T6UA

Nickel superoxide dismutase (nisod) native 1.30 a structure
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
117
structure length
117
Chain Sequence
HCDLPCGVYDPAQARIEAESVKAVQEKMAGNDDPHFQTRATVIKEQRAELAKHHVSVLWSDYFKPPHFEKYPELHQLVNDTLKAMSAAKGSKDPATGQKALDYIAQIDKIFWETKKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Superoxide dismutase [Ni]
publication title Nickel superoxide dismutase structure and mechanism.
pubmed doi rcsb
source organism Streptomyces coelicolor
total genus 50
structure length 117
sequence length 117
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2004-05-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.400 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nickel-containing superoxide dismutase 1t6uA00
1Q0KA 1Q0MA 1Q0DA 3G50A 1Q0FA 1T6UA 1Q0GA 4NCQA 1T6QA 1T6IA 3G4XA 3G4ZA
chains in the Genus database with same CATH superfamily
3SP1A 2CW0F 3NKEA 5L0IA 2WZFA 4DJ9A 1WTYA 2HJ3A 1SMYF 3RYLA 1TFOB 1N1CA 1LI7A 5GPGB 4C7OB 4CX9A 3G4XA 4NY3A 1PCXA 1WASA 3W4YA 1FR0A 3I5PA 1H9TA 2IXOA 2YLIA 4BG0A 3T6BA 1ORJA 3UR3C 3NMIA 2G3VA 1J8MF 4ZLDA 1RCPA 1ZVZA 1RKEA 4O79A 1M2VA 1OKKA 5BQGA 3QW1A 3U2MA 5B3SC 4CDYA 3GODA 5CI8A 2RD9A 3EFOA 1CGME 2YL1A 4E7ZA 2KQ9A 3KL4A 2QY9A 2ZD9A 3ATPA 3B71A 5JVEA 1IW7F 3AOUA 1NLXA 3IPMO 1K04A 4FX5A 2Q3TA 1FTSA 4JCHA 5BQHA 3C8ZA 3KKBA 4N6CA 1ORYA 5FZTA 3T6GB 5A69A 3U5SA 3DM5A 3CAXA 4OIPF 3JYYA 4PFOA 4DRHB 2HS5A 3HTKC 2EPKX 1ZHYA 4DOZA 5A6AA 1E84A 4PJLA 3HKKA 3KYJA 2V3CC 1CPQA 1FFTC 1HMOA 1OCZC 4X0RA 4LDQA 4XQ1A 1FAPB 5A6JA 1QLEC 1PD0A 1WATA 3GM1A 5HV9A 3DE9A 4LLEA 5TJ5E 3M1CB 4C7OA 2YVKA 5COMA 1MNEA 5L0CA 1ZHXA 2EPMX 3PDMP 4G0HA 4JJGA 4DVZA 2J0XA 2VC9A 3RQEA 5KYYA 3GM2A 2NG1A 1YZCA 2ZPAA 5KYNA 1YDIA 1Z23A 5IY5C 4PR9A 1Q0KA 1E2XA 1LM3B 4MVOA 3SZRA 3RVYA 4EIYA 3EGXB 5L0DA 3S9OA 1VB5A 2M4EA 2L6HA 3JT1A 4A4AA 4BJ6A 2HKVA 1OQCA 5DLJA 2PX3A 2W4BA 1OXKA 1I5NA 2PFDA 1UFBA 4ZLCA 1J8YF 3EGDA 2KC3A 4EKWA 2X51A 3FOPA 1YVIA 3RQGA 1IZMA 1ZU4A 2HSQA 5F28E 4CS9A 4NC3A 4MTOA 2WZGA 4JTCB 3Q7LA 2CDQA 1D0YA 2H8AA 4YT8A 4XTKA 1UG7A 3DJNB 4XPXA 1LKXA 1RKCA 3LJBA 4YWQA 2IOQA 2NUTB 2R02A 3EZIA 3JYHA 1JPJA 4CDVA 1SYQA 4RBNA 4BJ6C 2KK1A 3DD7A 2R7XA 2CYDA 3TJ6A 2ASRA 1BR4A 1JPNA 4MVUA 4O6YA 3U0CA 1LPEA 5CIVA 3ZSUA 3NMJA 4CIPA 2IM8A 1TKNA 1NFNA 1YLMA 2L6GA 4PFPA 1U89A 2JD3A 3ASNC 3JSZA 3UNGC 3V5YA 1FNTc 3RW0A 2LP4A 1JAFA 2AU5A 4IAOA 3CSKA 3LESA 2HFIA 3AG3C 2OQMA 3DAGA 3W8IA 3ZVRA 4E17A 1HY5A 4MW8A 1LE4A 2XS1A 3LS0A 4E0HA 5L0JA 3DMDA 3SYNA 1KTMA 2L6FA 1ZHZA 3KMIA 3NYMA 3MBGA 3QW0A 4J30B 4PJMA 2ICWG 3ZG1A 1VMAA 2YLGA 3N2ZB 2PBEA 1QSPA 4UDVA 4JKVA 1CGOA 2KSFA 1OKKD 4AE4A 2ZXPA 3MLGA 2AP3A 4U5BE 3M4BA 4M63A 3EG9B 4A2NB 1T01A 1A7DA 2PX0A 2EPOA 4JJFA 3R7CA 3WAQA 4KNVA 5KYUB 1LS1A 1NZEA 3L8IA 1HW1A 1OXBA 1RXQA 1M56C 1U6HA 2P6VA 3LEVA 2HSBA 4PJNA 4U5HA 3S0XA 3FMSA 1APCA 3NYLA 2GDCA 3LEOA 1OW8A 4MVZA 4EUKB 3ITFA 1WWPA 3EPVA 5JRAA 3VYWA 2EPNA 3T4RA 4P9TA 1BR2A 3JRTA 4P9FA 3WODF 5CI9A 2Q7RA 3U8PA 4PACA 1RJ9B 3QTHA 5JLIA 2OEXA 2IYLD 4DXWA 3DM9B 2E87A 1AUEA 2EINC 4YT4A 2IXPA 1EI7A 1ZYRF 3EH2A 3KYIA 4U5EE 3RH3A 3C8GB 1C17M 3GORA 4Z9HA 3QVZA 3ZC4A 5JP7A 1ZW3A 4DBQA 2P61A 4CS7A 4YT2A 3X2QC 4NTAA 1QQ3A 3T6JA 3ZQVA 1ZZPA 2XM4A 4EHPA 1NBBA 1ZHWA 3T9OA 3UGOA 4N4WA 2FGYA 2XLWA 4D4NA 2YHSA 3DJUB 3VAYA 3GWNA 4NQFA 3U9JA 2GA0A 3NDBB 5D91A 4LLCA 4ANJA 1YYJA 4EBKA 1Z5ZA 2HV7A 1A41A 2CCYA 2Z15A 1O5HA 4Z9JA 4XEFA 3ZQYA 5AC5A 3W8HA 2KW3C 1Z3IX 3PHF2 1ST6A 3SXYA 2WL8A 4U5DE 1NFOA 4YL3A 3JTLO 3ABLC 2R03A 4Q5SF 2LD6A 3VM6A 2NUTA 3G50A 3EHNA 2VB6A 1Q0GA 3TQOA 3M15A 3EJNA 4LERA 2G62A 4K1OA 2FFHA 4JIOA 1DOWA 2GWWA 3Q6NA 3U3BA 4J7TA 1D0ZA 2JPUA 2Q00A 3MFNA 3N0TA 5EGYA 2X0CA 4HFKB 4BJ1A 2AWYA 3POVA 2W4MA 4N6HA 2VCCA 1CGNA 2NUPB 1TWGA 3AQCA 3G4ZA 1XZQA 2QLAA 2YQYA 4MVRA 1TFKB 4JURI 1Z7Qc 3ZDLA 4IB4A 4CS8A 1FMVA 3W2WA 4BEJA 3DI5A 1LE2A 1NU9C 1WN0A 1BZ4A 2YEVA 4XPYA 4DBRA 2A68F 2Q9CA 2XLOA 2R7OA 3BRJA 3GEEA 3SXZA 1MMDA 2D4UA 3CZ6A 3R2PA 4YJWA 2VCBA 4YL1A 1H7IA 5COGA 5DS6A 3S84A 1NG1A 3B29A 3K7DA 2ZXOA 3UMKA 2BL2A 1TR2A 4IWBA 3H2VA 2P1AA 2QUPA 4NCQA 4MVQA 4H4KC 2L7AA 4QI2A 1OR2A 2OOCA 1WGWA 3B0PA 3EG9A 3O10A 2XXAB 1K40A 3DWWA 4JTAB 1M57C 4KNWA 4CS8C 3F46A 4HFFB 2L9JA 5KYUA 5KYXB 3EHMA 4JVSA 1LVKA 1JR8A 4HEAJ 3NMKA 4IGGA 2DB4A 3ZTZA 5L0HA 1HMDA 3AG1C 3DXJF 3L8JA 3IEEA 3CEXA 2B0JA 1A0BA 4U9EA 3RFYA 3AJMA 3OEOA 4K7BA 2Y39A 2XL8A 3SNHA 4J32B 3HJCA 2LCHA 5BUOA 1T6UA 3O39A 3TULA 2J46A 2VASA 1PV3A 1RJ9A 1YAUO 3JCUQ 3KH2A 2EIJC 3O6XA 4YT5A 3U2LA 4R32A 4E18A 2R7QA 4U5CE 5K0IA 3QMKA 3C8GA 2J9WA 5T1DB 1G5ZA 4JZAA 3M4CA 1YJGA 2P0NA 2PP4A 1S05A 3LNMB 3H65A 5COFA 3VRCA 1HW2A 3B9QA 1MMAA 4NTFA 2R7RA 4B6IA 2C04A 2YL3A 4I44A 2Y69C 2J45A 3Q6MA 3L1MA 3RKOF 2A6HF 2OKUA 3AG4C 1OCCC 4Q7CA 1TWHA 1C03A 4W8PA 4OINF 5L0GA 4LDKA 3C62A 4KI2A 3ASOC 4GQHA 1PD1A 4G78A 2I8BA 4AL1A 4XLPF 2YWAA 3ABMC 5E3CA 2LSEA 1YA9A 5EK0A 5DQTA 5AGFA 4LDRA 3FAPB 256BA 3HNJA 4BPMA 3FDQA 3NKDA 2WVOA 2OG2A 4GEHA 1GS9A 3A11A 4EBBA 3L34A 2LQGA 1MMNA 1KU2A 4O6MA 2WVQA 4U5GA 3UMHA 1E85A 1VTMP 2FAPB 3LS1A 4P6IC 4PJJA 3CQZA 4JRZA 4AX2A 1MMGA 4BJ5C 1VOMA 4EBJA 2XSEA 1ZW2A 3ZWIA 4JE9A 3MX3A 3OWTA 2W45A 5B1AC 1HE1A 2HZ8A 1EQ1A 4IJJA 3ZIBA 1K05A 2DYSC 5DQZA 3VF0A 1WOLA 2XLHA 2R7WA 2LFDA 4I1MA 3K66A 5JS5A 2YLDA 3NG1A 5JUAA 4LACB 1F1MA 5KYWB 3WG7C 1V4AA 2R25A 3S90A 2IBFA 1VK5A 3AGTA 3C7JA 2H7VC 3K33A 1Z63A 4U9DA 1QVXA 1FMWA 3TJ5A 1EA8A 1ZU5A 4AL0A 3JRMO 2XLMA 3OA1A 5A6BD 2J7PA 3EQLF 2R7VA 2G3KA 4MQ9F 5L3VA 3FXHA 1ZHTA 2F22A 3EGXA 1O3UA 4JCZA 1XZPA 2I15A 2Y3HA 1Y6DA 2W9YA 5KYXA 3B0UX 3S29A 2DYRC 3RF3A 1D1BA 3C63A 4IARA 3MYIA 2HMZA 4CDAA 4XLNF 2A0UA 2HUJA 2OCCC 3F47A 4C3EA 4EWCA 3JSEO 3NRHA 4G7HF 1VYIA 2YZSA 4YL0A 1R5ID 2YL7A 4KBLA 1T6IA 3FOOA 1CPRA 2MHRA 4W8KA 4WGYA 3DAFA 3TOLA 5L0FA 3E70C 2V26A 1YYXA 4I1OB 1T6QA 2WZLA 2Q4FA 1L3PA 1D0XA 2J9VA 2R05A 4OD4A 1LI5A 1A7EA 2XLVA 4QI0A 2R7UA 2AWCA 3C8GD 3HNLA 1QKRA 2Q9AA 2XL6A 2GFHA 2IXNA 3V5XA 1XWJA 3PMRA 1D1AA 3GM3A 5F5HA 2H7BA 2B0HA 4XEKA 4J7YA 5EHHA 1O87A 2QE9A 5D92A 2CNWA 1AEPA 1Z6AA 4CJOA 2OEVA 3IQCA 4JEBA 2YL0A 1BR1A 3EH1A 4JW1A 2AVKA 2NSGA 3RIPA 2YKZA 3TD7A 4BEMJ 2WVNA 2UUHA 1M6TA 3M79A 4CSAC 5DS5A 3FAJA 1YA7O 2R7SA 4GYTA 1M2OA 4MNDA 2QNLA 3RVZA 2L81A 4AE4B 2MWQA 3LAYA 3GEIA 5A6BA 2D5RB 1FFHA 3PCVA 3FVYA 2A1DD 1GQAA 3I5QA 4FAPB 2EILC 1S7ZA 3MYFA 4JEAA 3AGUA 3BEHA 3JZ0A 3Q7GA 4E7SA 1HE9A 3TK0A 1E86A 4CIHA 2A69F 1OR3A 2Y3GA 3V5ZA 3DKAA 4ULVA 2A0BA 3X1OA 2KGOA 5E2QA 5E33A 3ZTMA 4AK9A 1I4YA 2C03A 4O7GA 1SF8A 3QZCA 1OW7A 3AG2C 4XEVA 4CJGA 1KNYA 2OJQA 3HNKA 1T5OA 3NYJA 4YK5A 4D4XA 5KYWA 4U5FE 1MNDA 4K0DA 4MTGA 2Q9BA 2MYSA 4ONSA 2KYHA 4DRJB 3HLZA 3N24A 1U0BB 2KJGA 2IXMA 5JSLA 3SEOA 3DE8A 1QPUA 1YARO 4QDLA 2Y3DA 4JC7A 4MS2A 2P7VA 3LLKA 1R4TA 3L0IA 2J7PD 1L7CA 2XLEA 1SZIA 4O6NA 1EKYA 3K6BA 4C3BA 1D1CA 2VH3A 2PNOA 4PK4A 3S27A 3US6A 1Q0FA 2TMVP 3IQTA 4IAQA 4BJ5A 1VLSA 3C18A 1G8XA 2M64A 4NTBA 2LK4A 3O55A 1GGQA 1Q0DA 1MQVA 1TQGA 2PF4E 3LUTB 3IQ5A 2NPUA 4C3DA 2XS8A 2EPLX 1TWAA 3ECSA 4JTDB 4BJTA 1NSGB 4HE8D 3K1IA 1RKEB 4OD5A 4FESA 1M2VB 4MVMA 2YRFA 3DZAA 2J0WA 1OCRC 1E83A 4XWJA 3EFOB 2OU6A 4N06A 3RQFA 5AC4A 2Y3BA 1H6GA 1BDJB 4FWVA 5E3AA 4L6RA 2LIGA 1JMWA 3EZHA 5DVWA 5B3IA 2HV6A 4OIQF 4IRUA 3TOMA 2ZXRA 4RD9A 4G7ZF 4CS9C 1RMVA 2NUPA 1H9GA 4E0IA 3I4UA 3WHNA 1QZXA 5BQIA 4I3MA 3LLIA 4RDAA 4YN0B 2GAQA 5L3QA 5A6KA 1YZAA 2CNWD 2QTVA 1TWCA 2XL4A 4OIOF 2XRHA 3UGPA 3K1IC 1G4WR 1B68A 2WB7A 4ER9A 1W2WA 5KYYB 2RSEB 5T3TA 2O9XA 3A9CA 3FHDA 4WGZA 3K1HA 2DI3A 5T3WA 3IQ6A 3U3FA 1OW6A 4DRIB 2A6EF 3SXKA 1GM5A 1A7VA 2OJED 1VYKA 4Q4ZF 2JX0A 2J8WA 1NU7D 4OIRF 2KNHA 4WABA 5HSWA 4MW3A 2H7OA 2XXAA 3J06A 4G7OF 1OCOC 3SXMA 2VCAA 3U8VA 2EIMC 1Y4CA 2XM0A 3EGDB 3IHUA 3GANA 3U9MA 1SR2A 4MTFA 1T9KA 1VLTA 2UUIA 3GWLA 4WJ0A 1JOGA 4CBEA 1AVOB 3H2UA 5B1BC 1ORSC 2NSFA 3B0VC 1Q0MA 1DOVA 5F5FA 3QVYA 3LNRA 3E9VA 2DGJA 3AQBA 3HNIA 2J9BA 3S28A 2HJMA 1V74B 3W2VA 3V7OA 4F4BA 1LIHA 1JRAA 5FCLA 2XLDA 5JT4A 3UMIA 2J9UA 3ABKC 2CGEA 4Z9IA 1I4ZA 1BBHA 4H54A 1G4US 4KC9A 2BE5F 3GEHA 3KPHA 2ZXWC 5DS4A 4CSAA 2R7TA 2LFFA 2HMQA 4XPWA 1LS4A 4ULWA 1V54C 2R9RB 4MVSA 2BC5A 4DVYP 1V55C 1C02A 2ETSA 2EIKC
chains in the Genus database with same CATH topology
1Q0KA 1Q0MA 1Q0DA 3G50A 1Q0FA 1T6UA 1Q0GA 4NCQA 1T6QA 1T6IA 3G4XA 3G4ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q0K A;  1Q0M A;  1Q0D A;  3G50 A;  1Q0F A;  1T6U A;  1Q0G A;  4NCQ A;  1T6Q A;  1T6I A;  3G4X A;  3G4Z A; 
#chains in the Genus database with same CATH topology
 3SP1 A;  2CW0 F;  3NKE A;  5L0I A;  2WZF A;  4DJ9 A;  1WTY A;  2HJ3 A;  1SMY F;  3RYL A;  1TFO B;  1N1C A;  1LI7 A;  5GPG B;  4C7O B;  4CX9 A;  3G4X A;  4NY3 A;  1PCX A;  1WAS A;  3W4Y A;  1FR0 A;  3I5P A;  1H9T A;  2IXO A;  2YLI A;  4BG0 A;  3T6B A;  1ORJ A;  3UR3 C;  3NMI A;  2G3V A;  1J8M F;  4ZLD A;  1RCP A;  1ZVZ A;  1RKE A;  4O79 A;  1M2V A;  1OKK A;  5BQG A;  3QW1 A;  3U2M A;  5B3S C;  4CDY A;  3GOD A;  5CI8 A;  2RD9 A;  3EFO A;  1CGM E;  2YL1 A;  4E7Z A;  2KQ9 A;  3KL4 A;  2QY9 A;  2ZD9 A;  3ATP A;  3B71 A;  5JVE A;  1IW7 F;  3AOU A;  1NLX A;  3IPM O;  1K04 A;  4FX5 A;  2Q3T A;  1FTS A;  4JCH A;  5BQH A;  3C8Z A;  3KKB A;  4N6C A;  1ORY A;  5FZT A;  3T6G B;  5A69 A;  3U5S A;  3DM5 A;  3CAX A;  4OIP F;  3JYY A;  4PFO A;  4DRH B;  2HS5 A;  3HTK C;  2EPK X;  1ZHY A;  4DOZ A;  5A6A A;  1E84 A;  4PJL A;  3HKK A;  3KYJ A;  2V3C C;  1CPQ A;  1FFT C;  1HMO A;  1OCZ C;  4X0R A;  4LDQ A;  4XQ1 A;  1FAP B;  5A6J A;  1QLE C;  1PD0 A;  1WAT A;  3GM1 A;  5HV9 A;  3DE9 A;  4LLE A;  5TJ5 E;  3M1C B;  4C7O A;  2YVK A;  5COM A;  1MNE A;  5L0C A;  1ZHX A;  2EPM X;  3PDM P;  4G0H A;  4JJG A;  4DVZ A;  2J0X A;  2VC9 A;  3RQE A;  5KYY A;  3GM2 A;  2NG1 A;  1YZC A;  2ZPA A;  5KYN A;  1YDI A;  1Z23 A;  5IY5 C;  4PR9 A;  1Q0K A;  1E2X A;  1LM3 B;  4MVO A;  3SZR A;  3RVY A;  4EIY A;  3EGX B;  5L0D A;  3S9O A;  1VB5 A;  2M4E A;  2L6H A;  3JT1 A;  4A4A A;  4BJ6 A;  2HKV A;  1OQC A;  5DLJ A;  2PX3 A;  2W4B A;  1OXK A;  1I5N A;  2PFD A;  1UFB A;  4ZLC A;  1J8Y F;  3EGD A;  2KC3 A;  4EKW A;  2X51 A;  3FOP A;  1YVI A;  3RQG A;  1IZM A;  1ZU4 A;  2HSQ A;  5F28 E;  4CS9 A;  4NC3 A;  4MTO A;  2WZG A;  4JTC B;  3Q7L A;  2CDQ A;  1D0Y A;  2H8A A;  4YT8 A;  4XTK A;  1UG7 A;  3DJN B;  4XPX A;  1LKX A;  1RKC A;  3LJB A;  4YWQ A;  2IOQ A;  2NUT B;  2R02 A;  3EZI A;  3JYH A;  1JPJ A;  4CDV A;  1SYQ A;  4RBN A;  4BJ6 C;  2KK1 A;  3DD7 A;  2R7X A;  2CYD A;  3TJ6 A;  2ASR A;  1BR4 A;  1JPN A;  4MVU A;  4O6Y A;  3U0C A;  1LPE A;  5CIV A;  3ZSU A;  3NMJ A;  4CIP A;  2IM8 A;  1TKN A;  1NFN A;  1YLM A;  2L6G A;  4PFP A;  1U89 A;  2JD3 A;  3ASN C;  3JSZ A;  3UNG C;  3V5Y A;  1FNT c;  3RW0 A;  2LP4 A;  1JAF A;  2AU5 A;  4IAO A;  3CSK A;  3LES A;  2HFI A;  3AG3 C;  2OQM A;  3DAG A;  3W8I A;  3ZVR A;  4E17 A;  1HY5 A;  4MW8 A;  1LE4 A;  2XS1 A;  3LS0 A;  4E0H A;  5L0J A;  3DMD A;  3SYN A;  1KTM A;  2L6F A;  1ZHZ A;  3KMI A;  3NYM A;  3MBG A;  3QW0 A;  4J30 B;  4PJM A;  2ICW G;  3ZG1 A;  1VMA A;  2YLG A;  3N2Z B;  2PBE A;  1QSP A;  4UDV A;  4JKV A;  1CGO A;  2KSF A;  1OKK D;  4AE4 A;  2ZXP A;  3MLG A;  2AP3 A;  4U5B E;  3M4B A;  4M63 A;  3EG9 B;  4A2N B;  1T01 A;  1A7D A;  2PX0 A;  2EPO A;  4JJF A;  3R7C A;  3WAQ A;  4KNV A;  5KYU B;  1LS1 A;  1NZE A;  3L8I A;  1HW1 A;  1OXB A;  1RXQ A;  1M56 C;  1U6H A;  2P6V A;  3LEV A;  2HSB A;  4PJN A;  4U5H A;  3S0X A;  3FMS A;  1APC A;  3NYL A;  2GDC A;  3LEO A;  1OW8 A;  4MVZ A;  4EUK B;  3ITF A;  1WWP A;  3EPV A;  5JRA A;  3VYW A;  2EPN A;  3T4R A;  4P9T A;  1BR2 A;  3JRT A;  4P9F A;  3WOD F;  5CI9 A;  2Q7R A;  3U8P A;  4PAC A;  1RJ9 B;  3QTH A;  5JLI A;  2OEX A;  2IYL D;  4DXW A;  3DM9 B;  2E87 A;  1AUE A;  2EIN C;  4YT4 A;  2IXP A;  1EI7 A;  1ZYR F;  3EH2 A;  3KYI A;  4U5E E;  3RH3 A;  3C8G B;  1C17 M;  3GOR A;  4Z9H A;  3QVZ A;  3ZC4 A;  5JP7 A;  1ZW3 A;  4DBQ A;  2P61 A;  4CS7 A;  4YT2 A;  3X2Q C;  4NTA A;  1QQ3 A;  3T6J A;  3ZQV A;  1ZZP A;  2XM4 A;  4EHP A;  1NBB A;  1ZHW A;  3T9O A;  3UGO A;  4N4W A;  2FGY A;  2XLW A;  4D4N A;  2YHS A;  3DJU B;  3VAY A;  3GWN A;  4NQF A;  3U9J A;  2GA0 A;  3NDB B;  5D91 A;  4LLC A;  4ANJ A;  1YYJ A;  4EBK A;  1Z5Z A;  2HV7 A;  1A41 A;  2CCY A;  2Z15 A;  1O5H A;  4Z9J A;  4XEF A;  3ZQY A;  5AC5 A;  3W8H A;  2KW3 C;  1Z3I X;  3PHF 2;  1ST6 A;  3SXY A;  2WL8 A;  4U5D E;  1NFO A;  4YL3 A;  3JTL O;  3ABL C;  2R03 A;  4Q5S F;  2LD6 A;  3VM6 A;  2NUT A;  3G50 A;  3EHN A;  2VB6 A;  1Q0G A;  3TQO A;  3M15 A;  3EJN A;  4LER A;  2G62 A;  4K1O A;  2FFH A;  4JIO A;  1DOW A;  2GWW A;  3Q6N A;  3U3B A;  4J7T A;  1D0Z A;  2JPU A;  2Q00 A;  3MFN A;  3N0T A;  5EGY A;  2X0C A;  4HFK B;  4BJ1 A;  2AWY A;  3POV A;  2W4M A;  4N6H A;  2VCC A;  1CGN A;  2NUP B;  1TWG A;  3AQC A;  3G4Z A;  1XZQ A;  2QLA A;  2YQY A;  4MVR A;  1TFK B;  4JUR I;  1Z7Q c;  3ZDL A;  4IB4 A;  4CS8 A;  1FMV A;  3W2W A;  4BEJ A;  3DI5 A;  1LE2 A;  1NU9 C;  1WN0 A;  1BZ4 A;  2YEV A;  4XPY A;  4DBR A;  2A68 F;  2Q9C A;  2XLO A;  2R7O A;  3BRJ A;  3GEE A;  3SXZ A;  1MMD A;  2D4U A;  3CZ6 A;  3R2P A;  4YJW A;  2VCB A;  4YL1 A;  1H7I A;  5COG A;  5DS6 A;  3S84 A;  1NG1 A;  3B29 A;  3K7D A;  2ZXO A;  3UMK A;  2BL2 A;  1TR2 A;  4IWB A;  3H2V A;  2P1A A;  2QUP A;  4NCQ A;  4MVQ A;  4H4K C;  2L7A A;  4QI2 A;  1OR2 A;  2OOC A;  1WGW A;  3B0P A;  3EG9 A;  3O10 A;  2XXA B;  1K40 A;  3DWW A;  4JTA B;  1M57 C;  4KNW A;  4CS8 C;  3F46 A;  4HFF B;  2L9J A;  5KYU A;  5KYX B;  3EHM A;  4JVS A;  1LVK A;  1JR8 A;  4HEA J;  3NMK A;  4IGG A;  2DB4 A;  3ZTZ A;  5L0H A;  1HMD A;  3AG1 C;  3DXJ F;  3L8J A;  3IEE A;  3CEX A;  2B0J A;  1A0B A;  4U9E A;  3RFY A;  3AJM A;  3OEO A;  4K7B A;  2Y39 A;  2XL8 A;  3SNH A;  4J32 B;  3HJC A;  2LCH A;  5BUO A;  1T6U A;  3O39 A;  3TUL A;  2J46 A;  2VAS A;  1PV3 A;  1RJ9 A;  1YAU O;  3JCU Q;  3KH2 A;  2EIJ C;  3O6X A;  4YT5 A;  3U2L A;  4R32 A;  4E18 A;  2R7Q A;  4U5C E;  5K0I A;  3QMK A;  3C8G A;  2J9W A;  5T1D B;  1G5Z A;  4JZA A;  3M4C A;  1YJG A;  2P0N A;  2PP4 A;  1S05 A;  3LNM B;  3H65 A;  5COF A;  3VRC A;  1HW2 A;  3B9Q A;  1MMA A;  4NTF A;  2R7R A;  4B6I A;  2C04 A;  2YL3 A;  4I44 A;  2Y69 C;  2J45 A;  3Q6M A;  3L1M A;  3RKO F;  2A6H F;  2OKU A;  3AG4 C;  1OCC C;  4Q7C A;  1TWH A;  1C03 A;  4W8P A;  4OIN F;  5L0G A;  4LDK A;  3C62 A;  4KI2 A;  3ASO C;  4GQH A;  1PD1 A;  4G78 A;  2I8B A;  4AL1 A;  4XLP F;  2YWA A;  3ABM C;  5E3C A;  2LSE A;  1YA9 A;  5EK0 A;  5DQT A;  5AGF A;  4LDR A;  3FAP B;  256B A;  3HNJ A;  4BPM A;  3FDQ A;  3NKD A;  2WVO A;  2OG2 A;  4GEH A;  1GS9 A;  3A11 A;  4EBB A;  3L34 A;  2LQG A;  1MMN A;  1KU2 A;  4O6M A;  2WVQ A;  4U5G A;  3UMH A;  1E85 A;  1VTM P;  2FAP B;  3LS1 A;  4P6I C;  4PJJ A;  3CQZ A;  4JRZ A;  4AX2 A;  1MMG A;  4BJ5 C;  1VOM A;  4EBJ A;  2XSE A;  1ZW2 A;  3ZWI A;  4JE9 A;  3MX3 A;  3OWT A;  2W45 A;  5B1A C;  1HE1 A;  2HZ8 A;  1EQ1 A;  4IJJ A;  3ZIB A;  1K05 A;  2DYS C;  5DQZ A;  3VF0 A;  1WOL A;  2XLH A;  2R7W A;  2LFD A;  4I1M A;  3K66 A;  5JS5 A;  2YLD A;  3NG1 A;  5JUA A;  4LAC B;  1F1M A;  5KYW B;  3WG7 C;  1V4A A;  2R25 A;  3S90 A;  2IBF A;  1VK5 A;  3AGT A;  3C7J A;  2H7V C;  3K33 A;  1Z63 A;  4U9D A;  1QVX A;  1FMW A;  3TJ5 A;  1EA8 A;  1ZU5 A;  4AL0 A;  3JRM O;  2XLM A;  3OA1 A;  5A6B D;  2J7P A;  3EQL F;  2R7V A;  2G3K A;  4MQ9 F;  5L3V A;  3FXH A;  1ZHT A;  2F22 A;  3EGX A;  1O3U A;  4JCZ A;  1XZP A;  2I15 A;  2Y3H A;  1Y6D A;  2W9Y A;  5KYX A;  3B0U X;  3S29 A;  2DYR C;  3RF3 A;  1D1B A;  3C63 A;  4IAR A;  3MYI A;  2HMZ A;  4CDA A;  4XLN F;  2A0U A;  2HUJ A;  2OCC C;  3F47 A;  4C3E A;  4EWC A;  3JSE O;  3NRH A;  4G7H F;  1VYI A;  2YZS A;  4YL0 A;  1R5I D;  2YL7 A;  4KBL A;  1T6I A;  3FOO A;  1CPR A;  2MHR A;  4W8K A;  4WGY A;  3DAF A;  3TOL A;  5L0F A;  3E70 C;  2V26 A;  1YYX A;  4I1O B;  1T6Q A;  2WZL A;  2Q4F A;  1L3P A;  1D0X A;  2J9V A;  2R05 A;  4OD4 A;  1LI5 A;  1A7E A;  2XLV A;  4QI0 A;  2R7U A;  2AWC A;  3C8G D;  3HNL A;  1QKR A;  2Q9A A;  2XL6 A;  2GFH A;  2IXN A;  3V5X A;  1XWJ A;  3PMR A;  1D1A A;  3GM3 A;  5F5H A;  2H7B A;  2B0H A;  4XEK A;  4J7Y A;  5EHH A;  1O87 A;  2QE9 A;  5D92 A;  2CNW A;  1AEP A;  1Z6A A;  4CJO A;  2OEV A;  3IQC A;  4JEB A;  2YL0 A;  1BR1 A;  3EH1 A;  4JW1 A;  2AVK A;  2NSG A;  3RIP A;  2YKZ A;  3TD7 A;  4BEM J;  2WVN A;  2UUH A;  1M6T A;  3M79 A;  4CSA C;  5DS5 A;  3FAJ A;  1YA7 O;  2R7S A;  4GYT A;  1M2O A;  4MND A;  2QNL A;  3RVZ A;  2L81 A;  4AE4 B;  2MWQ A;  3LAY A;  3GEI A;  5A6B A;  2D5R B;  1FFH A;  3PCV A;  3FVY A;  2A1D D;  1GQA A;  3I5Q A;  4FAP B;  2EIL C;  1S7Z A;  3MYF A;  4JEA A;  3AGU A;  3BEH A;  3JZ0 A;  3Q7G A;  4E7S A;  1HE9 A;  3TK0 A;  1E86 A;  4CIH A;  2A69 F;  1OR3 A;  2Y3G A;  3V5Z A;  3DKA A;  4ULV A;  2A0B A;  3X1O A;  2KGO A;  5E2Q A;  5E33 A;  3ZTM A;  4AK9 A;  1I4Y A;  2C03 A;  4O7G A;  1SF8 A;  3QZC A;  1OW7 A;  3AG2 C;  4XEV A;  4CJG A;  1KNY A;  2OJQ A;  3HNK A;  1T5O A;  3NYJ A;  4YK5 A;  4D4X A;  5KYW A;  4U5F E;  1MND A;  4K0D A;  4MTG A;  2Q9B A;  2MYS A;  4ONS A;  2KYH A;  4DRJ B;  3HLZ A;  3N24 A;  1U0B B;  2KJG A;  2IXM A;  5JSL A;  3SEO A;  3DE8 A;  1QPU A;  1YAR O;  4QDL A;  2Y3D A;  4JC7 A;  4MS2 A;  2P7V A;  3LLK A;  1R4T A;  3L0I A;  2J7P D;  1L7C A;  2XLE A;  1SZI A;  4O6N A;  1EKY A;  3K6B A;  4C3B A;  1D1C A;  2VH3 A;  2PNO A;  4PK4 A;  3S27 A;  3US6 A;  1Q0F A;  2TMV P;  3IQT A;  4IAQ A;  4BJ5 A;  1VLS A;  3C18 A;  1G8X A;  2M64 A;  4NTB A;  2LK4 A;  3O55 A;  1GGQ A;  1Q0D A;  1MQV A;  1TQG A;  2PF4 E;  3LUT B;  3IQ5 A;  2NPU A;  4C3D A;  2XS8 A;  2EPL X;  1TWA A;  3ECS A;  4JTD B;  4BJT A;  1NSG B;  4HE8 D;  3K1I A;  1RKE B;  4OD5 A;  4FES A;  1M2V B;  4MVM A;  2YRF A;  3DZA A;  2J0W A;  1OCR C;  1E83 A;  4XWJ A;  3EFO B;  2OU6 A;  4N06 A;  3RQF A;  5AC4 A;  2Y3B A;  1H6G A;  1BDJ B;  4FWV A;  5E3A A;  4L6R A;  2LIG A;  1JMW A;  3EZH A;  5DVW A;  5B3I A;  2HV6 A;  4OIQ F;  4IRU A;  3TOM A;  2ZXR A;  4RD9 A;  4G7Z F;  4CS9 C;  1RMV A;  2NUP A;  1H9G A;  4E0I A;  3I4U A;  3WHN A;  1QZX A;  5BQI A;  4I3M A;  3LLI A;  4RDA A;  4YN0 B;  2GAQ A;  5L3Q A;  5A6K A;  1YZA A;  2CNW D;  2QTV A;  1TWC A;  2XL4 A;  4OIO F;  2XRH A;  3UGP A;  3K1I C;  1G4W R;  1B68 A;  2WB7 A;  4ER9 A;  1W2W A;  5KYY B;  2RSE B;  5T3T A;  2O9X A;  3A9C A;  3FHD A;  4WGZ A;  3K1H A;  2DI3 A;  5T3W A;  3IQ6 A;  3U3F A;  1OW6 A;  4DRI B;  2A6E F;  3SXK A;  1GM5 A;  1A7V A;  2OJE D;  1VYK A;  4Q4Z F;  2JX0 A;  2J8W A;  1NU7 D;  4OIR F;  2KNH A;  4WAB A;  5HSW A;  4MW3 A;  2H7O A;  2XXA A;  3J06 A;  4G7O F;  1OCO C;  3SXM A;  2VCA A;  3U8V A;  2EIM C;  1Y4C A;  2XM0 A;  3EGD B;  3IHU A;  3GAN A;  3U9M A;  1SR2 A;  4MTF A;  1T9K A;  1VLT A;  2UUI A;  3GWL A;  4WJ0 A;  1JOG A;  4CBE A;  1AVO B;  3H2U A;  5B1B C;  1ORS C;  2NSF A;  3B0V C;  1Q0M A;  1DOV A;  5F5F A;  3QVY A;  3LNR A;  3E9V A;  2DGJ A;  3AQB A;  3HNI A;  2J9B A;  3S28 A;  2HJM A;  1V74 B;  3W2V A;  3V7O A;  4F4B A;  1LIH A;  1JRA A;  5FCL A;  2XLD A;  5JT4 A;  3UMI A;  2J9U A;  3ABK C;  2CGE A;  4Z9I A;  1I4Z A;  1BBH A;  4H54 A;  1G4U S;  4KC9 A;  2BE5 F;  3GEH A;  3KPH A;  2ZXW C;  5DS4 A;  4CSA A;  2R7T A;  2LFF A;  2HMQ A;  4XPW A;  1LS4 A;  4ULW A;  1V54 C;  2R9R B;  4MVS A;  2BC5 A;  4DVY P;  1V55 C;  1C02 A;  2ETS A;  2EIK C; 
#chains in the Genus database with same CATH homology
 1Q0K A;  1Q0M A;  1Q0D A;  3G50 A;  1Q0F A;  1T6U A;  1Q0G A;  4NCQ A;  1T6Q A;  1T6I A;  3G4X A;  3G4Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...