1O3UA

Crystal structure of an hepn domain protein (tm0613) from thermotoga maritima at 1.75 a resolution
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
126
structure length
120
Chain Sequence
HHHMDAAKDDLEHAKHDLEHGFYNWACFSSQQAAEKAVKAVFQRMGAQAWGYSVPDFLGELSSRFEIPEELMDHALELDKACDALPSGSPRNRYSRIEAERLVNYAEKIIRFCEDLLSRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords conserved hypothetical protein TM0613
publication title Crystal structure of an HEPN domain protein (TM0613) from Thermotoga maritima at 1.75 A resolution.
pubmed doi rcsb
source organism Thermotoga maritima
total genus 45
structure length 120
sequence length 126
ec nomenclature
pdb deposition date 2003-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05168 HEPN HEPN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 1o3uA00
3B71A 1UFBA 3GM3A 3RQFA 1OW8A 3C8GD 1WTYA 1OW6A 3GM1A 2Q00A 4EBKA 2JPUA 5F28E 1K04A 1WWPA 2YWAA 1ZZPA 3S9OA 4XEFA 3GM2A 4NQFA 3AJMA 2JX0A 3JZ0A 2L6HA 3RQEA 1PV3A 3MFNA 1JOGA 1K40A 1KTMA 3BRJA 4XEKA 4XEVA 3C8GA 1O3UA 3O10A 4R32A 3U3FA 1WOLA 3TULA 3U0CA 2L6GA 3K7DA 1KNYA 3L8IA 3RQGA 2KK1A 3C18A 3C8GB 2LK4A 4EBJA 1V4AA 2PBEA 1K05A 3L8JA 1QVXA 3JYYA 1OW7A 2HSBA 2L6FA
chains in the Genus database with same CATH superfamily
1Q0GA 2HJ3A 1MNEA 3UMHA 3HTKC 2LSEA 4QI0A 1TWCA 3KKBA 2PX0A 4MTGA 1DOWA 1B68A 1ZZPA 2NG1A 4FWVA 3FXHA 4O6YA 4YT4A 1JPNA 3DWWA 1APCA 1JAFA 1VYKA 3JYHA 3GODA 3TQOA 5L0HA 1S05A 2KW3C 1HMDA 4XTKA 2X51A 2Y39A 4H54A 1LS4A 1ZHWA 3GEHA 2OJQA 1V55C 1J8MF 2KC3A 2OEXA 4K7BA 4PFPA 4U5CE 5AGFA 4BEMJ 5DQTA 4CJOA 4NC3A 5BQIA 5JT4A 2OEVA 3S90A 3C8GA 1O3UA 3O10A 2YLIA 4JEBA 4KC9A 1OQCA 1MNDA 1ZVZA 3C8GB 3EH1A 5A6AA 2R7SA 4U5BE 2CDQA 1D1AA 2AWCA 3S28A 2GFHA 4G78A 5EHHA 1FNTc 2HKVA 2ZPAA 1NG1A 3AG2C 2XLHA 3EFOA 3H2UA 4CDVA 1QSPA 5E33A 4I3MA 1YZAA 1HE1A 3C7JA 2Y69C 4LDQA 2ZXRA 2A6EF 4YT2A 5L0CA 2NUTA 1BR4A 3M79A 2W9YA 1TQGA 4MTFA 2ZXPA 2HFIA 2R7QA 3VM6A 5A6BD 2NUTB 4AL0A 2AWYA 4JRZA 3EJNA 5E2QA 1RXQA 3U2LA 3GEEA 1WGWA 3NYLA 3SXKA 4D4NA 1QQ3A 1QPUA 4MNDA 3NMIA 3C18A 5BQHA 2OOCA 1JRAA 1LI7A 5HSWA 1HY5A 1QZXA 3A11A 1N1CA 2C03A 3L8JA 4YT5A 2HSBA 4NTAA 4D4XA 1FR0A 4JEAA 1Q0MA 4MVMA 2IXOA 1LE2A 1UFBA 2Y3HA 3SNHA 3AQBA 2CNWD 2EPOA 2ZXWC 3RF3A 1CPQA 2KGOA 1PD1A 1E83A 3S0XA 2EIJC 4FX5A 1HW2A 4ZLDA 4IAOA 256BA 3FHDA 3HNIA 3QW1A 3NKDA 3NMJA 3RH3A 4CDYA 2VC9A 2JX0A 2O9XA 3PMRA 4W8KA 3JSEO 2KSFA 3MFNA 4YK5A 2A0BA 4OD5A 4BJ6C 1KTMA 5L3VA 3JTLO 3RIPA 1R5ID 4XEKA 1YARO 4MVUA 4K0DA 1HW1A 4DOZA 4LDKA 3EZHA 4CS8C 2PNOA 4I1MA 2MYSA 1KNYA 3L8IA 2V26A 4CX9A 2J46A 1YVIA 2WZLA 3AOUA 2KK1A 2PF4E 3CQZA 2A69F 2IOQA 3HJCA 2EINC 4MS2A 3US6A 5KYYA 1GGQA 1J8YF 3EHNA 3RQFA 2XLVA 2G62A 3NMKA 2J7PD 1A0BA 4G7ZF 3M4CA 3JSZA 2J9UA 5L0JA 5KYYB 1UG7A 2LFDA 2FFHA 1Z63A 1O5HA 4YJWA 4YWQA 1MQVA 4BJ6A 4JJFA 1ORSC 1U89A 1DOVA 2BC5A 3ASNC 1E86A 5JSLA 3L1MA 1EI7A 3KYJA 4CS8A 4I1OB 5COMA 3OA1A 4J7TA 1T6UA 5K0IA 1E84A 2CGEA 2J9BA 3PCVA 4NTFA 1HMOA 1WASA 4E17A 2Y3BA 4QI2A 3LEVA 3W2WA 4ONSA 5D92A 3EHMA 3U8VA 5T3WA 3S84A 2XLDA 3FDQA 2XLWA 2YHSA 1BR1A 2H7VC 5DQZA 3GEIA 5KYUA 4N06A 4YL0A 1ZU5A 2DI3A 1VMAA 3Q7LA 1Q0FA 3ZSUA 3PDMP 2YKZA 4ULVA 4U5EE 1YA9A 4AE4A 3CAXA 3EPVA 2G3VA 2QUPA 4DVYP 1YLMA 3LNMB 4Q4ZF 5FZTA 4EBKA 1CGOA 1MMGA 5JLIA 1F1MA 1LVKA 1WWPA 2QNLA 2YWAA 3SP1A 1Z3IX 1AUEA 3LNRA 3B9QA 3SZRA 3RKOF 4BJ5C 1RCPA 1WN0A 3N2ZB 4GYTA 2L6HA 3K1HA 5BQGA 5A69A 3U9JA 4DVZA 3ABLC 3QW0A 4W8PA 2DYRC 2QE9A 2WVNA 3LS1A 2LIGA 3RVYA 2WL8A 5E3AA 1OCCC 2I15A 2YLGA 3TD7A 3TJ5A 3ZWIA 4B6IA 1OXBA 1XZQA 1V54C 3DE8A 3IQCA 2LK4A 4OIRF 2PBEA 2J45A 3ZC4A 1FTSA 4KI2A 1M2OA 5COGA 4J7YA 1JPJA 1M6TA 4GQHA 1R4TA 4ANJA 1BZ4A 1U0BB 2DGJA 4BJ5A 1L3PA 3JT1A 4XQ1A 5A6BA 4Z9JA 5KYWB 3UGOA 3FOOA 2QY9A 4BJ1A 2ZXOA 3NYJA 1YAUO 5EK0A 4JZAA 4MVZA 3ZDLA 1C02A 4QDLA 1U6HA 2Y3GA 4O6MA 3ATPA 5F5HA 3N0TA 1ZHYA 3IQ6A 1FMVA 2CNWA 4P9TA 3K33A 2EPLX 4Z9HA 1M57C 4ULWA 1TKNA 4JVSA 3V5ZA 3LJBA 3WAQA 3JCUQ 3J06A 4CBEA 3KH2A 1JMWA 4EBJA 1MMAA 1ZYRF 2HUJA 3LLKA 1QVXA 4U5GA 3UMIA 3X1OA 1ST6A 1LM3B 1HE9A 3L34A 4I44A 3SXZA 2L7AA 1T01A 4DRIB 1WTYA 3V7OA 3MLGA 4AK9A 2VCCA 3OWTA 2W4MA 4K1OA 1L7CA 1TWHA 2R7OA 5T3TA 2PX3A 3WHNA 3CZ6A 5DS4A 3IQ5A 1E2XA 1AEPA 1H7IA 1RKCA 3N24A 2TMVP 4OIOF 4E18A 4OIPF 4Z9IA 1FFTC 2ASRA 3TOMA 3AG4C 3T6JA 2HV7A 2GDCA 1ZW2A 2CCYA 2NSFA 2YZSA 2R7UA 3T4RA 4JIOA 2NUPB 3LUTB 2XRHA 1QLEC 1YJGA 3B0PA 3IEEA 4XPWA 4ZLCA 5B3SC 3RFYA 1D0ZA 3DAFA 2A0UA 3DKAA 3KYIA 5DS5A 3CSKA 1RMVA 2J7PA 3TULA 2DYSC 1C03A 1GS9A 1Y4CA 1LE4A 2L6GA 1QKRA 3E70C 4LDRA 1V74B 4RD9A 2F22A 5KYXB 4YL3A 5FCLA 2R7XA 2L81A 2P6VA 1G4WR 3F47A 3K6BA 4U9EA 3HLZA 5E3CA 3W8HA 1OCRC 2AP3A 3O39A 2RD9A 2EILC 1YYXA 2J0WA 1AVOB 1H9TA 4JE9A 5JRAA 3FVYA 5DVWA 1SR2A 2A6HF 4MQ9F 2JPUA 5COFA 2PP4A 2P0NA 4HEAJ 2EPKX 2HV6A 2XLOA 5D91A 2H7OA 3GWNA 4AL1A 1WATA 4PJJA 2XM0A 3C63A 3JRTA 3LS0A 4JW1A 4N6HA 4YT8A 2YRFA 4MTOA 4EBBA 1I4YA 1NU9C 4XLPF 2YLDA 4C3EA 3SEOA 2GA0A 2WZFA 3ZG1A 2EIMC 4E0IA 4MW8A 1T9KA 1SZIA 2BE5F 3B29A 2GWWA 4N4WA 1PD0A 4IJJA 5JP7A 2EPMX 2PFDA 3G4XA 2XXAA 2XS1A 3LEOA 4EHPA 3EGXA 5HV9A 4LACB 4IRUA 2XXAB 3GM3A 1VB5A 1PCXA 3EGXB 3NYMA 4PJNA 2XL6A 2A1DD 3H2VA 1LI5A 4IARA 4DXWA 4PK4A 1XWJA 2J9VA 1D1CA 3W4YA 3EH2A 5L0IA 4U9DA 1LS1A 1VLTA 4E7SA 3AJMA 2OU6A 4XWJA 3I5PA 1C17M 5TJ5E 3U3BA 2Q3TA 1ORYA 4N6CA 3NKEA 2HSQA 2YL3A 3Q6NA 4JTAB 3R7CA 2FAPB 3T6GB 4CIPA 4E7ZA 2VASA 3BRJA 3AGUA 1Q0KA 1BR2A 1WOLA 5A6JA 1M56C 3U0CA 2HZ8A 1LPEA 2Z15A 3KPHA 2RSEB 2XL8A 1I4ZA 4JTDB 3UNGC 2YL0A 1D1BA 1V4AA 2P1AA 2IBFA 4O6NA 5JVEA 4DBRA 5EGYA 4CSAC 3QTHA 4J30B 2CW0F 1A7EA 2VH3A 3M4BA 4BJTA 3B0UX 1VK5A 1CPRA 1ZHXA 2Y3DA 1GM5A 1LKXA 3OEOA 4NTBA 4CDAA 4OIQF 4DJ9A 5L3QA 4JCHA 1MMDA 1EA8A 4L6RA 3AQCA 2J8WA 1NSGB 3GM2A 4FESA 1D0XA 1ZHTA 2EPNA 1T5OA 3FMSA 5CI8A 1M2VA 3EZIA 4XLNF 5L0GA 2Q4FA 3RQEA 2KJGA 4OD4A 2OKUA 2IXPA 3AG1C 2EIKC 3HNLA 3LESA 3SXMA 4HFFB 1M2VB 4IAQA 4CS9C 4XEVA 3MX3A 2HJMA 2QTVA 2R05A 3Q7GA 3ZTMA 1SF8A 2OG2A 3K7DA 1TFKB 4DRJB 3DJUB 2YQYA 1VOMA 4CSAA 2JD3A 2HMZA 3DM5A 2H8AA 2C04A 2VB6A 2D5RB 3GANA 4Q5SF 2UUHA 3E9VA 1A7DA 3O6XA 3AG3C 2M4EA 1A7VA 4WJ0A 5KYWA 2R7WA 1O87A 1YA7O 3GM1A 3M15A 2KNHA 2MWQA 2LQGA 3DMDA 3K66A 1NFNA 4WGZA 4PACA 2D4UA 3C8ZA 4JTCB 1OKKD 4PJLA 3GORA 2I8BA 2YL1A 5JS5A 1IW7F 4WGYA 4LLCA 1VYIA 2R9RB 4H4KC 1JOGA 5DS6A 5JUAA 2R25A 3MBGA 2P7VA 3VYWA 2W45A 1G4US 2WVOA 4U5FE 1FAPB 1RJ9B 1VLSA 1TWGA 2AU5A 3U3FA 5B1AC 1IZMA 4IGGA 4BG0A 3C62A 3ABMC 3DM9B 4HE8D 4DBQA 4JKVA 3I5QA 3ZVRA 2LFFA 3B0VC 3G50A 4RDAA 4BPMA 3W8IA 1ZHZA 3DI5A 4O7GA 3M1CB 2Q00A 4MVOA 1OR3A 2AVKA 5F28E 2IXNA 2LCHA 3H65A 3ZTZA 4WABA 3QVZA 3NDBB 2WB7A 2NUPA 3G4ZA 3TK0A 1ORJA 3F46A 4EWCA 3ZIBA 1ZW3A 2XM4A 3S29A 1K40A 2P61A 1TR2A 3UGPA 5KYXA 2NPUA 2WZGA 1KU2A 1TFOB 3RVZA 3RQGA 2VCAA 3DD7A 3ZQVA 2YEVA 1JR8A 3EQLF 4YN0B 3ZQYA 4LERA 1OW6A 1SYQA 1T6IA 3IPMO 5BUOA 3LAYA 2OQMA 4A4AA 4IWBA 4OINF 4JJGA 3S9OA 2M64A 2VCBA 2R7RA 4C7OA 3EFOB 4X0RA 3A9CA 4GEHA 1Q0DA 3TJ6A 2ICWG 2WVQA 3KMIA 4XPYA 5IY5C 4C7OB 3UMKA 3VAYA 1D0YA 3HKKA 4A2NB 5GPGB 4CJGA 1VTMP 2Q9CA 3FOPA 1XZPA 3NG1A 4EUKB 1EQ1A 4NCQA 1EKYA 3QZCA 3MYIA 3AGTA 4JCZA 2IYLD 4R32A 3POVA 4CIHA 3RW0A 2B0JA 4XPXA 2QLAA 1FMWA 3U2MA 2R03A 3DXJF 2GAQA 4KNWA 4C3BA 4CS7A 1OW7A 2FGYA 3WODF 1T6QA 5B1BC 2V3CC 2X0CA 4HFKB 4M63A 2Q9BA 3C8GD 4RBNA 3ASOC 4JURI 4O79A 3S27A 1H9GA 1NFOA 3WG7C 1TWAA 5F5FA 2OJED 1K04A 3EG9A 3I4UA 4FAPB 4ER9A 5L0FA 2MHRA 2Q9AA 3EG9B 3JZ0A 4P6IC 2R7VA 2XL4A 3ABKC 3UR3C 1LIHA 1ZU4A 1GQAA 4MVRA 5KYNA 4MVSA 1E85A 2XSEA 2YL7A 3K1IC 1OXKA 3SXYA 1CGNA 1H6GA 1G5ZA 1YYJA 4G7OF 3ITFA 4IB4A 3SYNA 3LLIA 4NY3A 3VF0A 5AC4A 2R7TA 4KBLA 4UDVA 1OKKA 3NRHA 3DAGA 3QVYA 1I5NA 1NU7D 4DRHB 3U5SA 4E0HA 2BL2A 3B71A 3V5XA 2LD6A 1Z23A 3FAJA 3KL4A 1OW8A 2IXMA 2H7BA 2R02A 2Q7RA 2IM8A 3GWLA 1OCZC 1Z5ZA 2KQ9A 1OR2A 1Z7Qc 3TOLA 2DB4A 2XS8A 1Z6AA 4J32B 1BBHA 4XEFA 4NQFA 2L9JA 2HMQA 3DJNB 4YL1A 3R2PA 4F4BA 3ECSA 3K1IA 3O55A 1CGME 2LP4A 2E87A 1NBBA 1Y6DA 1NLXA 5T1DB 1NZEA 3U9MA 4BEJA 3BEHA 3V5YA 4Q7CA 3PHF2 1FFHA 2J0XA 3EGDA 4PJMA 1S7ZA 4PFOA 5CIVA 4P9FA 4LLEA 3T9OA 3Q6MA 4U5DE 5CI9A 2HS5A 2YVKA 3QMKA 3EGDB 1A41A 4G0HA 1K05A 2J9WA 2G3KA 4MW3A 4EIYA 5AC5A 2L6FA 1SMYF 5KYUB 2UUIA 4MVQA 1G8XA 5B3IA 3U8PA 2ZD9A 1W2WA 3IHUA 5L0DA 4AE4B 3DZAA 3RYLA 3W2VA 1BDJB 3L0IA 1RKEA 2A68F 1YZCA 2XLEA 3X2QC 2W4BA 4JC7A 1PV3A 1MMNA 1RKEB 4KNVA 4CS9A 5A6KA 1OCOC 1RJ9A 2B0HA 3IQTA 2OCCC 4G7HF 2NSGA 3JRMO 4AX2A 3T6BA 4EKWA 1YDIA 3DE9A 3MYFA 4PR9A 4U5HA 2KYHA 3FAPB 4C3DA 2CYDA 3CEXA 5DLJA 2ETSA 3HNKA 3VRCA 3HNJA 3JYYA 2XLMA
chains in the Genus database with same CATH topology
3B71A 1UFBA 3GM3A 3RQFA 1OW8A 3C8GD 1WTYA 1OW6A 3GM1A 2Q00A 4EBKA 2JPUA 5F28E 1K04A 1WWPA 2YWAA 1ZZPA 3S9OA 4XEFA 3GM2A 4NQFA 3AJMA 2JX0A 3JZ0A 2L6HA 3RQEA 1PV3A 3MFNA 1JOGA 1K40A 1KTMA 3BRJA 4XEKA 4XEVA 3C8GA 1O3UA 3O10A 4R32A 3U3FA 1WOLA 3TULA 3U0CA 2L6GA 3K7DA 1KNYA 3L8IA 3RQGA 2KK1A 3C18A 3C8GB 2LK4A 4EBJA 1V4AA 2PBEA 1K05A 3L8JA 1QVXA 3JYYA 1OW7A 2HSBA 2L6FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B71 A;  1UFB A;  3GM3 A;  3RQF A;  1OW8 A;  3C8G D;  1WTY A;  1OW6 A;  3GM1 A;  2Q00 A;  4EBK A;  2JPU A;  5F28 E;  1K04 A;  1WWP A;  2YWA A;  1ZZP A;  3S9O A;  4XEF A;  3GM2 A;  4NQF A;  3AJM A;  2JX0 A;  3JZ0 A;  2L6H A;  3RQE A;  1PV3 A;  3MFN A;  1JOG A;  1K40 A;  1KTM A;  3BRJ A;  4XEK A;  4XEV A;  3C8G A;  1O3U A;  3O10 A;  4R32 A;  3U3F A;  1WOL A;  3TUL A;  3U0C A;  2L6G A;  3K7D A;  1KNY A;  3L8I A;  3RQG A;  2KK1 A;  3C18 A;  3C8G B;  2LK4 A;  4EBJ A;  1V4A A;  2PBE A;  1K05 A;  3L8J A;  1QVX A;  3JYY A;  1OW7 A;  2HSB A;  2L6F A; 
#chains in the Genus database with same CATH topology
 1Q0G A;  2HJ3 A;  1MNE A;  3UMH A;  3HTK C;  2LSE A;  4QI0 A;  1TWC A;  3KKB A;  2PX0 A;  4MTG A;  1DOW A;  1B68 A;  1ZZP A;  2NG1 A;  4FWV A;  3FXH A;  4O6Y A;  4YT4 A;  1JPN A;  3DWW A;  1APC A;  1JAF A;  1VYK A;  3JYH A;  3GOD A;  3TQO A;  5L0H A;  1S05 A;  2KW3 C;  1HMD A;  4XTK A;  2X51 A;  2Y39 A;  4H54 A;  1LS4 A;  1ZHW A;  3GEH A;  2OJQ A;  1V55 C;  1J8M F;  2KC3 A;  2OEX A;  4K7B A;  4PFP A;  4U5C E;  5AGF A;  4BEM J;  5DQT A;  4CJO A;  4NC3 A;  5BQI A;  5JT4 A;  2OEV A;  3S90 A;  3C8G A;  1O3U A;  3O10 A;  2YLI A;  4JEB A;  4KC9 A;  1OQC A;  1MND A;  1ZVZ A;  3C8G B;  3EH1 A;  5A6A A;  2R7S A;  4U5B E;  2CDQ A;  1D1A A;  2AWC A;  3S28 A;  2GFH A;  4G78 A;  5EHH A;  1FNT c;  2HKV A;  2ZPA A;  1NG1 A;  3AG2 C;  2XLH A;  3EFO A;  3H2U A;  4CDV A;  1QSP A;  5E33 A;  4I3M A;  1YZA A;  1HE1 A;  3C7J A;  2Y69 C;  4LDQ A;  2ZXR A;  2A6E F;  4YT2 A;  5L0C A;  2NUT A;  1BR4 A;  3M79 A;  2W9Y A;  1TQG A;  4MTF A;  2ZXP A;  2HFI A;  2R7Q A;  3VM6 A;  5A6B D;  2NUT B;  4AL0 A;  2AWY A;  4JRZ A;  3EJN A;  5E2Q A;  1RXQ A;  3U2L A;  3GEE A;  1WGW A;  3NYL A;  3SXK A;  4D4N A;  1QQ3 A;  1QPU A;  4MND A;  3NMI A;  3C18 A;  5BQH A;  2OOC A;  1JRA A;  1LI7 A;  5HSW A;  1HY5 A;  1QZX A;  3A11 A;  1N1C A;  2C03 A;  3L8J A;  4YT5 A;  2HSB A;  4NTA A;  4D4X A;  1FR0 A;  4JEA A;  1Q0M A;  4MVM A;  2IXO A;  1LE2 A;  1UFB A;  2Y3H A;  3SNH A;  3AQB A;  2CNW D;  2EPO A;  2ZXW C;  3RF3 A;  1CPQ A;  2KGO A;  1PD1 A;  1E83 A;  3S0X A;  2EIJ C;  4FX5 A;  1HW2 A;  4ZLD A;  4IAO A;  256B A;  3FHD A;  3HNI A;  3QW1 A;  3NKD A;  3NMJ A;  3RH3 A;  4CDY A;  2VC9 A;  2JX0 A;  2O9X A;  3PMR A;  4W8K A;  3JSE O;  2KSF A;  3MFN A;  4YK5 A;  2A0B A;  4OD5 A;  4BJ6 C;  1KTM A;  5L3V A;  3JTL O;  3RIP A;  1R5I D;  4XEK A;  1YAR O;  4MVU A;  4K0D A;  1HW1 A;  4DOZ A;  4LDK A;  3EZH A;  4CS8 C;  2PNO A;  4I1M A;  2MYS A;  1KNY A;  3L8I A;  2V26 A;  4CX9 A;  2J46 A;  1YVI A;  2WZL A;  3AOU A;  2KK1 A;  2PF4 E;  3CQZ A;  2A69 F;  2IOQ A;  3HJC A;  2EIN C;  4MS2 A;  3US6 A;  5KYY A;  1GGQ A;  1J8Y F;  3EHN A;  3RQF A;  2XLV A;  2G62 A;  3NMK A;  2J7P D;  1A0B A;  4G7Z F;  3M4C A;  3JSZ A;  2J9U A;  5L0J A;  5KYY B;  1UG7 A;  2LFD A;  2FFH A;  1Z63 A;  1O5H A;  4YJW A;  4YWQ A;  1MQV A;  4BJ6 A;  4JJF A;  1ORS C;  1U89 A;  1DOV A;  2BC5 A;  3ASN C;  1E86 A;  5JSL A;  3L1M A;  1EI7 A;  3KYJ A;  4CS8 A;  4I1O B;  5COM A;  3OA1 A;  4J7T A;  1T6U A;  5K0I A;  1E84 A;  2CGE A;  2J9B A;  3PCV A;  4NTF A;  1HMO A;  1WAS A;  4E17 A;  2Y3B A;  4QI2 A;  3LEV A;  3W2W A;  4ONS A;  5D92 A;  3EHM A;  3U8V A;  5T3W A;  3S84 A;  2XLD A;  3FDQ A;  2XLW A;  2YHS A;  1BR1 A;  2H7V C;  5DQZ A;  3GEI A;  5KYU A;  4N06 A;  4YL0 A;  1ZU5 A;  2DI3 A;  1VMA A;  3Q7L A;  1Q0F A;  3ZSU A;  3PDM P;  2YKZ A;  4ULV A;  4U5E E;  1YA9 A;  4AE4 A;  3CAX A;  3EPV A;  2G3V A;  2QUP A;  4DVY P;  1YLM A;  3LNM B;  4Q4Z F;  5FZT A;  4EBK A;  1CGO A;  1MMG A;  5JLI A;  1F1M A;  1LVK A;  1WWP A;  2QNL A;  2YWA A;  3SP1 A;  1Z3I X;  1AUE A;  3LNR A;  3B9Q A;  3SZR A;  3RKO F;  4BJ5 C;  1RCP A;  1WN0 A;  3N2Z B;  4GYT A;  2L6H A;  3K1H A;  5BQG A;  5A69 A;  3U9J A;  4DVZ A;  3ABL C;  3QW0 A;  4W8P A;  2DYR C;  2QE9 A;  2WVN A;  3LS1 A;  2LIG A;  3RVY A;  2WL8 A;  5E3A A;  1OCC C;  2I15 A;  2YLG A;  3TD7 A;  3TJ5 A;  3ZWI A;  4B6I A;  1OXB A;  1XZQ A;  1V54 C;  3DE8 A;  3IQC A;  2LK4 A;  4OIR F;  2PBE A;  2J45 A;  3ZC4 A;  1FTS A;  4KI2 A;  1M2O A;  5COG A;  4J7Y A;  1JPJ A;  1M6T A;  4GQH A;  1R4T A;  4ANJ A;  1BZ4 A;  1U0B B;  2DGJ A;  4BJ5 A;  1L3P A;  3JT1 A;  4XQ1 A;  5A6B A;  4Z9J A;  5KYW B;  3UGO A;  3FOO A;  2QY9 A;  4BJ1 A;  2ZXO A;  3NYJ A;  1YAU O;  5EK0 A;  4JZA A;  4MVZ A;  3ZDL A;  1C02 A;  4QDL A;  1U6H A;  2Y3G A;  4O6M A;  3ATP A;  5F5H A;  3N0T A;  1ZHY A;  3IQ6 A;  1FMV A;  2CNW A;  4P9T A;  3K33 A;  2EPL X;  4Z9H A;  1M57 C;  4ULW A;  1TKN A;  4JVS A;  3V5Z A;  3LJB A;  3WAQ A;  3JCU Q;  3J06 A;  4CBE A;  3KH2 A;  1JMW A;  4EBJ A;  1MMA A;  1ZYR F;  2HUJ A;  3LLK A;  1QVX A;  4U5G A;  3UMI A;  3X1O A;  1ST6 A;  1LM3 B;  1HE9 A;  3L34 A;  4I44 A;  3SXZ A;  2L7A A;  1T01 A;  4DRI B;  1WTY A;  3V7O A;  3MLG A;  4AK9 A;  2VCC A;  3OWT A;  2W4M A;  4K1O A;  1L7C A;  1TWH A;  2R7O A;  5T3T A;  2PX3 A;  3WHN A;  3CZ6 A;  5DS4 A;  3IQ5 A;  1E2X A;  1AEP A;  1H7I A;  1RKC A;  3N24 A;  2TMV P;  4OIO F;  4E18 A;  4OIP F;  4Z9I A;  1FFT C;  2ASR A;  3TOM A;  3AG4 C;  3T6J A;  2HV7 A;  2GDC A;  1ZW2 A;  2CCY A;  2NSF A;  2YZS A;  2R7U A;  3T4R A;  4JIO A;  2NUP B;  3LUT B;  2XRH A;  1QLE C;  1YJG A;  3B0P A;  3IEE A;  4XPW A;  4ZLC A;  5B3S C;  3RFY A;  1D0Z A;  3DAF A;  2A0U A;  3DKA A;  3KYI A;  5DS5 A;  3CSK A;  1RMV A;  2J7P A;  3TUL A;  2DYS C;  1C03 A;  1GS9 A;  1Y4C A;  1LE4 A;  2L6G A;  1QKR A;  3E70 C;  4LDR A;  1V74 B;  4RD9 A;  2F22 A;  5KYX B;  4YL3 A;  5FCL A;  2R7X A;  2L81 A;  2P6V A;  1G4W R;  3F47 A;  3K6B A;  4U9E A;  3HLZ A;  5E3C A;  3W8H A;  1OCR C;  2AP3 A;  3O39 A;  2RD9 A;  2EIL C;  1YYX A;  2J0W A;  1AVO B;  1H9T A;  4JE9 A;  5JRA A;  3FVY A;  5DVW A;  1SR2 A;  2A6H F;  4MQ9 F;  2JPU A;  5COF A;  2PP4 A;  2P0N A;  4HEA J;  2EPK X;  2HV6 A;  2XLO A;  5D91 A;  2H7O A;  3GWN A;  4AL1 A;  1WAT A;  4PJJ A;  2XM0 A;  3C63 A;  3JRT A;  3LS0 A;  4JW1 A;  4N6H A;  4YT8 A;  2YRF A;  4MTO A;  4EBB A;  1I4Y A;  1NU9 C;  4XLP F;  2YLD A;  4C3E A;  3SEO A;  2GA0 A;  2WZF A;  3ZG1 A;  2EIM C;  4E0I A;  4MW8 A;  1T9K A;  1SZI A;  2BE5 F;  3B29 A;  2GWW A;  4N4W A;  1PD0 A;  4IJJ A;  5JP7 A;  2EPM X;  2PFD A;  3G4X A;  2XXA A;  2XS1 A;  3LEO A;  4EHP A;  3EGX A;  5HV9 A;  4LAC B;  4IRU A;  2XXA B;  3GM3 A;  1VB5 A;  1PCX A;  3EGX B;  3NYM A;  4PJN A;  2XL6 A;  2A1D D;  3H2V A;  1LI5 A;  4IAR A;  4DXW A;  4PK4 A;  1XWJ A;  2J9V A;  1D1C A;  3W4Y A;  3EH2 A;  5L0I A;  4U9D A;  1LS1 A;  1VLT A;  4E7S A;  3AJM A;  2OU6 A;  4XWJ A;  3I5P A;  1C17 M;  5TJ5 E;  3U3B A;  2Q3T A;  1ORY A;  4N6C A;  3NKE A;  2HSQ A;  2YL3 A;  3Q6N A;  4JTA B;  3R7C A;  2FAP B;  3T6G B;  4CIP A;  4E7Z A;  2VAS A;  3BRJ A;  3AGU A;  1Q0K A;  1BR2 A;  1WOL A;  5A6J A;  1M56 C;  3U0C A;  2HZ8 A;  1LPE A;  2Z15 A;  3KPH A;  2RSE B;  2XL8 A;  1I4Z A;  4JTD B;  3UNG C;  2YL0 A;  1D1B A;  1V4A A;  2P1A A;  2IBF A;  4O6N A;  5JVE A;  4DBR A;  5EGY A;  4CSA C;  3QTH A;  4J30 B;  2CW0 F;  1A7E A;  2VH3 A;  3M4B A;  4BJT A;  3B0U X;  1VK5 A;  1CPR A;  1ZHX A;  2Y3D A;  1GM5 A;  1LKX A;  3OEO A;  4NTB A;  4CDA A;  4OIQ F;  4DJ9 A;  5L3Q A;  4JCH A;  1MMD A;  1EA8 A;  4L6R A;  3AQC A;  2J8W A;  1NSG B;  3GM2 A;  4FES A;  1D0X A;  1ZHT A;  2EPN A;  1T5O A;  3FMS A;  5CI8 A;  1M2V A;  3EZI A;  4XLN F;  5L0G A;  2Q4F A;  3RQE A;  2KJG A;  4OD4 A;  2OKU A;  2IXP A;  3AG1 C;  2EIK C;  3HNL A;  3LES A;  3SXM A;  4HFF B;  1M2V B;  4IAQ A;  4CS9 C;  4XEV A;  3MX3 A;  2HJM A;  2QTV A;  2R05 A;  3Q7G A;  3ZTM A;  1SF8 A;  2OG2 A;  3K7D A;  1TFK B;  4DRJ B;  3DJU B;  2YQY A;  1VOM A;  4CSA A;  2JD3 A;  2HMZ A;  3DM5 A;  2H8A A;  2C04 A;  2VB6 A;  2D5R B;  3GAN A;  4Q5S F;  2UUH A;  3E9V A;  1A7D A;  3O6X A;  3AG3 C;  2M4E A;  1A7V A;  4WJ0 A;  5KYW A;  2R7W A;  1O87 A;  1YA7 O;  3GM1 A;  3M15 A;  2KNH A;  2MWQ A;  2LQG A;  3DMD A;  3K66 A;  1NFN A;  4WGZ A;  4PAC A;  2D4U A;  3C8Z A;  4JTC B;  1OKK D;  4PJL A;  3GOR A;  2I8B A;  2YL1 A;  5JS5 A;  1IW7 F;  4WGY A;  4LLC A;  1VYI A;  2R9R B;  4H4K C;  1JOG A;  5DS6 A;  5JUA A;  2R25 A;  3MBG A;  2P7V A;  3VYW A;  2W45 A;  1G4U S;  2WVO A;  4U5F E;  1FAP B;  1RJ9 B;  1VLS A;  1TWG A;  2AU5 A;  3U3F A;  5B1A C;  1IZM A;  4IGG A;  4BG0 A;  3C62 A;  3ABM C;  3DM9 B;  4HE8 D;  4DBQ A;  4JKV A;  3I5Q A;  3ZVR A;  2LFF A;  3B0V C;  3G50 A;  4RDA A;  4BPM A;  3W8I A;  1ZHZ A;  3DI5 A;  4O7G A;  3M1C B;  2Q00 A;  4MVO A;  1OR3 A;  2AVK A;  5F28 E;  2IXN A;  2LCH A;  3H65 A;  3ZTZ A;  4WAB A;  3QVZ A;  3NDB B;  2WB7 A;  2NUP A;  3G4Z A;  3TK0 A;  1ORJ A;  3F46 A;  4EWC A;  3ZIB A;  1ZW3 A;  2XM4 A;  3S29 A;  1K40 A;  2P61 A;  1TR2 A;  3UGP A;  5KYX A;  2NPU A;  2WZG A;  1KU2 A;  1TFO B;  3RVZ A;  3RQG A;  2VCA A;  3DD7 A;  3ZQV A;  2YEV A;  1JR8 A;  3EQL F;  4YN0 B;  3ZQY A;  4LER A;  1OW6 A;  1SYQ A;  1T6I A;  3IPM O;  5BUO A;  3LAY A;  2OQM A;  4A4A A;  4IWB A;  4OIN F;  4JJG A;  3S9O A;  2M64 A;  2VCB A;  2R7R A;  4C7O A;  3EFO B;  4X0R A;  3A9C A;  4GEH A;  1Q0D A;  3TJ6 A;  2ICW G;  2WVQ A;  3KMI A;  4XPY A;  5IY5 C;  4C7O B;  3UMK A;  3VAY A;  1D0Y A;  3HKK A;  4A2N B;  5GPG B;  4CJG A;  1VTM P;  2Q9C A;  3FOP A;  1XZP A;  3NG1 A;  4EUK B;  1EQ1 A;  4NCQ A;  1EKY A;  3QZC A;  3MYI A;  3AGT A;  4JCZ A;  2IYL D;  4R32 A;  3POV A;  4CIH A;  3RW0 A;  2B0J A;  4XPX A;  2QLA A;  1FMW A;  3U2M A;  2R03 A;  3DXJ F;  2GAQ A;  4KNW A;  4C3B A;  4CS7 A;  1OW7 A;  2FGY A;  3WOD F;  1T6Q A;  5B1B C;  2V3C C;  2X0C A;  4HFK B;  4M63 A;  2Q9B A;  3C8G D;  4RBN A;  3ASO C;  4JUR I;  4O79 A;  3S27 A;  1H9G A;  1NFO A;  3WG7 C;  1TWA A;  5F5F A;  2OJE D;  1K04 A;  3EG9 A;  3I4U A;  4FAP B;  4ER9 A;  5L0F A;  2MHR A;  2Q9A A;  3EG9 B;  3JZ0 A;  4P6I C;  2R7V A;  2XL4 A;  3ABK C;  3UR3 C;  1LIH A;  1ZU4 A;  1GQA A;  4MVR A;  5KYN A;  4MVS A;  1E85 A;  2XSE A;  2YL7 A;  3K1I C;  1OXK A;  3SXY A;  1CGN A;  1H6G A;  1G5Z A;  1YYJ A;  4G7O F;  3ITF A;  4IB4 A;  3SYN A;  3LLI A;  4NY3 A;  3VF0 A;  5AC4 A;  2R7T A;  4KBL A;  4UDV A;  1OKK A;  3NRH A;  3DAG A;  3QVY A;  1I5N A;  1NU7 D;  4DRH B;  3U5S A;  4E0H A;  2BL2 A;  3B71 A;  3V5X A;  2LD6 A;  1Z23 A;  3FAJ A;  3KL4 A;  1OW8 A;  2IXM A;  2H7B A;  2R02 A;  2Q7R A;  2IM8 A;  3GWL A;  1OCZ C;  1Z5Z A;  2KQ9 A;  1OR2 A;  1Z7Q c;  3TOL A;  2DB4 A;  2XS8 A;  1Z6A A;  4J32 B;  1BBH A;  4XEF A;  4NQF A;  2L9J A;  2HMQ A;  3DJN B;  4YL1 A;  3R2P A;  4F4B A;  3ECS A;  3K1I A;  3O55 A;  1CGM E;  2LP4 A;  2E87 A;  1NBB A;  1Y6D A;  1NLX A;  5T1D B;  1NZE A;  3U9M A;  4BEJ A;  3BEH A;  3V5Y A;  4Q7C A;  3PHF 2;  1FFH A;  2J0X A;  3EGD A;  4PJM A;  1S7Z A;  4PFO A;  5CIV A;  4P9F A;  4LLE A;  3T9O A;  3Q6M A;  4U5D E;  5CI9 A;  2HS5 A;  2YVK A;  3QMK A;  3EGD B;  1A41 A;  4G0H A;  1K05 A;  2J9W A;  2G3K A;  4MW3 A;  4EIY A;  5AC5 A;  2L6F A;  1SMY F;  5KYU B;  2UUI A;  4MVQ A;  1G8X A;  5B3I A;  3U8P A;  2ZD9 A;  1W2W A;  3IHU A;  5L0D A;  4AE4 B;  3DZA A;  3RYL A;  3W2V A;  1BDJ B;  3L0I A;  1RKE A;  2A68 F;  1YZC A;  2XLE A;  3X2Q C;  2W4B A;  4JC7 A;  1PV3 A;  1MMN A;  1RKE B;  4KNV A;  4CS9 A;  5A6K A;  1OCO C;  1RJ9 A;  2B0H A;  3IQT A;  2OCC C;  4G7H F;  2NSG A;  3JRM O;  4AX2 A;  3T6B A;  4EKW A;  1YDI A;  3DE9 A;  3MYF A;  4PR9 A;  4U5H A;  2KYH A;  3FAP B;  4C3D A;  2CYD A;  3CEX A;  5DLJ A;  2ETS A;  3HNK A;  3VRC A;  3HNJ A;  3JYY A;  2XLM A; 
#chains in the Genus database with same CATH homology
 3B71 A;  1UFB A;  3GM3 A;  3RQF A;  1OW8 A;  3C8G D;  1WTY A;  1OW6 A;  3GM1 A;  2Q00 A;  4EBK A;  2JPU A;  5F28 E;  1K04 A;  1WWP A;  2YWA A;  1ZZP A;  3S9O A;  4XEF A;  3GM2 A;  4NQF A;  3AJM A;  2JX0 A;  3JZ0 A;  2L6H A;  3RQE A;  1PV3 A;  3MFN A;  1JOG A;  1K40 A;  1KTM A;  3BRJ A;  4XEK A;  4XEV A;  3C8G A;  1O3U A;  3O10 A;  4R32 A;  3U3F A;  1WOL A;  3TUL A;  3U0C A;  2L6G A;  3K7D A;  1KNY A;  3L8I A;  3RQG A;  2KK1 A;  3C18 A;  3C8G B;  2LK4 A;  4EBJ A;  1V4A A;  2PBE A;  1K05 A;  3L8J A;  1QVX A;  3JYY A;  1OW7 A;  2HSB A;  2L6F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...