1O3UA

Crystal structure of an hepn domain protein (tm0613) from thermotoga maritima at 1.75 a resolution
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
126
structure length
120
Chain Sequence
HHHMDAAKDDLEHAKHDLEHGFYNWACFSSQQAAEKAVKAVFQRMGAQAWGYSVPDFLGELSSRFEIPEELMDHALELDKACDALPSGSPRNRYSRIEAERLVNYAEKIIRFCEDLLSRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords conserved hypothetical protein TM0613
publication title Crystal structure of an HEPN domain protein (TM0613) from Thermotoga maritima at 1.75 A resolution.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Unknown function
total genus 45
structure length 120
sequence length 126
ec nomenclature
pdb deposition date 2003-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05168 HEPN HEPN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 1o3uA00
1V4AA 1WOLA 3L8IA 1WWPA 3S9OA 1OW8A 1KTMA 2L6HA 4XEVA 1WTYA 4EBJA 1PV3A 1OW6A 1K05A 3GM1A 2LK4A 3JYYA 3RQEA 3MFNA 3JZ0A 4R32A 3GM3A 4EBKA 3B71A 3L8JA 1K40A 3RQGA 5F28E 1OW7A 3GM2A 2JX0A 3RQFA 1KNYA 2PBEA 3U0CA 2L6FA 1JOGA 1QVXA 3U3FA 1K04A 3C8GD 3C8GA 2KK1A 2L6GA 3C18A 2YWAA 3AJMA 3BRJA 4NQFA 4XEFA 3C8GB 3K7DA 1O3UA 1UFBA 1ZZPA 4XEKA 3TULA 3O10A 2JPUA 2HSBA 2Q00A
chains in the Genus database with same CATH superfamily
3IPMO 5B1BC 5KYXA 3GEEA 1ZHYA 1OCZC 1ZU4A 2WVOA 2LFFA 2P0NA 1OW6A 1D1AA 1YAUO 2Y39A 3LESA 4RBNA 3U9JA 3JZ0A 3B9QA 4G0HA 2VCCA 3UMIA 3PHF2 4LLEA 5JUAA 3H2UA 2WVQA 3ATPA 2H7VC 4JW1A 2Y3DA 1CPQA 5JLIA 2LQGA 5KYUA 5A6JA 2KW3C 5E3CA 5BQIA 3U8PA 4IJJA 3S28A 1JRAA 1GQAA 1QSPA 1G4US 4LACB 1H6GA 5E33A 1HY5A 4KBLA 1U89A 1WGWA 1S05A 4DRIB 4G78A 1MMGA 3FAJA 3RKOF 1LE2A 1O5HA 1ORJA 2QY9A 3LUTB 4MVZA 4P6IC 4LLCA 1EKYA 2HV6A 1N1CA 4XPYA 4DRJB 5TJ5E 3RQEA 1EA8A 1DOVA 3HKKA 2KSFA 2LP4A 3R2PA 4KNWA 4DJ9A 3RQGA 1D0ZA 1IZMA 1LM3B 4DVZA 3EGXB 2R7SA 4OIOF 2IYLD 3DJNB 2VH3A 4EKWA 4I1MA 4MVUA 2PFDA 4PJMA 4CSAA 1NU9C 3HNJA 2L9JA 4JEBA 2NG1A 1YVIA 2XL4A 3W4YA 1E85A 2V3CC 2ZXOA 4MNDA 5JP7A 2IXNA 1YZCA 2GAQA 1HE9A 1O87A 3ZQYA 3M1CB 3TULA 3POVA 2EIJC 4QDLA 3SP1A 4PR9A 4U5GA 2G62A 4HEAJ 1OKKD 4HE8D 5KYNA 3RYLA 3O39A 3T4RA 3TJ5A 2R7QA 4AK9A 1NFNA 1TKNA 4AL1A 1IW7F 3RVZA 3FMSA 1FNTc 3KKBA 4OD5A 1ZHXA 4MVRA 1K05A 1VMAA 1NLXA 2LK4A 3M15A 1J8YF 3QVYA 3QW0A 4JTAB 4MTGA 3S29A 4OIRF 2YHSA 1YDIA 2JX0A 2OG2A 3B0UX 1L7CA 2XS8A 4IAOA 1JOGA 4HFKB 4AE4A 4C3EA 5JVEA 2KK1A 2L6GA 2OOCA 4XLPF 2R7XA 3DKAA 2VASA 5F5FA 3ZIBA 4MS2A 3CZ6A 5A6KA 3C8GB 3Q6MA 3UGOA 1Z23A 3AG4C 3SYNA 2J9VA 3FOOA 4O6MA 1I5NA 1CGME 2HKVA 4MVOA 5B3SC 3W8IA 5L0DA 1L3PA 2RSEB 2A6HF 1BBHA 2EPLX 1XZQA 3LAYA 3AGUA 3DWWA 4NCQA 4CDYA 5KYWB 1C02A 4E17A 3J06A 2XLOA 4YT2A 3CAXA 3ITFA 1R5ID 2LIGA 1M56C 3U2LA 2IBFA 3X1OA 2XL8A 4JTDB 4MVQA 5JT4A 3EGDB 4N6HA 2PX0A 4PACA 3V5ZA 5A6BD 2R7TA 1I4YA 2J0WA 5JRAA 1MMNA 4J7TA 1TWGA 2HSQA 3GM2A 3AG2C 2XLMA 2L6FA 5EK0A 4U9DA 2X0CA 1MMDA 4RD9A 4AL0A 3RVYA 3MYIA 4WJ0A 1F1MA 4FAPB 4ZLCA 2Q9BA 1Z6AA 1OCRC 5DS6A 4QI2A 2BC5A 1G8XA 4XEKA 1ORYA 4U5CE 2IM8A 3EH2A 3ZVRA 1QZXA 2O9XA 5IY5C 1OKKA 5K0IA 3EGDA 3TK0A 4ANJA 3KYIA 1D0YA 4D4XA 2EPOA 2DYRC 4E18A 3NYMA 2A0UA 4K7BA 1E83A 1JR8A 1ST6A 1D1CA 3L0IA 1VYIA 4ER9A 2XL6A 5EHHA 1FAPB 1R4TA 4JIOA 3T9OA 5F28E 4JJFA 3OA1A 2R7WA 1XWJA 3KH2A 3ZWIA 3S84A 2PBEA 2AWYA 1OCCC 3NMIA 2WVNA 3U3BA 2Y3HA 4JCZA 1B68A 4U5FE 4AX2A 4BPMA 2AU5A 5BUOA 1T6IA 4NQFA 3MX3A 5FCLA 3LS1A 4OD4A 5L0CA 5DQZA 1LIHA 1VLTA 2EPNA 3K1IC 4H4KC 4JC7A 4JJGA 1VOMA 1CPRA 3U9MA 4DOZA 1WOLA 1LI5A 2RD9A 1TFKB 1VK5A 3HLZA 5COMA 4BJ1A 5DS4A 3B29A 4J7YA 3IEEA 5E3AA 4XEVA 3NYLA 4C3BA 2CW0F 2AVKA 4IAQA 3UNGC 2NUPB 1HW1A 1TWAA 1PD1A 2YQYA 3HNIA 2P1AA 2WL8A 3GODA 5FZTA 4BJ5C 5A6BA 1YYXA 3GM3A 3JSZA 3AOUA 4H54A 3DD7A 1M2VB 256BA 4XLNF 1HW2A 3TJ6A 3BEHA 4BJTA 2C04A 4UDVA 3A11A 3E9VA 4JZAA 1ZW3A 1CGOA 1TWHA 2WZLA 3OWTA 3TOMA 1OQCA 1QKRA 2NSGA 4IRUA 5L0HA 2VB6A 4LERA 4I3MA 5COGA 1ZHZA 1OCOC 3S0XA 3DE8A 3GORA 2OKUA 4CS8A 1O3UA 1ZZPA 4HFFB 3V5YA 4YT8A 3NG1A 5KYYB 1AUEA 3CEXA 3FXHA 5D92A 1LKXA 1T6UA 3EPVA 2MHRA 2XLWA 3RW0A 1Y6DA 2A69F 3US6A 4I44A 4PK4A 2Y3BA 2YLGA 3JRTA 4IWBA 4G7OF 2IXOA 1ZHWA 5L0FA 1YA9A 4Z9IA 4CJGA 2D4UA 4D4NA 5HSWA 2LCHA 1HMDA 3WG7C 3B71A 2GDCA 1Q0FA 4CS9C 5DS5A 2CGEA 4Q5SF 1GS9A 2XSEA 2A0BA 3C63A 5AGFA 1A0BA 3C62A 1I4ZA 4U9EA 4RDAA 1V74B 3C8GD 1ZU5A 2YL0A 1RMVA 4DRHB 2BL2A 5KYYA 1RKEB 1TWCA 5DLJA 3M79A 4K1OA 3DAGA 4WABA 1M2OA 3OEOA 2LFDA 2TMVP 2I15A 3JTLO 4XQ1A 4W8KA 4EHPA 4G7ZF 3M4BA 3DXJF 3IQ6A 4KC9A 5JSLA 1H7IA 3GWNA 3V7OA 4JKVA 2EPMX 4DBRA 3LEVA 1MMAA 4FWVA 3WHNA 1E84A 5A6AA 1EQ1A 1T01A 4FESA 2HMQA 1PV3A 2Q9AA 1BDJB 4JTCB 2VCBA 3EGXA 4A4AA 2P6VA 2VC9A 2D5RB 1YLMA 2WZFA 2V26A 3GM1A 4K0DA 4R32A 3T6BA 5DQTA 4LDQA 4PFPA 2MYSA 2R7RA 3H65A 2A1DD 2X51A 1RKEA 1KNYA 2EILC 5CIVA 1LS1A 1LVKA 2XLHA 2C03A 2R7OA 3EG9B 3F47A 3L34A 3IHUA 2CCYA 2MWQA 1NU7D 2HJ3A 2YWAA 2Q7RA 3FOPA 4BJ6C 1E2XA 3SXZA 3ZTZA 4NTAA 3JRMO 1RXQA 3DM5A 4XWJA 2EIMC 2UUIA 4CX9A 3O10A 2JPUA 3ECSA 3L1MA 4YT5A 5AC4A 2FAPB 4G7HF 3B0VC 3S9OA 2L6HA 1EI7A 3SZRA 3UMHA 5L0IA 1QLEC 1T9KA 4YT4A 4Q4ZF 5COFA 2ZD9A 4BJ5A 1NG1A 2JD3A 4Z9JA 4EIYA 3Q7LA 4PJNA 3JYYA 4CDVA 3KPHA 5D91A 3LNMB 1VB5A 1T5OA 1K40A 2J46A 4YWQA 3QMKA 4OIPF 2B0HA 4N4WA 1Q0GA 3O6XA 4P9TA 3HNKA 2AP3A 2R7UA 3SXYA 4EBBA 4C3DA 3F46A 1QVXA 2ZPAA 1M57C 1T6QA 2Q3TA 2XLDA 1TQGA 3EHMA 3C8GA 5T3WA 4EWCA 1ZVZA 4CJOA 3UGPA 3CSKA 3ZSUA 3W2WA 1JMWA 2KYHA 3HNLA 1FR0A 4XEFA 2HFIA 5KYWA 4CDAA 4DBQA 1VLSA 2Q00A 2FFHA 3E70C 2OJED 3L8IA 1WWPA 3N24A 2J9WA 4KNVA 3WODF 4BG0A 1J8MF 2EINC 3TQOA 1HMOA 3QZCA 2W9YA 4U5BE 2GFHA 2YZSA 1H9TA 4YJWA 5CI8A 3C7JA 2J0XA 1YARO 2ICWG 3AQBA 4FX5A 3S90A 4EBKA 3LLIA 3KMIA 4O7GA 2HZ8A 2A68F 1ORSC 1AVOB 1OXKA 3UR3C 3LLKA 3RFYA 2M4EA 2I8BA 3DE9A 3JCUQ 1DOWA 1C17M 4I1OB 1Q0KA 3EH1A 3LEOA 3AJMA 4CSAC 3N0TA 2LD6A 3RH3A 5L0JA 2YL3A 3TD7A 3M4CA 3I5PA 2J8WA 2R7VA 4O79A 1SYQA 3ZG1A 1SMYF 4BEJA 2OU6A 1V4AA 3JSEO 3MLGA 4E0HA 2M64A 1D0XA 2YRFA 1SR2A 2ZXPA 2NPUA 1Z3IX 3IQCA 1FMWA 3SXMA 3B0PA 2HS5A 3FHDA 3LNRA 2L7AA 3ASNC 3DMDA 4GYTA 3FAPB 3DZAA 2R05A 2FGYA 3Q7GA 4YL3A 2PNOA 2J7PD 4MVMA 2YL7A 3RIPA 4CIPA 2F22A 4YL1A 2ZXRA 2ETSA 1KU2A 3FVYA 4CBEA 4Z9HA 3NYJA 2G3VA 3GANA 3G50A 3NKEA 1K04A 4U5HA 4L6RA 4BJ6A 3G4ZA 4XPXA 3EZIA 2P61A 3EHNA 2B0JA 1Q0DA 1WATA 3DJUB 3A9CA 1NSGB 4KI2A 3DAFA 2P7VA 2CDQA 2PF4E 4Q7CA 1OXBA 3C8ZA 1WN0A 4E0IA 4YL0A 1C03A 1FFTC 1BR4A 1A7VA 3AG1C 3MBGA 2NUPA 3ABLC 5B1AC 3VM6A 4EUKB 4GEHA 2Z15A 3LS0A 5HV9A 3Q6NA 2GA0A 3I4UA 3NDBB 2NUTB 3ASOC 4IB4A 4WGZA 1FFHA 1M2VA 4MW3A 3VYWA 3SEOA 1E86A 4ULWA 2KJGA 2W45A 2YEVA 1Z5ZA 3L8JA 4A2NB 4C7OB 2R9RB 2EIKC 1OW7A 2WZGA 3ZDLA 5T1DB 2HUJA 3ZC4A 3EFOB 3N2ZB 2IXMA 4ULVA 3V5XA 2R25A 3O55A 1VTMP 2CNWD 3NKDA 4WGYA 3W8HA 4E7SA 4NTFA 2H8AA 2W4MA 1PD0A 3K7DA 4MQ9F 2G3KA 2QE9A 2HSBA 3VRCA 2NUTA 4ONSA 5E2QA 1JPJA 1BR2A 3R7CA 2NSFA 2Y69C 3HTKC 2E87A 3TOLA 3NMKA 4YN0B 1ZYRF 1SZIA 2KC3A 4MVSA 5L3QA 1LPEA 2AWCA 1JPNA 3U5SA 4C7OA 4EBJA 2YKZA 3LJBA 3GWLA 4GQHA 1D1BA 4YK5A 4JCHA 1HE1A 3KL4A 1G4WR 4NY3A 3X2QC 2XM0A 2H7BA 2IOQA 3EFOA 2H7OA 2QNLA 2DYSC 4IGGA 4B6IA 4MTOA 2J7PA 1FMVA 4OIQF 3EQLF 4LDRA 2XM4A 4U5EE 4JURI 3RQFA 4E7ZA 3UMKA 1Z63A 3KYJA 3T6JA 1APCA 2IXPA 4MTFA 3SNHA 3U8VA 4BEMJ 1YJGA 3AG3C 4J32B 2CYDA 1WASA 4XTKA 3K1IA 5CI9A 2L81A 4AE4B 1PCXA 2YVKA 3K6BA 3G4XA 4PJJA 4OINF 2XXAB 1MQVA 1UFBA 2OQMA 4JRZA 3QTHA 5L0GA 5GPGB 5F5HA 4QI0A 1AEPA 1OW8A 1YZAA 3AGTA 5DVWA 1KTMA 1FTSA 2LSEA 2WB7A 3IQTA 2DB4A 2HV7A 2R02A 1V55C 1YYJA 3SXKA 2KQ9A 2QLAA 3CQZA 2GWWA 1OR3A 4NC3A 3EG9A 2HJMA 1LE4A 1S7ZA 4PFOA 1Z7Qc 1NBBA 3H2VA 3K1HA 3AQCA 4JE9A 4O6NA 1CGNA 2ASRA 2DI3A 2PP4A 2ZXWC 2OEXA 3EJNA 3VAYA 2J9BA 5B3IA 5EGYA 1LI7A 2XXAA 1W2WA 4IARA 4ZLDA 1GM5A 1BZ4A 2YL1A 3PDMP 2CNWA 2XLEA 4PJLA 2XLVA 5BQGA 3FDQA 3PMRA 2PX3A 4CS8C 1ZW2A 3PCVA 1M6TA 2XS1A 3GEIA 5A69A 3T6GB 3WAQA 3VF0A 2YLDA 3I5QA 1XZPA 4NTBA 4M63A 4JEAA 3RF3A 1OR2A 2J45A 3JT1A 1QPUA 2HMZA 2Q4FA 2Q9CA 4N6CA 4CS9A 1JAFA 4F4BA 3W2VA 4CIHA 3QW1A 1MNDA 2DGJA 3MYFA 4X0RA 2XRHA 1U0BB 3DM9B 4JVSA 1Y4CA 2KGOA 1V54C 3GEHA 3NMJA 4MW8A 3QVZA 1A7DA 3U3FA 4N06A 5JS5A 3C18A 5BQHA 5T3TA 1MNEA 3ZTMA 3BRJA 2YLIA 1A7EA 1NZEA 1TFOB 3NRHA 1NFOA 2EPKX 1RJ9B 2UUHA 1VYKA 2QTVA 2R03A 3IQ5A 1BR1A 2OCCC 3K33A 1SF8A 4O6YA 1ZHTA 2A6EF 4CS7A 1WTYA 2VCAA 3U2MA 1LS4A 1QQ3A 2Y3GA 4J30B 1TR2A 3S27A 2OEVA 5KYXB 5L3VA 3MFNA 2J9UA 3ZQVA 1UG7A 3EZHA 2QUPA 4DXWA 1RKCA 3U0CA 3DI5A 1RCPA 3K66A 5AC5A 4P9FA 2W4BA 1YA7O 1RJ9A 1A41A 3ABMC 2KNHA 4XPWA 4LDKA 2OJQA 3ABKC 1G5ZA 1Q0MA 1U6HA 4U5DE 4W8PA 5KYUB 4DVYP 1H9GA 2BE5F 3JYHA 1GGQA 3HJCA
chains in the Genus database with same CATH topology
1V4AA 1WOLA 3L8IA 1WWPA 3S9OA 1OW8A 1KTMA 2L6HA 4XEVA 1WTYA 4EBJA 1PV3A 1OW6A 1K05A 3GM1A 2LK4A 3JYYA 3RQEA 3MFNA 3JZ0A 4R32A 3GM3A 4EBKA 3B71A 3L8JA 1K40A 3RQGA 5F28E 1OW7A 3GM2A 2JX0A 3RQFA 1KNYA 2PBEA 3U0CA 2L6FA 1JOGA 1QVXA 3U3FA 1K04A 3C8GD 3C8GA 2KK1A 2L6GA 3C18A 2YWAA 3AJMA 3BRJA 4NQFA 4XEFA 3C8GB 3K7DA 1O3UA 1UFBA 1ZZPA 4XEKA 3TULA 3O10A 2JPUA 2HSBA 2Q00A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1V4A A;  1WOL A;  3L8I A;  1WWP A;  3S9O A;  1OW8 A;  1KTM A;  2L6H A;  4XEV A;  1WTY A;  4EBJ A;  1PV3 A;  1OW6 A;  1K05 A;  3GM1 A;  2LK4 A;  3JYY A;  3RQE A;  3MFN A;  3JZ0 A;  4R32 A;  3GM3 A;  4EBK A;  3B71 A;  3L8J A;  1K40 A;  3RQG A;  5F28 E;  1OW7 A;  3GM2 A;  2JX0 A;  3RQF A;  1KNY A;  2PBE A;  3U0C A;  2L6F A;  1JOG A;  1QVX A;  3U3F A;  1K04 A;  3C8G D;  3C8G A;  2KK1 A;  2L6G A;  3C18 A;  2YWA A;  3AJM A;  3BRJ A;  4NQF A;  4XEF A;  3C8G B;  3K7D A;  1O3U A;  1UFB A;  1ZZP A;  4XEK A;  3TUL A;  3O10 A;  2JPU A;  2HSB A;  2Q00 A; 
#chains in the Genus database with same CATH topology
 3IPM O;  5B1B C;  5KYX A;  3GEE A;  1ZHY A;  1OCZ C;  1ZU4 A;  2WVO A;  2LFF A;  2P0N A;  1OW6 A;  1D1A A;  1YAU O;  2Y39 A;  3LES A;  4RBN A;  3U9J A;  3JZ0 A;  3B9Q A;  4G0H A;  2VCC A;  3UMI A;  3PHF 2;  4LLE A;  5JUA A;  3H2U A;  2WVQ A;  3ATP A;  2H7V C;  4JW1 A;  2Y3D A;  1CPQ A;  5JLI A;  2LQG A;  5KYU A;  5A6J A;  2KW3 C;  5E3C A;  5BQI A;  3U8P A;  4IJJ A;  3S28 A;  1JRA A;  1GQA A;  1QSP A;  1G4U S;  4LAC B;  1H6G A;  5E33 A;  1HY5 A;  4KBL A;  1U89 A;  1WGW A;  1S05 A;  4DRI B;  4G78 A;  1MMG A;  3FAJ A;  3RKO F;  1LE2 A;  1O5H A;  1ORJ A;  2QY9 A;  3LUT B;  4MVZ A;  4P6I C;  4LLC A;  1EKY A;  2HV6 A;  1N1C A;  4XPY A;  4DRJ B;  5TJ5 E;  3RQE A;  1EA8 A;  1DOV A;  3HKK A;  2KSF A;  2LP4 A;  3R2P A;  4KNW A;  4DJ9 A;  3RQG A;  1D0Z A;  1IZM A;  1LM3 B;  4DVZ A;  3EGX B;  2R7S A;  4OIO F;  2IYL D;  3DJN B;  2VH3 A;  4EKW A;  4I1M A;  4MVU A;  2PFD A;  4PJM A;  4CSA A;  1NU9 C;  3HNJ A;  2L9J A;  4JEB A;  2NG1 A;  1YVI A;  2XL4 A;  3W4Y A;  1E85 A;  2V3C C;  2ZXO A;  4MND A;  5JP7 A;  2IXN A;  1YZC A;  2GAQ A;  1HE9 A;  1O87 A;  3ZQY A;  3M1C B;  3TUL A;  3POV A;  2EIJ C;  4QDL A;  3SP1 A;  4PR9 A;  4U5G A;  2G62 A;  4HEA J;  1OKK D;  4HE8 D;  5KYN A;  3RYL A;  3O39 A;  3T4R A;  3TJ5 A;  2R7Q A;  4AK9 A;  1NFN A;  1TKN A;  4AL1 A;  1IW7 F;  3RVZ A;  3FMS A;  1FNT c;  3KKB A;  4OD5 A;  1ZHX A;  4MVR A;  1K05 A;  1VMA A;  1NLX A;  2LK4 A;  3M15 A;  1J8Y F;  3QVY A;  3QW0 A;  4JTA B;  4MTG A;  3S29 A;  4OIR F;  2YHS A;  1YDI A;  2JX0 A;  2OG2 A;  3B0U X;  1L7C A;  2XS8 A;  4IAO A;  1JOG A;  4HFK B;  4AE4 A;  4C3E A;  5JVE A;  2KK1 A;  2L6G A;  2OOC A;  4XLP F;  2R7X A;  3DKA A;  2VAS A;  5F5F A;  3ZIB A;  4MS2 A;  3CZ6 A;  5A6K A;  3C8G B;  3Q6M A;  3UGO A;  1Z23 A;  3AG4 C;  3SYN A;  2J9V A;  3FOO A;  4O6M A;  1I5N A;  1CGM E;  2HKV A;  4MVO A;  5B3S C;  3W8I A;  5L0D A;  1L3P A;  2RSE B;  2A6H F;  1BBH A;  2EPL X;  1XZQ A;  3LAY A;  3AGU A;  3DWW A;  4NCQ A;  4CDY A;  5KYW B;  1C02 A;  4E17 A;  3J06 A;  2XLO A;  4YT2 A;  3CAX A;  3ITF A;  1R5I D;  2LIG A;  1M56 C;  3U2L A;  2IBF A;  3X1O A;  2XL8 A;  4JTD B;  4MVQ A;  5JT4 A;  3EGD B;  4N6H A;  2PX0 A;  4PAC A;  3V5Z A;  5A6B D;  2R7T A;  1I4Y A;  2J0W A;  5JRA A;  1MMN A;  4J7T A;  1TWG A;  2HSQ A;  3GM2 A;  3AG2 C;  2XLM A;  2L6F A;  5EK0 A;  4U9D A;  2X0C A;  1MMD A;  4RD9 A;  4AL0 A;  3RVY A;  3MYI A;  4WJ0 A;  1F1M A;  4FAP B;  4ZLC A;  2Q9B A;  1Z6A A;  1OCR C;  5DS6 A;  4QI2 A;  2BC5 A;  1G8X A;  4XEK A;  1ORY A;  4U5C E;  2IM8 A;  3EH2 A;  3ZVR A;  1QZX A;  2O9X A;  5IY5 C;  1OKK A;  5K0I A;  3EGD A;  3TK0 A;  4ANJ A;  3KYI A;  1D0Y A;  4D4X A;  2EPO A;  2DYR C;  4E18 A;  3NYM A;  2A0U A;  4K7B A;  1E83 A;  1JR8 A;  1ST6 A;  1D1C A;  3L0I A;  1VYI A;  4ER9 A;  2XL6 A;  5EHH A;  1FAP B;  1R4T A;  4JIO A;  3T9O A;  5F28 E;  4JJF A;  3OA1 A;  2R7W A;  1XWJ A;  3KH2 A;  3ZWI A;  3S84 A;  2PBE A;  2AWY A;  1OCC C;  3NMI A;  2WVN A;  3U3B A;  2Y3H A;  4JCZ A;  1B68 A;  4U5F E;  4AX2 A;  4BPM A;  2AU5 A;  5BUO A;  1T6I A;  4NQF A;  3MX3 A;  5FCL A;  3LS1 A;  4OD4 A;  5L0C A;  5DQZ A;  1LIH A;  1VLT A;  2EPN A;  3K1I C;  4H4K C;  4JC7 A;  4JJG A;  1VOM A;  1CPR A;  3U9M A;  4DOZ A;  1WOL A;  1LI5 A;  2RD9 A;  1TFK B;  1VK5 A;  3HLZ A;  5COM A;  4BJ1 A;  5DS4 A;  3B29 A;  4J7Y A;  3IEE A;  5E3A A;  4XEV A;  3NYL A;  4C3B A;  2CW0 F;  2AVK A;  4IAQ A;  3UNG C;  2NUP B;  1HW1 A;  1TWA A;  1PD1 A;  2YQY A;  3HNI A;  2P1A A;  2WL8 A;  3GOD A;  5FZT A;  4BJ5 C;  5A6B A;  1YYX A;  3GM3 A;  3JSZ A;  3AOU A;  4H54 A;  3DD7 A;  1M2V B;  256B A;  4XLN F;  1HW2 A;  3TJ6 A;  3BEH A;  4BJT A;  2C04 A;  4UDV A;  3A11 A;  3E9V A;  4JZA A;  1ZW3 A;  1CGO A;  1TWH A;  2WZL A;  3OWT A;  3TOM A;  1OQC A;  1QKR A;  2NSG A;  4IRU A;  5L0H A;  2VB6 A;  4LER A;  4I3M A;  5COG A;  1ZHZ A;  1OCO C;  3S0X A;  3DE8 A;  3GOR A;  2OKU A;  4CS8 A;  1O3U A;  1ZZP A;  4HFF B;  3V5Y A;  4YT8 A;  3NG1 A;  5KYY B;  1AUE A;  3CEX A;  3FXH A;  5D92 A;  1LKX A;  1T6U A;  3EPV A;  2MHR A;  2XLW A;  3RW0 A;  1Y6D A;  2A69 F;  3US6 A;  4I44 A;  4PK4 A;  2Y3B A;  2YLG A;  3JRT A;  4IWB A;  4G7O F;  2IXO A;  1ZHW A;  5L0F A;  1YA9 A;  4Z9I A;  4CJG A;  2D4U A;  4D4N A;  5HSW A;  2LCH A;  1HMD A;  3WG7 C;  3B71 A;  2GDC A;  1Q0F A;  4CS9 C;  5DS5 A;  2CGE A;  4Q5S F;  1GS9 A;  2XSE A;  2A0B A;  3C63 A;  5AGF A;  1A0B A;  3C62 A;  1I4Z A;  4U9E A;  4RDA A;  1V74 B;  3C8G D;  1ZU5 A;  2YL0 A;  1RMV A;  4DRH B;  2BL2 A;  5KYY A;  1RKE B;  1TWC A;  5DLJ A;  3M79 A;  4K1O A;  3DAG A;  4WAB A;  1M2O A;  3OEO A;  2LFD A;  2TMV P;  2I15 A;  3JTL O;  4XQ1 A;  4W8K A;  4EHP A;  4G7Z F;  3M4B A;  3DXJ F;  3IQ6 A;  4KC9 A;  5JSL A;  1H7I A;  3GWN A;  3V7O A;  4JKV A;  2EPM X;  4DBR A;  3LEV A;  1MMA A;  4FWV A;  3WHN A;  1E84 A;  5A6A A;  1EQ1 A;  1T01 A;  4FES A;  2HMQ A;  1PV3 A;  2Q9A A;  1BDJ B;  4JTC B;  2VCB A;  3EGX A;  4A4A A;  2P6V A;  2VC9 A;  2D5R B;  1YLM A;  2WZF A;  2V26 A;  3GM1 A;  4K0D A;  4R32 A;  3T6B A;  5DQT A;  4LDQ A;  4PFP A;  2MYS A;  2R7R A;  3H65 A;  2A1D D;  2X51 A;  1RKE A;  1KNY A;  2EIL C;  5CIV A;  1LS1 A;  1LVK A;  2XLH A;  2C03 A;  2R7O A;  3EG9 B;  3F47 A;  3L34 A;  3IHU A;  2CCY A;  2MWQ A;  1NU7 D;  2HJ3 A;  2YWA A;  2Q7R A;  3FOP A;  4BJ6 C;  1E2X A;  3SXZ A;  3ZTZ A;  4NTA A;  3JRM O;  1RXQ A;  3DM5 A;  4XWJ A;  2EIM C;  2UUI A;  4CX9 A;  3O10 A;  2JPU A;  3ECS A;  3L1M A;  4YT5 A;  5AC4 A;  2FAP B;  4G7H F;  3B0V C;  3S9O A;  2L6H A;  1EI7 A;  3SZR A;  3UMH A;  5L0I A;  1QLE C;  1T9K A;  4YT4 A;  4Q4Z F;  5COF A;  2ZD9 A;  4BJ5 A;  1NG1 A;  2JD3 A;  4Z9J A;  4EIY A;  3Q7L A;  4PJN A;  3JYY A;  4CDV A;  3KPH A;  5D91 A;  3LNM B;  1VB5 A;  1T5O A;  1K40 A;  2J46 A;  4YWQ A;  3QMK A;  4OIP F;  2B0H A;  4N4W A;  1Q0G A;  3O6X A;  4P9T A;  3HNK A;  2AP3 A;  2R7U A;  3SXY A;  4EBB A;  4C3D A;  3F46 A;  1QVX A;  2ZPA A;  1M57 C;  1T6Q A;  2Q3T A;  2XLD A;  1TQG A;  3EHM A;  3C8G A;  5T3W A;  4EWC A;  1ZVZ A;  4CJO A;  3UGP A;  3CSK A;  3ZSU A;  3W2W A;  1JMW A;  2KYH A;  3HNL A;  1FR0 A;  4XEF A;  2HFI A;  5KYW A;  4CDA A;  4DBQ A;  1VLS A;  2Q00 A;  2FFH A;  3E70 C;  2OJE D;  3L8I A;  1WWP A;  3N24 A;  2J9W A;  4KNV A;  3WOD F;  4BG0 A;  1J8M F;  2EIN C;  3TQO A;  1HMO A;  3QZC A;  2W9Y A;  4U5B E;  2GFH A;  2YZS A;  1H9T A;  4YJW A;  5CI8 A;  3C7J A;  2J0X A;  1YAR O;  2ICW G;  3AQB A;  4FX5 A;  3S90 A;  4EBK A;  3LLI A;  3KMI A;  4O7G A;  2HZ8 A;  2A68 F;  1ORS C;  1AVO B;  1OXK A;  3UR3 C;  3LLK A;  3RFY A;  2M4E A;  2I8B A;  3DE9 A;  3JCU Q;  1DOW A;  1C17 M;  4I1O B;  1Q0K A;  3EH1 A;  3LEO A;  3AJM A;  4CSA C;  3N0T A;  2LD6 A;  3RH3 A;  5L0J A;  2YL3 A;  3TD7 A;  3M4C A;  3I5P A;  2J8W A;  2R7V A;  4O79 A;  1SYQ A;  3ZG1 A;  1SMY F;  4BEJ A;  2OU6 A;  1V4A A;  3JSE O;  3MLG A;  4E0H A;  2M64 A;  1D0X A;  2YRF A;  1SR2 A;  2ZXP A;  2NPU A;  1Z3I X;  3IQC A;  1FMW A;  3SXM A;  3B0P A;  2HS5 A;  3FHD A;  3LNR A;  2L7A A;  3ASN C;  3DMD A;  4GYT A;  3FAP B;  3DZA A;  2R05 A;  2FGY A;  3Q7G A;  4YL3 A;  2PNO A;  2J7P D;  4MVM A;  2YL7 A;  3RIP A;  4CIP A;  2F22 A;  4YL1 A;  2ZXR A;  2ETS A;  1KU2 A;  3FVY A;  4CBE A;  4Z9H A;  3NYJ A;  2G3V A;  3GAN A;  3G50 A;  3NKE A;  1K04 A;  4U5H A;  4L6R A;  4BJ6 A;  3G4Z A;  4XPX A;  3EZI A;  2P61 A;  3EHN A;  2B0J A;  1Q0D A;  1WAT A;  3DJU B;  3A9C A;  1NSG B;  4KI2 A;  3DAF A;  2P7V A;  2CDQ A;  2PF4 E;  4Q7C A;  1OXB A;  3C8Z A;  1WN0 A;  4E0I A;  4YL0 A;  1C03 A;  1FFT C;  1BR4 A;  1A7V A;  3AG1 C;  3MBG A;  2NUP A;  3ABL C;  5B1A C;  3VM6 A;  4EUK B;  4GEH A;  2Z15 A;  3LS0 A;  5HV9 A;  3Q6N A;  2GA0 A;  3I4U A;  3NDB B;  2NUT B;  3ASO C;  4IB4 A;  4WGZ A;  1FFH A;  1M2V A;  4MW3 A;  3VYW A;  3SEO A;  1E86 A;  4ULW A;  2KJG A;  2W45 A;  2YEV A;  1Z5Z A;  3L8J A;  4A2N B;  4C7O B;  2R9R B;  2EIK C;  1OW7 A;  2WZG A;  3ZDL A;  5T1D B;  2HUJ A;  3ZC4 A;  3EFO B;  3N2Z B;  2IXM A;  4ULV A;  3V5X A;  2R25 A;  3O55 A;  1VTM P;  2CNW D;  3NKD A;  4WGY A;  3W8H A;  4E7S A;  4NTF A;  2H8A A;  2W4M A;  1PD0 A;  3K7D A;  4MQ9 F;  2G3K A;  2QE9 A;  2HSB A;  3VRC A;  2NUT A;  4ONS A;  5E2Q A;  1JPJ A;  1BR2 A;  3R7C A;  2NSF A;  2Y69 C;  3HTK C;  2E87 A;  3TOL A;  3NMK A;  4YN0 B;  1ZYR F;  1SZI A;  2KC3 A;  4MVS A;  5L3Q A;  1LPE A;  2AWC A;  1JPN A;  3U5S A;  4C7O A;  4EBJ A;  2YKZ A;  3LJB A;  3GWL A;  4GQH A;  1D1B A;  4YK5 A;  4JCH A;  1HE1 A;  3KL4 A;  1G4W R;  4NY3 A;  3X2Q C;  2XM0 A;  2H7B A;  2IOQ A;  3EFO A;  2H7O A;  2QNL A;  2DYS C;  4IGG A;  4B6I A;  4MTO A;  2J7P A;  1FMV A;  4OIQ F;  3EQL F;  4LDR A;  2XM4 A;  4U5E E;  4JUR I;  3RQF A;  4E7Z A;  3UMK A;  1Z63 A;  3KYJ A;  3T6J A;  1APC A;  2IXP A;  4MTF A;  3SNH A;  3U8V A;  4BEM J;  1YJG A;  3AG3 C;  4J32 B;  2CYD A;  1WAS A;  4XTK A;  3K1I A;  5CI9 A;  2L81 A;  4AE4 B;  1PCX A;  2YVK A;  3K6B A;  3G4X A;  4PJJ A;  4OIN F;  2XXA B;  1MQV A;  1UFB A;  2OQM A;  4JRZ A;  3QTH A;  5L0G A;  5GPG B;  5F5H A;  4QI0 A;  1AEP A;  1OW8 A;  1YZA A;  3AGT A;  5DVW A;  1KTM A;  1FTS A;  2LSE A;  2WB7 A;  3IQT A;  2DB4 A;  2HV7 A;  2R02 A;  1V55 C;  1YYJ A;  3SXK A;  2KQ9 A;  2QLA A;  3CQZ A;  2GWW A;  1OR3 A;  4NC3 A;  3EG9 A;  2HJM A;  1LE4 A;  1S7Z A;  4PFO A;  1Z7Q c;  1NBB A;  3H2V A;  3K1H A;  3AQC A;  4JE9 A;  4O6N A;  1CGN A;  2ASR A;  2DI3 A;  2PP4 A;  2ZXW C;  2OEX A;  3EJN A;  3VAY A;  2J9B A;  5B3I A;  5EGY A;  1LI7 A;  2XXA A;  1W2W A;  4IAR A;  4ZLD A;  1GM5 A;  1BZ4 A;  2YL1 A;  3PDM P;  2CNW A;  2XLE A;  4PJL A;  2XLV A;  5BQG A;  3FDQ A;  3PMR A;  2PX3 A;  4CS8 C;  1ZW2 A;  3PCV A;  1M6T A;  2XS1 A;  3GEI A;  5A69 A;  3T6G B;  3WAQ A;  3VF0 A;  2YLD A;  3I5Q A;  1XZP A;  4NTB A;  4M63 A;  4JEA A;  3RF3 A;  1OR2 A;  2J45 A;  3JT1 A;  1QPU A;  2HMZ A;  2Q4F A;  2Q9C A;  4N6C A;  4CS9 A;  1JAF A;  4F4B A;  3W2V A;  4CIH A;  3QW1 A;  1MND A;  2DGJ A;  3MYF A;  4X0R A;  2XRH A;  1U0B B;  3DM9 B;  4JVS A;  1Y4C A;  2KGO A;  1V54 C;  3GEH A;  3NMJ A;  4MW8 A;  3QVZ A;  1A7D A;  3U3F A;  4N06 A;  5JS5 A;  3C18 A;  5BQH A;  5T3T A;  1MNE A;  3ZTM A;  3BRJ A;  2YLI A;  1A7E A;  1NZE A;  1TFO B;  3NRH A;  1NFO A;  2EPK X;  1RJ9 B;  2UUH A;  1VYK A;  2QTV A;  2R03 A;  3IQ5 A;  1BR1 A;  2OCC C;  3K33 A;  1SF8 A;  4O6Y A;  1ZHT A;  2A6E F;  4CS7 A;  1WTY A;  2VCA A;  3U2M A;  1LS4 A;  1QQ3 A;  2Y3G A;  4J30 B;  1TR2 A;  3S27 A;  2OEV A;  5KYX B;  5L3V A;  3MFN A;  2J9U A;  3ZQV A;  1UG7 A;  3EZH A;  2QUP A;  4DXW A;  1RKC A;  3U0C A;  3DI5 A;  1RCP A;  3K66 A;  5AC5 A;  4P9F A;  2W4B A;  1YA7 O;  1RJ9 A;  1A41 A;  3ABM C;  2KNH A;  4XPW A;  4LDK A;  2OJQ A;  3ABK C;  1G5Z A;  1Q0M A;  1U6H A;  4U5D E;  4W8P A;  5KYU B;  4DVY P;  1H9G A;  2BE5 F;  3JYH A;  1GGQ A;  3HJC A; 
#chains in the Genus database with same CATH homology
 1V4A A;  1WOL A;  3L8I A;  1WWP A;  3S9O A;  1OW8 A;  1KTM A;  2L6H A;  4XEV A;  1WTY A;  4EBJ A;  1PV3 A;  1OW6 A;  1K05 A;  3GM1 A;  2LK4 A;  3JYY A;  3RQE A;  3MFN A;  3JZ0 A;  4R32 A;  3GM3 A;  4EBK A;  3B71 A;  3L8J A;  1K40 A;  3RQG A;  5F28 E;  1OW7 A;  3GM2 A;  2JX0 A;  3RQF A;  1KNY A;  2PBE A;  3U0C A;  2L6F A;  1JOG A;  1QVX A;  3U3F A;  1K04 A;  3C8G D;  3C8G A;  2KK1 A;  2L6G A;  3C18 A;  2YWA A;  3AJM A;  3BRJ A;  4NQF A;  4XEF A;  3C8G B;  3K7D A;  1O3U A;  1UFB A;  1ZZP A;  4XEK A;  3TUL A;  3O10 A;  2JPU A;  2HSB A;  2Q00 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...