1O3UA

Crystal structure of an hepn domain protein (tm0613) from thermotoga maritima at 1.75 a resolution
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
126
structure length
120
Chain Sequence
b'HHHMDAAKDDLEHAKHDLEHGFYNWACFSSQQAAEKAVKAVFQRMGAQAWGYSVPDFLGELSSRFEIPEELMDHALELDKACDALPSGSPRNRYSRIEAERLVNYAEKIIRFCEDLLSRI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords conserved hypothetical protein TM0613
molecule tags Unknown function
source organism Thermotoga maritima
publication title Crystal structure of an HEPN domain protein (TM0613) from Thermotoga maritima at 1.75 A resolution.
pubmed doi rcsb
total genus 45
structure length 120
sequence length 126
ec nomenclature
pdb deposition date 2003-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05168 HEPN HEPN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 1o3uA00
3GM1A 5F28E 3GM2A 1WWPA 2L6GA 3JYYA 2JX0A 3TULA 1V4AA 3MFNA 1WTYA 1OW7A 3U3FA 2L6HA 3C18A 4EBJA 1OW6A 3RQEA 2PBEA 3BRJA 2KK1A 3RQFA 1KNYA 3L8JA 3C8GA 3L8IA 4XEKA 1O3UA 1QVXA 3C8GD 3O10A 3B71A 2YWAA 3K7DA 3U0CA 1OW8A 1JOGA 4NQFA 3JZ0A 2LK4A 2HSBA 4R32A 1UFBA 1K05A 4XEFA 3RQGA 2JPUA 1K04A 2Q00A 3AJMA 1WOLA 3S9OA 1PV3A 4EBKA 3GM3A 4XEVA 1KTMA 1ZZPA 3C8GB 2L6FA 1K40A
chains in the Genus database with same CATH superfamily
1YZCA 5D92A 3QVYA 4JZAA 4IAOA 4LDRA 4G0HA 3OEOA 4JE9A 1AUEA 4P9FA 3AGTA 3DMDA 4N6HA 4ONSA 5L0FA 2NUTB 3QTHA 4Z9JA 4CX9A 1J8MF 5DLJA 3LNRA 4FX5A 1YJGA 2GFHA 4IRUA 1S7ZA 3M79A 2OQMA 1OCOC 1D1CA 1RJ9A 2IOQA 3EGXB 4LLCA 4U5GA 4DRJB 2G3KA 2XM4A 1GGQA 3NKDA 1SMYF 3K7DA 1Z7Qc 3T6BA 3CEXA 2EILC 2A68F 5KYXB 4LDKA 2A6EF 3U5SA 1MNEA 2Y3HA 3H2VA 3NDBB 3LEOA 2JPUA 3NMIA 2PF4E 2OG2A 3UMHA 4DRIB 1LKXA 3MLGA 3GM3A 3SP1A 3S0XA 2P6VA 3C8GB 3S84A 5CI9A 2QLAA 1B68A 3GODA 4NTFA 2MHRA 4IWBA 1OCCC 5DQZA 4CS9C 1A7EA 4MVUA 4BJ6A 3QW0A 4RDAA 2EIJC 1OW7A 2XLOA 2GA0A 3ZG1A 1RCPA 2D5RB 2NUPA 1U89A 2PBEA 2LSEA 3JYHA 3K1IA 4IGGA 1D0YA 3W2WA 5A6BD 3GEEA 1LI5A 4U5BE 5BUOA 1LS4A 1EKYA 1ORJA 1YA9A 4PK4A 4OIQF 3DE9A 1IW7F 1FMVA 4U5DE 4ZLDA 2IXPA 1HW1A 3NKEA 2AWCA 256BA 3RIPA 4LERA 2A69F 1A7VA 1LE4A 1EA8A 1WN0A 1ST6A 3K66A 4U5CE 1ORSC 3US6A 1T5OA 3HKKA 2YRFA 4YT2A 1U6HA 4FWVA 1YVIA 4BJ5A 4CBEA 3UGOA 1HW2A 4HFKB 1ZHWA 4E7ZA 1LIHA 4BEMJ 1NFNA 3BEHA 3DWWA 2WZGA 4PJNA 5BQHA 4UDVA 3KPHA 1R4TA 1WTYA 1Z3IX 2UUHA 5E33A 5AGFA 2CYDA 4JKVA 4EIYA 2XLWA 4XTKA 5JP7A 3DKAA 1G4WR 1C03A 5AC4A 3A11A 4JEBA 3GEHA 2LP4A 2VCCA 2MYSA 3UMKA 1XWJA 2J0WA 2KJGA 5L0GA 3B71A 1LE2A 4HEAJ 4P6IC 2R7UA 1F1MA 3JZ0A 2FAPB 1YZAA 2HSBA 2J9UA 3RW0A 2J9BA 3UMIA 1JMWA 3FHDA 2TMVP 2RSEB 4ER9A 3LLKA 3LESA 1M2OA 3VAYA 2GWWA 3HNJA 1LPEA 1T01A 3CAXA 3RVYA 4XEVA 1YYXA 2LFDA 2IYLD 2L6FA 4EKWA 4LACB 4OD5A 2Q7RA 2OU6A 5B1BC 3AGUA 3TD7A 2NSFA 1T9KA 1LM3B 1OR3A 1QKRA 2CCYA 2HJ3A 3JSEO 1HE1A 1V4AA 3LS0A 1SF8A 2HSQA 5D91A 3SZRA 1T6IA 1E85A 3R7CA 2H7OA 2HKVA 2YLDA 4U9EA 1DOWA 2V3CC 4RD9A 4E0IA 1O3UA 5KYWA 3U8VA 2WB7A 2XXAB 3IEEA 3T4RA 4YT8A 2L81A 3CSKA 3NRHA 3PMRA 3N2ZB 5CIVA 5FCLA 5B1AC 1E83A 2PX0A 4XLPF 1H6GA 2IXOA 1SYQA 1LVKA 2JD3A 1M56C 3Q6NA 4F4BA 2IXMA 4RBNA 2QY9A 4E17A 1KTMA 4LDQA 2PFDA 3N24A 3VYWA 3FMSA 2HMQA 3AG3C 2EPNA 4K7BA 2EPLX 3WAQA 2EPOA 1FFHA 1T6QA 1OXKA 1TKNA 2C03A 1QPUA 2J9WA 3MFNA 2NUTA 4CS7A 1ZW3A 2XL4A 3LS1A 2OOCA 2G3VA 3ITFA 5DS5A 3LEVA 3ZSUA 1OCZC 3TQOA 1J8YF 2XSEA 2EPMX 3EZHA 2CNWA 3L8IA 2KGOA 3QZCA 4JTAB 5KYUB 3POVA 1OKKA 2L9JA 2CNWD 4NTBA 2WVQA 1LS1A 1NFOA 3VM6A 3IHUA 2VASA 4R32A 2R7TA 1A0BA 1NU7D 1TWAA 4O7GA 3RQGA 4JVSA 2R7RA 3ATPA 1HMOA 1NBBA 2KW3C 1VOMA 3RVZA 4E7SA 5AC5A 2P61A 1E86A 4XPWA 5A69A 1TWGA 1NU9C 4M63A 1TR2A 3I5PA 4PJJA 1WASA 2Q3TA 3JT1A 2OCCC 3M4BA 1VTMP 1Q0DA 2L6GA 3M15A 4NC3A 5L3VA 3TULA 1CGOA 1TFKB 3U9MA 3ABLC 4H54A 2NUPB 4XPYA 3E9VA 3KYIA 4HE8D 1EQ1A 3C8GA 5K0IA 4X0RA 4C3DA 4AL0A 1A7DA 1ZHYA 1GM5A 5L0CA 1QVXA 2B0JA 2XXAA 3O6XA 3S29A 2E87A 5L0JA 4PJMA 2DYRC 4MVSA 1C17M 4K0DA 3W2VA 1MMDA 3EGDA 3TJ5A 4CS8A 4EBKA 1D0ZA 3TOMA 3T6GB 4DJ9A 4MW8A 3W8HA 1A41A 2OJQA 4Q7CA 2VCBA 2AVKA 5KYYA 1TWCA 4U5EE 5HSWA 4C7OB 3RYLA 3OA1A 3KYJA 2XLHA 5EGYA 5EK0A 3DXJF 1AEPA 4GYTA 2P0NA 4YL1A 5E3AA 3W8IA 3GORA 3JTLO 2KNHA 3LLIA 2HFIA 4YJWA 3SNHA 4AK9A 3FOOA 3NYMA 4PFOA 1RXQA 3O10A 5T3WA 2YWAA 4K1OA 4CIHA 1VYIA 2R7VA 4DBRA 4G7OF 2QE9A 4ULWA 3U2MA 2HUJA 4AE4B 3FXHA 1QQ3A 2B0HA 3AJMA 1RMVA 5F5FA 2XLEA 1AVOB 2QNLA 1RJ9B 2DYSC 3UR3C 3M1CB 3H2UA 3SXKA 1ZYRF 5T1DB 4CSAA 1BDJB 2A0UA 2LFFA 4MNDA 4O79A 4IJJA 4BJTA 5IY5C 3KL4A 1VLSA 4BG0A 1SR2A 2XS1A 4CDVA 1FTSA 2ETSA 3ZWIA 2VC9A 3BRJA 1VYKA 2CGEA 3S90A 3RH3A 4PJLA 1YDIA 5L0DA 2F22A 2EPKX 4MTGA 2BL2A 3C62A 2EINC 5JLIA 3JRMO 4MW3A 2PNOA 1MMAA 3HNLA 1H9GA 2AU5A 3E70C 4JW1A 3RF3A 5F5HA 3VF0A 1FAPB 2YQYA 4C7OA 1TFOB 2A6HF 3DAFA 1Q0MA 5BQIA 4QDLA 4OIRF 1VK5A 2W4BA 4DBQA 2CDQA 5EHHA 4A2NB 2OEVA 3TOLA 2R7SA 2DGJA 2D4UA 1VMAA 4MTFA 1FMWA 2HV7A 3NYJA 2YL1A 3NG1A 2R9RB 1JRAA 4YN0B 3I5QA 4O6MA 4I1MA 5L3QA 2ZXOA 3ZTZA 2NPUA 4J30B 3GEIA 2R7XA 1ZU5A 2HJMA 4IAQA 4BJ5C 4BEJA 3IQTA 2HV6A 3TK0A 1NSGB 4Q5SF 3HTKC 2YL3A 2IXNA 2YEVA 2ZPAA 4J7YA 2Y3DA 3SEOA 4IB4A 1H9TA 3EHNA 4E18A 1HE9A 4YK5A 3WODF 3NMKA 4WJ0A 3QVZA 3T9OA 3I4UA 4JTDB 3S28A 5JRAA 4CDAA 2G62A 4DOZA 5A6KA 5L0HA 3F47A 3K33A 3GM1A 4NCQA 3KH2A 2XLMA 1FR0A 4KBLA 1XZQA 1ZW2A 3GM2A 2LD6A 2JX0A 2X51A 3Q7LA 4DRHB 1S05A 2Y3GA 2BE5F 3DI5A 3QMKA 3B0UX 2LIGA 2L6HA 2IM8A 2R02A 2ZXWC 3LUTB 3K6BA 4YL3A 3U2LA 4JCZA 3SYNA 1YLMA 4KC9A 1MMNA 2HZ8A 3ZTMA 2WZFA 2YL7A 2Y3BA 3ZQYA 1GS9A 4WGZA 1OW8A 1D0XA 2ASRA 1JR8A 3NYLA 4MVOA 1FFTC 4N06A 1TQGA 5DVWA 3C7JA 1UFBA 1Z5ZA 4XEFA 1TWHA 1PD1A 3UGPA 3KMIA 3G4ZA 2YZSA 3V7OA 4D4XA 2R25A 1NZEA 3IPMO 1XZPA 3RKOF 2J0XA 4G78A 4G7ZF 2ZD9A 1D1BA 2FGYA 4JURI 2HS5A 4I1OB 3H65A 1IZMA 3DE8A 2WVNA 1JAFA 4MVQA 3M4CA 1PCXA 3DD7A 4J7TA 1M2VB 3U8PA 3ZIBA 1N1CA 1EI7A 2Y39A 1QZXA 1CPQA 4OINF 2GAQA 2KK1A 1VB5A 4JJFA 1OKKD 4C3BA 3AQCA 3OWTA 1Y4CA 2P1AA 3B29A 5KYNA 3IQCA 3R2PA 1HMDA 2Y69C 2W45A 1R5ID 4HFFB 4J32B 1OQCA 5JVEA 2R7OA 1UG7A 4G7HF 3TJ6A 2H8AA 1L3PA 1W2WA 2J45A 2J7PD 1WOLA 3WHNA 4AX2A 4H4KC 4WABA 5JSLA 3S9OA 2CW0F 4NY3A 3DAGA 2YLGA 3EFOA 3MX3A 1I4YA 4BPMA 4C3EA 2KQ9A 2P7VA 1K40A 4OIOF 3ASOC 1V74B 2XLDA 3GWNA 2YVKA 3CQZA 3SXYA 3X2QC 3JCUQ 2LCHA 4FESA 3ZC4A 5DS4A 3HNIA 1WWPA 3JYYA 3SXMA 3FAJA 3B0VC 2NSGA 3MYIA 5E3CA 2J46A 3LAYA 4ULVA 2VH3A 4W8PA 4AE4A 5COGA 2L7AA 1O87A 2A0BA 5GPGB 1RKEA 3C18A 3T6JA 3EH1A 2YL0A 4U9DA 1BZ4A 2DI3A 5DS6A 4CDYA 3EQLF 3ZVRA 5L0IA 3WG7C 4DXWA 2XRHA 3SXZA 4MVZA 2YLIA 1QSPA 2BC5A 2QTVA 3CZ6A 3FDQA 4NQFA 2J7PA 2LK4A 4YL0A 4JIOA 3FAPB 2DB4A 1M2VA 1M57C 2XL8A 3EFOB 1L7CA 3IQ5A 3C8ZA 4JTCB 5COFA 5T3TA 2Q9CA 4B6IA 2OKUA 1G4US 2IBFA 2A1DD 5COMA 3DM5A 1MQVA 1ZZPA 4JCHA 3FVYA 2XM0A 3DM9B 3K1IC 3Q6MA 3UNGC 1E84A 3MYFA 3G4XA 4XLNF 2WZLA 3A9CA 1G8XA 1RKEB 3K1HA 2V26A 4MTOA 4U5FE 2KC3A 5JT4A 5A6BA 3PHF2 2ZXRA 4CS9A 2RD9A 3U9JA 1D1AA 3C63A 2OEXA 3FOPA 3ABMC 4PR9A 3RQFA 1BBHA 1V55C 4MVRA 1DOVA 2ICWG 2M64A 3DZAA 3NMJA 4N6CA 4XEKA 4JRZA 4GQHA 3LNMB 1LI7A 4L6RA 1RKCA 3J06A 3U0CA 4D4NA 5B3SC 1YYJA 1JOGA 4PFPA 5CI8A 3X1OA 5A6AA 1K04A 1O5HA 2VB6A 4IARA 4PACA 5TJ5E 3ZDLA 3DJUB 4YT4A 3V5ZA 4XQ1A 5JUAA 3VRCA 1ZHTA 3HJCA 3G50A 4ZLCA 4LLEA 4Q4ZF 1V54C 1QLEC 4CJGA 3IQ6A 2MWQA 5DQTA 1SZIA 2W4MA 4CJOA 2EIKC 5E2QA 5KYXA 4OD4A 1ZHXA 2XS8A 3DJNB 2PP4A 4O6YA 3L34A 2R03A 3HNKA 4NTAA 4U5HA 3U3FA 1FNTc 4GEHA 3GWLA 5KYYB 2Q9BA 5FZTA 4ANJA 5BQGA 1YARO 3LJBA 4XWJA 3EZIA 2OJED 4EWCA 1VLTA 1JPJA 3AG1C 1BR2A 2M4EA 1U0BB 4DVYP 3JRTA 1OCRC 1OXBA 3B9QA 2J9VA 1WGWA 4P9TA 4EBBA 2AWYA 2YHSA 1K05A 2ZXPA 2Q00A 4I3MA 4FAPB 1JPNA 4MVMA 1ZU4A 4XPXA 2PX3A 4KNWA 2W9YA 3ASNC 3PCVA 3L0IA 4QI2A 2KYHA 2Q4FA 3RFYA 2Q9AA 2EIMC 2Z15A 2NG1A 3L1MA 1MNDA 3PDMP 2KSFA 2H7BA 2J8WA 2WL8A 3AG4C 1T6UA 1I5NA 2WVOA 3V5YA 1ZHZA 2R7QA 4Z9HA 3W4YA 4KI2A 1OW6A 2YKZA 3RQEA 4A4AA 4CSAC 1I4ZA 3L8JA 2AP3A 1G5ZA 1YA7O 3EGXA 4JC7A 5KYUA 4QI0A 3MBGA 1WATA 3N0TA 3V5XA 4EUKB 5JS5A 2I8BA 3C8GD 3B0PA 4Z9IA 3EG9A 1CGME 1Z23A 1BR1A 4BJ6C 4W8KA 3ZQVA 5B3IA 4KNVA 3EHMA 1Y6DA 4JEAA 5A6JA 3ECSA 1HY5A 1PD0A 3O39A 4BJ1A 2FFHA 1KU2A 1C02A 4MQ9F 1PV3A 3KKBA 4YT5A 3S27A 2O9XA 2QUPA 4AL1A 2R7WA 1NLXA 5F28E 1ZVZA 1CPRA 1GQAA 3AG2C 1Q0KA 3AQBA 1APCA 3EG9B 3QW1A 4MS2A 4DVZA 3U3BA 2LQGA 1E2XA 3GANA 3EH2A 2H7VC 2I15A 1Z6AA 2C04A 2VCAA 3AOUA 2XLVA 4E0HA 4EBJA 2UUIA 3EGDB 4N4WA 1KNYA 2HMZA 1Q0FA 1OR2A 4YWQA 3Q7GA 1MMGA 5KYWB 4CIPA 1YAUO 3HLZA 2R05A 4JJGA 2X0CA 3ABKC 1NG1A 3F46A 3EPVA 4EHPA 4CS8C 3JSZA 4I44A 4OIPF 3EJNA 1M6TA 5HV9A 2XL6A 3O55A 1Z63A 1Q0GA 4O6NA 1ORYA 2GDCA 1H7IA 1BR4A 4WGYA 1CGNA
chains in the Genus database with same CATH topology
3GM1A 5F28E 3GM2A 1WWPA 2L6GA 3JYYA 2JX0A 3TULA 1V4AA 3MFNA 1WTYA 1OW7A 3U3FA 2L6HA 3C18A 4EBJA 1OW6A 3RQEA 2PBEA 3BRJA 2KK1A 3RQFA 1KNYA 3L8JA 3C8GA 3L8IA 4XEKA 1O3UA 1QVXA 3C8GD 3O10A 3B71A 2YWAA 3K7DA 3U0CA 1OW8A 1JOGA 4NQFA 3JZ0A 2LK4A 2HSBA 4R32A 1UFBA 1K05A 4XEFA 3RQGA 2JPUA 1K04A 2Q00A 3AJMA 1WOLA 3S9OA 1PV3A 4EBKA 3GM3A 4XEVA 1KTMA 1ZZPA 3C8GB 2L6FA 1K40A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GM1 A;  5F28 E;  3GM2 A;  1WWP A;  2L6G A;  3JYY A;  2JX0 A;  3TUL A;  1V4A A;  3MFN A;  1WTY A;  1OW7 A;  3U3F A;  2L6H A;  3C18 A;  4EBJ A;  1OW6 A;  3RQE A;  2PBE A;  3BRJ A;  2KK1 A;  3RQF A;  1KNY A;  3L8J A;  3C8G A;  3L8I A;  4XEK A;  1O3U A;  1QVX A;  3C8G D;  3O10 A;  3B71 A;  2YWA A;  3K7D A;  3U0C A;  1OW8 A;  1JOG A;  4NQF A;  3JZ0 A;  2LK4 A;  2HSB A;  4R32 A;  1UFB A;  1K05 A;  4XEF A;  3RQG A;  2JPU A;  1K04 A;  2Q00 A;  3AJM A;  1WOL A;  3S9O A;  1PV3 A;  4EBK A;  3GM3 A;  4XEV A;  1KTM A;  1ZZP A;  3C8G B;  2L6F A;  1K40 A; 
#chains in the Genus database with same CATH topology
 1YZC A;  5D92 A;  3QVY A;  4JZA A;  4IAO A;  4LDR A;  4G0H A;  3OEO A;  4JE9 A;  1AUE A;  4P9F A;  3AGT A;  3DMD A;  4N6H A;  4ONS A;  5L0F A;  2NUT B;  3QTH A;  4Z9J A;  4CX9 A;  1J8M F;  5DLJ A;  3LNR A;  4FX5 A;  1YJG A;  2GFH A;  4IRU A;  1S7Z A;  3M79 A;  2OQM A;  1OCO C;  1D1C A;  1RJ9 A;  2IOQ A;  3EGX B;  4LLC A;  4U5G A;  4DRJ B;  2G3K A;  2XM4 A;  1GGQ A;  3NKD A;  1SMY F;  3K7D A;  1Z7Q c;  3T6B A;  3CEX A;  2EIL C;  2A68 F;  5KYX B;  4LDK A;  2A6E F;  3U5S A;  1MNE A;  2Y3H A;  3H2V A;  3NDB B;  3LEO A;  2JPU A;  3NMI A;  2PF4 E;  2OG2 A;  3UMH A;  4DRI B;  1LKX A;  3MLG A;  3GM3 A;  3SP1 A;  3S0X A;  2P6V A;  3C8G B;  3S84 A;  5CI9 A;  2QLA A;  1B68 A;  3GOD A;  4NTF A;  2MHR A;  4IWB A;  1OCC C;  5DQZ A;  4CS9 C;  1A7E A;  4MVU A;  4BJ6 A;  3QW0 A;  4RDA A;  2EIJ C;  1OW7 A;  2XLO A;  2GA0 A;  3ZG1 A;  1RCP A;  2D5R B;  2NUP A;  1U89 A;  2PBE A;  2LSE A;  3JYH A;  3K1I A;  4IGG A;  1D0Y A;  3W2W A;  5A6B D;  3GEE A;  1LI5 A;  4U5B E;  5BUO A;  1LS4 A;  1EKY A;  1ORJ A;  1YA9 A;  4PK4 A;  4OIQ F;  3DE9 A;  1IW7 F;  1FMV A;  4U5D E;  4ZLD A;  2IXP A;  1HW1 A;  3NKE A;  2AWC A;  256B A;  3RIP A;  4LER A;  2A69 F;  1A7V A;  1LE4 A;  1EA8 A;  1WN0 A;  1ST6 A;  3K66 A;  4U5C E;  1ORS C;  3US6 A;  1T5O A;  3HKK A;  2YRF A;  4YT2 A;  1U6H A;  4FWV A;  1YVI A;  4BJ5 A;  4CBE A;  3UGO A;  1HW2 A;  4HFK B;  1ZHW A;  4E7Z A;  1LIH A;  4BEM J;  1NFN A;  3BEH A;  3DWW A;  2WZG A;  4PJN A;  5BQH A;  4UDV A;  3KPH A;  1R4T A;  1WTY A;  1Z3I X;  2UUH A;  5E33 A;  5AGF A;  2CYD A;  4JKV A;  4EIY A;  2XLW A;  4XTK A;  5JP7 A;  3DKA A;  1G4W R;  1C03 A;  5AC4 A;  3A11 A;  4JEB A;  3GEH A;  2LP4 A;  2VCC A;  2MYS A;  3UMK A;  1XWJ A;  2J0W A;  2KJG A;  5L0G A;  3B71 A;  1LE2 A;  4HEA J;  4P6I C;  2R7U A;  1F1M A;  3JZ0 A;  2FAP B;  1YZA A;  2HSB A;  2J9U A;  3RW0 A;  2J9B A;  3UMI A;  1JMW A;  3FHD A;  2TMV P;  2RSE B;  4ER9 A;  3LLK A;  3LES A;  1M2O A;  3VAY A;  2GWW A;  3HNJ A;  1LPE A;  1T01 A;  3CAX A;  3RVY A;  4XEV A;  1YYX A;  2LFD A;  2IYL D;  2L6F A;  4EKW A;  4LAC B;  4OD5 A;  2Q7R A;  2OU6 A;  5B1B C;  3AGU A;  3TD7 A;  2NSF A;  1T9K A;  1LM3 B;  1OR3 A;  1QKR A;  2CCY A;  2HJ3 A;  3JSE O;  1HE1 A;  1V4A A;  3LS0 A;  1SF8 A;  2HSQ A;  5D91 A;  3SZR A;  1T6I A;  1E85 A;  3R7C A;  2H7O A;  2HKV A;  2YLD A;  4U9E A;  1DOW A;  2V3C C;  4RD9 A;  4E0I A;  1O3U A;  5KYW A;  3U8V A;  2WB7 A;  2XXA B;  3IEE A;  3T4R A;  4YT8 A;  2L81 A;  3CSK A;  3NRH A;  3PMR A;  3N2Z B;  5CIV A;  5FCL A;  5B1A C;  1E83 A;  2PX0 A;  4XLP F;  1H6G A;  2IXO A;  1SYQ A;  1LVK A;  2JD3 A;  1M56 C;  3Q6N A;  4F4B A;  2IXM A;  4RBN A;  2QY9 A;  4E17 A;  1KTM A;  4LDQ A;  2PFD A;  3N24 A;  3VYW A;  3FMS A;  2HMQ A;  3AG3 C;  2EPN A;  4K7B A;  2EPL X;  3WAQ A;  2EPO A;  1FFH A;  1T6Q A;  1OXK A;  1TKN A;  2C03 A;  1QPU A;  2J9W A;  3MFN A;  2NUT A;  4CS7 A;  1ZW3 A;  2XL4 A;  3LS1 A;  2OOC A;  2G3V A;  3ITF A;  5DS5 A;  3LEV A;  3ZSU A;  1OCZ C;  3TQO A;  1J8Y F;  2XSE A;  2EPM X;  3EZH A;  2CNW A;  3L8I A;  2KGO A;  3QZC A;  4JTA B;  5KYU B;  3POV A;  1OKK A;  2L9J A;  2CNW D;  4NTB A;  2WVQ A;  1LS1 A;  1NFO A;  3VM6 A;  3IHU A;  2VAS A;  4R32 A;  2R7T A;  1A0B A;  1NU7 D;  1TWA A;  4O7G A;  3RQG A;  4JVS A;  2R7R A;  3ATP A;  1HMO A;  1NBB A;  2KW3 C;  1VOM A;  3RVZ A;  4E7S A;  5AC5 A;  2P61 A;  1E86 A;  4XPW A;  5A69 A;  1TWG A;  1NU9 C;  4M63 A;  1TR2 A;  3I5P A;  4PJJ A;  1WAS A;  2Q3T A;  3JT1 A;  2OCC C;  3M4B A;  1VTM P;  1Q0D A;  2L6G A;  3M15 A;  4NC3 A;  5L3V A;  3TUL A;  1CGO A;  1TFK B;  3U9M A;  3ABL C;  4H54 A;  2NUP B;  4XPY A;  3E9V A;  3KYI A;  4HE8 D;  1EQ1 A;  3C8G A;  5K0I A;  4X0R A;  4C3D A;  4AL0 A;  1A7D A;  1ZHY A;  1GM5 A;  5L0C A;  1QVX A;  2B0J A;  2XXA A;  3O6X A;  3S29 A;  2E87 A;  5L0J A;  4PJM A;  2DYR C;  4MVS A;  1C17 M;  4K0D A;  3W2V A;  1MMD A;  3EGD A;  3TJ5 A;  4CS8 A;  4EBK A;  1D0Z A;  3TOM A;  3T6G B;  4DJ9 A;  4MW8 A;  3W8H A;  1A41 A;  2OJQ A;  4Q7C A;  2VCB A;  2AVK A;  5KYY A;  1TWC A;  4U5E E;  5HSW A;  4C7O B;  3RYL A;  3OA1 A;  3KYJ A;  2XLH A;  5EGY A;  5EK0 A;  3DXJ F;  1AEP A;  4GYT A;  2P0N A;  4YL1 A;  5E3A A;  3W8I A;  3GOR A;  3JTL O;  2KNH A;  3LLI A;  2HFI A;  4YJW A;  3SNH A;  4AK9 A;  3FOO A;  3NYM A;  4PFO A;  1RXQ A;  3O10 A;  5T3W A;  2YWA A;  4K1O A;  4CIH A;  1VYI A;  2R7V A;  4DBR A;  4G7O F;  2QE9 A;  4ULW A;  3U2M A;  2HUJ A;  4AE4 B;  3FXH A;  1QQ3 A;  2B0H A;  3AJM A;  1RMV A;  5F5F A;  2XLE A;  1AVO B;  2QNL A;  1RJ9 B;  2DYS C;  3UR3 C;  3M1C B;  3H2U A;  3SXK A;  1ZYR F;  5T1D B;  4CSA A;  1BDJ B;  2A0U A;  2LFF A;  4MND A;  4O79 A;  4IJJ A;  4BJT A;  5IY5 C;  3KL4 A;  1VLS A;  4BG0 A;  1SR2 A;  2XS1 A;  4CDV A;  1FTS A;  2ETS A;  3ZWI A;  2VC9 A;  3BRJ A;  1VYK A;  2CGE A;  3S90 A;  3RH3 A;  4PJL A;  1YDI A;  5L0D A;  2F22 A;  2EPK X;  4MTG A;  2BL2 A;  3C62 A;  2EIN C;  5JLI A;  3JRM O;  4MW3 A;  2PNO A;  1MMA A;  3HNL A;  1H9G A;  2AU5 A;  3E70 C;  4JW1 A;  3RF3 A;  5F5H A;  3VF0 A;  1FAP B;  2YQY A;  4C7O A;  1TFO B;  2A6H F;  3DAF A;  1Q0M A;  5BQI A;  4QDL A;  4OIR F;  1VK5 A;  2W4B A;  4DBQ A;  2CDQ A;  5EHH A;  4A2N B;  2OEV A;  3TOL A;  2R7S A;  2DGJ A;  2D4U A;  1VMA A;  4MTF A;  1FMW A;  2HV7 A;  3NYJ A;  2YL1 A;  3NG1 A;  2R9R B;  1JRA A;  4YN0 B;  3I5Q A;  4O6M A;  4I1M A;  5L3Q A;  2ZXO A;  3ZTZ A;  2NPU A;  4J30 B;  3GEI A;  2R7X A;  1ZU5 A;  2HJM A;  4IAQ A;  4BJ5 C;  4BEJ A;  3IQT A;  2HV6 A;  3TK0 A;  1NSG B;  4Q5S F;  3HTK C;  2YL3 A;  2IXN A;  2YEV A;  2ZPA A;  4J7Y A;  2Y3D A;  3SEO A;  4IB4 A;  1H9T A;  3EHN A;  4E18 A;  1HE9 A;  4YK5 A;  3WOD F;  3NMK A;  4WJ0 A;  3QVZ A;  3T9O A;  3I4U A;  4JTD B;  3S28 A;  5JRA A;  4CDA A;  2G62 A;  4DOZ A;  5A6K A;  5L0H A;  3F47 A;  3K33 A;  3GM1 A;  4NCQ A;  3KH2 A;  2XLM A;  1FR0 A;  4KBL A;  1XZQ A;  1ZW2 A;  3GM2 A;  2LD6 A;  2JX0 A;  2X51 A;  3Q7L A;  4DRH B;  1S05 A;  2Y3G A;  2BE5 F;  3DI5 A;  3QMK A;  3B0U X;  2LIG A;  2L6H A;  2IM8 A;  2R02 A;  2ZXW C;  3LUT B;  3K6B A;  4YL3 A;  3U2L A;  4JCZ A;  3SYN A;  1YLM A;  4KC9 A;  1MMN A;  2HZ8 A;  3ZTM A;  2WZF A;  2YL7 A;  2Y3B A;  3ZQY A;  1GS9 A;  4WGZ A;  1OW8 A;  1D0X A;  2ASR A;  1JR8 A;  3NYL A;  4MVO A;  1FFT C;  4N06 A;  1TQG A;  5DVW A;  3C7J A;  1UFB A;  1Z5Z A;  4XEF A;  1TWH A;  1PD1 A;  3UGP A;  3KMI A;  3G4Z A;  2YZS A;  3V7O A;  4D4X A;  2R25 A;  1NZE A;  3IPM O;  1XZP A;  3RKO F;  2J0X A;  4G78 A;  4G7Z F;  2ZD9 A;  1D1B A;  2FGY A;  4JUR I;  2HS5 A;  4I1O B;  3H65 A;  1IZM A;  3DE8 A;  2WVN A;  1JAF A;  4MVQ A;  3M4C A;  1PCX A;  3DD7 A;  4J7T A;  1M2V B;  3U8P A;  3ZIB A;  1N1C A;  1EI7 A;  2Y39 A;  1QZX A;  1CPQ A;  4OIN F;  2GAQ A;  2KK1 A;  1VB5 A;  4JJF A;  1OKK D;  4C3B A;  3AQC A;  3OWT A;  1Y4C A;  2P1A A;  3B29 A;  5KYN A;  3IQC A;  3R2P A;  1HMD A;  2Y69 C;  2W45 A;  1R5I D;  4HFF B;  4J32 B;  1OQC A;  5JVE A;  2R7O A;  1UG7 A;  4G7H F;  3TJ6 A;  2H8A A;  1L3P A;  1W2W A;  2J45 A;  2J7P D;  1WOL A;  3WHN A;  4AX2 A;  4H4K C;  4WAB A;  5JSL A;  3S9O A;  2CW0 F;  4NY3 A;  3DAG A;  2YLG A;  3EFO A;  3MX3 A;  1I4Y A;  4BPM A;  4C3E A;  2KQ9 A;  2P7V A;  1K40 A;  4OIO F;  3ASO C;  1V74 B;  2XLD A;  3GWN A;  2YVK A;  3CQZ A;  3SXY A;  3X2Q C;  3JCU Q;  2LCH A;  4FES A;  3ZC4 A;  5DS4 A;  3HNI A;  1WWP A;  3JYY A;  3SXM A;  3FAJ A;  3B0V C;  2NSG A;  3MYI A;  5E3C A;  2J46 A;  3LAY A;  4ULV A;  2VH3 A;  4W8P A;  4AE4 A;  5COG A;  2L7A A;  1O87 A;  2A0B A;  5GPG B;  1RKE A;  3C18 A;  3T6J A;  3EH1 A;  2YL0 A;  4U9D A;  1BZ4 A;  2DI3 A;  5DS6 A;  4CDY A;  3EQL F;  3ZVR A;  5L0I A;  3WG7 C;  4DXW A;  2XRH A;  3SXZ A;  4MVZ A;  2YLI A;  1QSP A;  2BC5 A;  2QTV A;  3CZ6 A;  3FDQ A;  4NQF A;  2J7P A;  2LK4 A;  4YL0 A;  4JIO A;  3FAP B;  2DB4 A;  1M2V A;  1M57 C;  2XL8 A;  3EFO B;  1L7C A;  3IQ5 A;  3C8Z A;  4JTC B;  5COF A;  5T3T A;  2Q9C A;  4B6I A;  2OKU A;  1G4U S;  2IBF A;  2A1D D;  5COM A;  3DM5 A;  1MQV A;  1ZZP A;  4JCH A;  3FVY A;  2XM0 A;  3DM9 B;  3K1I C;  3Q6M A;  3UNG C;  1E84 A;  3MYF A;  3G4X A;  4XLN F;  2WZL A;  3A9C A;  1G8X A;  1RKE B;  3K1H A;  2V26 A;  4MTO A;  4U5F E;  2KC3 A;  5JT4 A;  5A6B A;  3PHF 2;  2ZXR A;  4CS9 A;  2RD9 A;  3U9J A;  1D1A A;  3C63 A;  2OEX A;  3FOP A;  3ABM C;  4PR9 A;  3RQF A;  1BBH A;  1V55 C;  4MVR A;  1DOV A;  2ICW G;  2M64 A;  3DZA A;  3NMJ A;  4N6C A;  4XEK A;  4JRZ A;  4GQH A;  3LNM B;  1LI7 A;  4L6R A;  1RKC A;  3J06 A;  3U0C A;  4D4N A;  5B3S C;  1YYJ A;  1JOG A;  4PFP A;  5CI8 A;  3X1O A;  5A6A A;  1K04 A;  1O5H A;  2VB6 A;  4IAR A;  4PAC A;  5TJ5 E;  3ZDL A;  3DJU B;  4YT4 A;  3V5Z A;  4XQ1 A;  5JUA A;  3VRC A;  1ZHT A;  3HJC A;  3G50 A;  4ZLC A;  4LLE A;  4Q4Z F;  1V54 C;  1QLE C;  4CJG A;  3IQ6 A;  2MWQ A;  5DQT A;  1SZI A;  2W4M A;  4CJO A;  2EIK C;  5E2Q A;  5KYX A;  4OD4 A;  1ZHX A;  2XS8 A;  3DJN B;  2PP4 A;  4O6Y A;  3L34 A;  2R03 A;  3HNK A;  4NTA A;  4U5H A;  3U3F A;  1FNT c;  4GEH A;  3GWL A;  5KYY B;  2Q9B A;  5FZT A;  4ANJ A;  5BQG A;  1YAR O;  3LJB A;  4XWJ A;  3EZI A;  2OJE D;  4EWC A;  1VLT A;  1JPJ A;  3AG1 C;  1BR2 A;  2M4E A;  1U0B B;  4DVY P;  3JRT A;  1OCR C;  1OXB A;  3B9Q A;  2J9V A;  1WGW A;  4P9T A;  4EBB A;  2AWY A;  2YHS A;  1K05 A;  2ZXP A;  2Q00 A;  4I3M A;  4FAP B;  1JPN A;  4MVM A;  1ZU4 A;  4XPX A;  2PX3 A;  4KNW A;  2W9Y A;  3ASN C;  3PCV A;  3L0I A;  4QI2 A;  2KYH A;  2Q4F A;  3RFY A;  2Q9A A;  2EIM C;  2Z15 A;  2NG1 A;  3L1M A;  1MND A;  3PDM P;  2KSF A;  2H7B A;  2J8W A;  2WL8 A;  3AG4 C;  1T6U A;  1I5N A;  2WVO A;  3V5Y A;  1ZHZ A;  2R7Q A;  4Z9H A;  3W4Y A;  4KI2 A;  1OW6 A;  2YKZ A;  3RQE A;  4A4A A;  4CSA C;  1I4Z A;  3L8J A;  2AP3 A;  1G5Z A;  1YA7 O;  3EGX A;  4JC7 A;  5KYU A;  4QI0 A;  3MBG A;  1WAT A;  3N0T A;  3V5X A;  4EUK B;  5JS5 A;  2I8B A;  3C8G D;  3B0P A;  4Z9I A;  3EG9 A;  1CGM E;  1Z23 A;  1BR1 A;  4BJ6 C;  4W8K A;  3ZQV A;  5B3I A;  4KNV A;  3EHM A;  1Y6D A;  4JEA A;  5A6J A;  3ECS A;  1HY5 A;  1PD0 A;  3O39 A;  4BJ1 A;  2FFH A;  1KU2 A;  1C02 A;  4MQ9 F;  1PV3 A;  3KKB A;  4YT5 A;  3S27 A;  2O9X A;  2QUP A;  4AL1 A;  2R7W A;  1NLX A;  5F28 E;  1ZVZ A;  1CPR A;  1GQA A;  3AG2 C;  1Q0K A;  3AQB A;  1APC A;  3EG9 B;  3QW1 A;  4MS2 A;  4DVZ A;  3U3B A;  2LQG A;  1E2X A;  3GAN A;  3EH2 A;  2H7V C;  2I15 A;  1Z6A A;  2C04 A;  2VCA A;  3AOU A;  2XLV A;  4E0H A;  4EBJ A;  2UUI A;  3EGD B;  4N4W A;  1KNY A;  2HMZ A;  1Q0F A;  1OR2 A;  4YWQ A;  3Q7G A;  1MMG A;  5KYW B;  4CIP A;  1YAU O;  3HLZ A;  2R05 A;  4JJG A;  2X0C A;  3ABK C;  1NG1 A;  3F46 A;  3EPV A;  4EHP A;  4CS8 C;  3JSZ A;  4I44 A;  4OIP F;  3EJN A;  1M6T A;  5HV9 A;  2XL6 A;  3O55 A;  1Z63 A;  1Q0G A;  4O6N A;  1ORY A;  2GDC A;  1H7I A;  1BR4 A;  4WGY A;  1CGN A; 
#chains in the Genus database with same CATH homology
 3GM1 A;  5F28 E;  3GM2 A;  1WWP A;  2L6G A;  3JYY A;  2JX0 A;  3TUL A;  1V4A A;  3MFN A;  1WTY A;  1OW7 A;  3U3F A;  2L6H A;  3C18 A;  4EBJ A;  1OW6 A;  3RQE A;  2PBE A;  3BRJ A;  2KK1 A;  3RQF A;  1KNY A;  3L8J A;  3C8G A;  3L8I A;  4XEK A;  1O3U A;  1QVX A;  3C8G D;  3O10 A;  3B71 A;  2YWA A;  3K7D A;  3U0C A;  1OW8 A;  1JOG A;  4NQF A;  3JZ0 A;  2LK4 A;  2HSB A;  4R32 A;  1UFB A;  1K05 A;  4XEF A;  3RQG A;  2JPU A;  1K04 A;  2Q00 A;  3AJM A;  1WOL A;  3S9O A;  1PV3 A;  4EBK A;  3GM3 A;  4XEV A;  1KTM A;  1ZZP A;  3C8G B;  2L6F A;  1K40 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...