1K04A

Crystal structure of the focal adhesion targeting domain of focal adhesion kinase
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
142
structure length
142
Chain Sequence
EISPPPTANLDRSNDKVYENVTGLVKAVIEMSSKIQPAPPEEYVPMVKEVGLALRTLLATVDETIPLLPASTHREIEMAQKLLNSDLGELINKMKLAQQYVMTSLQQEYKKQMLTAAHALAVDAKNLLDVIDQARLKMLGQT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The structural basis of localization and signaling by the focal adhesion targeting domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords FOCAL ADHESION KINASE 1
total genus 56
structure length 142
sequence length 142
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2001-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03623 Focal_AT Focal adhesion targeting region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.540 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 1k04A01
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 1k04A02
3AE3C 1ZOYC 1K05A 4NQFA 3RQEA 4EBKA 1WOLA 1PV3A 3AE8C 3MFNA 2G3AA 3B71A 3SFDC 2JX0A 2JPUA 1ZZPA 4XEFA 1OW7A 3AE5C 3RQGA 3TULA 3AEGC 3K7DA 1OW6A 2Q00A 3U0CA 1WWPA 1O3UA 2HSBA 3GM3A 3AJMA 2FBWC 3S9OA 3RQFA 1KNYA 3L8IA 1YQ3C 1KTMA 3AE1C 3SFEC 1UFBA 4XEKA 3GM1A 2H88C 3AEAC 1WTYA 3O10A 3C18A 1QVXA 5F28E 2L6GA 4EBJA 3C8GB 3U3FA 1JOGA 4R32A 4YXDC 3ABVC 3C8GA 3L8JA 1K04A 2LK4A 4XEVA 1K40A 1YQ4C 3AECC 1ZP0C 3BRJA 3C8GD 2PBEA 2WQYC 1V4AA 3AEBC 3AEDC 3AE9C 2KK1A 3JYYA 3AEEC 3AEFC 3AE2C 1OW8A 3AE6C 2H89C 2L6HA 3GM2A 2L6FA 3JZ0A 3AE4C 3AE7C 4YTPC 2YWAA
chains in the Genus database with same CATH superfamily
1HUCA 3T6BA 1OCRC 1GD2E 2A45H 4FAPB 1M1JC 3HE5B 3HUSA 3RL0C 2K3RA 2KYVA 3BRTB 3DAFA 1WOLA 1NU7D 5CCGA 3HD7D 3MFNA 1HMOA 1FC2C 3OJAB 1E2XA 3Q5PA 3MLGA 4MVRA 3L75J 1IFJA 2N1TD 3SFDC 2D2CB 4D4XA 2Z15A 4G7OF 1M56D 3M0DC 1NSGB 1YVIA 2PF4E 3N7NA 3UGOA 4ZLDA 3MUDA 3CWBE 2CCYA 2Q00A 3U5SA 3M1CB 2QSIA 3TNUB 1PGOA 1QZXA 4CDVA 1XWJA 3VMAA 4GYTA 1X79B 4B6IA 1IW7F 3TGUE 4HEAJ 1FZBA 2YMYA 1H6GA 3RW0A 2KS1B 1Q90D 3AJMA 1L0LD 1VTMP 2YO2A 3G4ZA 1PGPA 1Z7Qc 3AE1C 4C3BA 3LW5J 3MP7B 1PGQA 4U5CE 2QJYB 4IL6X 2CNWA 4O79A 2GDCA 256BA 2Y3GA 2P67A 4XA4A 3L70D 3A9CA 4KNWA 4IFMA 5AVTB 2UUHA 1LIHA 2XM4A 1T6QA 1Z23A 3CCRP 4JE9A 4H44C 4EBJA 4OGQC 2AVKA 3IEEA 4C3EA 1K04A 1J1EC 2QJPB 3LEOA 2Y3HA 2JD3A 1L0ND 4XQ1A 3CWBG 4DRIB 2LD6A 4ULVA 2P6VA 4BJ5A 4BJ1A 1D7MA 4UB6E 4YPCA 4MVQA 4D4NA 2GA0A 3II6A 1HGVA 3AG1C 4C3DA 2E76C 4JQ0D 4E17A 1GM5A 1FE6A 5TISE 1KYOI 3Q2YA 1VL2A 1J8MF 2PRRA 3F5HA 4I1OB 1Q0MA 2B0JA 1GTWA 3E7KA 4GIFA 2P0NA 5AVUB 3CWBJ 3LAYA 1K73Q 4AL1A 4W80A 2XNXA 4OWFA 4GEHA 2GM4A 1L0LJ 4EDFA 3I55P 3MYFA 4Z1MH 3CMAP 1U0BB 2P7JA 4DRHB 2R44A 2QJPC 1J1DC 3KH2A 1NAFA 4NPDA 1YJGA 2B87B 5BU8B 4IFFA 3M9QA 4O9BA 2YL7A 2KSFA 2VCBA 3AE8C 4L74A 1FBMA 1YLMA 2Q9IA 1X0TA 1BE3E 1FU1A 2K37A 3PP5A 1NJIQ 1H7IA 3RVZA 2KIKA 2JX0A 3KMIA 1YHQP 3EZIA 3B0UX 1WGWA 1YIJP 5DJTB 2IBZG 2KJGA 2BEZF 4AX2A 3U1AA 1HMDA 3GEHA 4C7OB 2FYUD 3VMYA 1SQXK 2B9BA 5KLVG 1NTZK 1WWPA 5BUOA 4RD9A 3TYYA 2FYUK 5TJHA 5DS5A 2WVRA 1SQPK 1BGYE 3WUVA 3UMHA 1SQPD 2QA4P 5L3VA 1YYJA 2AP3A 3GM1A 4AL0A 1OZHA 3L75G 2CDQA 2EPKX 2G3KA 3QW1A 3KHUA 3D6YA 3FAJA 2R7UA 3ZWIA 4KC9A 3ECSA 2QY9A 1M1KQ 3FDQA 3M4BA 1W5CE 4QI0A 1PGJA 2PFXA 2HPCA 3C8GA 3X2QC 4PJNA 2V7QH 3EFFK 1JY3O 5JUAA 3D6ZA 1VQLP 4OD4A 2OJQA 4J7TA 2ZD9A 1KU2A 1NWQA 3LW5H 4LDKA 4EIYA 3H1KJ 1SQVK 2P2UA 3PCVA 5BQGA 1JNMA 3LEVA 3CCQP 1PP9D 2OYHC 1Q0FA 4WY4C 1AQTA 1QL2A 1DEEG 3U1CA 4I7ZB 5APVA 2KNCB 1GL2A 1M1JB 3KPHA 2KSEA 2KZJA 1NU1D 4HYTB 1YAUO 5JRAA 1QQ3A 2WPVB 4JZAA 1M6TA 2M5AA 4RKUJ 5F5HA 4RDAA 3VOPA 3PTZA 4YK5A 3AE7C 1E79H 5APQA 1BGYJ 1AVOB 3SNHA 5T1DB 2M8RA 4G7ZF 3IQTA 5KJ7D 1YARO 3EFOA 1WATA 1FOSF 4NQFA 5AW0B 4EBKA 1S5LH 2LP4A 3A7OA 1XTCC 3HE4B 1D1CA 1L0NK 4JPZB 3B0VC 1T3UA 1FZFA 3FHDA 1KILD 4CSAA 2J46A 4H44D 3H1HJ 1ZW3A 4N78D 1ZZPA 2HSQA 3GHGC 3W8HA 1TKNA 4DCKA 3GORA 1LNQA 4JEAA 1SQBJ 3U0CA 1N8RQ 2Q9AA 4BJTA 2JP3A 3H1KE 2OJED 4JCHA 3SWFA 2XRHA 2FFHA 4IRUA 4H44B 4PK4A 1OXZA 5KLVD 3L8IA 3FGAD 2V26A 2OYHB 1KYOD 2P58A 3HNLA 3VMXA 1ZR2A 1LP1A 3QMKA 1JR8A 3M06A 4IJJA 1Q7YQ 4P6IC 2A6EF 3RK3E 3TK1A 5B66E 2L6GA 3EZHA 1URQB 1Q0DA 3S28A 4U3FG 1N73B 1JOGA 3Q6NA 1LM3B 3L72G 3H1ID 1JRAA 3G50A 1S2EA 4HFFB 4LLCA 4BJ6C 1MMDA 3HJCA 3RL0B 3VP9A 3OW2O 5A6BA 4CBEA 3CX5I 1Y47A 1NTZG 1ZHZA 1NTKE 1S1CX 5KYYB 2WITA 4KHXA 1JTHA 4LLHA 1OKKD 1BCCE 2XZRA 3V2RA 5EFWB 3T97A 1NFOA 3NMIA 2YKOA 3NKDA 4DBRA 2FYNB 5GTIH 1LTJA 1NBBA 2FFDC 3U9JA 2QUPA 3BATA 2R7WA 1MMNA 1G4WR 2QLAA 2LXCB 4R4MA 5BVZA 1D0ZA 3U8VA 1URQC 1SQPJ 2QIWA 1FJPA 4DOJA 1GL2D 2Y39A 1OXKA 1KILC 1SQXJ 3H1LD 4YJWA 4YT2A 2XLMA 1CPRA 5E79H 1ZYRF 2OOCA 4DZOA 1LVKA 2GA1A 1YYCA 2YLGA 2AXCA 2I1JA 2RKLA 1NFNA 3O6XA 3TOMA 3NYLA 1SFCB 3L1MA 4I3MA 5FCLA 3L72J 3H1KD 4DJGA 3CC2P 2NUTB 1ORJA 2P1AA 4I6MC 3C63A 5CI8A 3OWTA 4BJ5C 1J2JB 2IXPA 4MN4C 1RMVA 1JEKA 2B0HA 4PJJA 1QEXA 1DH3A 2WL8A 5DS6A 1YQ3C 3FVYA 4MNDA 1KILE 2C0XA 2L91A 1WTYA 2WZ7A 3O6QA 5AVXB 1O87A 1JB0J 2A0BA 4NTFA 4GDOA 2R7VA 2L5GB 4JTCB 3H1LE 4R4LA 4E18A 1EZVI 3PHLA 1SQQD 1SQBG 4B86A 1Q81Q 3H2UA 3DWWA 4IGGA 1IZNB 1LTJC 1AA0A 2HYNA 3CC7P 3EQ2A 2LK4A 1K40A 2ZXPA 1PD1A 2GWWA 2Q3IA 4AE4B 3B5NA 1NU1E 2ZXXA 3KXDA 3QVYA 3S4RA 1U89A 4Z9IA 2OYHA 4QI2A 3AEBC 2NPSB 2QVAA 1Q2NA 1SQXD 1NTZD 3AE9C 3G6EP 4ONSA 4J32B 2Z5IA 2CPSA 3V2PA 2MYSA 3RKOF 2ZXEB 1LI7A 4JBZA 1R5SA 2D5RB 5DQTA 1Y6DA 5GTIE 1RF1A 3ZTZA 3HD7B 1IFPA 3C9IA 2K9JA 2VB6A 2AXTE 3EHMA 4PV1D 3G9RA 5KYXB 2LR2A 2OEVA 1LGHB 4Z9JA 1GW3A 1FZEA 3L71G 1MZ9A 2LFDA 3DD7A 4WVZA 3LESA 2FY8A 1RE3C 3SWKA 3L73G 2QEXP 4OIOF 1KYOE 3M15A 3GEEA 2IFNA 3ZVRA 3I4UA 1KYOH 1PCXA 2WSCJ 1RF0A 5KYWA 2KS1A 2FKWB 1VLSA 1JTHB 3L73J 5AGFA 3H1LJ 4CPGA 1JPNA 2HFED 3HLZA 4U3FE 2W6BA 4XPXA 1EQ7A 3TJ6A 1NTZE 3S1KA 4IL6H 3WUTA 1S7ZA 2CYDA 4JW1A 2XS8A 3DE8A 5CCHC 3FAPB 3NMDA 2QJKB 2HUJA 3LUTB 2E74C 2MKVA 5JVEA 3ASNC 3DM5A 3E70C 2O01J 1RXQA 2RMZA 2HMZA 2HV7A 4W8KA 4ASVA 2J9UA 2LFFA 3OEOA 4PD4I 1VQMP 5HV9A 2FAPB 3JT1A 4BG0A 3O10A 5DLJA 4D6TJ 1RY3A 1QVXA 1ST6A 1HW2A 3SXMA 2HKVA 4Q5SF 2XLOA 4E0IA 5AW8B 4H13C 4XLNF 1AUEA 1CZQA 4Z9HA 3L75D 1EDLA 1QL1A 2OKUA 3GWNA 3GHGA 5D91A 1FS0E 2CK3H 3D70A 5KAFH 3H1JG 4CS7A 1FJKA 2POHA 5E3AA 2O1KA 1LE4A 4KT0J 1PPJD 2XV5A 1S4XA 1OVVA 3HUSC 5B5EH 4NTBA 3L74G 3CI9A 1RE4A 3CCUP 2RD9A 2WSEH 1WRGA 3VP8A 3ZTMA 1V4AA 4CS9A 2X0CA 1PP9E 1SMYF 3NFQA 3CEXA 3CXHD 3B9QA 3AG4C 2V7QJ 5JS5A 3KZIH 1X8YA 1T01A 3VF0A 1NTMG 5KJ7A 3WAQA 1H88A 1HBWA 3FXDA 4J7YA 4U5BE 4WWIA 1DOVA 4OINF 1Z63A 2PNOA 3VYIA 1T9KA 1OCCC 4LDQA 3JZ0A 1GK4A 2ZXOA 4AK9A 1CW5A 3IQCA 2N1TC 2M64A 2Q3TA 1KILA 2R7QA 3ASOC 4WGZA 4DBQA 1JY2N 3US6A 4XLPF 2WPQA 4W7YA 5B1AC 3L70E 3P32A 3RQEA 5A69A 3ZDMA 2W45A 1VQ6P 3E9VA 1S5LX 3RGUA 1VF5D 1AFOA 1R5LA 4NPEA 1ZHYA 4D6TE 2PGDA 1RQVA 3IQ5A 4I2LC 2SPZA 2W27A 4OIQF 4XEFA 1L0LE 2JO1A 3C62A 1YA9A 1OW6A 1LTBC 3RK2D 1IFDA 1NTMJ 2K9JB 3K5BA 2FYUE 3TNUA 2WVNA 2X51A 4XWJA 2WB7A 1H0TB 4X0RA 2Q7RA 3CXHI 2A69F 3NMKA 1XZPA 1JM0A 1EXIA 1N7SD 1QKRA 3CWBD 4KJMA 2JWDA 1KQGB 1NVOA 2XNDH 4H0LD 1VMAA 2HPCB 5H2FE 1WN0A 1BE3D 3RK3C 3NMJA 2W83C 5D92A 5AC4A 1MKMA 5JLIA 5L0DA 4ANJA 1R8EA 3MYIA 2FYUG 2FYNC 3L70G 2IBFA 2IBZD 3SXZA 4H0LB 4KI2A 1KB9H 1AJYA 4MTFA 1Q0KA 2XLDA 2DI3A 2R5BA 5KLVE 1M57D 4EHPA 1QLEC 5AVWB 1JY3P 1OVUA 1QLED 5IY5C 1GZLA 2QE7H 4NPFX 1SYQA 3L70J 3EG9B 3M4CA 3AECC 1GK6A 1Y4CA 3NRHA 2J5UA 3VN0A 5CIVA 3U9MA 1LT1A 2ZAEB 2KSJA 5AW3B 4O7GA 1RHZB 1ZU4A 2E5YA 2KK1A 2J9BA 3K66A 1D1AA 3B0PA 3USSA 3C8ZA 1KFMA 1D0XA 1BBHA 4KBLA 3TGUJ 1N7LA 3QZCA 4EKWA 1TQGA 1L4AD 1FZCB 3H25A 1BDJB 2J9VA 3JC22 5AVYB 1USEA 3KDPB 4C7RA 4ZKPA 3JSEO 1BDCA 1QVFO 2HV6A 1VPCA 2RH0A 1OXBA 1YZCA 1LT9C 1PV3A 1SQBD 1SQQG 2W4BA 4H4KC 2KQ9A 5GTHH 3LNMB 4JKVA 1UG7A 1L4AB 2YZSA 1T8ZA 1KZUB 4MQ9F 4QMAA 2GAQA 2Y9ZA 2Y0EA 4RJTA 2BCCJ 1L2PA 1EDIA 1NYHA 3VTPC 1C17M 3H2VA 3FWNA 4M3LA 1AEPA 3AGTA 3AEGC 3FWLA 4I7ZC 3RK2C 3LLIA 2Y0DA 2E75C 1HF9A 3HKKA 2P7VA 3KYIA 4LACB 3H1JD 1URQA 4L6RA 3HTKA 2A68F 4JURI 1KILB 3QH9A 2QRXA 4BRYA 3OAKA 3U3BA 2IXMA 1T3JA 2YXRB 2JJLA 1A41A 4OIPF 5CI9A 3RQFA 1GU5A 3ZIBA 2A45I 5AVSB 5KYUB 4YT4A 3G4SP 1CGME 5TISH 5KAIH 5BU5A 2KXPB 3M9HA 4YL3A 3W8IA 1M2VA 1YTZT 4XPWA 5APWA 3ZQYA 5APTA 3G4XA 3C8GB 3GANA 4CDYA 2YVKA 4K1OA 3BCCJ 1MMGA 3R7CA 4O6MA 1O5HA 4WABA 4GODA 4JF7A 1L7CA 4DJ9A 4KNVA 3A2AA 1YITP 1VQPP 2XLVA 2LCHA 1YQ4C 1FTSA 3HNJA 3Q7LA 4JEBA 2AXTH 1N73C 1LTTC 1QGKB 4PD4D 3RBXA 1GL2B 1M1JA 5BQIA 5COGA 4Y99C 1NTMD 2BCCE 2H7VC 2XU6A 2A1DD 3FOOA 4MVMA 1A7VA 3TSIA 3CCMP 2EIKC 2O01N 2O3JA 4NCQA 2H89C 3LS1A 1P84D 2ZT9B 5DVWA 5EGYA 3PJSK 2R5DA 2IBZI 2Q9CA 4H13D 4PV1C 4DOZA 5L0IA 3BCCG 4J30B 1UIXA 2VRSA 3EH1A 2ZXRA 3CQZA 2Y0CA 4W8PA 2YLIA 5AW6B 2XSEA 1H89A 3V2NA 2UWJE 2M4EA 1SQXG 2KUBA 3MD0A 5KLVK 4H13B 5K5GB 4GT1A 3H32A 2LKMA 1J1EB 2PFDA 5KAIE 2OYOA 3CSKA 2EPNA 5E33A 3SYNA 2HLOA 3W2VA 2CNWD 3X1OA 3JCUQ 2ZT9C 2KYHA 2PP4A 3N4XA 2DW3A 1J1DB 5AVQB 5E3CA 1KNYA 3GODA 3FOPA 1K8AQ 5COMA 2LQGA 1MV8A 2KC3A 2H88C 1GL2C 3HE5A 4IAOA 2YL3A 2IPPA 2E87A 3T4RA 2P61A 4CIHA 3WG7C 5F28E 1SQBK 2YKZA 1JCDA 2FYZA 3W68A 1ZU5A 3HD7C 1JMWA 3Q1MA 1ZW2A 3P8CD 2YO3A 2R25A 3C8VA 2Y3DA 1RCPA 1USDA 4D6TG 1IZMA 4N4WA 5B1BC 2HODA 2E74B 1A7EA 2OYIC 1RE3A 4LERA 4BRYB 2HJ3A 3TGUD 2M0BA 3QWOC 2RSEB 3CD6P 3CX5H 5H2FH 4PJLA 3H1HE 5KYUA 1HVVA 1SF8A 2NG1A 1QPUA 3P7KA 4L75A 5DJUB 4WY4A 2MHRA 1LTJB 1LTIC 3QTHA 4K7BA 2FFDB 2FXMA 2E74D 3L0IA 2OQMA 4BXLA 3ITKA 1SQVG 2WWWA 1S9KD 1Q0GA 1VQOP 1SLQA 2MWQA 5BQHA 4JYCA 5KYWB 2E43A 1OVRA 4H54A 2XL8A 1BE3J 1VB5A 1QVGO 1Z6AA 3H6PA 2YWAA 1NO4A 3M0AA 1YJWP 3H1HD 1K05A 2H43A 2I15A 4C46A 5AW9B 2L81A 2IZ0A 3O55A 3Q6MA 4JYBA 2YL0A 2YKQA 3MZWB 4TLFA 5CCHD 2WSCH 3GF3A 2G3AA 4XE5B 3CPWO 2HFIA 1SQQJ 4PV1B 1KQLA 4GOEA 2BE5F 2XL6A 3C1LA 1J8YF 4XFJA 2J0WA 1SFCA 3TQOA 1LJ2A 5DS4A 5AW5B 5B66H 2GFHA 3EGDA 1V74B 2BEQD 1ZRTE 4K3AA 3KZIE 1TR2A 2R02A 1ZR4A 3L74E 1EZVE 1SVFA 1LWUB 1YTZI 1OR2A 1TWAA 4U5HA 1CI6B 3A0BH 1KQSO 4BEJA 1BR2A 3IAOA 2D2CD 2KLVA 2KP8A 5AW4B 5AC5A 1FZGA 2ASRA 2O01H 4Q7CA 1SZIA 3U2MA 3DM9B 1HY5A 4BJ6A 1EDKA 4MVSA 3SXYA 3F46A 1OR3A 1FDOA 2C9LY 2BL2A 4ZLCA 2NUPA 3G3ZA 3EFGA 1LTSC 1G5ZA 5JT4A 2BCCG 4JTDB 3E1IA 4OGQD 4WGYA 2PP6A 3ABVC 4IARA 3I5PA 1NH4A 2R7XA 5HSWA 2C0WA 3HUSB 2KGOA 5M1BA 1BE3G 2E75D 1BR4A 1IC2A 1G8XA 3B5NB 2Q9BA 1PPJE 5L0JA 1EKYA 4JTAB 2YHSA 2QE9A 1LT9B 2WPSA 1ZHXA 1M56C 2YQYA 2D2CC 1TWHA 4ASWA 2IM8A 1X22A 4A2NB 3T9OA 2WSSH 3MTUE 1FOSE 2KW3C 1CPQA 1FZAA 1ORYA 3AOUA 2DB4A 2ZJSE 3AEFC 2E75B 3SWYA 3AE2C 3IQ6A 4IL6E 4EWCA 1GW4A 2KB7P 2AU5A 1QSPA 2H7HA 2WZLA 1L3PA 1L4AC 3AQCA 3NYMA 2YIUB 3DE9A 2LXBA 2E5TA 1ZHWA 4OIRF 1HTLC 4XTKA 5A6AA 4O6NA 1NU1G 3UR3C 5CJ0A 3CL3D 4U3FD 4U7JA 1N7SB 3V4QA 3CCEP 3B71A 2Y69C 2WSFH 2IXNA 3WHNA 3CCJP 3MX3A 4Y28J 1T6UA 2A06G 4WBAA 3L35A 4UB8E 2JR8A 2R32A 4LLEA 4FESA 3IF4A 3TULA 2WVQA 1IO4A 1DIPA 2KNCA 1YDIA 3UMKA 1APCA 5CCHA 4JRZA 2WSFJ 1TWCA 5AVZB 2Q3EA 3MHVA 3DXJF 3V5XA 5E2QA 1N86A 1PZQA 1SP4A 2M5AB 5GPGB 3IFMA 2IOQA 3S9OA 4N6HA 5KKZB 2OCCC 1AVOA 1NU9C 1KORA 5A6KA 3KKBA 3V2QA 1YYXA 2GUSA 4JC7A 3K6BA 2HR3A 1RE4C 2ZYAA 3AG3C 3EG9A 3H1JJ 4U5DE 1SQPG 2ZPAA 5AW1B 2V3CC 2B87A 3JRMO 3H1HG 3TOLA 2J45A 1BCCJ 3UIAA 2M3BA 3DKAA 2IYLD 1E85A 4G78A 4CS9C 1D1BA 2B89A 1UIIA 2WQYC 5TJ5E 4CS8A 2WT7A 4MW8A 2ETSA 4EUKB 3S84A 1RKCA 4C7NB 2GUVA 5APXA 2W6JH 2WTYA 3JSZA 4PR9A 3U59A 3EHNA 1YJ9P 4K0DA 2F22A 2Q5UA 4PACA 5L8RJ 1U57A 2OYIA 2N9BA 3FXHA 2A45G 3I56P 4YL1A 4H0LC 2JDIH 4OD5A 2R7TA 2HJMA 1KB9E 2Z5HA 4IOIH 2R03A 4PJMA 5KAFE 1MQVA 1WT6A 2J0XA 3EQLF 4NY3A 1Z5ZA 4ULWA 3EH2A 4JCZA 2C03A 2YLDA 3M79A 1LWUC 3L71J 1L0LK 1DX7A 1W2WA 4RO0A 3HNIA 3AQBA 1RJ9B 5KYYA 1W2BO 2YL1A 4U9EA 3IPMO 4DVYP 1CSBA 2XKMA 1JAFA 1NOHA 3KQGA 3Q5RA 1G2CB 1HGZA 2R3SA 2EINC 3A0HH 1BZ4A 3GM3A 4ZNCA 1OFCX 4PD4H 2XXAA 1WMKA 1A7DA 1ZHTA 2YRFA 1EI7A 2XLEA 1G1IA 1FDIA 2BASA 2XS1A 4MS2A 3ZQVA 1BCCD 3N2ZB 1S3JA 1SQVD 1Y9BA 4MTGA 5F5FA 2IYOA 2P10A 4FX5A 1T2KD 1T2KC 1LS4A 1VLTA 3V5ZA 1L0LG 3ZG1A 4DVZA 1LE2A 3MGNA 3EGXB 1T6IA 1PIXA 4DXWA 3P8MC 2I8BA 2VH3A 5L0HA 1EQ1A 4AYCA 1HW1A 3L73D 5T3WA 4N6JA 1ZP0C 1URQD 1AQ5A 1T5OA 2PBEA 1SR2A 2YMKA 1N1CA 3RK3D 1YZAA 1YBKA 2QM7A 3DJUB 3AG2C 4EBBA 4HE8D 1K9MQ 1E84A 4GOFA 1SQQK 1A02F 1VQNP 2H7OA 3Q7GA 4JJFA 3O8ZA 4E7ZA 1FZCA 1H8AA 2L6FA 3GG2A 3HTKC 1D0YA 3RK3B 1PL5A 2N1TA 1DD3A 1RH5B 3GWLA 4U5FE 3NTNA 3H1LG 3GF7A 4NTAA 1U7MA 5CJ4A 2KNHA 3W4YA 1SQVE 1HWTC 1KC8Q 2IXOA 2WT7B 2HS5A 3KYQA 2JWAA 4UDVA 3PHF2 2IX7C 3UGPA 1GMJA 4MTOA 3POVA 1DOWA 3J06A 1OX3A 3RBZA 5KLVJ 2H8PD 5CBOA 2FGYA 2EPMX 1OW7A 2H7BA 2OTLP 1JY3N 3TGUG 4MVZA 2OTJP 5KLIC 4JVSA 3HTKB 3GLMA 3RIPA 1WASA 2A6HF 4LC1A 4YWQA 4GKGA 2J7PA 3TF5A 2KI7B 3PLNA 1GS9A 2O9XA 2N9YB 2W6AA 3K1HA 5KYXA 4CSAC 1KTMA 3WMM0 3H1IG 3NDBB 3T97B 3NYJA 4XEKA 3CCSP 2YNYA 2W9YA 3S90A 4O6YA 5B5EE 4M63A 2NRGA 2H8AA 5KLIB 1V55C 3MUDC 1HJBA 3OA7A 1KD1Q 1HE9A 3DJNB 1RJ9A 3A5TA 1N2DC 2OEXA 3BASA 1BCCG 3O39A 3FMSA 3CCLP 4YXDC 1AV1A 5COFA 2OTKE 2E42A 2FFDA 1NU1K 4N3YB 3VYWA 4XEVA 1ZVZA 2KZIA 1MNEA 1NZEA 1BSHA 5B3IA 5CCGD 1CGOA 2OG2A 2EILC 1JMMA 1RKEB 2A0UA 3K1IC 2IBZE 3S29A 1LI5A 4EIJA 2J7PD 2I8DA 3CMEP 3DI5A 3HNKA 2QNLA 3U2LA 3KYJA 3JCUE 3JYYA 3AEEC 1EDJA 2W90A 3N0TA 4A7PA 3M9BA 2L6HA 3JRTA 3RL0g 1CGNA 2VCAA 5EK0A 2J9WA 1SS1A 4LDRA 3I5QA 1OKKA 2NPSD 5EHHA 2C9NY 4UB8H 2XLWA 2R3CA 3S27A 2HMQA 3G71P 3W2WA 3A3YB 2YKPA 1NTKD 3H1KG 1FMWA 1NKZB 4JIOA 3K1IA 1A0BA 1ZW0A 2AEJA 1LWUA 2FYUJ 1KFNA 4A4AA 5AW2B 3UNGC 1RF1C 4MVUA 2ZVOB 1LS1A 3HRNA 1MFZA 3PDMP 3GEIA 4E0HA 4ER9A 4K35A 2XDJA 2JPUA 5JSLA 1KMIZ 2OQQA 1JUNA 1E86A 3WUUA 1GDTA 1HH0A 2W8ZA 4IWBA 1EC5A 4AE4A 3IN6A 3JYHA 5AVRB 3NXSA 4XPYA 4C7OA 3B5NC 2DYRC 4IAQA 3D71A 2QG4A 1A02J 1LPEA 4BWNA 2NPSA 4CIPA 4OGQB 3T6GB 1G1JA 1FAPB 1YI2P 4HJGH 4RBNA 1EA8A 2J8WA 3AEAC 5K0IA 3CXHE 4PJ0E 1FDMA 3U8PA 1RF1B 2W4MA 1S5LE 1T6AA 2D4UA 1KN7A 1P84H 3RFYA 4LGDE 2TMVP 3WU2E 1F1MA 3ZDLA 2WMMA 1M7LA 3AGUA 3WU2H 3TD7A 1L0NE 1Q82Q 2I1KA 4U5EE 3FXEA 3VMZA 1H9TA 1IFMA 3W67A 3TK0A 5APSA 4EOTA 2XM0A 3H65A 3BRJA 2JEEA 2C04A 3BEHA 4HFKB 3GW6A 1NHLA 1R5ID 1R4TA 4BEMJ 1JOCA 4WY4B 1OQCA 2ZXWC 4MW3A 1PP9G 3LIEA 4IB4A 2ITAA 2QJYC 2RN0A 3NG1A 3CC4P 3B5ND 4AUWA 1V54C 4MVOA 2IFMA 1ZV8A 3A11A 4I1MA 2J58A 3B8EB 1HJ0A 3GM2A 2VCCA 1N7SA 3A0HE 3LIDA 2Y9YA 4RESB 3AE4C 4WY4D 4DT0A 4HH2A 1H9GA 3CCVP 3AE3C 1ZOYC 3Q5SA 2K9YA 1RKEA 2ZFCA 3M91A 1NTKK 1FAVA 1DEBA 1NTMK 3C7JA 4L76A 5E79E 5APUA 1GGQA 3VRCA 1EZVG 1ORSC 1XTGB 3RVYA 4CX9A 1VOMA 3H1IE 2IZ1A 1P84E 4Y99B 1FFHA 2NSGA 4WB4A 2EPOA 1NAYA 3AE5C 2KK7A 1KB9I 1TFKB 2R7SA 3JSVC 4PJ0H 4G0HA 1YA7O 4ZMDA 5L3QA 1L0NJ 3B4SA 1NGMB 1VF5B 3SP1A 2EPLX 1EZVD 5A6JA 1FR0A 3L73E 1GQAA 1M2OA 3ZSUA 2UUIA 1L0NG 1FMVA 1VQKP 3B29A 3CX5D 4CS8C 1NTZJ 2LSEA 1SFCC 3K33A 1I4YA 3SXKA 1SQPE 4TT3H 3SFEC 1UFBA 1KV4A 3RK2B 3BVHA 1SQXE 1LKXA 2Y3BA 2NUPB 4OH8B 5CCGC 3LNRA 4EI2A 2HG5D 1HE1A 1LP1B 1MNDA 2MJZA 1IJDB 1NKNA 1L4AA 4N78E 3U3FA 5FZTA 5KTBA 4IFDK 3L8JA 3VAYA 2QTVA 5L0FA 3R2PA 3OA1A 1VF5C 4I44A 4U5GA 1LT9A 1JY2O 1SQQE 2FXPA 2Q7CA 1VYKA 1OMIA 1Z56A 1IK9A 5DQZA 1NLXA 2R7RA 3N24A 3H1JE 4N6CA 4W7ZA 3ZC4A 2Q6QA 1ZXGA 1E83A 3H1IJ 4G7HF 1M8OB 3RYLA 3L74J 3V6IA 3CLQA 4ZKUA 1H0TA 3AE6C 2R9RB 2QJKC 1M2VB 3IHUA 1OCOC 3Q3DA 4UB6H 3UMIA 1PP9J 2KLUA 1KQFB 1YJNP 3V5YA 2ZVNB 4YTPC 3M0DA 1IK7A 3QVZA 1AVYA 1SQBE 4CJGA 4F4BA 5JP7A 1BDDA 2PX0A 1KB9D 1W2EA 1C03A 2AWCA 4WJ0A 4GQHA 4P9FA 4I1LA 1G2CA 2IYPA 1RF0C 2A06D 3I5CA 2WSEJ 5GTHE 2OU6A 1JCCA 2L7AA 3V5BA 4EYYQ 2VASA 2EIJC 2R05A 4CDAA 5KJ7C 1EXJA 3CXHH 2O1JA 1C02A 3F89A 1TU3F 3EFOB 3ABMC 3L74D 2KOGA 3RH3A 1JMBA 2CW0F 1PPJG 2NUTA 2NSFA 1MFTA 1P84I 3HE4A 1LTGC 2ICWG 1U7JA 1TWGA 4YT5A 2FBWC 3L71E 3S0XA 3MIWA 3PRJA 1BGYD 5KYNA 1Z3IX 2K1AA 2JKVA 2HZ8A 4PFOA 4JJGA 3V7OA 1NTKJ 4YXWH 3EWKA 3O6QB 3PH0A 3EJNA 1IFIA 2NZ2A 2E76D 1B68A 1ZLLA 2WVOA 4R32A 1PD0A 3FX0A 1S9KE 1VQ9P 3E1RA 2M3EA 1BSNA 2AWYA 1IFNA 5L0GA 2V4HA 1VQ4P 5T3TA 1OCZC 1Q86Q 2PX3A 4BPMA 3SSUA 3C8GD 3L4FA 2E76B 2OARA 2L9JA 2BCCD 4C7NA 3ITFA 4PFPA 3ATPA 3TDKA 4PD4E 1N73A 1BR1A 1VK5A 3GMAA 3RF3A 2DGJA 3CZ6A 2P1JA 3L36A 3JCUH 3F47A 1OW8A 3ABKC 2K88A 3RL0D 2OYIB 5L0CA 1FNTc 4U9DA 3DAGA 3DMDA 1OWAA 2AEFA 3LLKA 4FWVA 3L71D 2YEVA 2ZYDA 4D6TD 3MBGA 3HD7A 5C39A 3P8CE 2WZFA 2NPUA 3L72E 3VM6A 1FFTC 2LIGA 3WODF 1SFCD 2EIMC 3V4WA 3BCCD 1MUUA 4E7SA 3ABLC 1U6HA 2J59M 2B88A 2HODB 5AW7B 3EPVA 1G4US 5A6BD 2ZT9D 1Y8AA 4QDLA 4HB1A 1ZMEC 5CMZA 2XL4A 2WPRA 3TJ5A 1VQ5P 2A06E 2PAJA 5B3SC 3RQGA 3IR9A 4DRJB 3K7DA 2CGEA 2Q1KA 3PMRA 1QX8A 1M57C 5AVVB 3L37A 3R4YA 2CPBA 2DYSC 4HKZH 3A0BE 1FZCC 1I4ZA 1O3UA 1OIPA 2XXAB 1SQVJ 2HSBA 5CHXA 1GU4A 2R7OA 2VC9A 2G8YA 3SEOA 4AQRD 2NPSC 2YXQB 2Q4FA 3BRVB 1LTAC 1NU1J 1TFOB 3LJBA 1MMAA 3KL4A 3C18A 2AEMA 3T6JA 1VDFA 1M90Q 3L75E 4NC3A 2IDBA 3QW0A 1ZN5A 4YN0B 3EGXA 3JTLO 1XZQA 3LS0A 1JY2P 4Q4ZF 1BGYG 1NTKG 1E5WA 3EGDB 1S05A 2WZGA 3GHGB 4N06A 1S72P 1JO5A 2QM8A 2XLHA 3DZAA 3NKEA 1JPJA 4P9TA 1VQ8P 2BC5A 1NTME 4YL0A 4CJOA 1X9VA 5KKZC 1CI6A 5APYA 1VQ7P 3BCCE 1N7SC 3KPEA 3H32B 1RQUA 1ZRTD 3AEDC 3L72D 2FXOA 2ZYGA 4L73A 3L34A 1I5NA 3SZRA 2OGUA 2Z4EA 1DD4A 1VYIA 3CX5E 4U3FJ 2YIUC 3CAXA 5CBNA 1PFIA 4OVNF 2G62A 4YT8A 2N1TB 1NG1A 2G3VA
chains in the Genus database with same CATH topology
3AE3C 1ZOYC 1UIXA 2QJPC 3Q5SA 1DD3A 1K05A 3GF7A 2K9YA 4NQFA 3RQEA 4EBKA 1WOLA 1PV3A 3AE8C 1S5LX 2ZT9D 1VF5D 3MFNA 2WSCJ 4U7JA 2WSEJ 3Q5PA 3GF3A 2G3AA 4H13B 3B71A 1ZMEC 1GMJA 4PV1B 4XFJA 3SFDC 2D2CB 1RQVA 4Y28J 2JX0A 4H44D 2JPUA 1ZZPA 4XEFA 1NYHA 2JO1A 1OW7A 1KMIZ 2OQQA 3AE5C 3RQGA 3TULA 2BEQD 3AEGC 3K7DA 1ZRTE 1OW6A 4I7ZC 1EXJA 1DIPA 1TU3F 2BEZF 2E75C 2Q00A 3U0CA 1HF9A 3Q5RA 2WSFJ 2QSIA 3IN6A 1NGMB 1VF5B 5KLIC 3R4YA 3GLMA 1WWPA 2JP3A 1EXIA 1O3UA 2E74C 2HSBA 2MKVA 2ZT9C 3D71A 3GM3A 1KQGB 3IAOA 2D2CD 2G8YA 1Q90D 4H0LD 1WMKA 4H44B 2FBWC 3S9OA 3AJMA 3RQFA 1KNYA 4OGQB 3L8IA 3FGAD 2O01J 1YQ3C 1KTMA 3AE1C 4TT3H 1KILE 1KORA 3LW5J 3SFEC 1UFBA 3T97B 4XEKA 3GM1A 2H88C 3AEAC 1FDIA 1MKMA 1WTYA 4IL6X 1FDOA 3O6QA 3D6YA 3O10A 3C18A 1JB0J 1R8EA 3EWKA 1QVXA 2FYNC 1Y9BA 4GDOA 3RK3E 5F28E 2IDBA 2P10A 2L6GA 4EBJA 3C8GB 4H13C 2NZ2A 4H0LB 4R4LA 2E76D 3Q1MA 4H44C 3U3FA 4OGQD 1JOGA 4R32A 4OGQC 4YXDC 3ABVC 3C8GA 3L8JA 3C8VA 1AJYA 3D70A 1K04A 1PIXA 5M1BA 3D6ZA 4KT0J 1VF5C 2E75D 2LK4A 4XEVA 1K40A 2E74B 2FXPA 1YQ4C 1OMIA 3AECC 1ZP0C 3BRJA 5KKZC 3C8GD 2D2CC 2J5UA 2E76B 2PBEA 2WQYC 1V4AA 1S1CX 2E76C 2YMKA 1RQUA 3AEBC 3GMAA 3Q2YA 1VL2A 3AEDC 2QJYC 3AE9C 4I7ZB 2KK1A 3JYYA 2V7QJ 3AEEC 3AEFC 2E75B 3AE2C 1OW8A 2E74D 3AE6C 2QJKC 2H89C 5L8RJ 2L6HA 1U57A 3RL0g 1HJ0A 3Q3DA 3GM2A 2ZT9B 1DD4A 2WPVB 2YIUC 4RKUJ 2L6FA 3JZ0A 4H13D 3AE4C 4PV1C 4R4MA 1KQFB 4PV1D 2QIWA 3G9RA 3AE7C 3H25A 4YTPC 4H0LC 4Z1MH 1PL5A 1IK7A 2YWAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AE3 C;  1ZOY C;  1K05 A;  4NQF A;  3RQE A;  4EBK A;  1WOL A;  1PV3 A;  3AE8 C;  3MFN A;  2G3A A;  3B71 A;  3SFD C;  2JX0 A;  2JPU A;  1ZZP A;  4XEF A;  1OW7 A;  3AE5 C;  3RQG A;  3TUL A;  3AEG C;  3K7D A;  1OW6 A;  2Q00 A;  3U0C A;  1WWP A;  1O3U A;  2HSB A;  3GM3 A;  3AJM A;  2FBW C;  3S9O A;  3RQF A;  1KNY A;  3L8I A;  1YQ3 C;  1KTM A;  3AE1 C;  3SFE C;  1UFB A;  4XEK A;  3GM1 A;  2H88 C;  3AEA C;  1WTY A;  3O10 A;  3C18 A;  1QVX A;  5F28 E;  2L6G A;  4EBJ A;  3C8G B;  3U3F A;  1JOG A;  4R32 A;  4YXD C;  3ABV C;  3C8G A;  3L8J A;  1K04 A;  2LK4 A;  4XEV A;  1K40 A;  1YQ4 C;  3AEC C;  1ZP0 C;  3BRJ A;  3C8G D;  2PBE A;  2WQY C;  1V4A A;  3AEB C;  3AED C;  3AE9 C;  2KK1 A;  3JYY A;  3AEE C;  3AEF C;  3AE2 C;  1OW8 A;  3AE6 C;  2H89 C;  2L6H A;  3GM2 A;  2L6F A;  3JZ0 A;  3AE4 C;  3AE7 C;  4YTP C;  2YWA A; 
#chains in the Genus database with same CATH topology
 1HUC A;  3T6B A;  1OCR C;  1GD2 E;  2A45 H;  4FAP B;  1M1J C;  3HE5 B;  3HUS A;  3RL0 C;  2K3R A;  2KYV A;  3BRT B;  3DAF A;  1WOL A;  1NU7 D;  5CCG A;  3HD7 D;  3MFN A;  1HMO A;  1FC2 C;  3OJA B;  1E2X A;  3Q5P A;  3MLG A;  4MVR A;  3L75 J;  1IFJ A;  2N1T D;  3SFD C;  2D2C B;  4D4X A;  2Z15 A;  4G7O F;  1M56 D;  3M0D C;  1NSG B;  1YVI A;  2PF4 E;  3N7N A;  3UGO A;  4ZLD A;  3MUD A;  3CWB E;  2CCY A;  2Q00 A;  3U5S A;  3M1C B;  2QSI A;  3TNU B;  1PGO A;  1QZX A;  4CDV A;  1XWJ A;  3VMA A;  4GYT A;  1X79 B;  4B6I A;  1IW7 F;  3TGU E;  4HEA J;  1FZB A;  2YMY A;  1H6G A;  3RW0 A;  2KS1 B;  1Q90 D;  3AJM A;  1L0L D;  1VTM P;  2YO2 A;  3G4Z A;  1PGP A;  1Z7Q c;  3AE1 C;  4C3B A;  3LW5 J;  3MP7 B;  1PGQ A;  4U5C E;  2QJY B;  4IL6 X;  2CNW A;  4O79 A;  2GDC A;  256B A;  2Y3G A;  2P67 A;  4XA4 A;  3L70 D;  3A9C A;  4KNW A;  4IFM A;  5AVT B;  2UUH A;  1LIH A;  2XM4 A;  1T6Q A;  1Z23 A;  3CCR P;  4JE9 A;  4H44 C;  4EBJ A;  4OGQ C;  2AVK A;  3IEE A;  4C3E A;  1K04 A;  1J1E C;  2QJP B;  3LEO A;  2Y3H A;  2JD3 A;  1L0N D;  4XQ1 A;  3CWB G;  4DRI B;  2LD6 A;  4ULV A;  2P6V A;  4BJ5 A;  4BJ1 A;  1D7M A;  4UB6 E;  4YPC A;  4MVQ A;  4D4N A;  2GA0 A;  3II6 A;  1HGV A;  3AG1 C;  4C3D A;  2E76 C;  4JQ0 D;  4E17 A;  1GM5 A;  1FE6 A;  5TIS E;  1KYO I;  3Q2Y A;  1VL2 A;  1J8M F;  2PRR A;  3F5H A;  4I1O B;  1Q0M A;  2B0J A;  1GTW A;  3E7K A;  4GIF A;  2P0N A;  5AVU B;  3CWB J;  3LAY A;  1K73 Q;  4AL1 A;  4W80 A;  2XNX A;  4OWF A;  4GEH A;  2GM4 A;  1L0L J;  4EDF A;  3I55 P;  3MYF A;  4Z1M H;  3CMA P;  1U0B B;  2P7J A;  4DRH B;  2R44 A;  2QJP C;  1J1D C;  3KH2 A;  1NAF A;  4NPD A;  1YJG A;  2B87 B;  5BU8 B;  4IFF A;  3M9Q A;  4O9B A;  2YL7 A;  2KSF A;  2VCB A;  3AE8 C;  4L74 A;  1FBM A;  1YLM A;  2Q9I A;  1X0T A;  1BE3 E;  1FU1 A;  2K37 A;  3PP5 A;  1NJI Q;  1H7I A;  3RVZ A;  2KIK A;  2JX0 A;  3KMI A;  1YHQ P;  3EZI A;  3B0U X;  1WGW A;  1YIJ P;  5DJT B;  2IBZ G;  2KJG A;  2BEZ F;  4AX2 A;  3U1A A;  1HMD A;  3GEH A;  4C7O B;  2FYU D;  3VMY A;  1SQX K;  2B9B A;  5KLV G;  1NTZ K;  1WWP A;  5BUO A;  4RD9 A;  3TYY A;  2FYU K;  5TJH A;  5DS5 A;  2WVR A;  1SQP K;  1BGY E;  3WUV A;  3UMH A;  1SQP D;  2QA4 P;  5L3V A;  1YYJ A;  2AP3 A;  3GM1 A;  4AL0 A;  1OZH A;  3L75 G;  2CDQ A;  2EPK X;  2G3K A;  3QW1 A;  3KHU A;  3D6Y A;  3FAJ A;  2R7U A;  3ZWI A;  4KC9 A;  3ECS A;  2QY9 A;  1M1K Q;  3FDQ A;  3M4B A;  1W5C E;  4QI0 A;  1PGJ A;  2PFX A;  2HPC A;  3C8G A;  3X2Q C;  4PJN A;  2V7Q H;  3EFF K;  1JY3 O;  5JUA A;  3D6Z A;  1VQL P;  4OD4 A;  2OJQ A;  4J7T A;  2ZD9 A;  1KU2 A;  1NWQ A;  3LW5 H;  4LDK A;  4EIY A;  3H1K J;  1SQV K;  2P2U A;  3PCV A;  5BQG A;  1JNM A;  3LEV A;  3CCQ P;  1PP9 D;  2OYH C;  1Q0F A;  4WY4 C;  1AQT A;  1QL2 A;  1DEE G;  3U1C A;  4I7Z B;  5APV A;  2KNC B;  1GL2 A;  1M1J B;  3KPH A;  2KSE A;  2KZJ A;  1NU1 D;  4HYT B;  1YAU O;  5JRA A;  1QQ3 A;  2WPV B;  4JZA A;  1M6T A;  2M5A A;  4RKU J;  5F5H A;  4RDA A;  3VOP A;  3PTZ A;  4YK5 A;  3AE7 C;  1E79 H;  5APQ A;  1BGY J;  1AVO B;  3SNH A;  5T1D B;  2M8R A;  4G7Z F;  3IQT A;  5KJ7 D;  1YAR O;  3EFO A;  1WAT A;  1FOS F;  4NQF A;  5AW0 B;  4EBK A;  1S5L H;  2LP4 A;  3A7O A;  1XTC C;  3HE4 B;  1D1C A;  1L0N K;  4JPZ B;  3B0V C;  1T3U A;  1FZF A;  3FHD A;  1KIL D;  4CSA A;  2J46 A;  4H44 D;  3H1H J;  1ZW3 A;  4N78 D;  1ZZP A;  2HSQ A;  3GHG C;  3W8H A;  1TKN A;  4DCK A;  3GOR A;  1LNQ A;  4JEA A;  1SQB J;  3U0C A;  1N8R Q;  2Q9A A;  4BJT A;  2JP3 A;  3H1K E;  2OJE D;  4JCH A;  3SWF A;  2XRH A;  2FFH A;  4IRU A;  4H44 B;  4PK4 A;  1OXZ A;  5KLV D;  3L8I A;  3FGA D;  2V26 A;  2OYH B;  1KYO D;  2P58 A;  3HNL A;  3VMX A;  1ZR2 A;  1LP1 A;  3QMK A;  1JR8 A;  3M06 A;  4IJJ A;  1Q7Y Q;  4P6I C;  2A6E F;  3RK3 E;  3TK1 A;  5B66 E;  2L6G A;  3EZH A;  1URQ B;  1Q0D A;  3S28 A;  4U3F G;  1N73 B;  1JOG A;  3Q6N A;  1LM3 B;  3L72 G;  3H1I D;  1JRA A;  3G50 A;  1S2E A;  4HFF B;  4LLC A;  4BJ6 C;  1MMD A;  3HJC A;  3RL0 B;  3VP9 A;  3OW2 O;  5A6B A;  4CBE A;  3CX5 I;  1Y47 A;  1NTZ G;  1ZHZ A;  1NTK E;  1S1C X;  5KYY B;  2WIT A;  4KHX A;  1JTH A;  4LLH A;  1OKK D;  1BCC E;  2XZR A;  3V2R A;  5EFW B;  3T97 A;  1NFO A;  3NMI A;  2YKO A;  3NKD A;  4DBR A;  2FYN B;  5GTI H;  1LTJ A;  1NBB A;  2FFD C;  3U9J A;  2QUP A;  3BAT A;  2R7W A;  1MMN A;  1G4W R;  2QLA A;  2LXC B;  4R4M A;  5BVZ A;  1D0Z A;  3U8V A;  1URQ C;  1SQP J;  2QIW A;  1FJP A;  4DOJ A;  1GL2 D;  2Y39 A;  1OXK A;  1KIL C;  1SQX J;  3H1L D;  4YJW A;  4YT2 A;  2XLM A;  1CPR A;  5E79 H;  1ZYR F;  2OOC A;  4DZO A;  1LVK A;  2GA1 A;  1YYC A;  2YLG A;  2AXC A;  2I1J A;  2RKL A;  1NFN A;  3O6X A;  3TOM A;  3NYL A;  1SFC B;  3L1M A;  4I3M A;  5FCL A;  3L72 J;  3H1K D;  4DJG A;  3CC2 P;  2NUT B;  1ORJ A;  2P1A A;  4I6M C;  3C63 A;  5CI8 A;  3OWT A;  4BJ5 C;  1J2J B;  2IXP A;  4MN4 C;  1RMV A;  1JEK A;  2B0H A;  4PJJ A;  1QEX A;  1DH3 A;  2WL8 A;  5DS6 A;  1YQ3 C;  3FVY A;  4MND A;  1KIL E;  2C0X A;  2L91 A;  1WTY A;  2WZ7 A;  3O6Q A;  5AVX B;  1O87 A;  1JB0 J;  2A0B A;  4NTF A;  4GDO A;  2R7V A;  2L5G B;  4JTC B;  3H1L E;  4R4L A;  4E18 A;  1EZV I;  3PHL A;  1SQQ D;  1SQB G;  4B86 A;  1Q81 Q;  3H2U A;  3DWW A;  4IGG A;  1IZN B;  1LTJ C;  1AA0 A;  2HYN A;  3CC7 P;  3EQ2 A;  2LK4 A;  1K40 A;  2ZXP A;  1PD1 A;  2GWW A;  2Q3I A;  4AE4 B;  3B5N A;  1NU1 E;  2ZXX A;  3KXD A;  3QVY A;  3S4R A;  1U89 A;  4Z9I A;  2OYH A;  4QI2 A;  3AEB C;  2NPS B;  2QVA A;  1Q2N A;  1SQX D;  1NTZ D;  3AE9 C;  3G6E P;  4ONS A;  4J32 B;  2Z5I A;  2CPS A;  3V2P A;  2MYS A;  3RKO F;  2ZXE B;  1LI7 A;  4JBZ A;  1R5S A;  2D5R B;  5DQT A;  1Y6D A;  5GTI E;  1RF1 A;  3ZTZ A;  3HD7 B;  1IFP A;  3C9I A;  2K9J A;  2VB6 A;  2AXT E;  3EHM A;  4PV1 D;  3G9R A;  5KYX B;  2LR2 A;  2OEV A;  1LGH B;  4Z9J A;  1GW3 A;  1FZE A;  3L71 G;  1MZ9 A;  2LFD A;  3DD7 A;  4WVZ A;  3LES A;  2FY8 A;  1RE3 C;  3SWK A;  3L73 G;  2QEX P;  4OIO F;  1KYO E;  3M15 A;  3GEE A;  2IFN A;  3ZVR A;  3I4U A;  1KYO H;  1PCX A;  2WSC J;  1RF0 A;  5KYW A;  2KS1 A;  2FKW B;  1VLS A;  1JTH B;  3L73 J;  5AGF A;  3H1L J;  4CPG A;  1JPN A;  2HFE D;  3HLZ A;  4U3F E;  2W6B A;  4XPX A;  1EQ7 A;  3TJ6 A;  1NTZ E;  3S1K A;  4IL6 H;  3WUT A;  1S7Z A;  2CYD A;  4JW1 A;  2XS8 A;  3DE8 A;  5CCH C;  3FAP B;  3NMD A;  2QJK B;  2HUJ A;  3LUT B;  2E74 C;  2MKV A;  5JVE A;  3ASN C;  3DM5 A;  3E70 C;  2O01 J;  1RXQ A;  2RMZ A;  2HMZ A;  2HV7 A;  4W8K A;  4ASV A;  2J9U A;  2LFF A;  3OEO A;  4PD4 I;  1VQM P;  5HV9 A;  2FAP B;  3JT1 A;  4BG0 A;  3O10 A;  5DLJ A;  4D6T J;  1RY3 A;  1QVX A;  1ST6 A;  1HW2 A;  3SXM A;  2HKV A;  4Q5S F;  2XLO A;  4E0I A;  5AW8 B;  4H13 C;  4XLN F;  1AUE A;  1CZQ A;  4Z9H A;  3L75 D;  1EDL A;  1QL1 A;  2OKU A;  3GWN A;  3GHG A;  5D91 A;  1FS0 E;  2CK3 H;  3D70 A;  5KAF H;  3H1J G;  4CS7 A;  1FJK A;  2POH A;  5E3A A;  2O1K A;  1LE4 A;  4KT0 J;  1PPJ D;  2XV5 A;  1S4X A;  1OVV A;  3HUS C;  5B5E H;  4NTB A;  3L74 G;  3CI9 A;  1RE4 A;  3CCU P;  2RD9 A;  2WSE H;  1WRG A;  3VP8 A;  3ZTM A;  1V4A A;  4CS9 A;  2X0C A;  1PP9 E;  1SMY F;  3NFQ A;  3CEX A;  3CXH D;  3B9Q A;  3AG4 C;  2V7Q J;  5JS5 A;  3KZI H;  1X8Y A;  1T01 A;  3VF0 A;  1NTM G;  5KJ7 A;  3WAQ A;  1H88 A;  1HBW A;  3FXD A;  4J7Y A;  4U5B E;  4WWI A;  1DOV A;  4OIN F;  1Z63 A;  2PNO A;  3VYI A;  1T9K A;  1OCC C;  4LDQ A;  3JZ0 A;  1GK4 A;  2ZXO A;  4AK9 A;  1CW5 A;  3IQC A;  2N1T C;  2M64 A;  2Q3T A;  1KIL A;  2R7Q A;  3ASO C;  4WGZ A;  4DBQ A;  1JY2 N;  3US6 A;  4XLP F;  2WPQ A;  4W7Y A;  5B1A C;  3L70 E;  3P32 A;  3RQE A;  5A69 A;  3ZDM A;  2W45 A;  1VQ6 P;  3E9V A;  1S5L X;  3RGU A;  1VF5 D;  1AFO A;  1R5L A;  4NPE A;  1ZHY A;  4D6T E;  2PGD A;  1RQV A;  3IQ5 A;  4I2L C;  2SPZ A;  2W27 A;  4OIQ F;  4XEF A;  1L0L E;  2JO1 A;  3C62 A;  1YA9 A;  1OW6 A;  1LTB C;  3RK2 D;  1IFD A;  1NTM J;  2K9J B;  3K5B A;  2FYU E;  3TNU A;  2WVN A;  2X51 A;  4XWJ A;  2WB7 A;  1H0T B;  4X0R A;  2Q7R A;  3CXH I;  2A69 F;  3NMK A;  1XZP A;  1JM0 A;  1EXI A;  1N7S D;  1QKR A;  3CWB D;  4KJM A;  2JWD A;  1KQG B;  1NVO A;  2XND H;  4H0L D;  1VMA A;  2HPC B;  5H2F E;  1WN0 A;  1BE3 D;  3RK3 C;  3NMJ A;  2W83 C;  5D92 A;  5AC4 A;  1MKM A;  5JLI A;  5L0D A;  4ANJ A;  1R8E A;  3MYI A;  2FYU G;  2FYN C;  3L70 G;  2IBF A;  2IBZ D;  3SXZ A;  4H0L B;  4KI2 A;  1KB9 H;  1AJY A;  4MTF A;  1Q0K A;  2XLD A;  2DI3 A;  2R5B A;  5KLV E;  1M57 D;  4EHP A;  1QLE C;  5AVW B;  1JY3 P;  1OVU A;  1QLE D;  5IY5 C;  1GZL A;  2QE7 H;  4NPF X;  1SYQ A;  3L70 J;  3EG9 B;  3M4C A;  3AEC C;  1GK6 A;  1Y4C A;  3NRH A;  2J5U A;  3VN0 A;  5CIV A;  3U9M A;  1LT1 A;  2ZAE B;  2KSJ A;  5AW3 B;  4O7G A;  1RHZ B;  1ZU4 A;  2E5Y A;  2KK1 A;  2J9B A;  3K66 A;  1D1A A;  3B0P A;  3USS A;  3C8Z A;  1KFM A;  1D0X A;  1BBH A;  4KBL A;  3TGU J;  1N7L A;  3QZC A;  4EKW A;  1TQG A;  1L4A D;  1FZC B;  3H25 A;  1BDJ B;  2J9V A;  3JC2 2;  5AVY B;  1USE A;  3KDP B;  4C7R A;  4ZKP A;  3JSE O;  1BDC A;  1QVF O;  2HV6 A;  1VPC A;  2RH0 A;  1OXB A;  1YZC A;  1LT9 C;  1PV3 A;  1SQB D;  1SQQ G;  2W4B A;  4H4K C;  2KQ9 A;  5GTH H;  3LNM B;  4JKV A;  1UG7 A;  1L4A B;  2YZS A;  1T8Z A;  1KZU B;  4MQ9 F;  4QMA A;  2GAQ A;  2Y9Z A;  2Y0E A;  4RJT A;  2BCC J;  1L2P A;  1EDI A;  1NYH A;  3VTP C;  1C17 M;  3H2V A;  3FWN A;  4M3L A;  1AEP A;  3AGT A;  3AEG C;  3FWL A;  4I7Z C;  3RK2 C;  3LLI A;  2Y0D A;  2E75 C;  1HF9 A;  3HKK A;  2P7V A;  3KYI A;  4LAC B;  3H1J D;  1URQ A;  4L6R A;  3HTK A;  2A68 F;  4JUR I;  1KIL B;  3QH9 A;  2QRX A;  4BRY A;  3OAK A;  3U3B A;  2IXM A;  1T3J A;  2YXR B;  2JJL A;  1A41 A;  4OIP F;  5CI9 A;  3RQF A;  1GU5 A;  3ZIB A;  2A45 I;  5AVS B;  5KYU B;  4YT4 A;  3G4S P;  1CGM E;  5TIS H;  5KAI H;  5BU5 A;  2KXP B;  3M9H A;  4YL3 A;  3W8I A;  1M2V A;  1YTZ T;  4XPW A;  5APW A;  3ZQY A;  5APT A;  3G4X A;  3C8G B;  3GAN A;  4CDY A;  2YVK A;  4K1O A;  3BCC J;  1MMG A;  3R7C A;  4O6M A;  1O5H A;  4WAB A;  4GOD A;  4JF7 A;  1L7C A;  4DJ9 A;  4KNV A;  3A2A A;  1YIT P;  1VQP P;  2XLV A;  2LCH A;  1YQ4 C;  1FTS A;  3HNJ A;  3Q7L A;  4JEB A;  2AXT H;  1N73 C;  1LTT C;  1QGK B;  4PD4 D;  3RBX A;  1GL2 B;  1M1J A;  5BQI A;  5COG A;  4Y99 C;  1NTM D;  2BCC E;  2H7V C;  2XU6 A;  2A1D D;  3FOO A;  4MVM A;  1A7V A;  3TSI A;  3CCM P;  2EIK C;  2O01 N;  2O3J A;  4NCQ A;  2H89 C;  3LS1 A;  1P84 D;  2ZT9 B;  5DVW A;  5EGY A;  3PJS K;  2R5D A;  2IBZ I;  2Q9C A;  4H13 D;  4PV1 C;  4DOZ A;  5L0I A;  3BCC G;  4J30 B;  1UIX A;  2VRS A;  3EH1 A;  2ZXR A;  3CQZ A;  2Y0C A;  4W8P A;  2YLI A;  5AW6 B;  2XSE A;  1H89 A;  3V2N A;  2UWJ E;  2M4E A;  1SQX G;  2KUB A;  3MD0 A;  5KLV K;  4H13 B;  5K5G B;  4GT1 A;  3H32 A;  2LKM A;  1J1E B;  2PFD A;  5KAI E;  2OYO A;  3CSK A;  2EPN A;  5E33 A;  3SYN A;  2HLO A;  3W2V A;  2CNW D;  3X1O A;  3JCU Q;  2ZT9 C;  2KYH A;  2PP4 A;  3N4X A;  2DW3 A;  1J1D B;  5AVQ B;  5E3C A;  1KNY A;  3GOD A;  3FOP A;  1K8A Q;  5COM A;  2LQG A;  1MV8 A;  2KC3 A;  2H88 C;  1GL2 C;  3HE5 A;  4IAO A;  2YL3 A;  2IPP A;  2E87 A;  3T4R A;  2P61 A;  4CIH A;  3WG7 C;  5F28 E;  1SQB K;  2YKZ A;  1JCD A;  2FYZ A;  3W68 A;  1ZU5 A;  3HD7 C;  1JMW A;  3Q1M A;  1ZW2 A;  3P8C D;  2YO3 A;  2R25 A;  3C8V A;  2Y3D A;  1RCP A;  1USD A;  4D6T G;  1IZM A;  4N4W A;  5B1B C;  2HOD A;  2E74 B;  1A7E A;  2OYI C;  1RE3 A;  4LER A;  4BRY B;  2HJ3 A;  3TGU D;  2M0B A;  3QWO C;  2RSE B;  3CD6 P;  3CX5 H;  5H2F H;  4PJL A;  3H1H E;  5KYU A;  1HVV A;  1SF8 A;  2NG1 A;  1QPU A;  3P7K A;  4L75 A;  5DJU B;  4WY4 A;  2MHR A;  1LTJ B;  1LTI C;  3QTH A;  4K7B A;  2FFD B;  2FXM A;  2E74 D;  3L0I A;  2OQM A;  4BXL A;  3ITK A;  1SQV G;  2WWW A;  1S9K D;  1Q0G A;  1VQO P;  1SLQ A;  2MWQ A;  5BQH A;  4JYC A;  5KYW B;  2E43 A;  1OVR A;  4H54 A;  2XL8 A;  1BE3 J;  1VB5 A;  1QVG O;  1Z6A A;  3H6P A;  2YWA A;  1NO4 A;  3M0A A;  1YJW P;  3H1H D;  1K05 A;  2H43 A;  2I15 A;  4C46 A;  5AW9 B;  2L81 A;  2IZ0 A;  3O55 A;  3Q6M A;  4JYB A;  2YL0 A;  2YKQ A;  3MZW B;  4TLF A;  5CCH D;  2WSC H;  3GF3 A;  2G3A A;  4XE5 B;  3CPW O;  2HFI A;  1SQQ J;  4PV1 B;  1KQL A;  4GOE A;  2BE5 F;  2XL6 A;  3C1L A;  1J8Y F;  4XFJ A;  2J0W A;  1SFC A;  3TQO A;  1LJ2 A;  5DS4 A;  5AW5 B;  5B66 H;  2GFH A;  3EGD A;  1V74 B;  2BEQ D;  1ZRT E;  4K3A A;  3KZI E;  1TR2 A;  2R02 A;  1ZR4 A;  3L74 E;  1EZV E;  1SVF A;  1LWU B;  1YTZ I;  1OR2 A;  1TWA A;  4U5H A;  1CI6 B;  3A0B H;  1KQS O;  4BEJ A;  1BR2 A;  3IAO A;  2D2C D;  2KLV A;  2KP8 A;  5AW4 B;  5AC5 A;  1FZG A;  2ASR A;  2O01 H;  4Q7C A;  1SZI A;  3U2M A;  3DM9 B;  1HY5 A;  4BJ6 A;  1EDK A;  4MVS A;  3SXY A;  3F46 A;  1OR3 A;  1FDO A;  2C9L Y;  2BL2 A;  4ZLC A;  2NUP A;  3G3Z A;  3EFG A;  1LTS C;  1G5Z A;  5JT4 A;  2BCC G;  4JTD B;  3E1I A;  4OGQ D;  4WGY A;  2PP6 A;  3ABV C;  4IAR A;  3I5P A;  1NH4 A;  2R7X A;  5HSW A;  2C0W A;  3HUS B;  2KGO A;  5M1B A;  1BE3 G;  2E75 D;  1BR4 A;  1IC2 A;  1G8X A;  3B5N B;  2Q9B A;  1PPJ E;  5L0J A;  1EKY A;  4JTA B;  2YHS A;  2QE9 A;  1LT9 B;  2WPS A;  1ZHX A;  1M56 C;  2YQY A;  2D2C C;  1TWH A;  4ASW A;  2IM8 A;  1X22 A;  4A2N B;  3T9O A;  2WSS H;  3MTU E;  1FOS E;  2KW3 C;  1CPQ A;  1FZA A;  1ORY A;  3AOU A;  2DB4 A;  2ZJS E;  3AEF C;  2E75 B;  3SWY A;  3AE2 C;  3IQ6 A;  4IL6 E;  4EWC A;  1GW4 A;  2KB7 P;  2AU5 A;  1QSP A;  2H7H A;  2WZL A;  1L3P A;  1L4A C;  3AQC A;  3NYM A;  2YIU B;  3DE9 A;  2LXB A;  2E5T A;  1ZHW A;  4OIR F;  1HTL C;  4XTK A;  5A6A A;  4O6N A;  1NU1 G;  3UR3 C;  5CJ0 A;  3CL3 D;  4U3F D;  4U7J A;  1N7S B;  3V4Q A;  3CCE P;  3B71 A;  2Y69 C;  2WSF H;  2IXN A;  3WHN A;  3CCJ P;  3MX3 A;  4Y28 J;  1T6U A;  2A06 G;  4WBA A;  3L35 A;  4UB8 E;  2JR8 A;  2R32 A;  4LLE A;  4FES A;  3IF4 A;  3TUL A;  2WVQ A;  1IO4 A;  1DIP A;  2KNC A;  1YDI A;  3UMK A;  1APC A;  5CCH A;  4JRZ A;  2WSF J;  1TWC A;  5AVZ B;  2Q3E A;  3MHV A;  3DXJ F;  3V5X A;  5E2Q A;  1N86 A;  1PZQ A;  1SP4 A;  2M5A B;  5GPG B;  3IFM A;  2IOQ A;  3S9O A;  4N6H A;  5KKZ B;  2OCC C;  1AVO A;  1NU9 C;  1KOR A;  5A6K A;  3KKB A;  3V2Q A;  1YYX A;  2GUS A;  4JC7 A;  3K6B A;  2HR3 A;  1RE4 C;  2ZYA A;  3AG3 C;  3EG9 A;  3H1J J;  4U5D E;  1SQP G;  2ZPA A;  5AW1 B;  2V3C C;  2B87 A;  3JRM O;  3H1H G;  3TOL A;  2J45 A;  1BCC J;  3UIA A;  2M3B A;  3DKA A;  2IYL D;  1E85 A;  4G78 A;  4CS9 C;  1D1B A;  2B89 A;  1UII A;  2WQY C;  5TJ5 E;  4CS8 A;  2WT7 A;  4MW8 A;  2ETS A;  4EUK B;  3S84 A;  1RKC A;  4C7N B;  2GUV A;  5APX A;  2W6J H;  2WTY A;  3JSZ A;  4PR9 A;  3U59 A;  3EHN A;  1YJ9 P;  4K0D A;  2F22 A;  2Q5U A;  4PAC A;  5L8R J;  1U57 A;  2OYI A;  2N9B A;  3FXH A;  2A45 G;  3I56 P;  4YL1 A;  4H0L C;  2JDI H;  4OD5 A;  2R7T A;  2HJM A;  1KB9 E;  2Z5H A;  4IOI H;  2R03 A;  4PJM A;  5KAF E;  1MQV A;  1WT6 A;  2J0X A;  3EQL F;  4NY3 A;  1Z5Z A;  4ULW A;  3EH2 A;  4JCZ A;  2C03 A;  2YLD A;  3M79 A;  1LWU C;  3L71 J;  1L0L K;  1DX7 A;  1W2W A;  4RO0 A;  3HNI A;  3AQB A;  1RJ9 B;  5KYY A;  1W2B O;  2YL1 A;  4U9E A;  3IPM O;  4DVY P;  1CSB A;  2XKM A;  1JAF A;  1NOH A;  3KQG A;  3Q5R A;  1G2C B;  1HGZ A;  2R3S A;  2EIN C;  3A0H H;  1BZ4 A;  3GM3 A;  4ZNC A;  1OFC X;  4PD4 H;  2XXA A;  1WMK A;  1A7D A;  1ZHT A;  2YRF A;  1EI7 A;  2XLE A;  1G1I A;  1FDI A;  2BAS A;  2XS1 A;  4MS2 A;  3ZQV A;  1BCC D;  3N2Z B;  1S3J A;  1SQV D;  1Y9B A;  4MTG A;  5F5F A;  2IYO A;  2P10 A;  4FX5 A;  1T2K D;  1T2K C;  1LS4 A;  1VLT A;  3V5Z A;  1L0L G;  3ZG1 A;  4DVZ A;  1LE2 A;  3MGN A;  3EGX B;  1T6I A;  1PIX A;  4DXW A;  3P8M C;  2I8B A;  2VH3 A;  5L0H A;  1EQ1 A;  4AYC A;  1HW1 A;  3L73 D;  5T3W A;  4N6J A;  1ZP0 C;  1URQ D;  1AQ5 A;  1T5O A;  2PBE A;  1SR2 A;  2YMK A;  1N1C A;  3RK3 D;  1YZA A;  1YBK A;  2QM7 A;  3DJU B;  3AG2 C;  4EBB A;  4HE8 D;  1K9M Q;  1E84 A;  4GOF A;  1SQQ K;  1A02 F;  1VQN P;  2H7O A;  3Q7G A;  4JJF A;  3O8Z A;  4E7Z A;  1FZC A;  1H8A A;  2L6F A;  3GG2 A;  3HTK C;  1D0Y A;  3RK3 B;  1PL5 A;  2N1T A;  1DD3 A;  1RH5 B;  3GWL A;  4U5F E;  3NTN A;  3H1L G;  3GF7 A;  4NTA A;  1U7M A;  5CJ4 A;  2KNH A;  3W4Y A;  1SQV E;  1HWT C;  1KC8 Q;  2IXO A;  2WT7 B;  2HS5 A;  3KYQ A;  2JWA A;  4UDV A;  3PHF 2;  2IX7 C;  3UGP A;  1GMJ A;  4MTO A;  3POV A;  1DOW A;  3J06 A;  1OX3 A;  3RBZ A;  5KLV J;  2H8P D;  5CBO A;  2FGY A;  2EPM X;  1OW7 A;  2H7B A;  2OTL P;  1JY3 N;  3TGU G;  4MVZ A;  2OTJ P;  5KLI C;  4JVS A;  3HTK B;  3GLM A;  3RIP A;  1WAS A;  2A6H F;  4LC1 A;  4YWQ A;  4GKG A;  2J7P A;  3TF5 A;  2KI7 B;  3PLN A;  1GS9 A;  2O9X A;  2N9Y B;  2W6A A;  3K1H A;  5KYX A;  4CSA C;  1KTM A;  3WMM 0;  3H1I G;  3NDB B;  3T97 B;  3NYJ A;  4XEK A;  3CCS P;  2YNY A;  2W9Y A;  3S90 A;  4O6Y A;  5B5E E;  4M63 A;  2NRG A;  2H8A A;  5KLI B;  1V55 C;  3MUD C;  1HJB A;  3OA7 A;  1KD1 Q;  1HE9 A;  3DJN B;  1RJ9 A;  3A5T A;  1N2D C;  2OEX A;  3BAS A;  1BCC G;  3O39 A;  3FMS A;  3CCL P;  4YXD C;  1AV1 A;  5COF A;  2OTK E;  2E42 A;  2FFD A;  1NU1 K;  4N3Y B;  3VYW A;  4XEV A;  1ZVZ A;  2KZI A;  1MNE A;  1NZE A;  1BSH A;  5B3I A;  5CCG D;  1CGO A;  2OG2 A;  2EIL C;  1JMM A;  1RKE B;  2A0U A;  3K1I C;  2IBZ E;  3S29 A;  1LI5 A;  4EIJ A;  2J7P D;  2I8D A;  3CME P;  3DI5 A;  3HNK A;  2QNL A;  3U2L A;  3KYJ A;  3JCU E;  3JYY A;  3AEE C;  1EDJ A;  2W90 A;  3N0T A;  4A7P A;  3M9B A;  2L6H A;  3JRT A;  3RL0 g;  1CGN A;  2VCA A;  5EK0 A;  2J9W A;  1SS1 A;  4LDR A;  3I5Q A;  1OKK A;  2NPS D;  5EHH A;  2C9N Y;  4UB8 H;  2XLW A;  2R3C A;  3S27 A;  2HMQ A;  3G71 P;  3W2W A;  3A3Y B;  2YKP A;  1NTK D;  3H1K G;  1FMW A;  1NKZ B;  4JIO A;  3K1I A;  1A0B A;  1ZW0 A;  2AEJ A;  1LWU A;  2FYU J;  1KFN A;  4A4A A;  5AW2 B;  3UNG C;  1RF1 C;  4MVU A;  2ZVO B;  1LS1 A;  3HRN A;  1MFZ A;  3PDM P;  3GEI A;  4E0H A;  4ER9 A;  4K35 A;  2XDJ A;  2JPU A;  5JSL A;  1KMI Z;  2OQQ A;  1JUN A;  1E86 A;  3WUU A;  1GDT A;  1HH0 A;  2W8Z A;  4IWB A;  1EC5 A;  4AE4 A;  3IN6 A;  3JYH A;  5AVR B;  3NXS A;  4XPY A;  4C7O A;  3B5N C;  2DYR C;  4IAQ A;  3D71 A;  2QG4 A;  1A02 J;  1LPE A;  4BWN A;  2NPS A;  4CIP A;  4OGQ B;  3T6G B;  1G1J A;  1FAP B;  1YI2 P;  4HJG H;  4RBN A;  1EA8 A;  2J8W A;  3AEA C;  5K0I A;  3CXH E;  4PJ0 E;  1FDM A;  3U8P A;  1RF1 B;  2W4M A;  1S5L E;  1T6A A;  2D4U A;  1KN7 A;  1P84 H;  3RFY A;  4LGD E;  2TMV P;  3WU2 E;  1F1M A;  3ZDL A;  2WMM A;  1M7L A;  3AGU A;  3WU2 H;  3TD7 A;  1L0N E;  1Q82 Q;  2I1K A;  4U5E E;  3FXE A;  3VMZ A;  1H9T A;  1IFM A;  3W67 A;  3TK0 A;  5APS A;  4EOT A;  2XM0 A;  3H65 A;  3BRJ A;  2JEE A;  2C04 A;  3BEH A;  4HFK B;  3GW6 A;  1NHL A;  1R5I D;  1R4T A;  4BEM J;  1JOC A;  4WY4 B;  1OQC A;  2ZXW C;  4MW3 A;  1PP9 G;  3LIE A;  4IB4 A;  2ITA A;  2QJY C;  2RN0 A;  3NG1 A;  3CC4 P;  3B5N D;  4AUW A;  1V54 C;  4MVO A;  2IFM A;  1ZV8 A;  3A11 A;  4I1M A;  2J58 A;  3B8E B;  1HJ0 A;  3GM2 A;  2VCC A;  1N7S A;  3A0H E;  3LID A;  2Y9Y A;  4RES B;  3AE4 C;  4WY4 D;  4DT0 A;  4HH2 A;  1H9G A;  3CCV P;  3AE3 C;  1ZOY C;  3Q5S A;  2K9Y A;  1RKE A;  2ZFC A;  3M91 A;  1NTK K;  1FAV A;  1DEB A;  1NTM K;  3C7J A;  4L76 A;  5E79 E;  5APU A;  1GGQ A;  3VRC A;  1EZV G;  1ORS C;  1XTG B;  3RVY A;  4CX9 A;  1VOM A;  3H1I E;  2IZ1 A;  1P84 E;  4Y99 B;  1FFH A;  2NSG A;  4WB4 A;  2EPO A;  1NAY A;  3AE5 C;  2KK7 A;  1KB9 I;  1TFK B;  2R7S A;  3JSV C;  4PJ0 H;  4G0H A;  1YA7 O;  4ZMD A;  5L3Q A;  1L0N J;  3B4S A;  1NGM B;  1VF5 B;  3SP1 A;  2EPL X;  1EZV D;  5A6J A;  1FR0 A;  3L73 E;  1GQA A;  1M2O A;  3ZSU A;  2UUI A;  1L0N G;  1FMV A;  1VQK P;  3B29 A;  3CX5 D;  4CS8 C;  1NTZ J;  2LSE A;  1SFC C;  3K33 A;  1I4Y A;  3SXK A;  1SQP E;  4TT3 H;  3SFE C;  1UFB A;  1KV4 A;  3RK2 B;  3BVH A;  1SQX E;  1LKX A;  2Y3B A;  2NUP B;  4OH8 B;  5CCG C;  3LNR A;  4EI2 A;  2HG5 D;  1HE1 A;  1LP1 B;  1MND A;  2MJZ A;  1IJD B;  1NKN A;  1L4A A;  4N78 E;  3U3F A;  5FZT A;  5KTB A;  4IFD K;  3L8J A;  3VAY A;  2QTV A;  5L0F A;  3R2P A;  3OA1 A;  1VF5 C;  4I44 A;  4U5G A;  1LT9 A;  1JY2 O;  1SQQ E;  2FXP A;  2Q7C A;  1VYK A;  1OMI A;  1Z56 A;  1IK9 A;  5DQZ A;  1NLX A;  2R7R A;  3N24 A;  3H1J E;  4N6C A;  4W7Z A;  3ZC4 A;  2Q6Q A;  1ZXG A;  1E83 A;  3H1I J;  4G7H F;  1M8O B;  3RYL A;  3L74 J;  3V6I A;  3CLQ A;  4ZKU A;  1H0T A;  3AE6 C;  2R9R B;  2QJK C;  1M2V B;  3IHU A;  1OCO C;  3Q3D A;  4UB6 H;  3UMI A;  1PP9 J;  2KLU A;  1KQF B;  1YJN P;  3V5Y A;  2ZVN B;  4YTP C;  3M0D A;  1IK7 A;  3QVZ A;  1AVY A;  1SQB E;  4CJG A;  4F4B A;  5JP7 A;  1BDD A;  2PX0 A;  1KB9 D;  1W2E A;  1C03 A;  2AWC A;  4WJ0 A;  4GQH A;  4P9F A;  4I1L A;  1G2C A;  2IYP A;  1RF0 C;  2A06 D;  3I5C A;  2WSE J;  5GTH E;  2OU6 A;  1JCC A;  2L7A A;  3V5B A;  4EYY Q;  2VAS A;  2EIJ C;  2R05 A;  4CDA A;  5KJ7 C;  1EXJ A;  3CXH H;  2O1J A;  1C02 A;  3F89 A;  1TU3 F;  3EFO B;  3ABM C;  3L74 D;  2KOG A;  3RH3 A;  1JMB A;  2CW0 F;  1PPJ G;  2NUT A;  2NSF A;  1MFT A;  1P84 I;  3HE4 A;  1LTG C;  2ICW G;  1U7J A;  1TWG A;  4YT5 A;  2FBW C;  3L71 E;  3S0X A;  3MIW A;  3PRJ A;  1BGY D;  5KYN A;  1Z3I X;  2K1A A;  2JKV A;  2HZ8 A;  4PFO A;  4JJG A;  3V7O A;  1NTK J;  4YXW H;  3EWK A;  3O6Q B;  3PH0 A;  3EJN A;  1IFI A;  2NZ2 A;  2E76 D;  1B68 A;  1ZLL A;  2WVO A;  4R32 A;  1PD0 A;  3FX0 A;  1S9K E;  1VQ9 P;  3E1R A;  2M3E A;  1BSN A;  2AWY A;  1IFN A;  5L0G A;  2V4H A;  1VQ4 P;  5T3T A;  1OCZ C;  1Q86 Q;  2PX3 A;  4BPM A;  3SSU A;  3C8G D;  3L4F A;  2E76 B;  2OAR A;  2L9J A;  2BCC D;  4C7N A;  3ITF A;  4PFP A;  3ATP A;  3TDK A;  4PD4 E;  1N73 A;  1BR1 A;  1VK5 A;  3GMA A;  3RF3 A;  2DGJ A;  3CZ6 A;  2P1J A;  3L36 A;  3JCU H;  3F47 A;  1OW8 A;  3ABK C;  2K88 A;  3RL0 D;  2OYI B;  5L0C A;  1FNT c;  4U9D A;  3DAG A;  3DMD A;  1OWA A;  2AEF A;  3LLK A;  4FWV A;  3L71 D;  2YEV A;  2ZYD A;  4D6T D;  3MBG A;  3HD7 A;  5C39 A;  3P8C E;  2WZF A;  2NPU A;  3L72 E;  3VM6 A;  1FFT C;  2LIG A;  3WOD F;  1SFC D;  2EIM C;  3V4W A;  3BCC D;  1MUU A;  4E7S A;  3ABL C;  1U6H A;  2J59 M;  2B88 A;  2HOD B;  5AW7 B;  3EPV A;  1G4U S;  5A6B D;  2ZT9 D;  1Y8A A;  4QDL A;  4HB1 A;  1ZME C;  5CMZ A;  2XL4 A;  2WPR A;  3TJ5 A;  1VQ5 P;  2A06 E;  2PAJ A;  5B3S C;  3RQG A;  3IR9 A;  4DRJ B;  3K7D A;  2CGE A;  2Q1K A;  3PMR A;  1QX8 A;  1M57 C;  5AVV B;  3L37 A;  3R4Y A;  2CPB A;  2DYS C;  4HKZ H;  3A0B E;  1FZC C;  1I4Z A;  1O3U A;  1OIP A;  2XXA B;  1SQV J;  2HSB A;  5CHX A;  1GU4 A;  2R7O A;  2VC9 A;  2G8Y A;  3SEO A;  4AQR D;  2NPS C;  2YXQ B;  2Q4F A;  3BRV B;  1LTA C;  1NU1 J;  1TFO B;  3LJB A;  1MMA A;  3KL4 A;  3C18 A;  2AEM A;  3T6J A;  1VDF A;  1M90 Q;  3L75 E;  4NC3 A;  2IDB A;  3QW0 A;  1ZN5 A;  4YN0 B;  3EGX A;  3JTL O;  1XZQ A;  3LS0 A;  1JY2 P;  4Q4Z F;  1BGY G;  1NTK G;  1E5W A;  3EGD B;  1S05 A;  2WZG A;  3GHG B;  4N06 A;  1S72 P;  1JO5 A;  2QM8 A;  2XLH A;  3DZA A;  3NKE A;  1JPJ A;  4P9T A;  1VQ8 P;  2BC5 A;  1NTM E;  4YL0 A;  4CJO A;  1X9V A;  5KKZ C;  1CI6 A;  5APY A;  1VQ7 P;  3BCC E;  1N7S C;  3KPE A;  3H32 B;  1RQU A;  1ZRT D;  3AED C;  3L72 D;  2FXO A;  2ZYG A;  4L73 A;  3L34 A;  1I5N A;  3SZR A;  2OGU A;  2Z4E A;  1DD4 A;  1VYI A;  3CX5 E;  4U3F J;  2YIU C;  3CAX A;  5CBN A;  1PFI A;  4OVN F;  2G62 A;  4YT8 A;  2N1T B;  1NG1 A;  2G3V A; 
#chains in the Genus database with same CATH homology
 3AE3 C;  1ZOY C;  1UIX A;  2QJP C;  3Q5S A;  1DD3 A;  1K05 A;  3GF7 A;  2K9Y A;  4NQF A;  3RQE A;  4EBK A;  1WOL A;  1PV3 A;  3AE8 C;  1S5L X;  2ZT9 D;  1VF5 D;  3MFN A;  2WSC J;  4U7J A;  2WSE J;  3Q5P A;  3GF3 A;  2G3A A;  4H13 B;  3B71 A;  1ZME C;  1GMJ A;  4PV1 B;  4XFJ A;  3SFD C;  2D2C B;  1RQV A;  4Y28 J;  2JX0 A;  4H44 D;  2JPU A;  1ZZP A;  4XEF A;  1NYH A;  2JO1 A;  1OW7 A;  1KMI Z;  2OQQ A;  3AE5 C;  3RQG A;  3TUL A;  2BEQ D;  3AEG C;  3K7D A;  1ZRT E;  1OW6 A;  4I7Z C;  1EXJ A;  1DIP A;  1TU3 F;  2BEZ F;  2E75 C;  2Q00 A;  3U0C A;  1HF9 A;  3Q5R A;  2WSF J;  2QSI A;  3IN6 A;  1NGM B;  1VF5 B;  5KLI C;  3R4Y A;  3GLM A;  1WWP A;  2JP3 A;  1EXI A;  1O3U A;  2E74 C;  2HSB A;  2MKV A;  2ZT9 C;  3D71 A;  3GM3 A;  1KQG B;  3IAO A;  2D2C D;  2G8Y A;  1Q90 D;  4H0L D;  1WMK A;  4H44 B;  2FBW C;  3S9O A;  3AJM A;  3RQF A;  1KNY A;  4OGQ B;  3L8I A;  3FGA D;  2O01 J;  1YQ3 C;  1KTM A;  3AE1 C;  4TT3 H;  1KIL E;  1KOR A;  3LW5 J;  3SFE C;  1UFB A;  3T97 B;  4XEK A;  3GM1 A;  2H88 C;  3AEA C;  1FDI A;  1MKM A;  1WTY A;  4IL6 X;  1FDO A;  3O6Q A;  3D6Y A;  3O10 A;  3C18 A;  1JB0 J;  1R8E A;  3EWK A;  1QVX A;  2FYN C;  1Y9B A;  4GDO A;  3RK3 E;  5F28 E;  2IDB A;  2P10 A;  2L6G A;  4EBJ A;  3C8G B;  4H13 C;  2NZ2 A;  4H0L B;  4R4L A;  2E76 D;  3Q1M A;  4H44 C;  3U3F A;  4OGQ D;  1JOG A;  4R32 A;  4OGQ C;  4YXD C;  3ABV C;  3C8G A;  3L8J A;  3C8V A;  1AJY A;  3D70 A;  1K04 A;  1PIX A;  5M1B A;  3D6Z A;  4KT0 J;  1VF5 C;  2E75 D;  2LK4 A;  4XEV A;  1K40 A;  2E74 B;  2FXP A;  1YQ4 C;  1OMI A;  3AEC C;  1ZP0 C;  3BRJ A;  5KKZ C;  3C8G D;  2D2C C;  2J5U A;  2E76 B;  2PBE A;  2WQY C;  1V4A A;  1S1C X;  2E76 C;  2YMK A;  1RQU A;  3AEB C;  3GMA A;  3Q2Y A;  1VL2 A;  3AED C;  2QJY C;  3AE9 C;  4I7Z B;  2KK1 A;  3JYY A;  2V7Q J;  3AEE C;  3AEF C;  2E75 B;  3AE2 C;  1OW8 A;  2E74 D;  3AE6 C;  2QJK C;  2H89 C;  5L8R J;  2L6H A;  1U57 A;  3RL0 g;  1HJ0 A;  3Q3D A;  3GM2 A;  2ZT9 B;  1DD4 A;  2WPV B;  2YIU C;  4RKU J;  2L6F A;  3JZ0 A;  4H13 D;  3AE4 C;  4PV1 C;  4R4M A;  1KQF B;  4PV1 D;  2QIW A;  3G9R A;  3AE7 C;  3H25 A;  4YTP C;  4H0L C;  4Z1M H;  1PL5 A;  1IK7 A;  2YWA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...