1K04A

Crystal structure of the focal adhesion targeting domain of focal adhesion kinase
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
142
structure length
142
Chain Sequence
EISPPPTANLDRSNDKVYENVTGLVKAVIEMSSKIQPAPPEEYVPMVKEVGLALRTLLATVDETIPLLPASTHREIEMAQKLLNSDLGELINKMKLAQQYVMTSLQQEYKKQMLTAAHALAVDAKNLLDVIDQARLKMLGQT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords FOCAL ADHESION KINASE 1
publication title The structural basis of localization and signaling by the focal adhesion targeting domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 56
structure length 142
sequence length 142
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2001-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03623 Focal_AT Focal adhesion targeting region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.540 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 1k04A01
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 1k04A02
3K7DA 4XEVA 3L8IA 2L6FA 3AEFC 1K04A 4XEKA 3AE5C 3RQFA 3AEGC 2PBEA 1OW7A 2L6GA 2HSBA 3AE2C 3TULA 1K05A 4EBJA 3AE3C 3JYYA 1O3UA 3MFNA 3BRJA 2WQYC 3RQEA 3AEBC 3AE8C 2JPUA 1V4AA 3SFDC 1WTYA 3JZ0A 4EBKA 3SFEC 1KTMA 1WOLA 3C8GD 3AE4C 1YQ4C 2JX0A 1YQ3C 1ZP0C 2Q00A 1KNYA 1ZZPA 3AE1C 3ABVC 1UFBA 4XEFA 3AECC 2KK1A 3B71A 5F28E 1QVXA 3GM1A 3AEEC 3U0CA 1OW8A 3C18A 2H89C 3L8JA 3AEDC 1JOGA 3C8GB 1WWPA 1OW6A 3AE6C 2H88C 2YWAA 1K40A 4YTPC 3O10A 4YXDC 3S9OA 1PV3A 2FBWC 3RQGA 4R32A 3U3FA 2G3AA 4NQFA 3GM2A 3C8GA 2L6HA 3AE7C 3GM3A 2LK4A 1ZOYC 3AE9C 3AEAC 3AJMA
chains in the Genus database with same CATH superfamily
2OYHC 1DH3A 2KZIA 1WATA 4YT8A 1ZW2A 3V4WA 2PX0A 2Q1KA 2VASA 1VK5A 3AEFC 4RD9A 1OZHA 2W6BA 4PD4D 5KYXB 3TOLA 3S4RA 2QJKC 1NU7D 5KYYB 4XLNF 2ZFCA 1SQPK 1ST6A 1N8RQ 3K66A 4YT4A 2OTJP 1IFPA 3EG9B 1EQ1A 1CSBA 1GM5A 3TULA 1JY3P 3GF3A 4L75A 3MTUE 3V5YA 3K1IC 3LIEA 2M4EA 3LS0A 3A7OA 3B5NC 3RF3A 3MHVA 3SEOA 3CCLP 1U57A 1BSHA 5CBNA 3OAKA 3V5XA 3WMM0 1YYXA 3EH2A 1JPJA 1HH0A 4BRYA 4Z9IA 4U3FG 3M9HA 2DI3A 2C0XA 3H32B 1LIHA 4U5CE 2R7TA 1Q7YQ 4IAQA 3MX3A 1QVFO 5KAFH 3POVA 1M90Q 1CPRA 4D4NA 4EIYA 5AVRB 3QWOC 5DVWA 3AE4C 2KS1B 4H13D 4HJGH 5CCGC 2JX0A 2YKZA 2WVQA 3KPHA 1LT9B 3GF7A 3ATPA 4G7HF 3JSZA 4MNDA 5HV9A 2Q7CA 3FXDA 5F5FA 1ZU4A 4GDOA 1OCCC 1V74B 4I3MA 5APYA 4C3DA 4DCKA 1KB9H 2EPNA 5KAFE 1FS0E 3VYIA 5L0JA 1Q2NA 2DB4A 3V2NA 1JY2N 3GODA 1T6AA 3HNLA 2J58A 2ZXPA 3M15A 4E0IA 5KAIE 4N78D 1VDFA 3HKKA 4IL6E 2A68F 2SPZA 3G4ZA 1RKCA 1PP9E 4YTPC 3IN6A 2ZPAA 4YT2A 4J30B 3HE4A 4J7YA 1M57C 2JR8A 1WGWA 3S9OA 1J2JB 2LD6A 4CBEA 3P8CD 3MYFA 1PV3A 4PD4E 1A02J 1OKKA 2WSCJ 2FYUJ 2H7OA 3TOMA 1PGJA 2OYIC 1VQNP 2XL8A 2YO2A 4GIFA 1JRAA 3LW5J 4JF7A 2M5AA 2OYHB 1MUUA 4EI2A 2L6HA 3S27A 3GG2A 3GEIA 1RF1C 4JTAB 5B3IA 2IBZI 1PGQA 3E70C 5DLJA 4CS8A 3M0DA 3R7CA 3Q7GA 1JB0J 4U3FD 2IYPA 3L8IA 3Q3DA 4PV1D 3HD7C 4HEAJ 2QJKB 4IFDK 1A41A 2YL7A 1K04A 1RE3A 5A6BA 1NU1J 2XS1A 3JC22 1BGYD 2EPLX 2RH0A 1Z23A 4DRJB 1VF5D 2N1TC 3L70J 3B5NB 4DBRA 3CWBE 1T8ZA 3M9BA 1L4AA 4XE5B 1RE4C 3LESA 1DD3A 2YZSA 3PH0A 5E3AA 2QTVA 5L0FA 3JYYA 2KGOA 3K33A 1NGMB 3EQ2A 4BEMJ 2NUTA 3TGUG 5A6AA 1YIJP 3IQ5A 1LI5A 3V6IA 1URQC 4UB6H 2W6JH 3U59A 4D6TG 2D5RB 5KLVJ 3TK0A 2IXNA 4CIHA 3Q5RA 3LNRA 2L7AA 4ZMDA 1N73A 1BBHA 3W2VA 4N78E 2FFDA 1CI6A 5KYUA 5APQA 1N7SC 1NTMG 1VQMP 1KNYA 4BJ6A 2Y9ZA 1QSPA 2QM8A 4H0LD 2P6VA 3ABVC 2W9YA 4UB6E 2KK7A 3TF5A 4LDRA 3GMAA 2L91A 2H7VC 2NPSA 3A9CA 4MQ9F 4Q5SF 2XKMA 1HW2A 2HYNA 2Y3HA 4EKWA 1NH4A 2HODB 2ZT9D 1NJIQ 2LQGA 5COMA 2H7HA 2ZYDA 2YWAA 2X0CA 2OEXA 5L0CA 2OYIB 1YZAA 1LTBC 1BGYE 2OOCA 2ZAEB 5A6KA 5E79H 3H1JE 1RF1B 4BWNA 3F89A 2AEMA 2EPMX 3ECSA 3G4SP 5KYWB 5AW2B 1HTLC 3C8GA 2J0XA 4BPMA 4QMAA 3TNUB 2LK4A 1YTZT 1H0TB 3EHMA 4FAPB 3TGUD 2KNCB 1SQQG 2I15A 3D70A 3H1LD 2JWDA 4YJWA 3EWKA 1VMAA 2WZGA 2OJQA 2YL3A 5JT4A 2IM8A 3EGDB 4WY4D 4DT0A 1HGVA 2N1TB 2FXMA 3EGXA 1QGKB 5E79E 5GTIE 3GORA 1NTKE 1LE4A 3T9OA 3TK1A 2G8YA 2L5GB 3DJNB 2KP8A 1LP1A 1DOVA 2RN0A 1NTMD 1M2OA 3CC7P 2TMVP 1M2VA 1RXQA 1SYQA 3UR3C 1L0NJ 1MMAA 3H1KG 4JYCA 5AVWB 3GWNA 4K1OA 4IFMA 1JY2P 1URQB 4HE8D 1PPJG 2O1JA 2W8ZA 4I1MA 3W2WA 3RQEA 4JJGA 2PNOA 4HKZH 4JW1A 3ABLC 1OKKD 2IZ0A 1D1AA 3KH2A 2Y3GA 2B89A 4FESA 5KYNA 1KTMA 1Q86Q 2NUPB 1N7SB 4PK4A 5L0GA 5DQTA 4WGZA 3GW6A 1MV8A 4I1OB 1SQVE 2KIKA 3G9RA 1BSNA 4IOIH 1KILC 2CK3H 3MP7B 3LNMB 3VTPC 1ZHXA 2QJYC 1MNDA 5A6BD 2KK1A 1VQ7P 1IFIA 1OFCX 1X79B 2A6HF 4GODA 4DOZA 2QG4A 2BL2A 1NTZG 3W4YA 1LTTC 2AXCA 1EA8A 3IEEA 1NYHA 1N7LA 1JEKA 3I5CA 1M56D 3RK3C 1L4AD 3H1LE 3CXHE 2H88C 3C9IA 1S5LX 1PGOA 1NFNA 2K9YA 3UIAA 4MVQA 4AQRD 2OJED 3RQGA 1CPQA 3H1KD 2GDCA 4N06A 2FYUG 3SNHA 1RH5B 1IC2A 1PPJD 5AW7B 4PFPA 3CX5D 1HGZA 2OQMA 3Q2YA 3CWBJ 4HFFB 2Q3IA 1JTHB 2ZVOB 2QUPA 3O39A 3T4RA 4CSAA 2WVOA 3BASA 3RQFA 2NSFA 2J59M 3PTZA 1NU1G 3W67A 1Y47A 2YKPA 4Z1MH 3ASNC 2LSEA 5BUOA 4CJGA 1OWAA 4C7RA 1FDMA 1QLEC 1EXJA 2WSEJ 5KJ7A 5EGYA 2W4BA 3SZRA 3L70G 2NPSD 1LTIC 5EK0A 2AXTE 3WG7C 1HUCA 4PJJA 2POHA 1HVVA 3RYLA 5JS5A 4K35A 1O3UA 2K9JB 2EINC 1NTZD 5CHXA 1YI2P 3KYIA 4NTAA 3M9QA 2YMYA 3S90A 3GWLA 2HJMA 2YKQA 3K5BA 1JPNA 1Q0FA 5L0DA 3SFDC 3JZ0A 2XZRA 3IFMA 4QI2A 1Q81Q 5KKZC 1KILB 3NFQA 3C8GD 5HSWA 5KLVG 1YHQP 3U5SA 2E74C 4H13B 2E75D 1OMIA 1L7CA 1S9KD 4GOFA 4QDLA 4H54A 3H6PA 2FYUD 2QJYB 3KZIH 2P1JA 4U3FJ 3VRCA 4JC7A 2O9XA 1SVFA 2WSFJ 3V2RA 1G2CB 1LKXA 1WASA 5B66E 4W8PA 1RMVA 2GAQA 2NRGA 1SZIA 3GM1A 1OXBA 5BQIA 2FXOA 3ZTZA 1BGYJ 1VQLP 3H1JJ 3RK3B 3DE9A 1D0ZA 1RJ9A 4PJ0H 2HKVA 3WAQA 1FR0A 2IBZG 1GD2E 1BCCD 2R7QA 4E18A 1J1EC 1ZRTE 1DEBA 2UWJE 1IFNA 4LC1A 3H1HD 1NLXA 5CI9A 3L73E 3HNJA 4JYBA 3L70D 2ZD9A 2ICWG 4P9FA 3CXHI 4MVRA 4AE4B 1PD1A 4C7OB 3KPEA 3L36A 4O6MA 5COGA 1NTKJ 1ZOYC 3L75D 2H8AA 3JCUQ 3ZC4A 4PJ0E 3G71P 2KI7B 3R2PA 3FAJA 2Z5IA 1GK6A 2H7BA 4O6NA 3CD6P 4AYCA 2R5BA 5E2QA 2YLGA 3UMIA 1Z63A 4MVMA 1R5LA 1VQ9P 1OW7A 1IFJA 2YIUC 5KLVD 2HMZA 3HTKC 2HSBA 2KLUA 3LIDA 1MKMA 3BVHA 2IYLD 3FGAD 2A06E 2IFMA 2KXPB 1TWAA 4W7ZA 1VYKA 2P7JA 1YITP 3RBZA 2G62A 4XPYA 4P9TA 3N7NA 3MGNA 2J46A 1SFCC 2QE9A 1BE3E 4ONSA 1S9KE 2QY9A 3U9JA 2WZFA 3LW5H 1L0NG 3MFNA 1FZBA 1Z6AA 2G3VA 3HE5A 1SQVJ 4EIJA 1FMWA 2IBZD 5KKZB 1AQ5A 1AFOA 1JM0A 1T3JA 4A2NB 4OIOF 2Z5HA 1SF8A 3UGOA 1MFZA 3II6A 3UMHA 3L1MA 1KQFB 2OGUA 1LTJC 2WMMA 3O8ZA 1FNTc 3RK2C 1YQ4C 2R3CA 4CPGA 3TGUJ 4E0HA 4EWCA 3P7KA 3KL4A 3H1LJ 3H1HE 4I6MC 1OCZC 2AEFA 1NWQA 3M0DC 1YJGA 3T97A 1PP9G 4U7JA 1ZR2A 1S05A 1KZUB 1JCCA 4Z9JA 1M1JC 3CCUP 1J1EB 2XXAB 1Y9BA 4TT3H 5KJ7D 2RMZA 5L8RJ 2A0UA 5GTHH 1NTMJ 1M1KQ 3H1IE 2I1JA 2E42A 2KSFA 1L4AC 1YYCA 3V2QA 3LUTB 1OIPA 4NTBA 5B3SC 4OVNF 1HY5A 3CCMP 3Q5PA 3G6EP 3U3FA 3L72D 2HLOA 1U7MA 4BRYB 1RF0A 2W45A 4JEBA 2XLVA 1NKZB 3AE9C 2E76D 1LTAC 4WVZA 2WT7B 4HFKB 3QW1A 1FMVA 3L35A 1PFIA 1LS4A 3RH3A 3AQCA 1LTSC 3ZG1A 4A7PA 1QQ3A 2EPOA 2YIUB 3CWBG 2VCCA 4XEKA 2YXQB 1GS9A 3HTKB 3FDQA 2MYSA 5D91A 2R25A 2HPCB 1H6GA 1QZXA 2FY8A 2FFDC 5KTBA 2LCHA 1VYIA 2W4MA 1K8AQ 4ZLCA 1GU4A 1SFCB 3VAYA 3WUUA 2JKVA 1VQ5P 2C03A 2WZLA 2B88A 1PP9D 2MKVA 3GHGC 3TDKA 4NCQA 2BEQD 1AEPA 1IFDA 4X0RA 4CX9A 4ER9A 5FCLA 1LWUA 1APCA 3AE8C 4NPEA 1G8XA 3QVYA 3MUDA 3DI5A 4CDAA 1IO4A 5DS6A 4G7ZF 1LTJB 1JMBA 4GT1A 3RK2B 2NPUA 3S29A 5AW8B 3ASOC 2GA0A 3PMRA 1A02F 3W8HA 3JT1A 2XLWA 2DYRC 3CEXA 3H1KJ 4UB8H 3Q6NA 3FOOA 2VCAA 4G78A 3PRJA 1ZZPA 1ZHZA 2RSEB 1FDIA 3FOPA 4U5EE 1PZQA 4O79A 1M1JB 4JEAA 1QVXA 2ETSA 4I44A 1S4XA 1SQQK 5BQGA 3L72E 2YLIA 3CWBD 2HFED 4R4MA 3U0CA 1OW8A 2H89C 4G7OF 3L74E 4UB8E 1BGYG 2R7SA 3H1JG 2Q9IA 4XQ1A 1WWPA 4LERA 1L4AB 4WY4A 1FZCA 3GANA 1WT6A 4YXDC 3LAYA 5A6JA 1DEEG 2Y39A 2D2CC 4EHPA 2ZJSE 1HE9A 3G4XA 2NUTB 1NTZJ 2W83C 3CCQP 2XRHA 2WWWA 3L71E 1KN7A 3K7DA 4OGQC 4MVOA 1T9KA 1NTKG 1XZPA 1O5HA 3O6QB 2A45I 4A4AA 4JRZA 3Q7LA 1EZVE 3BCCD 2FFDB 2EILC 2DYSC 3RVYA 1AA0A 2IXOA 2QM7A 5TJ5E 4I7ZC 1Q0KA 1ZU5A 5APXA 1G4US 2DW3A 1NAFA 1KB9E 2FGYA 1K73Q 3HRNA 1T6UA 4IB4A 4WJ0A 3GHGB 3CCJP 1HJ0A 2XSEA 1HW1A 1CW5A 1EDJA 3SWFA 1FOSF 4R4LA 1FFHA 3LEVA 3NKEA 4DXWA 1L0LE 5DJTB 3S1KA 5KYYA 3SXYA 2J8WA 2OTKE 3BRJA 5CIVA 1BCCJ 5BU5A 2KQ9A 4YT5A 3H1JD 2JPUA 1V4AA 2WPVB 3H1HJ 1SQVG 2R7OA 5CI8A 2OEVA 5H2FH 4HB1A 3PDMP 1GGQA 3U8PA 4LDQA 2E75B 3L75J 1PIXA 1ZN5A 3I5QA 3NYLA 5AW1B 4MTGA 2EPKX 2WL8A 1S72P 4J32B 1TU3F 2FYUK 1BR1A 2O01J 1FU1A 3PCVA 1NTKD 3H1LG 4CS9A 3VP9A 3EGXB 3ZIBA 4CSAC 3B0UX 2M64A 3C18A 5AVVB 3RL0D 1KILE 1U89A 3IQTA 4KNVA 2AWYA 1Z56A 1NZEA 1EXIA 4RBNA 3B9QA 3O55A 5A69A 2D2CB 1NU1K 2BEZF 1TKNA 3LLKA 3CLQA 3BCCE 4MVUA 3DJUB 5DS4A 3JCUH 3C8VA 2HV6A 4EOTA 1D0YA 1JR8A 1USDA 2A0BA 4OGQB 1WMKA 3P32A 3RK3E 2M0BA 3WUTA 1LE2A 3NDBB 1OCRC 2PX3A 1SQXE 1N86A 1ZHTA 4RKUJ 3F5HA 1Y8AA 3B8EB 1SQVD 2PP4A 1IZMA 4JVSA 1NBBA 4I7ZB 1H7IA 1LI7A 2OYHA 3RVZA 2OCCC 1VQOP 1R5ID 2QIWA 1Q0MA 4KT0J 1T6QA 2FAPB 2FXPA 2V7QH 5AW9B 5KLVK 2L9JA 4XLPF 1EZVI 1LJ2A 1OVUA 3TSIA 4W8KA 3I4UA 1Y6DA 3DAGA 1QX8A 1KQSO 1EDIA 2J45A 5CCHC 3CXHD 1NHLA 1SQBE 3Q1MA 1KB9I 1OCOC 2C0WA 5AW0B 4HH2A 3FVYA 1OXKA 2K3RA 3B5NA 1J8MF 4AX2A 4YL3A 4L74A 2BASA 5FZTA 1AUEA 4O9BA 5L0HA 3WUVA 1TWCA 1YYJA 5DS5A 3L72J 2FYZA 2VB6A 2KW3C 2AP3A 2OKUA 2KYHA 2Q00A 3OA1A 1ORYA 1WN0A 1S5LH 1PGPA 4N4WA 1NKNA 1U7JA 5CCGA 2EIJC 1Z7Qc 3VF0A 2R7VA 5F28E 3MD0A 2R7WA 3GEEA 3NKDA 1KQLA 2M3BA 2OYOA 1GW4A 2PP6A 2NSGA 4OD4A 3TQOA 4KBLA 2N9YB 3VMYA 1D0XA 2GA1A 2BCCE 4NTFA 4FWVA 1LPEA 4PACA 4N6HA 4ASVA 1L2PA 1I4YA 4XA4A 1C02A 1S5LE 4H13C 2YLDA 1PP9J 3I56P 2C9NY 1YDIA 2ZXXA 1FZEA 3M91A 2EIKC 2XM4A 4FX5A 1FZGA 2XL4A 2WPRA 1C17M 4NQFA 1MZ9A 3SWKA 2LFDA 3IQ6A 1L0NK 1PCXA 1R4TA 3DXJF 3UMKA 1AVOB 3D71A 2XLMA 3WHNA 1W2EA 1IK7A 4Q4ZF 2R32A 3RL0g 3ZQYA 2A06G 4H44D 3H65A 1HBWA 5DJUB 3TNUA 3C7JA 3HD7A 1H0TA 1Z5ZA 2KNCA 1BE3G 2H43A 1ZW3A 2P10A 2HMQA 2NZ2A 1CGME 4BJ5C 2WITA 5BU8B 2R5DA 3EGDA 2KUBA 4ZLDA 1U0BB 2N1TA 5E3CA 3UNGC 5BVZA 4D6TE 1ZRTD 2YVKA 1RE4A 1SMYF 3L73D 4PV1C 1GTWA 1NFOA 3CMEP 1RKEA 1VLTA 2Z4EA 1BCCG 1JNMA 1Q90D 4XPXA 3U2LA 2P1AA 4J7TA 2LR2A 4KC9A 3H1HG 5T3WA 1JMMA 1VF5C 3GEHA 1URQA 3OEOA 3TJ5A 3KDPB 2UUIA 1RF0C 2D4UA 1SQPE 1T2KD 1U6HA 3L75G 4ZKUA 2XNXA 1YBKA 4C3EA 4CDVA 2YHSA 3BCCJ 1OR2A 1N7SA 1HJBA 1E84A 2W90A 2J9WA 3B29A 2VCBA 4RO0A 2XDJA 3H1IG 2CPSA 3NMKA 5APWA 2A06D 1FFTC 1I4ZA 5C39A 3BRVB 1G5ZA 1OW6A 1SQXJ 4AL1A 4OIPF 1K40A 5COFA 1BE3D 3NYMA 3U3BA 2L81A 1YA9A 3FMSA 2A45G 4D4XA 3HUSA 5B5EH 2G3KA 1SQQE 4NY3A 2Q6QA 1MFTA 3HNIA 3HE5B 2G3AA 3B5ND 3IAOA 3T6GB 1X0TA 1GQAA 2I8BA 4H0LC 2FKWB 2GUSA 3MYIA 256BA 4BEJA 4IFFA 3L34A 5JLIA 2WVNA 5GPGB 4OD5A 1TWGA 1PD0A 1J1DC 2OQQA 2N9BA 4PJNA 3MIWA 2ZT9C 3KZIE 4CJOA 3AEGC 3LEOA 4IJJA 2R03A 4H4KC 1KYOH 3JYHA 2AEJA 4IRUA 1NU9C 3NMJA 5CCGD 2YL0A 3CCEP 1A7DA 3T97B 5AGFA 1YLMA 4EBJA 4C7NB 4EBBA 2O3JA 4LDKA 3GLMA 3CC2P 3OWTA 4L76A 2E5YA 1BZ4A 2Q3TA 2FYNC 4PV1B 2IYOA 1JY3N 3H1ID 1CGNA 1K9MQ 4U5DE 1JUNA 2M8RA 2QEXP 1ZV8A 1RQVA 3KYQA 4PFOA 1LT1A 1OQCA 4WY4C 1H88A 1FZCC 2HSQA 2AVKA 1VF5B 2Q9CA 1ORSC 3SSUA 4BG0A 1GL2A 1YA7O 2ZXOA 2QRXA 5M1BA 5BQHA 2I1KA 1NG1A 3EFOB 4G0HA 1M57D 1S3JA 4LLHA 3QH9A 4DOJA 1RY3A 1H89A 3BEHA 2JP3A 2WSCH 3X1OA 3L72G 4JCHA 3DM9B 1G1JA 4YXWH 1ZLLA 3JSVC 2P7VA 4OWFA 1XTCC 3NXSA 2EIMC 1KILA 2A69F 4GEHA 2Q4FA 5TJHA 1NTKK 1RCPA 1T6IA 3HD7D 4W80A 3Q6MA 4JKVA 5E33A 1SR2A 2QJPB 4Q7CA 4XPWA 1JOGA 1W2WA 4XTKA 2YO3A 3EQLF 4ZKPA 2Y0CA 3TJ6A 3C63A 2IZ1A 3VMZA 2B87A 1EQ7A 4XWJA 2JEEA 2WPSA 2N1TD 1MMNA 4MVSA 2YXRB 1P84H 2V4HA 2FBWC 4CS8C 2PAJA 4H0LB 1DOWA 1TR2A 5TISH 2W27A 2E5TA 1LWUB 3SYNA 1QVGO 2KZJA 1SS1A 1G1IA 1EZVG 1RE3C 1LS1A 3QZCA 3FX0A 1CZQA 2HV7A 5D92A 1J1DB 5L3QA 1D7MA 3J06A 2Q5UA 2ZT9B 1A7EA 4K0DA 2L6FA 1URQD 1DX7A 4JTCB 4C3BA 1FZFA 4AE4A 1SQVK 3ABKC 1M56C 1P84E 2UUHA 3ZTMA 3TD7A 2KYVA 1LGHB 1L0LG 4OIRF 3E1IA 3FAPB 4O7GA 5AVYB 3M4BA 2J7PA 4K3AA 1N7SD 2FYNB 3MBGA 3AE3C 3L74D 3IPMO 2P2UA 3NRHA 4DBQA 1Q0GA 2R05A 3V5ZA 2XLOA 1UG7A 5GTHE 2XLDA 2Y3DA 1A7VA 3ZWIA 4WY4B 1FZCB 1FAPB 1W5CE 2CDQA 3M1CB 1N73C 1VB5A 2QNLA 1SQPJ 4DVYP 3ZDMA 3SFEC 1YJ9P 3L71D 3H2VA 1I5NA 3N0TA 4BJ6C 3P8MC 2VC9A 4DVZA 1KYOI 2V3CC 1ZW0A 2IX7C 4DJGA 1NTMK 3A2AA 3FXEA 3IF4A 1KV4A 3F46A 2LXCB 2XV5A 2NPSC 5CBOA 2RD9A 1EZVD 3N2ZB 1FOSE 1TFKB 4IARA 3HE4B 3AECC 4GOEA 1BR4A 4JBZA 4BJTA 1QL2A 1KB9D 1NO4A 3VN0A 4IGGA 3BCCG 1UIIA 2YEVA 3HJCA 3K6BA 4MS2A 2M5AB 4MVZA 1KC8Q 1L0LD 1SQXG 3WODF 1T5OA 2E75C 4C46A 2OTLP 3A3YB 1A0BA 3LLIA 2HR3A 3DZAA 2XXAA 3NTNA 4L6RA 1ZXGA 3L73J 3T6BA 4WGYA 2IBFA 5AVZB 3AJMA 3V7OA 2F22A 1GL2D 1R8EA 1W2BO 1QL1A 4YL0A 1Z3IX 4JPZB 1D1BA 2IXPA 3RGUA 4I2LC 3CCVP 1HWTC 1EDLA 4H44B 2XM0A 3DAFA 3ZVRA 2MWQA 1SP4A 1LTGC 4JIOA 1BDDA 1SQBG 2J5UA 2OARA 2H8PD 2R44A 2WT7A 1L0NE 4DRIB 3CCRP 1UIXA 1P84I 2BC5A 4E17A 4EUKB 1KILD 5KAIH 3HTKA 4U5HA 4IL6H 1MMGA 1KFMA 2HPCA 1FC2C 5T3TA 4I1LA 1GZLA 5KLIC 1N73B 3KXDA 5AW3B 2JJLA 1JMWA 1E86A 4PD4H 3U1CA 3SWYA 1FJPA 5EHHA 1CI6B 1V55C 3AQBA 5KYUB 1BE3J 1S7ZA 1E85A 1VQ4P 3RKOF 2YQYA 3NMIA 1SFCA 1OVVA 3V2PA 2J0WA 2B0JA 1GK4A 3RK3D 2CCYA 2AU5A 1E2XA 1SQXD 2CYDA 3ZQVA 4M3LA 1DIPA 1SLQA 2DGJA 2J9BA 1YTZI 2NPSB 2VH3A 1CGOA 2Y0DA 1PL5A 3DKAA 5AVTB 1Q82Q 3EZHA 5KYXA 1YQ3C 5CMZA 2Z15A 3NG1A 3JRTA 2WB7A 1LVKA 2YMKA 3AE1C 3EG9A 1GW3A 1LTJA 1B68A 3JSEO 4YWQA 2J9VA 1IW7F 1NTZK 2BCCG 2C9LY 1HE1A 3X2QC 2YL1A 1HMDA 3ITFA 1E83A 2R9RB 5AW4B 2JDIH 3L8JA 1M8OB 1RHZB 4IL6X 3IHUA 4IAOA 3C8GB 3CL3D 2J7PD 2WPQA 3OJAB 1AJYA 1ZMEC 2XLHA 4MTOA 4OH8B 1SQBD 3RBXA 1VOMA 1M1JA 4LACB 1QLED 3H32A 1DD4A 4DRHB 2WSEH 5L0IA 2P58A 3KKBA 3H1IJ 2B9BA 1MMDA 2NG1A 2Q3EA 3GM2A 1IJDB 2KS1A 5H2FE 2KSEA 3PHF2 1LT9A 4MW3A 3CCSP 4XEVA 1LP1B 1C03A 4BJ1A 3U9MA 1OXZA 2LFFA 1F1MA 1JCDA 3EFGA 4CDYA 4K7BA 4LGDE 1M2VB 3AE5C 5KJ7C 3CPWO 1OX3A 3W8IA 3CAXA 1Y4CA 4ULWA 1ZYRF 4KI2A 1LM3B 4WBAA 3AE2C 3B4SA 5AC4A 3VOPA 1BR2A 2E74D 3SXKA 3JRMO 5KLIB 3O6QA 4E7ZA 1KMIZ 1FAVA 2IPPA 2WSFH 1JY3O 2IDBA 2BCCD 2CNWA 3QW0A 1EKYA 1QPUA 2LIGA 2E76C 1MQVA 1ZVZA 1H9TA 2ZYGA 5AVUB 3P8CE 3CZ6A 3VM6A 2HJ3A 3AEBC 3NYJA 1VQKP 1EC5A 3JCUE 3DMDA 2I8DA 4M63A 5JVEA 1OVRA 3GHGA 2JWAA 2Q7RA 3E7KA 3CC4P 2Y0EA 1TFOB 1SQPG 1Q0DA 1AVYA 3HUSC 1MNEA 4U3FE 3L0IA 4RESB 4PJMA 1X9VA 4EYYQ 3EJNA 4MN4C 2P61A 1X22A 1KD1Q 1EDKA 3TYYA 2YNYA 3L37A 3K1IA 2XLEA 5GTIH 2XNDH 4JCZA 4NPFX 3H25A 5APVA 2W6AA 4PD4I 1TQGA 4CS7A 3HD7B 3BATA 4PJLA 2PFXA 3QVZA 1V54C 1VQPP 5JUAA 4LLCA 4Z9HA 2WTYA 3CSKA 4U5GA 3I5PA 4D6TD 5JP7A 2GWWA 3O10A 5F5HA 4DZOA 3L74J 1NOHA 5K0IA 1QKRA 4P6IC 3R4YA 2ZXWC 2E87A 2HG5D 3IQCA 3RFYA 1AV1A 1VLSA 1RKEB 3M79A 1SFCD 1FTSA 3M0AA 3I55P 3AEAC 3L73G 3AGUA 3CQZA 2ITAA 3VYWA 3FWLA 3KYJA 2XS8A 1GU5A 5JSLA 3L71J 4JZAA 3DE8A 1GL2C 3DWWA 1SQPD 1O87A 4Y99C 2PBEA 1D1CA 2WSSH 1ORJA 3MLGA 2HFIA 2L6GA 2HODA 4B6IA 2R7UA 3AG4C 3RK2D 4CIPA 1J8YF 1JAFA 5IY5C 4JTDB 1EI7A 2IXMA 1VTMP 1USEA 4LLEA 5AVQB 1XWJA 2E76B 1NVOA 3CXHH 2OYIA 1KU2A 3RW0A 2B0HA 4GKGA 1TWHA 1RF1A 2WQYC 5KYWA 1L0LJ 1SQQD 2PRRA 5AVXB 4AL0A 2K37A 2WVRA 2GFHA 3HUSB 2O1KA 2C04A 1YJWP 2R7XA 3US6A 4O6YA 3TGUE 1BDCA 2KOGA 3M06A 1RJ9B 4YPCA 2QE7H 2LXBA 1YARO 4RDAA 3C1LA 1L3PA 2QA4P 2YKOA 1ZR4A 4YN0B 1KORA 4E7SA 2JD3A 4YK5A 1LNQA 1KQGB 3L4FA 2A6EF 2KJGA 2ZVNB 3W68A 4BXLA 2CPBA 1NTME 2Q9AA 1R5SA 5CJ0A 2AXTH 3N4XA 3A0BH 3VMAA 3PP5A 1H9GA 3PLNA 3VMXA 3JTLO 1L0LK 4JQ0D 1QEXA 2CNWD 3MZWB 1KYOD 1HF9A 2K1AA 2Y3BA 3M4CA 2LKMA 2NUPA 3G3ZA 3AE7C 3FHDA 5JRAA 1IK9A 2MJZA 2FFHA 2KC3A 1GL2B 3G50A 3A0BE 4Y99B 1M6TA 3FXHA 3RL0C 2QJPC 3SXZA 1VPCA 4HYTB 3OW2O 2HZ8A 2HS5A 1YVIA 5B66H 3A11A 2R7RA 3F47A 5APSA 3AOUA 4XFJA 4ZNCA 1K05A 3SP1A 5EFWB 1AVOA 2YRFA 4WB4A 3CX5H 5APUA 2RKLA 1LWUC 2Q9BA 3PJSK 3MUDC 3V4QA 3KQGA 3HLZA 1GMJA 2V26A 1X8YA 5K5GB 3RIPA 2B87B 1SQBJ 5B5EE 4N6CA 5CCHA 2ZYAA 3D6YA 3H1KE 4EBKA 5B1BC 1JY2O 5T1DB 3AG1C 4NC3A 1PPJE 4NPDA 2ZXEB 3CX5E 2ASRA 1JTHA 1WOLA 3U1AA 2V7QJ 2E43A 2IOQA 1NU1D 1SQXK 1NAYA 2P0NA 2CW0F 1T01A 2D2CD 1ZP0C 2ZXRA 3H2UA 4YL1A 4Y28J 3EFFK 2Y69C 1VL2A 1XZQA 2A1DD 2LP4A 1NSGB 4PR9A 5AW6B 4ASWA 1P84D 3PHLA 1UFBA 3U8VA 4OIQF 3B71A 4OGQD 3EPVA 3KMIA 1KYOE 4OINF 2X51A 3LS1A 3AEEC 1G4WR 4KNWA 4MW8A 4RJTA 2M3EA 2K9JA 3E1RA 1ZHYA 4AK9A 2JO1A 4WWIA 1VQ6P 3AGTA 4TLFA 4JJFA 1NTZE 1SQBK 1XTGB 2PGDA 3AG3C 1BDJB 2BCCJ 3B0VC 3L74G 5AVSB 4EDFA 3LJBA 3EH1A 4ANJA 4L73A 1HMOA 2MHRA 4MTFA 3E9VA 3EZIA 4GQHA 3C8ZA 3NMDA 1IFMA 3GM3A 4U9DA 2KNHA 3RL0B 2KB7P 3S28A 1M7LA 3CI9A 5B1AC 4KHXA 3VP8A 1G2CA 3IR9A 2FYUE 2Y9YA 2HUJA 5APTA 3Q5SA 3ABMC 2QVAA 2QLAA 3ZSUA 3A0HH 3L71G 4WABA 3KHUA 1RQUA 2XU6A 4JURI 1FZAA 4N3YB 2E74B 2QSIA 4IWBA 2PF4E 1GDTA 2R02A 1E79H 3ITKA 2P67A 1OR3A 1H8AA 2XL6A 2GUVA 2GM4A 3S84A 4W7YA 1NU1E 2CGEA 1BCCE 4UDVA 2O01H 3WU2H 3DM5A 4BJ5A 3EHNA 1JO5A 1FDOA 3A0HE 5AW5B 3L70E 2IFNA 4D6TJ 4C7OA 1N1CA 3C62A 3A5TA 1S1CX 1YAUO 1WTYA 3FWNA 5TISE 4C7NA 1FJKA 3SXMA 3U2MA 4ULVA 2KSJA 2A45H 4H44C 2OG2A 3L75E 1FBMA 4QI0A 1WRGA 2J9UA 3HNKA 2O01N 4F4BA 1IZNB 4U5FE 2VRSA 1VQ8P 3WU2E 1YJNP 2OU6A 3O6XA 4CS9C 4U5BE 5L3VA 4KJMA 1AQTA 3CX5I 2WZ7A 3S0XA 1YZCA 1T3UA 1LT9C 3QTHA 4N6JA 5KLVE 4XEFA 1E5WA 5DQZA 1ZHWA 3EFOA 3OA7A 1S2EA 1L0ND 4U9EA 3ZDLA 1JOCA 3UGPA 3V5BA 3N24A 3AEDC 3K1HA 2R3SA 2AWCA 3D6ZA 4GYTA 3BRTB 3QMKA 3AE6C 3CMAP 5CJ4A 1KFNA 1N2DC 4DJ9A 4B86A 2BE5F 4JE9A 3USSA 2IBZE 2PFDA 3AG2C 5AC5A 4R32A 3DD7A 4AUWA 2K88A 1FE6A 1T2KC 2KLVA 3B0PA 1SQQJ 5CCHD 3T6JA
chains in the Genus database with same CATH topology
3K7DA 2E76D 4OGQC 1R8EA 4RKUJ 3Q2YA 1JB0J 4XEVA 2ZT9B 3D70A 3L8IA 3Q3DA 4PV1D 3EWKA 3D71A 2QJPC 2L6FA 1IK7A 2OQQA 1K04A 3AEFC 3RL0g 3Q5SA 4XEKA 3AE5C 2ZT9C 3RQFA 4I7ZB 3AEGC 4H44D 2PBEA 4H44B 2QJKC 1OW7A 1RQUA 2QIWA 2YIUC 2L6GA 4KT0J 4XFJA 4Z1MH 2HSBA 2FXPA 3AE2C 1MKMA 1VF5D 2J5UA 2G8YA 4I7ZC 2P10A 3TULA 3GF3A 2NZ2A 1EXJA 2E74D 3FGAD 1K05A 2E74B 2QSIA 2WSEJ 3T97B 1UIXA 4EBJA 1DD3A 3O6QA 1KMIZ 3AE3C 1HJ0A 2E76B 3GLMA 4R4LA 1U57A 2IDBA 3Q1MA 2FYNC 4PV1B 5KLIC 3JYYA 2MKVA 2E76C 1O3UA 3MFNA 2BEQD 1GMJA 1NGMB 3BRJA 2WQYC 1FDOA 3RQEA 3AEBC 4PV1C 3AE8C 1RQVA 2JPUA 1V4AA 2WPVB 3SFDC 1S1CX 3D6YA 1WTYA 1Q90D 3JZ0A 4EBKA 1VF5B 4H44C 3SFEC 5KKZC 1KTMA 3Q5RA 5M1BA 1KQFB 1DIPA 1WOLA 2V7QJ 3C8GD 1VF5C 3AE4C 4H13D 2E74C 1PL5A 1YQ4C 2JP3A 2E75D 2E75B 1OMIA 4H13B 2JX0A 2D2CD 1PIXA 1YQ3C 1ZP0C 3G9RA 3GF7A 4Y28J 1VL2A 2Q00A 1KNYA 1ZZPA 1FDIA 2YMKA 3AE1C 1TU3F 2WSFJ 2O01J 4H0LD 4GDOA 3ABVC 2QJYC 1UFBA 1KORA 3AECC 4XEFA 2KK1A 3B71A 4OGQD 5F28E 1QVXA 3GM1A 4U7JA 1KQGB 3GMAA 3H25A 3AEEC 4R4MA 3U0CA 1OW8A 3C18A 2H89C 1KILE 1NYHA 3L8JA 1Y9BA 4TT3H 1EXIA 3AEDC 4IL6X 2ZT9D 1JOGA 3D6ZA 3C8GB 5L8RJ 2JO1A 1OW6A 1WWPA 1AJYA 1ZMEC 3AE6C 2H88C 1ZRTE 2YWAA 1K40A 4YTPC 3IN6A 3O10A 2D2CB 4YXDC 2BEZF 1S5LX 3S9OA 1PV3A 2K9YA 4H13C 1DD4A 2E75C 2WSCJ 2D2CC 2FBWC 3R4YA 3C8VA 4H0LB 3RQGA 4R32A 3Q5PA 1HF9A 3U3FA 3LW5J 2G3AA 3IAOA 4OGQB 4NQFA 1WMKA 3RK3E 3GM2A 3C8GA 2L6HA 4H0LC 3AE7C 3GM3A 2LK4A 1ZOYC 3AE9C 3AEAC 3AJMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K7D A;  4XEV A;  3L8I A;  2L6F A;  3AEF C;  1K04 A;  4XEK A;  3AE5 C;  3RQF A;  3AEG C;  2PBE A;  1OW7 A;  2L6G A;  2HSB A;  3AE2 C;  3TUL A;  1K05 A;  4EBJ A;  3AE3 C;  3JYY A;  1O3U A;  3MFN A;  3BRJ A;  2WQY C;  3RQE A;  3AEB C;  3AE8 C;  2JPU A;  1V4A A;  3SFD C;  1WTY A;  3JZ0 A;  4EBK A;  3SFE C;  1KTM A;  1WOL A;  3C8G D;  3AE4 C;  1YQ4 C;  2JX0 A;  1YQ3 C;  1ZP0 C;  2Q00 A;  1KNY A;  1ZZP A;  3AE1 C;  3ABV C;  1UFB A;  4XEF A;  3AEC C;  2KK1 A;  3B71 A;  5F28 E;  1QVX A;  3GM1 A;  3AEE C;  3U0C A;  1OW8 A;  3C18 A;  2H89 C;  3L8J A;  3AED C;  1JOG A;  3C8G B;  1WWP A;  1OW6 A;  3AE6 C;  2H88 C;  2YWA A;  1K40 A;  4YTP C;  3O10 A;  4YXD C;  3S9O A;  1PV3 A;  2FBW C;  3RQG A;  4R32 A;  3U3F A;  2G3A A;  4NQF A;  3GM2 A;  3C8G A;  2L6H A;  3AE7 C;  3GM3 A;  2LK4 A;  1ZOY C;  3AE9 C;  3AEA C;  3AJM A; 
#chains in the Genus database with same CATH topology
 2OYH C;  1DH3 A;  2KZI A;  1WAT A;  4YT8 A;  1ZW2 A;  3V4W A;  2PX0 A;  2Q1K A;  2VAS A;  1VK5 A;  3AEF C;  4RD9 A;  1OZH A;  2W6B A;  4PD4 D;  5KYX B;  3TOL A;  3S4R A;  2QJK C;  1NU7 D;  5KYY B;  4XLN F;  2ZFC A;  1SQP K;  1ST6 A;  1N8R Q;  3K66 A;  4YT4 A;  2OTJ P;  1IFP A;  3EG9 B;  1EQ1 A;  1CSB A;  1GM5 A;  3TUL A;  1JY3 P;  3GF3 A;  4L75 A;  3MTU E;  3V5Y A;  3K1I C;  3LIE A;  2M4E A;  3LS0 A;  3A7O A;  3B5N C;  3RF3 A;  3MHV A;  3SEO A;  3CCL P;  1U57 A;  1BSH A;  5CBN A;  3OAK A;  3V5X A;  3WMM 0;  1YYX A;  3EH2 A;  1JPJ A;  1HH0 A;  4BRY A;  4Z9I A;  4U3F G;  3M9H A;  2DI3 A;  2C0X A;  3H32 B;  1LIH A;  4U5C E;  2R7T A;  1Q7Y Q;  4IAQ A;  3MX3 A;  1QVF O;  5KAF H;  3POV A;  1M90 Q;  1CPR A;  4D4N A;  4EIY A;  5AVR B;  3QWO C;  5DVW A;  3AE4 C;  2KS1 B;  4H13 D;  4HJG H;  5CCG C;  2JX0 A;  2YKZ A;  2WVQ A;  3KPH A;  1LT9 B;  3GF7 A;  3ATP A;  4G7H F;  3JSZ A;  4MND A;  5HV9 A;  2Q7C A;  3FXD A;  5F5F A;  1ZU4 A;  4GDO A;  1OCC C;  1V74 B;  4I3M A;  5APY A;  4C3D A;  4DCK A;  1KB9 H;  2EPN A;  5KAF E;  1FS0 E;  3VYI A;  5L0J A;  1Q2N A;  2DB4 A;  3V2N A;  1JY2 N;  3GOD A;  1T6A A;  3HNL A;  2J58 A;  2ZXP A;  3M15 A;  4E0I A;  5KAI E;  4N78 D;  1VDF A;  3HKK A;  4IL6 E;  2A68 F;  2SPZ A;  3G4Z A;  1RKC A;  1PP9 E;  4YTP C;  3IN6 A;  2ZPA A;  4YT2 A;  4J30 B;  3HE4 A;  4J7Y A;  1M57 C;  2JR8 A;  1WGW A;  3S9O A;  1J2J B;  2LD6 A;  4CBE A;  3P8C D;  3MYF A;  1PV3 A;  4PD4 E;  1A02 J;  1OKK A;  2WSC J;  2FYU J;  2H7O A;  3TOM A;  1PGJ A;  2OYI C;  1VQN P;  2XL8 A;  2YO2 A;  4GIF A;  1JRA A;  3LW5 J;  4JF7 A;  2M5A A;  2OYH B;  1MUU A;  4EI2 A;  2L6H A;  3S27 A;  3GG2 A;  3GEI A;  1RF1 C;  4JTA B;  5B3I A;  2IBZ I;  1PGQ A;  3E70 C;  5DLJ A;  4CS8 A;  3M0D A;  3R7C A;  3Q7G A;  1JB0 J;  4U3F D;  2IYP A;  3L8I A;  3Q3D A;  4PV1 D;  3HD7 C;  4HEA J;  2QJK B;  4IFD K;  1A41 A;  2YL7 A;  1K04 A;  1RE3 A;  5A6B A;  1NU1 J;  2XS1 A;  3JC2 2;  1BGY D;  2EPL X;  2RH0 A;  1Z23 A;  4DRJ B;  1VF5 D;  2N1T C;  3L70 J;  3B5N B;  4DBR A;  3CWB E;  1T8Z A;  3M9B A;  1L4A A;  4XE5 B;  1RE4 C;  3LES A;  1DD3 A;  2YZS A;  3PH0 A;  5E3A A;  2QTV A;  5L0F A;  3JYY A;  2KGO A;  3K33 A;  1NGM B;  3EQ2 A;  4BEM J;  2NUT A;  3TGU G;  5A6A A;  1YIJ P;  3IQ5 A;  1LI5 A;  3V6I A;  1URQ C;  4UB6 H;  2W6J H;  3U59 A;  4D6T G;  2D5R B;  5KLV J;  3TK0 A;  2IXN A;  4CIH A;  3Q5R A;  3LNR A;  2L7A A;  4ZMD A;  1N73 A;  1BBH A;  3W2V A;  4N78 E;  2FFD A;  1CI6 A;  5KYU A;  5APQ A;  1N7S C;  1NTM G;  1VQM P;  1KNY A;  4BJ6 A;  2Y9Z A;  1QSP A;  2QM8 A;  4H0L D;  2P6V A;  3ABV C;  2W9Y A;  4UB6 E;  2KK7 A;  3TF5 A;  4LDR A;  3GMA A;  2L91 A;  2H7V C;  2NPS A;  3A9C A;  4MQ9 F;  4Q5S F;  2XKM A;  1HW2 A;  2HYN A;  2Y3H A;  4EKW A;  1NH4 A;  2HOD B;  2ZT9 D;  1NJI Q;  2LQG A;  5COM A;  2H7H A;  2ZYD A;  2YWA A;  2X0C A;  2OEX A;  5L0C A;  2OYI B;  1YZA A;  1LTB C;  1BGY E;  2OOC A;  2ZAE B;  5A6K A;  5E79 H;  3H1J E;  1RF1 B;  4BWN A;  3F89 A;  2AEM A;  2EPM X;  3ECS A;  3G4S P;  5KYW B;  5AW2 B;  1HTL C;  3C8G A;  2J0X A;  4BPM A;  4QMA A;  3TNU B;  2LK4 A;  1YTZ T;  1H0T B;  3EHM A;  4FAP B;  3TGU D;  2KNC B;  1SQQ G;  2I15 A;  3D70 A;  3H1L D;  2JWD A;  4YJW A;  3EWK A;  1VMA A;  2WZG A;  2OJQ A;  2YL3 A;  5JT4 A;  2IM8 A;  3EGD B;  4WY4 D;  4DT0 A;  1HGV A;  2N1T B;  2FXM A;  3EGX A;  1QGK B;  5E79 E;  5GTI E;  3GOR A;  1NTK E;  1LE4 A;  3T9O A;  3TK1 A;  2G8Y A;  2L5G B;  3DJN B;  2KP8 A;  1LP1 A;  1DOV A;  2RN0 A;  1NTM D;  1M2O A;  3CC7 P;  2TMV P;  1M2V A;  1RXQ A;  1SYQ A;  3UR3 C;  1L0N J;  1MMA A;  3H1K G;  4JYC A;  5AVW B;  3GWN A;  4K1O A;  4IFM A;  1JY2 P;  1URQ B;  4HE8 D;  1PPJ G;  2O1J A;  2W8Z A;  4I1M A;  3W2W A;  3RQE A;  4JJG A;  2PNO A;  4HKZ H;  4JW1 A;  3ABL C;  1OKK D;  2IZ0 A;  1D1A A;  3KH2 A;  2Y3G A;  2B89 A;  4FES A;  5KYN A;  1KTM A;  1Q86 Q;  2NUP B;  1N7S B;  4PK4 A;  5L0G A;  5DQT A;  4WGZ A;  3GW6 A;  1MV8 A;  4I1O B;  1SQV E;  2KIK A;  3G9R A;  1BSN A;  4IOI H;  1KIL C;  2CK3 H;  3MP7 B;  3LNM B;  3VTP C;  1ZHX A;  2QJY C;  1MND A;  5A6B D;  2KK1 A;  1VQ7 P;  1IFI A;  1OFC X;  1X79 B;  2A6H F;  4GOD A;  4DOZ A;  2QG4 A;  2BL2 A;  1NTZ G;  3W4Y A;  1LTT C;  2AXC A;  1EA8 A;  3IEE A;  1NYH A;  1N7L A;  1JEK A;  3I5C A;  1M56 D;  3RK3 C;  1L4A D;  3H1L E;  3CXH E;  2H88 C;  3C9I A;  1S5L X;  1PGO A;  1NFN A;  2K9Y A;  3UIA A;  4MVQ A;  4AQR D;  2OJE D;  3RQG A;  1CPQ A;  3H1K D;  2GDC A;  4N06 A;  2FYU G;  3SNH A;  1RH5 B;  1IC2 A;  1PPJ D;  5AW7 B;  4PFP A;  3CX5 D;  1HGZ A;  2OQM A;  3Q2Y A;  3CWB J;  4HFF B;  2Q3I A;  1JTH B;  2ZVO B;  2QUP A;  3O39 A;  3T4R A;  4CSA A;  2WVO A;  3BAS A;  3RQF A;  2NSF A;  2J59 M;  3PTZ A;  1NU1 G;  3W67 A;  1Y47 A;  2YKP A;  4Z1M H;  3ASN C;  2LSE A;  5BUO A;  4CJG A;  1OWA A;  4C7R A;  1FDM A;  1QLE C;  1EXJ A;  2WSE J;  5KJ7 A;  5EGY A;  2W4B A;  3SZR A;  3L70 G;  2NPS D;  1LTI C;  5EK0 A;  2AXT E;  3WG7 C;  1HUC A;  4PJJ A;  2POH A;  1HVV A;  3RYL A;  5JS5 A;  4K35 A;  1O3U A;  2K9J B;  2EIN C;  1NTZ D;  5CHX A;  1YI2 P;  3KYI A;  4NTA A;  3M9Q A;  2YMY A;  3S90 A;  3GWL A;  2HJM A;  2YKQ A;  3K5B A;  1JPN A;  1Q0F A;  5L0D A;  3SFD C;  3JZ0 A;  2XZR A;  3IFM A;  4QI2 A;  1Q81 Q;  5KKZ C;  1KIL B;  3NFQ A;  3C8G D;  5HSW A;  5KLV G;  1YHQ P;  3U5S A;  2E74 C;  4H13 B;  2E75 D;  1OMI A;  1L7C A;  1S9K D;  4GOF A;  4QDL A;  4H54 A;  3H6P A;  2FYU D;  2QJY B;  3KZI H;  2P1J A;  4U3F J;  3VRC A;  4JC7 A;  2O9X A;  1SVF A;  2WSF J;  3V2R A;  1G2C B;  1LKX A;  1WAS A;  5B66 E;  4W8P A;  1RMV A;  2GAQ A;  2NRG A;  1SZI A;  3GM1 A;  1OXB A;  5BQI A;  2FXO A;  3ZTZ A;  1BGY J;  1VQL P;  3H1J J;  3RK3 B;  3DE9 A;  1D0Z A;  1RJ9 A;  4PJ0 H;  2HKV A;  3WAQ A;  1FR0 A;  2IBZ G;  1GD2 E;  1BCC D;  2R7Q A;  4E18 A;  1J1E C;  1ZRT E;  1DEB A;  2UWJ E;  1IFN A;  4LC1 A;  3H1H D;  1NLX A;  5CI9 A;  3L73 E;  3HNJ A;  4JYB A;  3L70 D;  2ZD9 A;  2ICW G;  4P9F A;  3CXH I;  4MVR A;  4AE4 B;  1PD1 A;  4C7O B;  3KPE A;  3L36 A;  4O6M A;  5COG A;  1NTK J;  1ZOY C;  3L75 D;  2H8A A;  3JCU Q;  3ZC4 A;  4PJ0 E;  3G71 P;  2KI7 B;  3R2P A;  3FAJ A;  2Z5I A;  1GK6 A;  2H7B A;  4O6N A;  3CD6 P;  4AYC A;  2R5B A;  5E2Q A;  2YLG A;  3UMI A;  1Z63 A;  4MVM A;  1R5L A;  1VQ9 P;  1OW7 A;  1IFJ A;  2YIU C;  5KLV D;  2HMZ A;  3HTK C;  2HSB A;  2KLU A;  3LID A;  1MKM A;  3BVH A;  2IYL D;  3FGA D;  2A06 E;  2IFM A;  2KXP B;  1TWA A;  4W7Z A;  1VYK A;  2P7J A;  1YIT P;  3RBZ A;  2G62 A;  4XPY A;  4P9T A;  3N7N A;  3MGN A;  2J46 A;  1SFC C;  2QE9 A;  1BE3 E;  4ONS A;  1S9K E;  2QY9 A;  3U9J A;  2WZF A;  3LW5 H;  1L0N G;  3MFN A;  1FZB A;  1Z6A A;  2G3V A;  3HE5 A;  1SQV J;  4EIJ A;  1FMW A;  2IBZ D;  5KKZ B;  1AQ5 A;  1AFO A;  1JM0 A;  1T3J A;  4A2N B;  4OIO F;  2Z5H A;  1SF8 A;  3UGO A;  1MFZ A;  3II6 A;  3UMH A;  3L1M A;  1KQF B;  2OGU A;  1LTJ C;  2WMM A;  3O8Z A;  1FNT c;  3RK2 C;  1YQ4 C;  2R3C A;  4CPG A;  3TGU J;  4E0H A;  4EWC A;  3P7K A;  3KL4 A;  3H1L J;  3H1H E;  4I6M C;  1OCZ C;  2AEF A;  1NWQ A;  3M0D C;  1YJG A;  3T97 A;  1PP9 G;  4U7J A;  1ZR2 A;  1S05 A;  1KZU B;  1JCC A;  4Z9J A;  1M1J C;  3CCU P;  1J1E B;  2XXA B;  1Y9B A;  4TT3 H;  5KJ7 D;  2RMZ A;  5L8R J;  2A0U A;  5GTH H;  1NTM J;  1M1K Q;  3H1I E;  2I1J A;  2E42 A;  2KSF A;  1L4A C;  1YYC A;  3V2Q A;  3LUT B;  1OIP A;  4NTB A;  5B3S C;  4OVN F;  1HY5 A;  3CCM P;  3Q5P A;  3G6E P;  3U3F A;  3L72 D;  2HLO A;  1U7M A;  4BRY B;  1RF0 A;  2W45 A;  4JEB A;  2XLV A;  1NKZ B;  3AE9 C;  2E76 D;  1LTA C;  4WVZ A;  2WT7 B;  4HFK B;  3QW1 A;  1FMV A;  3L35 A;  1PFI A;  1LS4 A;  3RH3 A;  3AQC A;  1LTS C;  3ZG1 A;  4A7P A;  1QQ3 A;  2EPO A;  2YIU B;  3CWB G;  2VCC A;  4XEK A;  2YXQ B;  1GS9 A;  3HTK B;  3FDQ A;  2MYS A;  5D91 A;  2R25 A;  2HPC B;  1H6G A;  1QZX A;  2FY8 A;  2FFD C;  5KTB A;  2LCH A;  1VYI A;  2W4M A;  1K8A Q;  4ZLC A;  1GU4 A;  1SFC B;  3VAY A;  3WUU A;  2JKV A;  1VQ5 P;  2C03 A;  2WZL A;  2B88 A;  1PP9 D;  2MKV A;  3GHG C;  3TDK A;  4NCQ A;  2BEQ D;  1AEP A;  1IFD A;  4X0R A;  4CX9 A;  4ER9 A;  5FCL A;  1LWU A;  1APC A;  3AE8 C;  4NPE A;  1G8X A;  3QVY A;  3MUD A;  3DI5 A;  4CDA A;  1IO4 A;  5DS6 A;  4G7Z F;  1LTJ B;  1JMB A;  4GT1 A;  3RK2 B;  2NPU A;  3S29 A;  5AW8 B;  3ASO C;  2GA0 A;  3PMR A;  1A02 F;  3W8H A;  3JT1 A;  2XLW A;  2DYR C;  3CEX A;  3H1K J;  4UB8 H;  3Q6N A;  3FOO A;  2VCA A;  4G78 A;  3PRJ A;  1ZZP A;  1ZHZ A;  2RSE B;  1FDI A;  3FOP A;  4U5E E;  1PZQ A;  4O79 A;  1M1J B;  4JEA A;  1QVX A;  2ETS A;  4I44 A;  1S4X A;  1SQQ K;  5BQG A;  3L72 E;  2YLI A;  3CWB D;  2HFE D;  4R4M A;  3U0C A;  1OW8 A;  2H89 C;  4G7O F;  3L74 E;  4UB8 E;  1BGY G;  2R7S A;  3H1J G;  2Q9I A;  4XQ1 A;  1WWP A;  4LER A;  1L4A B;  4WY4 A;  1FZC A;  3GAN A;  1WT6 A;  4YXD C;  3LAY A;  5A6J A;  1DEE G;  2Y39 A;  2D2C C;  4EHP A;  2ZJS E;  1HE9 A;  3G4X A;  2NUT B;  1NTZ J;  2W83 C;  3CCQ P;  2XRH A;  2WWW A;  3L71 E;  1KN7 A;  3K7D A;  4OGQ C;  4MVO A;  1T9K A;  1NTK G;  1XZP A;  1O5H A;  3O6Q B;  2A45 I;  4A4A A;  4JRZ A;  3Q7L A;  1EZV E;  3BCC D;  2FFD B;  2EIL C;  2DYS C;  3RVY A;  1AA0 A;  2IXO A;  2QM7 A;  5TJ5 E;  4I7Z C;  1Q0K A;  1ZU5 A;  5APX A;  1G4U S;  2DW3 A;  1NAF A;  1KB9 E;  2FGY A;  1K73 Q;  3HRN A;  1T6U A;  4IB4 A;  4WJ0 A;  3GHG B;  3CCJ P;  1HJ0 A;  2XSE A;  1HW1 A;  1CW5 A;  1EDJ A;  3SWF A;  1FOS F;  4R4L A;  1FFH A;  3LEV A;  3NKE A;  4DXW A;  1L0L E;  5DJT B;  3S1K A;  5KYY A;  3SXY A;  2J8W A;  2OTK E;  3BRJ A;  5CIV A;  1BCC J;  5BU5 A;  2KQ9 A;  4YT5 A;  3H1J D;  2JPU A;  1V4A A;  2WPV B;  3H1H J;  1SQV G;  2R7O A;  5CI8 A;  2OEV A;  5H2F H;  4HB1 A;  3PDM P;  1GGQ A;  3U8P A;  4LDQ A;  2E75 B;  3L75 J;  1PIX A;  1ZN5 A;  3I5Q A;  3NYL A;  5AW1 B;  4MTG A;  2EPK X;  2WL8 A;  1S72 P;  4J32 B;  1TU3 F;  2FYU K;  1BR1 A;  2O01 J;  1FU1 A;  3PCV A;  1NTK D;  3H1L G;  4CS9 A;  3VP9 A;  3EGX B;  3ZIB A;  4CSA C;  3B0U X;  2M64 A;  3C18 A;  5AVV B;  3RL0 D;  1KIL E;  1U89 A;  3IQT A;  4KNV A;  2AWY A;  1Z56 A;  1NZE A;  1EXI A;  4RBN A;  3B9Q A;  3O55 A;  5A69 A;  2D2C B;  1NU1 K;  2BEZ F;  1TKN A;  3LLK A;  3CLQ A;  3BCC E;  4MVU A;  3DJU B;  5DS4 A;  3JCU H;  3C8V A;  2HV6 A;  4EOT A;  1D0Y A;  1JR8 A;  1USD A;  2A0B A;  4OGQ B;  1WMK A;  3P32 A;  3RK3 E;  2M0B A;  3WUT A;  1LE2 A;  3NDB B;  1OCR C;  2PX3 A;  1SQX E;  1N86 A;  1ZHT A;  4RKU J;  3F5H A;  1Y8A A;  3B8E B;  1SQV D;  2PP4 A;  1IZM A;  4JVS A;  1NBB A;  4I7Z B;  1H7I A;  1LI7 A;  2OYH A;  3RVZ A;  2OCC C;  1VQO P;  1R5I D;  2QIW A;  1Q0M A;  4KT0 J;  1T6Q A;  2FAP B;  2FXP A;  2V7Q H;  5AW9 B;  5KLV K;  2L9J A;  4XLP F;  1EZV I;  1LJ2 A;  1OVU A;  3TSI A;  4W8K A;  3I4U A;  1Y6D A;  3DAG A;  1QX8 A;  1KQS O;  1EDI A;  2J45 A;  5CCH C;  3CXH D;  1NHL A;  1SQB E;  3Q1M A;  1KB9 I;  1OCO C;  2C0W A;  5AW0 B;  4HH2 A;  3FVY A;  1OXK A;  2K3R A;  3B5N A;  1J8M F;  4AX2 A;  4YL3 A;  4L74 A;  2BAS A;  5FZT A;  1AUE A;  4O9B A;  5L0H A;  3WUV A;  1TWC A;  1YYJ A;  5DS5 A;  3L72 J;  2FYZ A;  2VB6 A;  2KW3 C;  2AP3 A;  2OKU A;  2KYH A;  2Q00 A;  3OA1 A;  1ORY A;  1WN0 A;  1S5L H;  1PGP A;  4N4W A;  1NKN A;  1U7J A;  5CCG A;  2EIJ C;  1Z7Q c;  3VF0 A;  2R7V A;  5F28 E;  3MD0 A;  2R7W A;  3GEE A;  3NKD A;  1KQL A;  2M3B A;  2OYO A;  1GW4 A;  2PP6 A;  2NSG A;  4OD4 A;  3TQO A;  4KBL A;  2N9Y B;  3VMY A;  1D0X A;  2GA1 A;  2BCC E;  4NTF A;  4FWV A;  1LPE A;  4PAC A;  4N6H A;  4ASV A;  1L2P A;  1I4Y A;  4XA4 A;  1C02 A;  1S5L E;  4H13 C;  2YLD A;  1PP9 J;  3I56 P;  2C9N Y;  1YDI A;  2ZXX A;  1FZE A;  3M91 A;  2EIK C;  2XM4 A;  4FX5 A;  1FZG A;  2XL4 A;  2WPR A;  1C17 M;  4NQF A;  1MZ9 A;  3SWK A;  2LFD A;  3IQ6 A;  1L0N K;  1PCX A;  1R4T A;  3DXJ F;  3UMK A;  1AVO B;  3D71 A;  2XLM A;  3WHN A;  1W2E A;  1IK7 A;  4Q4Z F;  2R32 A;  3RL0 g;  3ZQY A;  2A06 G;  4H44 D;  3H65 A;  1HBW A;  5DJU B;  3TNU A;  3C7J A;  3HD7 A;  1H0T A;  1Z5Z A;  2KNC A;  1BE3 G;  2H43 A;  1ZW3 A;  2P10 A;  2HMQ A;  2NZ2 A;  1CGM E;  4BJ5 C;  2WIT A;  5BU8 B;  2R5D A;  3EGD A;  2KUB A;  4ZLD A;  1U0B B;  2N1T A;  5E3C A;  3UNG C;  5BVZ A;  4D6T E;  1ZRT D;  2YVK A;  1RE4 A;  1SMY F;  3L73 D;  4PV1 C;  1GTW A;  1NFO A;  3CME P;  1RKE A;  1VLT A;  2Z4E A;  1BCC G;  1JNM A;  1Q90 D;  4XPX A;  3U2L A;  2P1A A;  4J7T A;  2LR2 A;  4KC9 A;  3H1H G;  5T3W A;  1JMM A;  1VF5 C;  3GEH A;  1URQ A;  3OEO A;  3TJ5 A;  3KDP B;  2UUI A;  1RF0 C;  2D4U A;  1SQP E;  1T2K D;  1U6H A;  3L75 G;  4ZKU A;  2XNX A;  1YBK A;  4C3E A;  4CDV A;  2YHS A;  3BCC J;  1OR2 A;  1N7S A;  1HJB A;  1E84 A;  2W90 A;  2J9W A;  3B29 A;  2VCB A;  4RO0 A;  2XDJ A;  3H1I G;  2CPS A;  3NMK A;  5APW A;  2A06 D;  1FFT C;  1I4Z A;  5C39 A;  3BRV B;  1G5Z A;  1OW6 A;  1SQX J;  4AL1 A;  4OIP F;  1K40 A;  5COF A;  1BE3 D;  3NYM A;  3U3B A;  2L81 A;  1YA9 A;  3FMS A;  2A45 G;  4D4X A;  3HUS A;  5B5E H;  2G3K A;  1SQQ E;  4NY3 A;  2Q6Q A;  1MFT A;  3HNI A;  3HE5 B;  2G3A A;  3B5N D;  3IAO A;  3T6G B;  1X0T A;  1GQA A;  2I8B A;  4H0L C;  2FKW B;  2GUS A;  3MYI A;  256B A;  4BEJ A;  4IFF A;  3L34 A;  5JLI A;  2WVN A;  5GPG B;  4OD5 A;  1TWG A;  1PD0 A;  1J1D C;  2OQQ A;  2N9B A;  4PJN A;  3MIW A;  2ZT9 C;  3KZI E;  4CJO A;  3AEG C;  3LEO A;  4IJJ A;  2R03 A;  4H4K C;  1KYO H;  3JYH A;  2AEJ A;  4IRU A;  1NU9 C;  3NMJ A;  5CCG D;  2YL0 A;  3CCE P;  1A7D A;  3T97 B;  5AGF A;  1YLM A;  4EBJ A;  4C7N B;  4EBB A;  2O3J A;  4LDK A;  3GLM A;  3CC2 P;  3OWT A;  4L76 A;  2E5Y A;  1BZ4 A;  2Q3T A;  2FYN C;  4PV1 B;  2IYO A;  1JY3 N;  3H1I D;  1CGN A;  1K9M Q;  4U5D E;  1JUN A;  2M8R A;  2QEX P;  1ZV8 A;  1RQV A;  3KYQ A;  4PFO A;  1LT1 A;  1OQC A;  4WY4 C;  1H88 A;  1FZC C;  2HSQ A;  2AVK A;  1VF5 B;  2Q9C A;  1ORS C;  3SSU A;  4BG0 A;  1GL2 A;  1YA7 O;  2ZXO A;  2QRX A;  5M1B A;  5BQH A;  2I1K A;  1NG1 A;  3EFO B;  4G0H A;  1M57 D;  1S3J A;  4LLH A;  3QH9 A;  4DOJ A;  1RY3 A;  1H89 A;  3BEH A;  2JP3 A;  2WSC H;  3X1O A;  3L72 G;  4JCH A;  3DM9 B;  1G1J A;  4YXW H;  1ZLL A;  3JSV C;  2P7V A;  4OWF A;  1XTC C;  3NXS A;  2EIM C;  1KIL A;  2A69 F;  4GEH A;  2Q4F A;  5TJH A;  1NTK K;  1RCP A;  1T6I A;  3HD7 D;  4W80 A;  3Q6M A;  4JKV A;  5E33 A;  1SR2 A;  2QJP B;  4Q7C A;  4XPW A;  1JOG A;  1W2W A;  4XTK A;  2YO3 A;  3EQL F;  4ZKP A;  2Y0C A;  3TJ6 A;  3C63 A;  2IZ1 A;  3VMZ A;  2B87 A;  1EQ7 A;  4XWJ A;  2JEE A;  2WPS A;  2N1T D;  1MMN A;  4MVS A;  2YXR B;  1P84 H;  2V4H A;  2FBW C;  4CS8 C;  2PAJ A;  4H0L B;  1DOW A;  1TR2 A;  5TIS H;  2W27 A;  2E5T A;  1LWU B;  3SYN A;  1QVG O;  2KZJ A;  1SS1 A;  1G1I A;  1EZV G;  1RE3 C;  1LS1 A;  3QZC A;  3FX0 A;  1CZQ A;  2HV7 A;  5D92 A;  1J1D B;  5L3Q A;  1D7M A;  3J06 A;  2Q5U A;  2ZT9 B;  1A7E A;  4K0D A;  2L6F A;  1URQ D;  1DX7 A;  4JTC B;  4C3B A;  1FZF A;  4AE4 A;  1SQV K;  3ABK C;  1M56 C;  1P84 E;  2UUH A;  3ZTM A;  3TD7 A;  2KYV A;  1LGH B;  1L0L G;  4OIR F;  3E1I A;  3FAP B;  4O7G A;  5AVY B;  3M4B A;  2J7P A;  4K3A A;  1N7S D;  2FYN B;  3MBG A;  3AE3 C;  3L74 D;  3IPM O;  2P2U A;  3NRH A;  4DBQ A;  1Q0G A;  2R05 A;  3V5Z A;  2XLO A;  1UG7 A;  5GTH E;  2XLD A;  2Y3D A;  1A7V A;  3ZWI A;  4WY4 B;  1FZC B;  1FAP B;  1W5C E;  2CDQ A;  3M1C B;  1N73 C;  1VB5 A;  2QNL A;  1SQP J;  4DVY P;  3ZDM A;  3SFE C;  1YJ9 P;  3L71 D;  3H2V A;  1I5N A;  3N0T A;  4BJ6 C;  3P8M C;  2VC9 A;  4DVZ A;  1KYO I;  2V3C C;  1ZW0 A;  2IX7 C;  4DJG A;  1NTM K;  3A2A A;  3FXE A;  3IF4 A;  1KV4 A;  3F46 A;  2LXC B;  2XV5 A;  2NPS C;  5CBO A;  2RD9 A;  1EZV D;  3N2Z B;  1FOS E;  1TFK B;  4IAR A;  3HE4 B;  3AEC C;  4GOE A;  1BR4 A;  4JBZ A;  4BJT A;  1QL2 A;  1KB9 D;  1NO4 A;  3VN0 A;  4IGG A;  3BCC G;  1UII A;  2YEV A;  3HJC A;  3K6B A;  4MS2 A;  2M5A B;  4MVZ A;  1KC8 Q;  1L0L D;  1SQX G;  3WOD F;  1T5O A;  2E75 C;  4C46 A;  2OTL P;  3A3Y B;  1A0B A;  3LLI A;  2HR3 A;  3DZA A;  2XXA A;  3NTN A;  4L6R A;  1ZXG A;  3L73 J;  3T6B A;  4WGY A;  2IBF A;  5AVZ B;  3AJM A;  3V7O A;  2F22 A;  1GL2 D;  1R8E A;  1W2B O;  1QL1 A;  4YL0 A;  1Z3I X;  4JPZ B;  1D1B A;  2IXP A;  3RGU A;  4I2L C;  3CCV P;  1HWT C;  1EDL A;  4H44 B;  2XM0 A;  3DAF A;  3ZVR A;  2MWQ A;  1SP4 A;  1LTG C;  4JIO A;  1BDD A;  1SQB G;  2J5U A;  2OAR A;  2H8P D;  2R44 A;  2WT7 A;  1L0N E;  4DRI B;  3CCR P;  1UIX A;  1P84 I;  2BC5 A;  4E17 A;  4EUK B;  1KIL D;  5KAI H;  3HTK A;  4U5H A;  4IL6 H;  1MMG A;  1KFM A;  2HPC A;  1FC2 C;  5T3T A;  4I1L A;  1GZL A;  5KLI C;  1N73 B;  3KXD A;  5AW3 B;  2JJL A;  1JMW A;  1E86 A;  4PD4 H;  3U1C A;  3SWY A;  1FJP A;  5EHH A;  1CI6 B;  1V55 C;  3AQB A;  5KYU B;  1BE3 J;  1S7Z A;  1E85 A;  1VQ4 P;  3RKO F;  2YQY A;  3NMI A;  1SFC A;  1OVV A;  3V2P A;  2J0W A;  2B0J A;  1GK4 A;  3RK3 D;  2CCY A;  2AU5 A;  1E2X A;  1SQX D;  2CYD A;  3ZQV A;  4M3L A;  1DIP A;  1SLQ A;  2DGJ A;  2J9B A;  1YTZ I;  2NPS B;  2VH3 A;  1CGO A;  2Y0D A;  1PL5 A;  3DKA A;  5AVT B;  1Q82 Q;  3EZH A;  5KYX A;  1YQ3 C;  5CMZ A;  2Z15 A;  3NG1 A;  3JRT A;  2WB7 A;  1LVK A;  2YMK A;  3AE1 C;  3EG9 A;  1GW3 A;  1LTJ A;  1B68 A;  3JSE O;  4YWQ A;  2J9V A;  1IW7 F;  1NTZ K;  2BCC G;  2C9L Y;  1HE1 A;  3X2Q C;  2YL1 A;  1HMD A;  3ITF A;  1E83 A;  2R9R B;  5AW4 B;  2JDI H;  3L8J A;  1M8O B;  1RHZ B;  4IL6 X;  3IHU A;  4IAO A;  3C8G B;  3CL3 D;  2J7P D;  2WPQ A;  3OJA B;  1AJY A;  1ZME C;  2XLH A;  4MTO A;  4OH8 B;  1SQB D;  3RBX A;  1VOM A;  1M1J A;  4LAC B;  1QLE D;  3H32 A;  1DD4 A;  4DRH B;  2WSE H;  5L0I A;  2P58 A;  3KKB A;  3H1I J;  2B9B A;  1MMD A;  2NG1 A;  2Q3E A;  3GM2 A;  1IJD B;  2KS1 A;  5H2F E;  2KSE A;  3PHF 2;  1LT9 A;  4MW3 A;  3CCS P;  4XEV A;  1LP1 B;  1C03 A;  4BJ1 A;  3U9M A;  1OXZ A;  2LFF A;  1F1M A;  1JCD A;  3EFG A;  4CDY A;  4K7B A;  4LGD E;  1M2V B;  3AE5 C;  5KJ7 C;  3CPW O;  1OX3 A;  3W8I A;  3CAX A;  1Y4C A;  4ULW A;  1ZYR F;  4KI2 A;  1LM3 B;  4WBA A;  3AE2 C;  3B4S A;  5AC4 A;  3VOP A;  1BR2 A;  2E74 D;  3SXK A;  3JRM O;  5KLI B;  3O6Q A;  4E7Z A;  1KMI Z;  1FAV A;  2IPP A;  2WSF H;  1JY3 O;  2IDB A;  2BCC D;  2CNW A;  3QW0 A;  1EKY A;  1QPU A;  2LIG A;  2E76 C;  1MQV A;  1ZVZ A;  1H9T A;  2ZYG A;  5AVU B;  3P8C E;  3CZ6 A;  3VM6 A;  2HJ3 A;  3AEB C;  3NYJ A;  1VQK P;  1EC5 A;  3JCU E;  3DMD A;  2I8D A;  4M63 A;  5JVE A;  1OVR A;  3GHG A;  2JWA A;  2Q7R A;  3E7K A;  3CC4 P;  2Y0E A;  1TFO B;  1SQP G;  1Q0D A;  1AVY A;  3HUS C;  1MNE A;  4U3F E;  3L0I A;  4RES B;  4PJM A;  1X9V A;  4EYY Q;  3EJN A;  4MN4 C;  2P61 A;  1X22 A;  1KD1 Q;  1EDK A;  3TYY A;  2YNY A;  3L37 A;  3K1I A;  2XLE A;  5GTI H;  2XND H;  4JCZ A;  4NPF X;  3H25 A;  5APV A;  2W6A A;  4PD4 I;  1TQG A;  4CS7 A;  3HD7 B;  3BAT A;  4PJL A;  2PFX A;  3QVZ A;  1V54 C;  1VQP P;  5JUA A;  4LLC A;  4Z9H A;  2WTY A;  3CSK A;  4U5G A;  3I5P A;  4D6T D;  5JP7 A;  2GWW A;  3O10 A;  5F5H A;  4DZO A;  3L74 J;  1NOH A;  5K0I A;  1QKR A;  4P6I C;  3R4Y A;  2ZXW C;  2E87 A;  2HG5 D;  3IQC A;  3RFY A;  1AV1 A;  1VLS A;  1RKE B;  3M79 A;  1SFC D;  1FTS A;  3M0A A;  3I55 P;  3AEA C;  3L73 G;  3AGU A;  3CQZ A;  2ITA A;  3VYW A;  3FWL A;  3KYJ A;  2XS8 A;  1GU5 A;  5JSL A;  3L71 J;  4JZA A;  3DE8 A;  1GL2 C;  3DWW A;  1SQP D;  1O87 A;  4Y99 C;  2PBE A;  1D1C A;  2WSS H;  1ORJ A;  3MLG A;  2HFI A;  2L6G A;  2HOD A;  4B6I A;  2R7U A;  3AG4 C;  3RK2 D;  4CIP A;  1J8Y F;  1JAF A;  5IY5 C;  4JTD B;  1EI7 A;  2IXM A;  1VTM P;  1USE A;  4LLE A;  5AVQ B;  1XWJ A;  2E76 B;  1NVO A;  3CXH H;  2OYI A;  1KU2 A;  3RW0 A;  2B0H A;  4GKG A;  1TWH A;  1RF1 A;  2WQY C;  5KYW A;  1L0L J;  1SQQ D;  2PRR A;  5AVX B;  4AL0 A;  2K37 A;  2WVR A;  2GFH A;  3HUS B;  2O1K A;  2C04 A;  1YJW P;  2R7X A;  3US6 A;  4O6Y A;  3TGU E;  1BDC A;  2KOG A;  3M06 A;  1RJ9 B;  4YPC A;  2QE7 H;  2LXB A;  1YAR O;  4RDA A;  3C1L A;  1L3P A;  2QA4 P;  2YKO A;  1ZR4 A;  4YN0 B;  1KOR A;  4E7S A;  2JD3 A;  4YK5 A;  1LNQ A;  1KQG B;  3L4F A;  2A6E F;  2KJG A;  2ZVN B;  3W68 A;  4BXL A;  2CPB A;  1NTM E;  2Q9A A;  1R5S A;  5CJ0 A;  2AXT H;  3N4X A;  3A0B H;  3VMA A;  3PP5 A;  1H9G A;  3PLN A;  3VMX A;  3JTL O;  1L0L K;  4JQ0 D;  1QEX A;  2CNW D;  3MZW B;  1KYO D;  1HF9 A;  2K1A A;  2Y3B A;  3M4C A;  2LKM A;  2NUP A;  3G3Z A;  3AE7 C;  3FHD A;  5JRA A;  1IK9 A;  2MJZ A;  2FFH A;  2KC3 A;  1GL2 B;  3G50 A;  3A0B E;  4Y99 B;  1M6T A;  3FXH A;  3RL0 C;  2QJP C;  3SXZ A;  1VPC A;  4HYT B;  3OW2 O;  2HZ8 A;  2HS5 A;  1YVI A;  5B66 H;  3A11 A;  2R7R A;  3F47 A;  5APS A;  3AOU A;  4XFJ A;  4ZNC A;  1K05 A;  3SP1 A;  5EFW B;  1AVO A;  2YRF A;  4WB4 A;  3CX5 H;  5APU A;  2RKL A;  1LWU C;  2Q9B A;  3PJS K;  3MUD C;  3V4Q A;  3KQG A;  3HLZ A;  1GMJ A;  2V26 A;  1X8Y A;  5K5G B;  3RIP A;  2B87 B;  1SQB J;  5B5E E;  4N6C A;  5CCH A;  2ZYA A;  3D6Y A;  3H1K E;  4EBK A;  5B1B C;  1JY2 O;  5T1D B;  3AG1 C;  4NC3 A;  1PPJ E;  4NPD A;  2ZXE B;  3CX5 E;  2ASR A;  1JTH A;  1WOL A;  3U1A A;  2V7Q J;  2E43 A;  2IOQ A;  1NU1 D;  1SQX K;  1NAY A;  2P0N A;  2CW0 F;  1T01 A;  2D2C D;  1ZP0 C;  2ZXR A;  3H2U A;  4YL1 A;  4Y28 J;  3EFF K;  2Y69 C;  1VL2 A;  1XZQ A;  2A1D D;  2LP4 A;  1NSG B;  4PR9 A;  5AW6 B;  4ASW A;  1P84 D;  3PHL A;  1UFB A;  3U8V A;  4OIQ F;  3B71 A;  4OGQ D;  3EPV A;  3KMI A;  1KYO E;  4OIN F;  2X51 A;  3LS1 A;  3AEE C;  1G4W R;  4KNW A;  4MW8 A;  4RJT A;  2M3E A;  2K9J A;  3E1R A;  1ZHY A;  4AK9 A;  2JO1 A;  4WWI A;  1VQ6 P;  3AGT A;  4TLF A;  4JJF A;  1NTZ E;  1SQB K;  1XTG B;  2PGD A;  3AG3 C;  1BDJ B;  2BCC J;  3B0V C;  3L74 G;  5AVS B;  4EDF A;  3LJB A;  3EH1 A;  4ANJ A;  4L73 A;  1HMO A;  2MHR A;  4MTF A;  3E9V A;  3EZI A;  4GQH A;  3C8Z A;  3NMD A;  1IFM A;  3GM3 A;  4U9D A;  2KNH A;  3RL0 B;  2KB7 P;  3S28 A;  1M7L A;  3CI9 A;  5B1A C;  4KHX A;  3VP8 A;  1G2C A;  3IR9 A;  2FYU E;  2Y9Y A;  2HUJ A;  5APT A;  3Q5S A;  3ABM C;  2QVA A;  2QLA A;  3ZSU A;  3A0H H;  3L71 G;  4WAB A;  3KHU A;  1RQU A;  2XU6 A;  4JUR I;  1FZA A;  4N3Y B;  2E74 B;  2QSI A;  4IWB A;  2PF4 E;  1GDT A;  2R02 A;  1E79 H;  3ITK A;  2P67 A;  1OR3 A;  1H8A A;  2XL6 A;  2GUV A;  2GM4 A;  3S84 A;  4W7Y A;  1NU1 E;  2CGE A;  1BCC E;  4UDV A;  2O01 H;  3WU2 H;  3DM5 A;  4BJ5 A;  3EHN A;  1JO5 A;  1FDO A;  3A0H E;  5AW5 B;  3L70 E;  2IFN A;  4D6T J;  4C7O A;  1N1C A;  3C62 A;  3A5T A;  1S1C X;  1YAU O;  1WTY A;  3FWN A;  5TIS E;  4C7N A;  1FJK A;  3SXM A;  3U2M A;  4ULV A;  2KSJ A;  2A45 H;  4H44 C;  2OG2 A;  3L75 E;  1FBM A;  4QI0 A;  1WRG A;  2J9U A;  3HNK A;  2O01 N;  4F4B A;  1IZN B;  4U5F E;  2VRS A;  1VQ8 P;  3WU2 E;  1YJN P;  2OU6 A;  3O6X A;  4CS9 C;  4U5B E;  5L3V A;  4KJM A;  1AQT A;  3CX5 I;  2WZ7 A;  3S0X A;  1YZC A;  1T3U A;  1LT9 C;  3QTH A;  4N6J A;  5KLV E;  4XEF A;  1E5W A;  5DQZ A;  1ZHW A;  3EFO A;  3OA7 A;  1S2E A;  1L0N D;  4U9E A;  3ZDL A;  1JOC A;  3UGP A;  3V5B A;  3N24 A;  3AED C;  3K1H A;  2R3S A;  2AWC A;  3D6Z A;  4GYT A;  3BRT B;  3QMK A;  3AE6 C;  3CMA P;  5CJ4 A;  1KFN A;  1N2D C;  4DJ9 A;  4B86 A;  2BE5 F;  4JE9 A;  3USS A;  2IBZ E;  2PFD A;  3AG2 C;  5AC5 A;  4R32 A;  3DD7 A;  4AUW A;  2K88 A;  1FE6 A;  1T2K C;  2KLV A;  3B0P A;  1SQQ J;  5CCH D;  3T6J A; 
#chains in the Genus database with same CATH homology
 3K7D A;  2E76 D;  4OGQ C;  1R8E A;  4RKU J;  3Q2Y A;  1JB0 J;  4XEV A;  2ZT9 B;  3D70 A;  3L8I A;  3Q3D A;  4PV1 D;  3EWK A;  3D71 A;  2QJP C;  2L6F A;  1IK7 A;  2OQQ A;  1K04 A;  3AEF C;  3RL0 g;  3Q5S A;  4XEK A;  3AE5 C;  2ZT9 C;  3RQF A;  4I7Z B;  3AEG C;  4H44 D;  2PBE A;  4H44 B;  2QJK C;  1OW7 A;  1RQU A;  2QIW A;  2YIU C;  2L6G A;  4KT0 J;  4XFJ A;  4Z1M H;  2HSB A;  2FXP A;  3AE2 C;  1MKM A;  1VF5 D;  2J5U A;  2G8Y A;  4I7Z C;  2P10 A;  3TUL A;  3GF3 A;  2NZ2 A;  1EXJ A;  2E74 D;  3FGA D;  1K05 A;  2E74 B;  2QSI A;  2WSE J;  3T97 B;  1UIX A;  4EBJ A;  1DD3 A;  3O6Q A;  1KMI Z;  3AE3 C;  1HJ0 A;  2E76 B;  3GLM A;  4R4L A;  1U57 A;  2IDB A;  3Q1M A;  2FYN C;  4PV1 B;  5KLI C;  3JYY A;  2MKV A;  2E76 C;  1O3U A;  3MFN A;  2BEQ D;  1GMJ A;  1NGM B;  3BRJ A;  2WQY C;  1FDO A;  3RQE A;  3AEB C;  4PV1 C;  3AE8 C;  1RQV A;  2JPU A;  1V4A A;  2WPV B;  3SFD C;  1S1C X;  3D6Y A;  1WTY A;  1Q90 D;  3JZ0 A;  4EBK A;  1VF5 B;  4H44 C;  3SFE C;  5KKZ C;  1KTM A;  3Q5R A;  5M1B A;  1KQF B;  1DIP A;  1WOL A;  2V7Q J;  3C8G D;  1VF5 C;  3AE4 C;  4H13 D;  2E74 C;  1PL5 A;  1YQ4 C;  2JP3 A;  2E75 D;  2E75 B;  1OMI A;  4H13 B;  2JX0 A;  2D2C D;  1PIX A;  1YQ3 C;  1ZP0 C;  3G9R A;  3GF7 A;  4Y28 J;  1VL2 A;  2Q00 A;  1KNY A;  1ZZP A;  1FDI A;  2YMK A;  3AE1 C;  1TU3 F;  2WSF J;  2O01 J;  4H0L D;  4GDO A;  3ABV C;  2QJY C;  1UFB A;  1KOR A;  3AEC C;  4XEF A;  2KK1 A;  3B71 A;  4OGQ D;  5F28 E;  1QVX A;  3GM1 A;  4U7J A;  1KQG B;  3GMA A;  3H25 A;  3AEE C;  4R4M A;  3U0C A;  1OW8 A;  3C18 A;  2H89 C;  1KIL E;  1NYH A;  3L8J A;  1Y9B A;  4TT3 H;  1EXI A;  3AED C;  4IL6 X;  2ZT9 D;  1JOG A;  3D6Z A;  3C8G B;  5L8R J;  2JO1 A;  1OW6 A;  1WWP A;  1AJY A;  1ZME C;  3AE6 C;  2H88 C;  1ZRT E;  2YWA A;  1K40 A;  4YTP C;  3IN6 A;  3O10 A;  2D2C B;  4YXD C;  2BEZ F;  1S5L X;  3S9O A;  1PV3 A;  2K9Y A;  4H13 C;  1DD4 A;  2E75 C;  2WSC J;  2D2C C;  2FBW C;  3R4Y A;  3C8V A;  4H0L B;  3RQG A;  4R32 A;  3Q5P A;  1HF9 A;  3U3F A;  3LW5 J;  2G3A A;  3IAO A;  4OGQ B;  4NQF A;  1WMK A;  3RK3 E;  3GM2 A;  3C8G A;  2L6H A;  4H0L C;  3AE7 C;  3GM3 A;  2LK4 A;  1ZOY C;  3AE9 C;  3AEA C;  3AJM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...