1K04A

Crystal structure of the focal adhesion targeting domain of focal adhesion kinase
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
142
structure length
142
Chain Sequence
b'EISPPPTANLDRSNDKVYENVTGLVKAVIEMSSKIQPAPPEEYVPMVKEVGLALRTLLATVDETIPLLPASTHREIEMAQKLLNSDLGELINKMKLAQQYVMTSLQQEYKKQMLTAAHALAVDAKNLLDVIDQARLKMLGQT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords FOCAL ADHESION KINASE 1
molecule tags Transferase
source organism Homo sapiens
publication title The structural basis of localization and signaling by the focal adhesion targeting domain.
pubmed doi rcsb
total genus 56
structure length 142
sequence length 142
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2001-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03623 Focal_AT Focal adhesion targeting region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.540 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 1k04A01
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 1k04A02
4XEFA 1ZOYC 3O10A 3K7DA 1OW7A 3B71A 1K40A 3AE4C 2G3AA 1K04A 2L6HA 4XEVA 3AE8C 1K05A 2LK4A 3AE1C 3AE7C 1YQ4C 4YTPC 3GM1A 3AEEC 3C8GD 2L6GA 1KTMA 3U0CA 3S9OA 1UFBA 1OW6A 1ZZPA 3AEFC 2KK1A 1V4AA 3AEGC 1KNYA 1YQ3C 2JX0A 1O3UA 3AE5C 2Q00A 3U3FA 2YWAA 4R32A 3C18A 4XEKA 2H88C 3C8GB 1WWPA 5F28E 4EBKA 3SFDC 3MFNA 3AJMA 3BRJA 3AEDC 3SFEC 3C8GA 3TULA 2L6FA 2H89C 3RQFA 1PV3A 3L8JA 3RQGA 4EBJA 4YXDC 2PBEA 1OW8A 3JYYA 3RQEA 2JPUA 3AEBC 3GM2A 3AEAC 1JOGA 3JZ0A 3ABVC 3AECC 1ZP0C 1WOLA 3AE6C 3AE2C 2FBWC 2HSBA 2WQYC 3L8IA 3AE9C 4NQFA 3AE3C 1QVXA 1WTYA 3GM3A
chains in the Genus database with same CATH superfamily
1GMJA 3L74E 1HY5A 3T6GB 3K7DA 2FFDC 3U59A 3EHMA 5AGFA 3H1LD 4HKZH 1D0XA 3EGXB 2HV6A 1K04A 3AE8C 1DOVA 2VH3A 3DAGA 1UG7A 2QG4A 3A9CA 5L8RJ 4A2NB 2EIJC 4O9BA 3M9QA 2QNLA 1D7MA 4JE9A 3M9BA 2HV7A 2WVRA 4MVZA 1ZRTE 1ZLLA 1H89A 3M0DA 3HKKA 2PF4E 3U9MA 3NYJA 1JY2N 2XLOA 2YMYA 3QH9A 1MMDA 1CGME 4I3MA 2LKMA 1HMDA 2J9UA 4LERA 3H1LJ 3FXHA 2JP3A 5CBOA 4HYTB 2WT7A 1Y47A 1BR2A 1LJ2A 2GWWA 1IFIA 1ZW3A 2QJKB 2R3SA 3JT1A 2CGEA 4N78D 5L0JA 1NFNA 3LAYA 4TLFA 4GEHA 1NU1D 2QE9A 1KORA 1LWUB 3FAPB 1NTMD 1GS9A 1IFNA 3Q3DA 3L75G 1WRGA 1VF5D 3L70J 2FFHA 1WN0A 5DS6A 1Z5ZA 3RQFA 2HYNA 1SS1A 3VM6A 4U5FE 1Y8AA 3MUDC 2OEVA 1FBMA 5AW7B 2E74B 4G78A 3FWLA 4YL1A 4J30B 1Q0FA 2EPKX 1LTTC 1S9KE 5KKZC 3CXHE 3S29A 4C7NA 2XZRA 4P9FA 3CC4P 5CJ4A 4EUKB 2RD9A 1OVUA 4BWNA 4JTDB 4O7GA 2W45A 4BG0A 1E84A 1BZ4A 4DOZA 4DXWA 5JS5A 3I5PA 1HJ0A 2WQYC 1FJKA 2E74D 3IPMO 1NLXA 1T6UA 4JRZA 1BGYJ 4XTKA 1ORSC 3TJ5A 3LS0A 4IFFA 1K73Q 1M1JC 1IK7A 2XKMA 1J1DB 2OQQA 2PFXA 4PV1D 1LIHA 1E85A 5APYA 5CCHC 1FE6A 2KS1B 1DH3A 3K1IC 1KYOD 1H88A 1IW7F 2E75C 1ZHWA 1PPJE 2KZIA 3A0HE 3ATPA 1FOSE 1EI7A 1M57D 2XLDA 3TGUJ 3SZRA 2KNCB 2A45H 3QW1A 4U3FE 1H6GA 3N2ZB 1EZVE 1YJ9P 4D6TE 2NUPB 3L36A 4F4BA 5E3CA 1R4TA 2KC3A 3UMIA 3VYIA 3E1IA 1I5NA 1SQXD 4IL6H 1SF8A 4W8KA 3WAQA 2F22A 3KL4A 1SQQE 4OVNF 1LE2A 1D1CA 1BE3G 1V54C 3RK3B 1KB9D 3KYJA 2NZ2A 1RKCA 3EFOB 3S28A 1IO4A 2K37A 2P58A 1ZR4A 3ZC4A 3V5YA 2ZPAA 1RQUA 3WUUA 2W4MA 4H44D 3L73D 4E0IA 3TOMA 1H0TB 4DOJA 1SP4A 2QJYB 5APXA 1FS0E 1SQXJ 3AEDC 4PK4A 4FWVA 1YITP 2HPCB 1PP9G 3K33A 2IBZD 4WGZA 3VRCA 1S4XA 3MX3A 4E17A 2LXCB 2H89C 2R44A 3TK0A 4D4XA 2G8YA 4NTBA 2Y3DA 1OX3A 5AVWB 5FCLA 1J1EB 1S7ZA 2D2CD 1R5LA 1AJYA 2RMZA 1M57C 3FGAD 3LJBA 1XTCC 3AEBC 3DD7A 3AEAC 5BQIA 1D0ZA 3H1IG 3MTUE 4XPWA 4RD9A 2A1DD 4GQHA 4LLCA 3B0VC 1FDIA 1Y4CA 1VQMP 3C8VA 3B29A 5F5HA 1SQBK 1HW2A 2YEVA 1OVVA 3B9QA 3TNUA 1NTKG 1I4YA 5BQGA 3T6BA 4YT2A 1BR4A 2Q3IA 1WTYA 3CWBJ 3GM3A 3TYYA 1FZGA 3G3ZA 4BJ1A 1H7IA 2R02A 3KKBA 3VP9A 4QI0A 1VQPP 4A7PA 2Y3GA 3GWNA 3BRVB 2PP4A 4KI2A 4U5EE 3GF3A 2IBZE 3LESA 3A2AA 1T2KC 3V7OA 4YTPC 3A3YB 4OH8B 3O8ZA 2XLWA 1URQB 2R7WA 1AVYA 3B5NB 1FDMA 1EZVD 1RE3C 4G7HF 3RL0D 4MVRA 4EKWA 2YO2A 2WSFJ 2UWJE 1P84D 5JUAA 2ZT9D 2Y0EA 3EFOA 4PFPA 2LR2A 2VCBA 2L7AA 5L0IA 1AVOB 3L70E 2QA4P 1MFZA 3S0XA 4K3AA 2SPZA 5B5EH 5COMA 1YQ3C 2JX0A 2VRSA 2G3KA 2DYSC 2NUTA 1VF5C 2YWAA 4OINF 2G62A 2J5UA 5APSA 2FYNB 1QZXA 5KLVD 3QTHA 1KYOI 2XDJA 4EBKA 1RXQA 2Q5UA 3SFDC 1LT9A 5AC4A 2M0BA 2N1TA 5AVYB 2OTLP 3PHF2 2NPSD 3IHUA 2YKQA 2QJKC 3H1IJ 5AW0B 1OKKA 1X22A 1LI5A 1OCOC 3Q6MA 1YJNP 2J7PA 2WZLA 2WITA 3CL3D 3CQZA 4CDVA 5CCHA 5H2FE 2WB7A 1OFCX 2AEJA 2J9WA 4U7JA 4GOFA 1A7DA 3L73E 5AVXB 3N0TA 1Q86Q 1JCDA 3CXHD 2R7XA 4CDYA 4EYYQ 2Q9AA 1Z7Qc 2N1TC 4WY4D 4K1OA 2MHRA 4K0DA 2M3EA 3E7KA 3IQCA 3VN0A 1EDJA 2DW3A 2FBWC 1JM0A 1NTME 2R5BA 1RH5B 1LNQA 2YLGA 4ZLCA 2J9VA 4YJWA 1JCCA 1RE3A 2E76C 1NSGB 3MZWB 3BATA 2FAPB 1Q81Q 4G0HA 1MFTA 3CEXA 1T3JA 3C63A 3KMIA 1W2WA 5KYYB 4U3FD 1V74B 2L6HA 3NKDA 2IFNA 4Q4ZF 1M2VA 5C39A 1NYHA 3F89A 2FKWB 4X0RA 1KILC 4DBQA 4N6HA 2QM7A 4CX9A 2HSQA 1JRAA 3U0CA 2E75B 1FAVA 1L0NK 1QLED 4JTCB 3RIPA 1OMIA 1NWQA 1TWAA 2ZXEB 1Q0MA 1VQ6P 2PX0A 1QKRA 2E76B 2HMQA 4LACB 5B66H 3NFQA 2M64A 3TNUB 2EPOA 2E43A 2VCCA 4U5GA 5GTIH 2R3CA 1DOWA 4U3FJ 2WTYA 2XS8A 3L1MA 1XWJA 1NKNA 1Q2NA 2E75D 3CCUP 2R5DA 2Z5HA 1CZQA 1KU2A 4D4NA 4PV1C 1ZRTD 3K1HA 1NG1A 3BRJA 1HF9A 2YMKA 4W80A 1TKNA 2XM0A 3EG9B 3V5ZA 4I2LC 2N9YB 3C8GA 2JJLA 5BU8B 2ZT9B 2B0JA 4N6JA 2KSJA 4LGDE 3WU2E 2KS1A 2V4HA 1M6TA 1QSPA 4IWBA 4UB8E 4GOEA 2AXTH 4NC3A 2HUJA 1LM3B 2PRRA 2WPSA 2FXMA 3CWBE 1BGYG 1VQ9P 5L0GA 3A0HH 1SFCD 3L74J 1N1CA 1K9MQ 2BEQD 1AUEA 4JURI 4EWCA 4PV1B 3JC22 1T3UA 3AECC 2PAJA 1YI2P 4MW3A 1GL2B 2A06G 3C8ZA 1C03A 2K9YA 3CX5D 2IYPA 4DJGA 3DXJF 2YO3A 5BUOA 3B5ND 1YYCA 3CCVP 3M9HA 1DEBA 1SQVJ 1DIPA 5KYWB 3V2NA 4CSAC 4PACA 2ICWG 5TISE 1UIIA 3L74D 3CXHH 1PGQA 3UMKA 1K40A 3VMAA 2HZ8A 4LC1A 2Q6QA 4C7OA 5KYXB 1Q0DA 1YQ4C 1LWUA 3I56P 4J7YA 2IYLD 2KIKA 1VL2A 4J32B 3CX5H 2B0HA 3BCCG 3KH2A 1MMGA 1BGYD 1G5ZA 5AVRB 2Q7RA 3SWFA 1GK6A 1IFJA 2WPQA 1K8AQ 4CIHA 3II6A 5TISH 4I7ZB 5KYWA 1QGKB 1ZHYA 1LTJA 2ZYGA 4CSAA 4O79A 5KJ7A 1URQC 5DS5A 1LTGC 1Z23A 4CS7A 1PD0A 5KKZB 3RH3A 1P84E 5CJ0A 3S4RA 1R5ID 1QEXA 3TGUD 2HG5D 4JF7A 5AW6B 3P8MC 3RVZA 1E83A 3EJNA 1TR2A 1EDLA 3NRHA 1RKEA 3AJMA 3IAOA 2XV5A 2YL7A 3L72E 1ZYRF 2R7OA 3T97A 3X1OA 2A06D 3M79A 2W90A 3P8CE 3GODA 2QJYC 1BCCE 3CCSP 2Y0CA 1G8XA 2A6HF 1H8AA 3RK3E 3SXZA 4DJ9A 2R32A 2KB7P 2AEFA 1YAUO 3M1CB 1Q0KA 3G6EP 1EC5A 2GUSA 3RYLA 5CCHD 4BJ5C 3GWLA 1ZU5A 3M0DC 4JCZA 5T3TA 2DYRC 1YBKA 4Z1MH 3DZAA 4C46A 4WY4C 3GM2A 2J7PD 1L0NJ 4MTOA 4L6RA 5L0FA 5AW4B 3M4CA 4GKGA 1VOMA 4GIFA 2LP4A 2PX3A 1SQQK 2WT7B 2M3BA 3SNHA 2W6JH 2WSEH 3GANA 2C03A 4EI2A 2QM8A 4C3EA 1A7VA 4DRIB 3KQGA 1JY2P 1FMWA 1M56C 2HLOA 1ZHXA 2W6AA 4B86A 2HODA 2QY9A 1RJ9A 2OYHA 1GM5A 5DJUB 2C9LY 3AE4C 1JY3O 1LWUC 1FZEA 2PFDA 4XEVA 1YDIA 1FAPB 3HUSB 5CBNA 2IYOA 1UIXA 2OYIA 1T8ZA 3WG7C 2BCCE 3QVYA 4N6CA 5DQTA 3LIDA 2OTJP 3EGXA 1DD4A 3ABKC 3H1KJ 1EXJA 2XL8A 3G9RA 2R9RB 3MD0A 1LT9C 1LTJC 2CCYA 1D0YA 3JSEO 3AG1C 3K6BA 4RDAA 1SQXE 2LFFA 2XLEA 1ZZPA 1VLTA 1SQXG 1MKMA 3Q7LA 1R8EA 1L0LE 1NU1K 3K5BA 3V2PA 2Z4EA 3JRMO 4MVUA 4IAQA 3KZIH 2ZXWC 5APVA 4M3LA 4A4AA 2Y3HA 1KQGB 1KFMA 1OKKD 1ZVZA 1PD1A 1G4WR 1GGQA 1WATA 1N73B 1GU4A 5CIVA 3UGOA 1RF1B 4ZLDA 1IK9A 1M1JB 5GTHE 5B1BC 2W8ZA 1C17M 1PZQA 1RMVA 2YXRB 1YVIA 1NTZK 1SFCB 4CS9C 3H1HG 1MNDA 4YL0A 1X8YA 3VMYA 3C7JA 1L2PA 2R7RA 2IXPA 3RVYA 1EZVG 1W5CE 2ASRA 4O6NA 3GORA 1X0TA 3VTPC 2W6BA 1YA7O 1ZMEC 1NAFA 3NTNA 1OXBA 3ABVC 2WZFA 3Q7GA 4XQ1A 4U3FG 2XLVA 4IFDK 1HH0A 3MYIA 4BJTA 3Q1MA 1BE3E 2ZXPA 1W2EA 3H1JE 3AE2C 4Z9JA 1VMAA 5KAFE 1OXKA 4I6MC 2P67A 2C04A 3P7KA 2Q7CA 1KB9H 5CCGD 1G1JA 1T6IA 3M15A 1HGZA 4P9TA 2QLAA 2FYUE 1RCPA 1QVXA 2LIGA 2XNDH 1T01A 2A6EF 1EQ1A 1ZOYC 4IARA 1QL2A 2LXBA 5H2FH 1E2XA 2I1KA 5GTIE 1N7SB 3I5CA 1VYKA 3EHNA 4OD5A 1CW5A 3BVHA 3E9VA 3L34A 1K05A 1S5LX 3RL0g 4NTAA 3MIWA 2YL1A 3U5SA 3CPWO 1I4ZA 1JR8A 1YYJA 5L0HA 4RESB 1RE4A 3VP8A 3MBGA 4RKUJ 1H9TA 4HH2A 1MMAA 2GDCA 1BDCA 2P0NA 1NH4A 1KILB 2C9NY 2Y9YA 1TWHA 3A0BE 2NPSB 3E70C 4IAOA 4C3DA 4BRYB 4OGQB 3O6XA 3H32B 3I4UA 1JMBA 1G4US 4IOIH 1QLEC 5L3VA 3H1IE 2OGUA 2UUIA 2IM8A 1NU1J 3AGUA 2CNWA 2CPBA 2RSEB 5E3AA 3MHVA 4CS9A 3CMAP 4XEKA 2KZJA 3U2LA 4MVOA 3JCUE 1OCCC 2H43A 4NY3A 3IQ6A 2FYZA 1JO5A 5CMZA 4JZAA 2JWDA 2OOCA 1FOSF 3AG3C 3VOPA 2WSCJ 4IL6E 1CPQA 2YXQB 5CCGC 3SFEC 4WY4B 2L6FA 3EZIA 3L71D 1ZHTA 3GLMA 2J58A 1HGVA 3H1LE 2Y39A 4OGQC 3JSVC 1M1KQ 1L4AC 3EQ2A 2ZT9C 2TMVP 1IFMA 2P6VA 2HPCA 1LS4A 2R25A 2BCCG 2E76D 1LTIC 3JYYA 3X2QC 4E7SA 3LW5H 3H1HD 2KLUA 2NPSA 1U89A 1M56D 3DE9A 4UB6E 1H0TA 1SQBD 2KOGA 2K9JB 3L72J 3SXYA 3U1AA 4L76A 2OG2A 1ZP0C 1FFTC 1VDFA 3V5BA 1HBWA 4ULWA 2ZYAA 4ZKPA 3TGUE 2XXAB 4IFMA 3SEOA 3HE4A 4GODA 3TGUG 1U57A 2K3RA 2NPUA 2ZYDA 5DLJA 3EWKA 3UR3C 3H6PA 4AL1A 5B3SC 2Y3BA 1CGNA 2AWYA 3HE5A 1JB0J 4KC9A 5B5EE 2IDBA 1JY2O 2XS1A 1L0NE 4QDLA 2R7SA 3Q5PA 4IB4A 2HMZA 5AVQB 1Y6DA 2IX7C 1N7LA 3H1JD 3IF4A 3RL0B 2EPNA 2KNCA 3CAXA 1AQ5A 2LSEA 4H13D 1MV8A 2KUBA 3FMSA 4J7TA 3HRNA 2K1AA 1FJPA 3O39A 3RKOF 3SWYA 1SQPJ 1J8YF 1LVKA 3DWWA 2OTKE 2B9BA 2IXMA 4I1OB 1FZCC 2W27A 1NTMG 4H0LB 3S1KA 1ZW0A 2A45I 4MN4C 1M1JA 1J2JB 3W2WA 2CNWD 1N73A 3LS1A 4C7NB 1E79H 1GL2C 3ABMC 1BCCD 4BXLA 3M91A 4TT3H 3EGDA 1S1CX 1L7CA 1LT1A 3GG2A 3B4SA 4H44C 2FY8A 1D1BA 5CHXA 3LNMB 1SQPD 4EBJA 4PJ0H 4LDRA 2FYUJ 2AP3A 5L0DA 3MUDA 1ZXGA 1QL1A 1BDDA 3FVYA 2Q4FA 2M8RA 1WASA 2HS5A 2OJQA 5APTA 3W67A 1LP1B 4WABA 5A6KA 1DD3A 2POHA 1E86A 3N24A 4N3YB 3BCCJ 1KYOH 4GT1A 2OJED 4IJJA 2WSFH 1KQFB 3PDMP 3P8CD 3FXEA 1C02A 2RH0A 4OD4A 5BQHA 4M63A 4H44B 3DAFA 3A5TA 3S90A 3AE3C 3ITKA 1NU1G 3H2VA 3KPEA 4MQ9F 2L6GA 5HSWA 1HW1A 3HLZA 1NTKD 1NO4A 1YZAA 3BEHA 4HFFB 4JPZB 3C62A 2O01H 4AE4A 1YZCA 5B1AC 2L5GB 2M4EA 3B8EB 4BEJA 5M1BA 1L0ND 1JNMA 1FR0A 1YTZT 3G50A 2YHSA 4I1MA 5A69A 1BR1A 2D4UA 3IQTA 4XPXA 3HNJA 3OJAB 2QUPA 3KHUA 1FMVA 3HNLA 3CLQA 3HUSC 3W8HA 3U1CA 2O1JA 4W8PA 2YKOA 2CK3H 1J8MF 3EPVA 4ONSA 1FC2C 2IFMA 1OQCA 3OA7A 2HR3A 4JTAB 3DMDA 3VF0A 1APCA 5KLVE 5IY5C 2AVKA 1FFHA 1KQLA 3AEFC 5AW2B 2GA1A 3L74G 2AXTE 3CD6P 3AQCA 3CCQP 1LTSC 1YA9A 2YVKA 1QVFO 2WWWA 4NPFX 2H88C 2HKVA 3CWBD 4U9EA 4HEAJ 3PCVA 4H13C 3HD7A 1A02J 4PJJA 4ANJA 4CDAA 4CS8C 3MFNA 1AV1A 1EZVI 2P7JA 1YHQP 1KN7A 3UIAA 2O9XA 2R7TA 5KAFH 3AGTA 3RBZA 2OARA 2HFED 1NOHA 3PMRA 1N8RQ 1L0NG 3W8IA 1O5HA 1URQD 2BCCD 3MGNA 2R7QA 2V7QH 2XNXA 1V55C 1AQTA 4WVZA 5B66E 2VASA 3W2VA 1IZNB 2QIWA 1T9KA 1DEEG 1PL5A 5E79E 3GHGA 2JKVA 2R7VA 1HE1A 4JKVA 3V2RA 1JTHB 1N2DC 2E42A 4C3BA 1U7MA 1NVOA 3AE6C 1NGMB 3TF5A 2C0WA 2I8DA 4U5HA 2YKZA 2BCCJ 5GTHH 1S72P 3V4QA 1FTSA 3EFFK 2AWCA 3DJNB 3H1KE 4ZNCA 3JCUQ 3R2PA 2DB4A 1KMIZ 3O55A 3H1KG 2Z15A 4K35A 3PLNA 3O10A 1FZBA 1OW7A 1SVFA 4R4LA 4JYBA 2LQGA 2QTVA 2NRGA 3H1ID 3CI9A 4RO0A 3SXKA 1J1EC 5A6JA 4IL6X 4P6IC 3T9OA 3AEEC 1SQVG 4MVSA 2A69F 3H25A 1N73C 3RW0A 3L35A 3S9OA 2FXOA 2FYUK 3WHNA 3NYMA 2YIUB 2ZXXA 1IC2A 3QWOC 2KGOA 3JTLO 4JW1A 1O87A 1EQ7A 3IN6A 2G3VA 1VTMP 2JDIH 1SFCC 4WGYA 2J0WA 2VCAA 3G71P 1DX7A 3FOPA 3WU2H 3QZCA 1YYXA 1OIPA 3U3FA 4D6TJ 4UB8H 1T2KD 1R5SA 2MKVA 3Q6NA 3C8GB 4KBLA 2IBZI 1LE4A 5EHHA 3ZTMA 4FAPB 4JJGA 4CJGA 1SQQJ 4MNDA 3ZVRA 3TDKA 2N1TD 5APWA 2KQ9A 1SQPG 3TK1A 1NTKE 5CI9A 1SQPE 1Z6AA 1OR3A 3L8JA 2DGJA 1IFPA 3R7CA 3ZIBA 4YN0B 1NTZJ 2GA0A 2J0XA 5AVZB 2PBEA 2WPVB 4DVZA 4IRUA 1G2CB 1VQ8P 3EZHA 4C7RA 3PRJA 3IEEA 3RK2D 2JPUA 1GDTA 5KYUA 1A7EA 3HTKC 2YKPA 5AW3B 1L0LD 3JZ0A 1LTAC 1VQOP 3FWNA 1S9KD 5E2QA 1N7SD 3PJSK 3CCJP 2CW0F 3L75D 1D1AA 1JEKA 3KYQA 2K9JA 1SQXK 1M2VB 1NTKK 5KYUB 4XWJA 3S27A 3H65A 4YT5A 3N7NA 1Z3IX 3D70A 1MNEA 5KYYA 3HD7C 4HJGH 2B87A 2B89A 1JOCA 2A06E 4MS2A 3ZQVA 2XL4A 1YLMA 5DS4A 3H1HJ 4CJOA 3KZIE 2X51A 1Z63A 3KXDA 1U7JA 2L9JA 1W2BO 3G4XA 4EIYA 2LK4A 3L75J 2KSFA 1H9GA 4JIOA 1OR2A 1FZCA 2J45A 3IFMA 3F47A 4W7ZA 1QVGO 2ZD9A 4XLPF 1QPUA 2A45G 1XTGB 4I1LA 5DJTB 1VYIA 3KPHA 4EHPA 1CI6B 2AXCA 2P61A 3ABLC 3JRTA 3H1HE 2I15A 2D2CB 3H32A 2WVNA 1KZUB 4QI2A 1M90Q 3TD7A 3V6IA 1RY3A 3L75E 1Q90D 1KILA 2WSEJ 5JVEA 2X0CA 1SQVD 5D92A 1FU1A 3AOUA 4MVQA 2FYUG 2KK7A 2Q3EA 3P32A 3E1RA 4H0LC 4HB1A 2MJZA 4AQRD 1ZR2A 4MTFA 1HMOA 4KNWA 2Y0DA 1KILD 3EH2A 5JLIA 2WSCH 3O6QA 2JO1A 1GTWA 4O6MA 1XZQA 1PV3A 1KQSO 2KI7B 1NTMJ 1EDIA 2EPMX 3RQGA 1WMKA 2B87B 4YXDC 1SZIA 3GMAA 1VB5A 3ITFA 4LLHA 5JSLA 3L70D 2Q9BA 3O6QB 3H2UA 5F5FA 2J8WA 1VLSA 3USSA 1RF0C 2EIMC 3ASNC 4KJMA 3GW6A 3HE4B 4BPMA 1PP9E 2XXAA 1M7LA 4WB4A 4XA4A 1GK4A 4YXWH 2XL6A 1JOGA 2XRHA 2GAQA 2BE5F 3QW0A 4ASVA 1HUCA 2IOQA 3FX0A 4YT4A 4OIRF 3HTKA 3RL0C 5AC5A 5A6BD 1URQA 1M8OB 1BCCJ 2IZ1A 3JYHA 1VQNP 5D91A 2O1KA 3EFGA 1TWGA 3SXMA 1G2CA 4WWIA 4W7YA 2YNYA 1PGOA 5K5GB 1KC8Q 4D6TG 4ZMDA 5T1DB 3L73J 1SQBE 2QSIA 3C1LA 2JR8A 2BEZF 3PH0A 4Y28J 5CCGA 4WY4A 1AFOA 2YIUC 2H7VC 2P1AA 5A6BA 3OWTA 3BRTB 1PPJD 1FZCB 2JWAA 3H1KD 3BCCD 3NMDA 3GEEA 2N9BA 5EGYA 1USEA 2NSFA 3GM1A 1FDOA 3OW2O 5E33A 5A6AA 2E87A 4EOTA 3CC2P 3C8GD 5KYNA 2BC5A 3A7OA 3K66A 2A0BA 2KSEA 3LIEA 2KYVA 4CS8A 2OCCC 1HTLC 1PGPA 2R05A 2XM4A 2IBZG 3F5HA 2OQMA 2YRFA 1GD2E 2D5RB 2VC9A 1JMWA 1TFKB 1NTKJ 2FYNC 3OEOA 5KLVG 1E5WA 1O3UA 5APQA 5E79H 4UDVA 3D6ZA 3TSIA 4R32A 1OWAA 3Q5RA 4UB6H 3T97B 1SR2A 1EDKA 1KD1Q 1M2OA 1WWPA 2FGYA 2ETSA 3FOOA 5F28E 3S84A 1S2EA 1JMMA 1USDA 1U0BB 3ZDMA 4JEAA 1BBHA 2R03A 2EINC 5COFA 4U5DE 5KAIE 1LGHB 2UUHA 4AE4B 1CPRA 3AG2C 2P2UA 2OYHB 3B0UX 1PP9D 2HODB 1GU5A 1KB9E 2W4BA 2FXPA 2ZAEB 1CGOA 4G7OF 1YARO 2V7QJ 1N86A 1JPNA 2H8AA 4HE8D 4YT8A 3RQEA 4AL0A 3Q5SA 1U6HA 1RF0A 1VQ7P 4ASWA 4JYCA 1QX8A 5JRAA 1LS1A 5DVWA 2C0XA 2J59M 4OWFA 5EFWB 5TJHA 5L3QA 4XPYA 2ZVNB 3HNKA 3M0AA 5AW1B 1FZAA 3RGUA 1NTZE 1X9VA 1ORYA 3CCEP 2DI3A 3SP1A 1LP1A 1GZLA 1OCRC 3U9JA 3ZQYA 1ZV8A 3GHGB 4C7OB 1FZFA 3UNGC 3CCRP 2OYHC 2WVOA 3L37A 3L0IA 4U5CE 4XEFA 3KDPB 4N78E 1Q82Q 3H1JG 3GEIA 2ZJSE 4JBZA 1F1MA 2E74C 2YL0A 2KW3C 2XLHA 3LLKA 2AEMA 1GQAA 2PNOA 1KILE 1RKEB 1TQGA 1VK5A 1PCXA 3HD7B 4PJLA 1P84H 3NMJA 4OGQD 5FZTA 2V3CC 3JCUH 3L72G 2WVQA 1SQVE 1GW3A 2E5YA 4YK5A 3LW5J 1ZHZA 4ULVA 4R4MA 3WODF 3CCLP 1OW6A 3I5QA 2YLDA 3PP5A 4PD4D 4GDOA 4JVSA 4YWQA 2GM4A 1LTJB 3AEGC 2ZXOA 1MUUA 3WUTA 2J46A 3NMIA 1PPJG 3CXHI 3R4YA 1JY3P 1QQ3A 2A68F 1JPJA 1LTBC 1NFOA 1JUNA 1WGWA 2OEXA 2IZ0A 5KTBA 3US6A 1YJGA 2JD3A 1VQ4P 3DE8A 1SQPK 2QRXA 3K1IA 4PD4E 4K7BA 5BVZA 5KLVJ 3TOLA 3ZWIA 5KJ7D 4ER9A 4RJTA 2XLMA 3T4RA 2YQYA 1VQ5P 2WZ7A 3U8PA 3U8VA 3HJCA 3T6JA 3L72D 1OCZC 5DQZA 4DCKA 4LLEA 5AVUB 3J06A 1VPCA 3CSKA 4ZKUA 3U2MA 3TJ6A 3NMKA 3H1LG 2KJGA 3WMM0 4EDFA 3POVA 1AEPA 2RN0A 2Q1KA 2ZXRA 3L71E 1BSHA 4DBRA 4AK9A 1X79B 4Q7CA 2RKLA 2P1JA 1BDJB 2R7UA 4I7ZC 2Y69C 2CYDA 3AQBA 1HWTC 1JY3N 3CC7P 5COGA 4CBEA 5AW5B 4XLNF 2H7HA 1Z56A 1B68A 4PJ0E 1NTZD 1T5OA 1OZHA 2QVAA 2NSGA 2H7OA 4E7ZA 4XE5B 1NBBA 2L81A 3NDBB 1S5LE 3W68A 4BJ6C 4H0LD 3L71J 3B0PA 2QJPB 3FXDA 4AX2A 3EGDB 3HD7D 5KJ7C 1L0LJ 2I8BA 2Q9CA 1PIXA 2ITAA 5CI8A 3ZDLA 3EQLF 1TWCA 2IBFA 1KFNA 3VAYA 4BEMJ 2ZFCA 4MTGA 4FX5A 5AVTB 1EXIA 1ZN5A 1UFBA 4NPDA 2GFHA 2HFIA 4WBAA 1S5LH 1SQBJ 3PHLA 2FFDA 4MVMA 3JSZA 3FDQA 5EK0A 1NHLA 3UGPA 1KNYA 4G7ZF 3AE5C 4Q5SF 3C18A 3MP7B 1NTZG 3HTKB 3CMEP 2Q9IA 1BSNA 1ORJA 3N4XA 3F46A 2OKUA 2KLVA 3U3BA 2XSEA 1GW4A 3RF3A 3CWBG 1T6AA 1ZW2A 4JEBA 4JCHA 1KB9I 1KYOE 2FYUD 3FAJA 1N7SA 3QMKA 4O6YA 3CX5I 3IQ5A 3H1JJ 5GPGB 1Q0GA 3HE5B 2XU6A 1SLQA 2QEXP 2MWQA 3RK2B 1WT6A 3ZG1A 256BA 1NU9C 1PGJA 4L75A 2EPLX 2NPSC 1L0LG 4DVYP 1AVOA 1MQVA 2WSSH 2EILC 4PFOA 1OXZA 4H54A 2H8PD 3L70G 4BJ5A 4Z9HA 5KAIH 3BASA 5BU5A 2HJMA 4RBNA 3CZ6A 2IPPA 4I44A 1S05A 3RFYA 4LDKA 4Y99B 3NKEA 4DRHB 3ASOC 3L8IA 3I55P 3DI5A 2Q3TA 3DKAA 2B88A 1TFOB 1T6QA 1CI6A 2YLIA 3MYFA 2D2CC 1LI7A 3NXSA 3BCCE 2ZVOB 3AG4C 1VQKP 2J9BA 1ZU4A 2W83C 1L4AB 4CPGA 3DM5A 4JC7A 3Q2YA 3RBXA 1BE3J 1MMNA 3EG9A 5KLVK 1L0LK 1NU1E 3AE7C 4JJFA 2WL8A 1RF1C 2M5AA 3UMHA 1LT9B 1PFIA 2LCHA 1Q7YQ 5AW9B 2OYIC 3L73G 4Y99C 1KTMA 4L73A 3RK3C 1OVRA 3VYWA 1MZ9A 5AVVB 3SYNA 3HNIA 2NUTB 1L3PA 3VMZA 5JP7A 2K88A 4JQ0D 4AUWA 2KK1A 1V4AA 4EIJA 2BASA 1IFDA 4E18A 4YPCA 3V5XA 3D6YA 2Q00A 1BE3D 4NCQA 3NYLA 3MLGA 4OIPF 4PD4I 2O01N 1BCCG 4MW8A 5T3WA 3L4FA 2YL3A 3A0BH 3NG1A 5TJ5E 1S3JA 4QMAA 2OYIB 3A11A 3HUSA 4PJNA 1RQVA 1IJDB 3SWKA 2OYOA 4NTFA 4IGGA 4KT0J 3TULA 1YJWP 1SYQA 3W4YA 4LDQA 1NTMK 4KHXA 3OAKA 1N7SC 1RJ9B 2KYHA 3LEOA 4EBBA 2AU5A 4DRJB 1OW8A 4PD4H 4OIOF 4H4KC 2E5TA 2KP8A 2IXOA 1SQVK 4AYCA 2VB6A 4YL3A 1TU3F 1RHZB 3V2QA 5AVSB 1YIJP 1WOLA 3DJUB 3CCMP 1Y9BA 3LUTB 3RK3D 2M5AB 2WZGA 2QJPC 4Z9IA 4XFJA 5KLIC 1GL2D 1HE9A 4BRYA 1L4AA 1PP9J 3ZTZA 3GHGC 1VQLP 2PGDA 4DT0A 1LPEA 2WPRA 4HFKB 3B71A 1NZEA 2WMMA 2OU6A 1YTZI 3M06A 1RF1A 2HJ3A 2G3AA 1AA0A 3OA1A 2O01J 3B5NC 2N1TB 3AE1C 2L91A 3DM9B 1BGYE 1J1DC 2V26A 3M4BA 5JT4A 4PR9A 1IZMA 2Y9ZA 4WJ0A 3GEHA 3PTZA 4E0HA 1A0BA 2CDQA 3ECSA 1HJBA 5KLIB 1CSBA 1NU7D 3IR9A 3ZSUA 4PJMA 1VF5B 4DZOA 4NPEA 2P7VA 5AW8B 3LEVA 4FESA 4N06A 3C9IA 3EH1A 5HV9A 3V4WA 1JAFA 3SSUA 1EA8A 2W9YA 3B5NA 4U5BE 3LLIA 2I1JA 2IXNA 1JTHA 3GF7A 3TQOA 3CX5E 2H7BA 2NUPA 1ST6A 2MYSA 1P84I 3QVZA 5KYXA 2EIKC 3G4ZA 4L74A 5B3IA 2CPSA 1HVVA 2KNHA 1SFCA 2Z5IA 2LD6A 4B6IA 4OIQF 1SMYF 1NKZB 1KV4A 1SQBG 1LKXA 1SQQG 3VMXA 2GUVA 2FFDB 2P10A 5APUA 3D71A 4U9DA 2YZSA 1G1IA 2QE7H 2JEEA 1NJIQ 3WUVA 1NAYA 3FHDA 2PP6A 4BJ6A 1L4AD 4KNVA 1GL2A 2KXPB 2LFDA 5K0IA 2O3JA 3RK2C 2NG1A 3L71G 4H13B 3G4SP 1A41A 1A02F 2HSBA 1RE4C 4D6TD 4CIPA 5L0CA 4N4WA 3AE9C 2BL2A 3LNRA 4NQFA 1XZPA 1FNTc 1EKYA 2A0UA 4GYTA 3KYIA 1SQQD
chains in the Genus database with same CATH topology
1GMJA 4PV1D 4XEFA 1ZOYC 1KMIZ 2D2CC 2E76C 1JB0J 2QSIA 3GM3A 2IDBA 3O10A 3K7DA 2BEZF 1OW7A 2E75C 4Y28J 4H0LD 3B71A 4R4LA 3Q5PA 2E74C 2YIUC 1K40A 3AE4C 3Q2YA 2G3AA 1K04A 5M1BA 2L6HA 4XEVA 2O01J 3AE8C 1K05A 1S5LX 3GF3A 3RL0g 2LK4A 3AE1C 1KILE 1NYHA 1PIXA 1UIXA 1YQ4C 3AE7C 4IL6X 5L8RJ 1VL2A 4YTPC 3GM1A 1FDOA 3AEEC 1DD4A 3C8GD 4OGQD 3H25A 1KTMA 1EXJA 1EXIA 1ZRTE 4RKUJ 3U0CA 2E75B 3S9OA 3G9RA 1UFBA 3LW5J 4H13D 1OMIA 2WSFJ 4I7ZB 4R4MA 2ZT9D 1OW6A 3IN6A 1VF5B 4OGQB 1ZZPA 3AEFC 4GDOA 2D2CB 2E76B 2KK1A 1V4AA 1MKMA 3AEGC 2FYNC 1KNYA 2NZ2A 1YQ3C 1R8EA 2JX0A 3D6YA 2JP3A 1O3UA 3AE5C 2Q00A 1Q90D 3R4YA 1VF5C 3U3FA 3D6ZA 2YWAA 4R32A 2WSEJ 3C18A 2E75D 2H88C 4XEKA 3Q5RA 2J5UA 4H0LB 1KQGB 2MKVA 3C8GB 4H13C 3T97B 1RQUA 1WWPA 3GF7A 5F28E 4PV1C 4EBKA 4H44D 3SFDC 1KORA 3MFNA 3AJMA 3BRJA 1HF9A 2YMKA 3IAOA 1RQVA 3AEDC 4H0LC 3Q3DA 4TT3H 2WSCJ 1S1CX 1VF5D 4KT0J 3SFEC 3C8GA 3TULA 2L6FA 3O6QA 2ZT9B 4H44C 2JO1A 2H89C 2QJKC 3GLMA 1DIPA 1PV3A 2QJYC 3L8JA 3RQFA 4OGQC 2G8YA 3RK3E 3RQGA 4EBJA 1WMKA 4YXDC 3GMAA 2E74B 2PBEA 2WPVB 2FXPA 2ZT9C 1OW8A 2QIWA 2V7QJ 1PL5A 2D2CD 2E76D 3JYYA 1AJYA 3RQEA 5KKZC 3FGAD 4U7JA 4Z1MH 2P10A 3D71A 3Q5SA 2JPUA 3AEBC 3GM2A 1DD3A 3AEAC 1JOGA 2BEQD 3JZ0A 4PV1B 1ZMEC 3ABVC 3AECC 1TU3F 1ZP0C 1KQFB 3Q1MA 1WOLA 1FDIA 3AE6C 1Y9BA 1NGMB 3AE2C 4I7ZC 4H13B 2FBWC 3C8VA 2K9YA 1HJ0A 2QJPC 2WQYC 2HSBA 2E74D 3L8IA 4H44B 3AE9C 3D70A 1U57A 4NQFA 3AE3C 4XFJA 1QVXA 1WTYA 5KLIC 3EWKA 1IK7A 2L6GA 2OQQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XEF A;  1ZOY C;  3O10 A;  3K7D A;  1OW7 A;  3B71 A;  1K40 A;  3AE4 C;  2G3A A;  1K04 A;  2L6H A;  4XEV A;  3AE8 C;  1K05 A;  2LK4 A;  3AE1 C;  3AE7 C;  1YQ4 C;  4YTP C;  3GM1 A;  3AEE C;  3C8G D;  2L6G A;  1KTM A;  3U0C A;  3S9O A;  1UFB A;  1OW6 A;  1ZZP A;  3AEF C;  2KK1 A;  1V4A A;  3AEG C;  1KNY A;  1YQ3 C;  2JX0 A;  1O3U A;  3AE5 C;  2Q00 A;  3U3F A;  2YWA A;  4R32 A;  3C18 A;  4XEK A;  2H88 C;  3C8G B;  1WWP A;  5F28 E;  4EBK A;  3SFD C;  3MFN A;  3AJM A;  3BRJ A;  3AED C;  3SFE C;  3C8G A;  3TUL A;  2L6F A;  2H89 C;  3RQF A;  1PV3 A;  3L8J A;  3RQG A;  4EBJ A;  4YXD C;  2PBE A;  1OW8 A;  3JYY A;  3RQE A;  2JPU A;  3AEB C;  3GM2 A;  3AEA C;  1JOG A;  3JZ0 A;  3ABV C;  3AEC C;  1ZP0 C;  1WOL A;  3AE6 C;  3AE2 C;  2FBW C;  2HSB A;  2WQY C;  3L8I A;  3AE9 C;  4NQF A;  3AE3 C;  1QVX A;  1WTY A;  3GM3 A; 
#chains in the Genus database with same CATH topology
 1GMJ A;  3L74 E;  1HY5 A;  3T6G B;  3K7D A;  2FFD C;  3U59 A;  3EHM A;  5AGF A;  3H1L D;  4HKZ H;  1D0X A;  3EGX B;  2HV6 A;  1K04 A;  3AE8 C;  1DOV A;  2VH3 A;  3DAG A;  1UG7 A;  2QG4 A;  3A9C A;  5L8R J;  4A2N B;  2EIJ C;  4O9B A;  3M9Q A;  2QNL A;  1D7M A;  4JE9 A;  3M9B A;  2HV7 A;  2WVR A;  4MVZ A;  1ZRT E;  1ZLL A;  1H89 A;  3M0D A;  3HKK A;  2PF4 E;  3U9M A;  3NYJ A;  1JY2 N;  2XLO A;  2YMY A;  3QH9 A;  1MMD A;  1CGM E;  4I3M A;  2LKM A;  1HMD A;  2J9U A;  4LER A;  3H1L J;  3FXH A;  2JP3 A;  5CBO A;  4HYT B;  2WT7 A;  1Y47 A;  1BR2 A;  1LJ2 A;  2GWW A;  1IFI A;  1ZW3 A;  2QJK B;  2R3S A;  3JT1 A;  2CGE A;  4N78 D;  5L0J A;  1NFN A;  3LAY A;  4TLF A;  4GEH A;  1NU1 D;  2QE9 A;  1KOR A;  1LWU B;  3FAP B;  1NTM D;  1GS9 A;  1IFN A;  3Q3D A;  3L75 G;  1WRG A;  1VF5 D;  3L70 J;  2FFH A;  1WN0 A;  5DS6 A;  1Z5Z A;  3RQF A;  2HYN A;  1SS1 A;  3VM6 A;  4U5F E;  1Y8A A;  3MUD C;  2OEV A;  1FBM A;  5AW7 B;  2E74 B;  4G78 A;  3FWL A;  4YL1 A;  4J30 B;  1Q0F A;  2EPK X;  1LTT C;  1S9K E;  5KKZ C;  3CXH E;  3S29 A;  4C7N A;  2XZR A;  4P9F A;  3CC4 P;  5CJ4 A;  4EUK B;  2RD9 A;  1OVU A;  4BWN A;  4JTD B;  4O7G A;  2W45 A;  4BG0 A;  1E84 A;  1BZ4 A;  4DOZ A;  4DXW A;  5JS5 A;  3I5P A;  1HJ0 A;  2WQY C;  1FJK A;  2E74 D;  3IPM O;  1NLX A;  1T6U A;  4JRZ A;  1BGY J;  4XTK A;  1ORS C;  3TJ5 A;  3LS0 A;  4IFF A;  1K73 Q;  1M1J C;  1IK7 A;  2XKM A;  1J1D B;  2OQQ A;  2PFX A;  4PV1 D;  1LIH A;  1E85 A;  5APY A;  5CCH C;  1FE6 A;  2KS1 B;  1DH3 A;  3K1I C;  1KYO D;  1H88 A;  1IW7 F;  2E75 C;  1ZHW A;  1PPJ E;  2KZI A;  3A0H E;  3ATP A;  1FOS E;  1EI7 A;  1M57 D;  2XLD A;  3TGU J;  3SZR A;  2KNC B;  2A45 H;  3QW1 A;  4U3F E;  1H6G A;  3N2Z B;  1EZV E;  1YJ9 P;  4D6T E;  2NUP B;  3L36 A;  4F4B A;  5E3C A;  1R4T A;  2KC3 A;  3UMI A;  3VYI A;  3E1I A;  1I5N A;  1SQX D;  4IL6 H;  1SF8 A;  4W8K A;  3WAQ A;  2F22 A;  3KL4 A;  1SQQ E;  4OVN F;  1LE2 A;  1D1C A;  1BE3 G;  1V54 C;  3RK3 B;  1KB9 D;  3KYJ A;  2NZ2 A;  1RKC A;  3EFO B;  3S28 A;  1IO4 A;  2K37 A;  2P58 A;  1ZR4 A;  3ZC4 A;  3V5Y A;  2ZPA A;  1RQU A;  3WUU A;  2W4M A;  4H44 D;  3L73 D;  4E0I A;  3TOM A;  1H0T B;  4DOJ A;  1SP4 A;  2QJY B;  5APX A;  1FS0 E;  1SQX J;  3AED C;  4PK4 A;  4FWV A;  1YIT P;  2HPC B;  1PP9 G;  3K33 A;  2IBZ D;  4WGZ A;  3VRC A;  1S4X A;  3MX3 A;  4E17 A;  2LXC B;  2H89 C;  2R44 A;  3TK0 A;  4D4X A;  2G8Y A;  4NTB A;  2Y3D A;  1OX3 A;  5AVW B;  5FCL A;  1J1E B;  1S7Z A;  2D2C D;  1R5L A;  1AJY A;  2RMZ A;  1M57 C;  3FGA D;  3LJB A;  1XTC C;  3AEB C;  3DD7 A;  3AEA C;  5BQI A;  1D0Z A;  3H1I G;  3MTU E;  4XPW A;  4RD9 A;  2A1D D;  4GQH A;  4LLC A;  3B0V C;  1FDI A;  1Y4C A;  1VQM P;  3C8V A;  3B29 A;  5F5H A;  1SQB K;  1HW2 A;  2YEV A;  1OVV A;  3B9Q A;  3TNU A;  1NTK G;  1I4Y A;  5BQG A;  3T6B A;  4YT2 A;  1BR4 A;  2Q3I A;  1WTY A;  3CWB J;  3GM3 A;  3TYY A;  1FZG A;  3G3Z A;  4BJ1 A;  1H7I A;  2R02 A;  3KKB A;  3VP9 A;  4QI0 A;  1VQP P;  4A7P A;  2Y3G A;  3GWN A;  3BRV B;  2PP4 A;  4KI2 A;  4U5E E;  3GF3 A;  2IBZ E;  3LES A;  3A2A A;  1T2K C;  3V7O A;  4YTP C;  3A3Y B;  4OH8 B;  3O8Z A;  2XLW A;  1URQ B;  2R7W A;  1AVY A;  3B5N B;  1FDM A;  1EZV D;  1RE3 C;  4G7H F;  3RL0 D;  4MVR A;  4EKW A;  2YO2 A;  2WSF J;  2UWJ E;  1P84 D;  5JUA A;  2ZT9 D;  2Y0E A;  3EFO A;  4PFP A;  2LR2 A;  2VCB A;  2L7A A;  5L0I A;  1AVO B;  3L70 E;  2QA4 P;  1MFZ A;  3S0X A;  4K3A A;  2SPZ A;  5B5E H;  5COM A;  1YQ3 C;  2JX0 A;  2VRS A;  2G3K A;  2DYS C;  2NUT A;  1VF5 C;  2YWA A;  4OIN F;  2G62 A;  2J5U A;  5APS A;  2FYN B;  1QZX A;  5KLV D;  3QTH A;  1KYO I;  2XDJ A;  4EBK A;  1RXQ A;  2Q5U A;  3SFD C;  1LT9 A;  5AC4 A;  2M0B A;  2N1T A;  5AVY B;  2OTL P;  3PHF 2;  2NPS D;  3IHU A;  2YKQ A;  2QJK C;  3H1I J;  5AW0 B;  1OKK A;  1X22 A;  1LI5 A;  1OCO C;  3Q6M A;  1YJN P;  2J7P A;  2WZL A;  2WIT A;  3CL3 D;  3CQZ A;  4CDV A;  5CCH A;  5H2F E;  2WB7 A;  1OFC X;  2AEJ A;  2J9W A;  4U7J A;  4GOF A;  1A7D A;  3L73 E;  5AVX B;  3N0T A;  1Q86 Q;  1JCD A;  3CXH D;  2R7X A;  4CDY A;  4EYY Q;  2Q9A A;  1Z7Q c;  2N1T C;  4WY4 D;  4K1O A;  2MHR A;  4K0D A;  2M3E A;  3E7K A;  3IQC A;  3VN0 A;  1EDJ A;  2DW3 A;  2FBW C;  1JM0 A;  1NTM E;  2R5B A;  1RH5 B;  1LNQ A;  2YLG A;  4ZLC A;  2J9V A;  4YJW A;  1JCC A;  1RE3 A;  2E76 C;  1NSG B;  3MZW B;  3BAT A;  2FAP B;  1Q81 Q;  4G0H A;  1MFT A;  3CEX A;  1T3J A;  3C63 A;  3KMI A;  1W2W A;  5KYY B;  4U3F D;  1V74 B;  2L6H A;  3NKD A;  2IFN A;  4Q4Z F;  1M2V A;  5C39 A;  1NYH A;  3F89 A;  2FKW B;  4X0R A;  1KIL C;  4DBQ A;  4N6H A;  2QM7 A;  4CX9 A;  2HSQ A;  1JRA A;  3U0C A;  2E75 B;  1FAV A;  1L0N K;  1QLE D;  4JTC B;  3RIP A;  1OMI A;  1NWQ A;  1TWA A;  2ZXE B;  1Q0M A;  1VQ6 P;  2PX0 A;  1QKR A;  2E76 B;  2HMQ A;  4LAC B;  5B66 H;  3NFQ A;  2M64 A;  3TNU B;  2EPO A;  2E43 A;  2VCC A;  4U5G A;  5GTI H;  2R3C A;  1DOW A;  4U3F J;  2WTY A;  2XS8 A;  3L1M A;  1XWJ A;  1NKN A;  1Q2N A;  2E75 D;  3CCU P;  2R5D A;  2Z5H A;  1CZQ A;  1KU2 A;  4D4N A;  4PV1 C;  1ZRT D;  3K1H A;  1NG1 A;  3BRJ A;  1HF9 A;  2YMK A;  4W80 A;  1TKN A;  2XM0 A;  3EG9 B;  3V5Z A;  4I2L C;  2N9Y B;  3C8G A;  2JJL A;  5BU8 B;  2ZT9 B;  2B0J A;  4N6J A;  2KSJ A;  4LGD E;  3WU2 E;  2KS1 A;  2V4H A;  1M6T A;  1QSP A;  4IWB A;  4UB8 E;  4GOE A;  2AXT H;  4NC3 A;  2HUJ A;  1LM3 B;  2PRR A;  2WPS A;  2FXM A;  3CWB E;  1BGY G;  1VQ9 P;  5L0G A;  3A0H H;  1SFC D;  3L74 J;  1N1C A;  1K9M Q;  2BEQ D;  1AUE A;  4JUR I;  4EWC A;  4PV1 B;  3JC2 2;  1T3U A;  3AEC C;  2PAJ A;  1YI2 P;  4MW3 A;  1GL2 B;  2A06 G;  3C8Z A;  1C03 A;  2K9Y A;  3CX5 D;  2IYP A;  4DJG A;  3DXJ F;  2YO3 A;  5BUO A;  3B5N D;  1YYC A;  3CCV P;  3M9H A;  1DEB A;  1SQV J;  1DIP A;  5KYW B;  3V2N A;  4CSA C;  4PAC A;  2ICW G;  5TIS E;  1UII A;  3L74 D;  3CXH H;  1PGQ A;  3UMK A;  1K40 A;  3VMA A;  2HZ8 A;  4LC1 A;  2Q6Q A;  4C7O A;  5KYX B;  1Q0D A;  1YQ4 C;  1LWU A;  3I56 P;  4J7Y A;  2IYL D;  2KIK A;  1VL2 A;  4J32 B;  3CX5 H;  2B0H A;  3BCC G;  3KH2 A;  1MMG A;  1BGY D;  1G5Z A;  5AVR B;  2Q7R A;  3SWF A;  1GK6 A;  1IFJ A;  2WPQ A;  1K8A Q;  4CIH A;  3II6 A;  5TIS H;  4I7Z B;  5KYW A;  1QGK B;  1ZHY A;  1LTJ A;  2ZYG A;  4CSA A;  4O79 A;  5KJ7 A;  1URQ C;  5DS5 A;  1LTG C;  1Z23 A;  4CS7 A;  1PD0 A;  5KKZ B;  3RH3 A;  1P84 E;  5CJ0 A;  3S4R A;  1R5I D;  1QEX A;  3TGU D;  2HG5 D;  4JF7 A;  5AW6 B;  3P8M C;  3RVZ A;  1E83 A;  3EJN A;  1TR2 A;  1EDL A;  3NRH A;  1RKE A;  3AJM A;  3IAO A;  2XV5 A;  2YL7 A;  3L72 E;  1ZYR F;  2R7O A;  3T97 A;  3X1O A;  2A06 D;  3M79 A;  2W90 A;  3P8C E;  3GOD A;  2QJY C;  1BCC E;  3CCS P;  2Y0C A;  1G8X A;  2A6H F;  1H8A A;  3RK3 E;  3SXZ A;  4DJ9 A;  2R32 A;  2KB7 P;  2AEF A;  1YAU O;  3M1C B;  1Q0K A;  3G6E P;  1EC5 A;  2GUS A;  3RYL A;  5CCH D;  4BJ5 C;  3GWL A;  1ZU5 A;  3M0D C;  4JCZ A;  5T3T A;  2DYR C;  1YBK A;  4Z1M H;  3DZA A;  4C46 A;  4WY4 C;  3GM2 A;  2J7P D;  1L0N J;  4MTO A;  4L6R A;  5L0F A;  5AW4 B;  3M4C A;  4GKG A;  1VOM A;  4GIF A;  2LP4 A;  2PX3 A;  1SQQ K;  2WT7 B;  2M3B A;  3SNH A;  2W6J H;  2WSE H;  3GAN A;  2C03 A;  4EI2 A;  2QM8 A;  4C3E A;  1A7V A;  4DRI B;  3KQG A;  1JY2 P;  1FMW A;  1M56 C;  2HLO A;  1ZHX A;  2W6A A;  4B86 A;  2HOD A;  2QY9 A;  1RJ9 A;  2OYH A;  1GM5 A;  5DJU B;  2C9L Y;  3AE4 C;  1JY3 O;  1LWU C;  1FZE A;  2PFD A;  4XEV A;  1YDI A;  1FAP B;  3HUS B;  5CBN A;  2IYO A;  1UIX A;  2OYI A;  1T8Z A;  3WG7 C;  2BCC E;  3QVY A;  4N6C A;  5DQT A;  3LID A;  2OTJ P;  3EGX A;  1DD4 A;  3ABK C;  3H1K J;  1EXJ A;  2XL8 A;  3G9R A;  2R9R B;  3MD0 A;  1LT9 C;  1LTJ C;  2CCY A;  1D0Y A;  3JSE O;  3AG1 C;  3K6B A;  4RDA A;  1SQX E;  2LFF A;  2XLE A;  1ZZP A;  1VLT A;  1SQX G;  1MKM A;  3Q7L A;  1R8E A;  1L0L E;  1NU1 K;  3K5B A;  3V2P A;  2Z4E A;  3JRM O;  4MVU A;  4IAQ A;  3KZI H;  2ZXW C;  5APV A;  4M3L A;  4A4A A;  2Y3H A;  1KQG B;  1KFM A;  1OKK D;  1ZVZ A;  1PD1 A;  1G4W R;  1GGQ A;  1WAT A;  1N73 B;  1GU4 A;  5CIV A;  3UGO A;  1RF1 B;  4ZLD A;  1IK9 A;  1M1J B;  5GTH E;  5B1B C;  2W8Z A;  1C17 M;  1PZQ A;  1RMV A;  2YXR B;  1YVI A;  1NTZ K;  1SFC B;  4CS9 C;  3H1H G;  1MND A;  4YL0 A;  1X8Y A;  3VMY A;  3C7J A;  1L2P A;  2R7R A;  2IXP A;  3RVY A;  1EZV G;  1W5C E;  2ASR A;  4O6N A;  3GOR A;  1X0T A;  3VTP C;  2W6B A;  1YA7 O;  1ZME C;  1NAF A;  3NTN A;  1OXB A;  3ABV C;  2WZF A;  3Q7G A;  4XQ1 A;  4U3F G;  2XLV A;  4IFD K;  1HH0 A;  3MYI A;  4BJT A;  3Q1M A;  1BE3 E;  2ZXP A;  1W2E A;  3H1J E;  3AE2 C;  4Z9J A;  1VMA A;  5KAF E;  1OXK A;  4I6M C;  2P67 A;  2C04 A;  3P7K A;  2Q7C A;  1KB9 H;  5CCG D;  1G1J A;  1T6I A;  3M15 A;  1HGZ A;  4P9T A;  2QLA A;  2FYU E;  1RCP A;  1QVX A;  2LIG A;  2XND H;  1T01 A;  2A6E F;  1EQ1 A;  1ZOY C;  4IAR A;  1QL2 A;  2LXB A;  5H2F H;  1E2X A;  2I1K A;  5GTI E;  1N7S B;  3I5C A;  1VYK A;  3EHN A;  4OD5 A;  1CW5 A;  3BVH A;  3E9V A;  3L34 A;  1K05 A;  1S5L X;  3RL0 g;  4NTA A;  3MIW A;  2YL1 A;  3U5S A;  3CPW O;  1I4Z A;  1JR8 A;  1YYJ A;  5L0H A;  4RES B;  1RE4 A;  3VP8 A;  3MBG A;  4RKU J;  1H9T A;  4HH2 A;  1MMA A;  2GDC A;  1BDC A;  2P0N A;  1NH4 A;  1KIL B;  2C9N Y;  2Y9Y A;  1TWH A;  3A0B E;  2NPS B;  3E70 C;  4IAO A;  4C3D A;  4BRY B;  4OGQ B;  3O6X A;  3H32 B;  3I4U A;  1JMB A;  1G4U S;  4IOI H;  1QLE C;  5L3V A;  3H1I E;  2OGU A;  2UUI A;  2IM8 A;  1NU1 J;  3AGU A;  2CNW A;  2CPB A;  2RSE B;  5E3A A;  3MHV A;  4CS9 A;  3CMA P;  4XEK A;  2KZJ A;  3U2L A;  4MVO A;  3JCU E;  1OCC C;  2H43 A;  4NY3 A;  3IQ6 A;  2FYZ A;  1JO5 A;  5CMZ A;  4JZA A;  2JWD A;  2OOC A;  1FOS F;  3AG3 C;  3VOP A;  2WSC J;  4IL6 E;  1CPQ A;  2YXQ B;  5CCG C;  3SFE C;  4WY4 B;  2L6F A;  3EZI A;  3L71 D;  1ZHT A;  3GLM A;  2J58 A;  1HGV A;  3H1L E;  2Y39 A;  4OGQ C;  3JSV C;  1M1K Q;  1L4A C;  3EQ2 A;  2ZT9 C;  2TMV P;  1IFM A;  2P6V A;  2HPC A;  1LS4 A;  2R25 A;  2BCC G;  2E76 D;  1LTI C;  3JYY A;  3X2Q C;  4E7S A;  3LW5 H;  3H1H D;  2KLU A;  2NPS A;  1U89 A;  1M56 D;  3DE9 A;  4UB6 E;  1H0T A;  1SQB D;  2KOG A;  2K9J B;  3L72 J;  3SXY A;  3U1A A;  4L76 A;  2OG2 A;  1ZP0 C;  1FFT C;  1VDF A;  3V5B A;  1HBW A;  4ULW A;  2ZYA A;  4ZKP A;  3TGU E;  2XXA B;  4IFM A;  3SEO A;  3HE4 A;  4GOD A;  3TGU G;  1U57 A;  2K3R A;  2NPU A;  2ZYD A;  5DLJ A;  3EWK A;  3UR3 C;  3H6P A;  4AL1 A;  5B3S C;  2Y3B A;  1CGN A;  2AWY A;  3HE5 A;  1JB0 J;  4KC9 A;  5B5E E;  2IDB A;  1JY2 O;  2XS1 A;  1L0N E;  4QDL A;  2R7S A;  3Q5P A;  4IB4 A;  2HMZ A;  5AVQ B;  1Y6D A;  2IX7 C;  1N7L A;  3H1J D;  3IF4 A;  3RL0 B;  2EPN A;  2KNC A;  3CAX A;  1AQ5 A;  2LSE A;  4H13 D;  1MV8 A;  2KUB A;  3FMS A;  4J7T A;  3HRN A;  2K1A A;  1FJP A;  3O39 A;  3RKO F;  3SWY A;  1SQP J;  1J8Y F;  1LVK A;  3DWW A;  2OTK E;  2B9B A;  2IXM A;  4I1O B;  1FZC C;  2W27 A;  1NTM G;  4H0L B;  3S1K A;  1ZW0 A;  2A45 I;  4MN4 C;  1M1J A;  1J2J B;  3W2W A;  2CNW D;  1N73 A;  3LS1 A;  4C7N B;  1E79 H;  1GL2 C;  3ABM C;  1BCC D;  4BXL A;  3M91 A;  4TT3 H;  3EGD A;  1S1C X;  1L7C A;  1LT1 A;  3GG2 A;  3B4S A;  4H44 C;  2FY8 A;  1D1B A;  5CHX A;  3LNM B;  1SQP D;  4EBJ A;  4PJ0 H;  4LDR A;  2FYU J;  2AP3 A;  5L0D A;  3MUD A;  1ZXG A;  1QL1 A;  1BDD A;  3FVY A;  2Q4F A;  2M8R A;  1WAS A;  2HS5 A;  2OJQ A;  5APT A;  3W67 A;  1LP1 B;  4WAB A;  5A6K A;  1DD3 A;  2POH A;  1E86 A;  3N24 A;  4N3Y B;  3BCC J;  1KYO H;  4GT1 A;  2OJE D;  4IJJ A;  2WSF H;  1KQF B;  3PDM P;  3P8C D;  3FXE A;  1C02 A;  2RH0 A;  4OD4 A;  5BQH A;  4M63 A;  4H44 B;  3DAF A;  3A5T A;  3S90 A;  3AE3 C;  3ITK A;  1NU1 G;  3H2V A;  3KPE A;  4MQ9 F;  2L6G A;  5HSW A;  1HW1 A;  3HLZ A;  1NTK D;  1NO4 A;  1YZA A;  3BEH A;  4HFF B;  4JPZ B;  3C62 A;  2O01 H;  4AE4 A;  1YZC A;  5B1A C;  2L5G B;  2M4E A;  3B8E B;  4BEJ A;  5M1B A;  1L0N D;  1JNM A;  1FR0 A;  1YTZ T;  3G50 A;  2YHS A;  4I1M A;  5A69 A;  1BR1 A;  2D4U A;  3IQT A;  4XPX A;  3HNJ A;  3OJA B;  2QUP A;  3KHU A;  1FMV A;  3HNL A;  3CLQ A;  3HUS C;  3W8H A;  3U1C A;  2O1J A;  4W8P A;  2YKO A;  2CK3 H;  1J8M F;  3EPV A;  4ONS A;  1FC2 C;  2IFM A;  1OQC A;  3OA7 A;  2HR3 A;  4JTA B;  3DMD A;  3VF0 A;  1APC A;  5KLV E;  5IY5 C;  2AVK A;  1FFH A;  1KQL A;  3AEF C;  5AW2 B;  2GA1 A;  3L74 G;  2AXT E;  3CD6 P;  3AQC A;  3CCQ P;  1LTS C;  1YA9 A;  2YVK A;  1QVF O;  2WWW A;  4NPF X;  2H88 C;  2HKV A;  3CWB D;  4U9E A;  4HEA J;  3PCV A;  4H13 C;  3HD7 A;  1A02 J;  4PJJ A;  4ANJ A;  4CDA A;  4CS8 C;  3MFN A;  1AV1 A;  1EZV I;  2P7J A;  1YHQ P;  1KN7 A;  3UIA A;  2O9X A;  2R7T A;  5KAF H;  3AGT A;  3RBZ A;  2OAR A;  2HFE D;  1NOH A;  3PMR A;  1N8R Q;  1L0N G;  3W8I A;  1O5H A;  1URQ D;  2BCC D;  3MGN A;  2R7Q A;  2V7Q H;  2XNX A;  1V55 C;  1AQT A;  4WVZ A;  5B66 E;  2VAS A;  3W2V A;  1IZN B;  2QIW A;  1T9K A;  1DEE G;  1PL5 A;  5E79 E;  3GHG A;  2JKV A;  2R7V A;  1HE1 A;  4JKV A;  3V2R A;  1JTH B;  1N2D C;  2E42 A;  4C3B A;  1U7M A;  1NVO A;  3AE6 C;  1NGM B;  3TF5 A;  2C0W A;  2I8D A;  4U5H A;  2YKZ A;  2BCC J;  5GTH H;  1S72 P;  3V4Q A;  1FTS A;  3EFF K;  2AWC A;  3DJN B;  3H1K E;  4ZNC A;  3JCU Q;  3R2P A;  2DB4 A;  1KMI Z;  3O55 A;  3H1K G;  2Z15 A;  4K35 A;  3PLN A;  3O10 A;  1FZB A;  1OW7 A;  1SVF A;  4R4L A;  4JYB A;  2LQG A;  2QTV A;  2NRG A;  3H1I D;  3CI9 A;  4RO0 A;  3SXK A;  1J1E C;  5A6J A;  4IL6 X;  4P6I C;  3T9O A;  3AEE C;  1SQV G;  4MVS A;  2A69 F;  3H25 A;  1N73 C;  3RW0 A;  3L35 A;  3S9O A;  2FXO A;  2FYU K;  3WHN A;  3NYM A;  2YIU B;  2ZXX A;  1IC2 A;  3QWO C;  2KGO A;  3JTL O;  4JW1 A;  1O87 A;  1EQ7 A;  3IN6 A;  2G3V A;  1VTM P;  2JDI H;  1SFC C;  4WGY A;  2J0W A;  2VCA A;  3G71 P;  1DX7 A;  3FOP A;  3WU2 H;  3QZC A;  1YYX A;  1OIP A;  3U3F A;  4D6T J;  4UB8 H;  1T2K D;  1R5S A;  2MKV A;  3Q6N A;  3C8G B;  4KBL A;  2IBZ I;  1LE4 A;  5EHH A;  3ZTM A;  4FAP B;  4JJG A;  4CJG A;  1SQQ J;  4MND A;  3ZVR A;  3TDK A;  2N1T D;  5APW A;  2KQ9 A;  1SQP G;  3TK1 A;  1NTK E;  5CI9 A;  1SQP E;  1Z6A A;  1OR3 A;  3L8J A;  2DGJ A;  1IFP A;  3R7C A;  3ZIB A;  4YN0 B;  1NTZ J;  2GA0 A;  2J0X A;  5AVZ B;  2PBE A;  2WPV B;  4DVZ A;  4IRU A;  1G2C B;  1VQ8 P;  3EZH A;  4C7R A;  3PRJ A;  3IEE A;  3RK2 D;  2JPU A;  1GDT A;  5KYU A;  1A7E A;  3HTK C;  2YKP A;  5AW3 B;  1L0L D;  3JZ0 A;  1LTA C;  1VQO P;  3FWN A;  1S9K D;  5E2Q A;  1N7S D;  3PJS K;  3CCJ P;  2CW0 F;  3L75 D;  1D1A A;  1JEK A;  3KYQ A;  2K9J A;  1SQX K;  1M2V B;  1NTK K;  5KYU B;  4XWJ A;  3S27 A;  3H65 A;  4YT5 A;  3N7N A;  1Z3I X;  3D70 A;  1MNE A;  5KYY A;  3HD7 C;  4HJG H;  2B87 A;  2B89 A;  1JOC A;  2A06 E;  4MS2 A;  3ZQV A;  2XL4 A;  1YLM A;  5DS4 A;  3H1H J;  4CJO A;  3KZI E;  2X51 A;  1Z63 A;  3KXD A;  1U7J A;  2L9J A;  1W2B O;  3G4X A;  4EIY A;  2LK4 A;  3L75 J;  2KSF A;  1H9G A;  4JIO A;  1OR2 A;  1FZC A;  2J45 A;  3IFM A;  3F47 A;  4W7Z A;  1QVG O;  2ZD9 A;  4XLP F;  1QPU A;  2A45 G;  1XTG B;  4I1L A;  5DJT B;  1VYI A;  3KPH A;  4EHP A;  1CI6 B;  2AXC A;  2P61 A;  3ABL C;  3JRT A;  3H1H E;  2I15 A;  2D2C B;  3H32 A;  2WVN A;  1KZU B;  4QI2 A;  1M90 Q;  3TD7 A;  3V6I A;  1RY3 A;  3L75 E;  1Q90 D;  1KIL A;  2WSE J;  5JVE A;  2X0C A;  1SQV D;  5D92 A;  1FU1 A;  3AOU A;  4MVQ A;  2FYU G;  2KK7 A;  2Q3E A;  3P32 A;  3E1R A;  4H0L C;  4HB1 A;  2MJZ A;  4AQR D;  1ZR2 A;  4MTF A;  1HMO A;  4KNW A;  2Y0D A;  1KIL D;  3EH2 A;  5JLI A;  2WSC H;  3O6Q A;  2JO1 A;  1GTW A;  4O6M A;  1XZQ A;  1PV3 A;  1KQS O;  2KI7 B;  1NTM J;  1EDI A;  2EPM X;  3RQG A;  1WMK A;  2B87 B;  4YXD C;  1SZI A;  3GMA A;  1VB5 A;  3ITF A;  4LLH A;  5JSL A;  3L70 D;  2Q9B A;  3O6Q B;  3H2U A;  5F5F A;  2J8W A;  1VLS A;  3USS A;  1RF0 C;  2EIM C;  3ASN C;  4KJM A;  3GW6 A;  3HE4 B;  4BPM A;  1PP9 E;  2XXA A;  1M7L A;  4WB4 A;  4XA4 A;  1GK4 A;  4YXW H;  2XL6 A;  1JOG A;  2XRH A;  2GAQ A;  2BE5 F;  3QW0 A;  4ASV A;  1HUC A;  2IOQ A;  3FX0 A;  4YT4 A;  4OIR F;  3HTK A;  3RL0 C;  5AC5 A;  5A6B D;  1URQ A;  1M8O B;  1BCC J;  2IZ1 A;  3JYH A;  1VQN P;  5D91 A;  2O1K A;  3EFG A;  1TWG A;  3SXM A;  1G2C A;  4WWI A;  4W7Y A;  2YNY A;  1PGO A;  5K5G B;  1KC8 Q;  4D6T G;  4ZMD A;  5T1D B;  3L73 J;  1SQB E;  2QSI A;  3C1L A;  2JR8 A;  2BEZ F;  3PH0 A;  4Y28 J;  5CCG A;  4WY4 A;  1AFO A;  2YIU C;  2H7V C;  2P1A A;  5A6B A;  3OWT A;  3BRT B;  1PPJ D;  1FZC B;  2JWA A;  3H1K D;  3BCC D;  3NMD A;  3GEE A;  2N9B A;  5EGY A;  1USE A;  2NSF A;  3GM1 A;  1FDO A;  3OW2 O;  5E33 A;  5A6A A;  2E87 A;  4EOT A;  3CC2 P;  3C8G D;  5KYN A;  2BC5 A;  3A7O A;  3K66 A;  2A0B A;  2KSE A;  3LIE A;  2KYV A;  4CS8 A;  2OCC C;  1HTL C;  1PGP A;  2R05 A;  2XM4 A;  2IBZ G;  3F5H A;  2OQM A;  2YRF A;  1GD2 E;  2D5R B;  2VC9 A;  1JMW A;  1TFK B;  1NTK J;  2FYN C;  3OEO A;  5KLV G;  1E5W A;  1O3U A;  5APQ A;  5E79 H;  4UDV A;  3D6Z A;  3TSI A;  4R32 A;  1OWA A;  3Q5R A;  4UB6 H;  3T97 B;  1SR2 A;  1EDK A;  1KD1 Q;  1M2O A;  1WWP A;  2FGY A;  2ETS A;  3FOO A;  5F28 E;  3S84 A;  1S2E A;  1JMM A;  1USD A;  1U0B B;  3ZDM A;  4JEA A;  1BBH A;  2R03 A;  2EIN C;  5COF A;  4U5D E;  5KAI E;  1LGH B;  2UUH A;  4AE4 B;  1CPR A;  3AG2 C;  2P2U A;  2OYH B;  3B0U X;  1PP9 D;  2HOD B;  1GU5 A;  1KB9 E;  2W4B A;  2FXP A;  2ZAE B;  1CGO A;  4G7O F;  1YAR O;  2V7Q J;  1N86 A;  1JPN A;  2H8A A;  4HE8 D;  4YT8 A;  3RQE A;  4AL0 A;  3Q5S A;  1U6H A;  1RF0 A;  1VQ7 P;  4ASW A;  4JYC A;  1QX8 A;  5JRA A;  1LS1 A;  5DVW A;  2C0X A;  2J59 M;  4OWF A;  5EFW B;  5TJH A;  5L3Q A;  4XPY A;  2ZVN B;  3HNK A;  3M0A A;  5AW1 B;  1FZA A;  3RGU A;  1NTZ E;  1X9V A;  1ORY A;  3CCE P;  2DI3 A;  3SP1 A;  1LP1 A;  1GZL A;  1OCR C;  3U9J A;  3ZQY A;  1ZV8 A;  3GHG B;  4C7O B;  1FZF A;  3UNG C;  3CCR P;  2OYH C;  2WVO A;  3L37 A;  3L0I A;  4U5C E;  4XEF A;  3KDP B;  4N78 E;  1Q82 Q;  3H1J G;  3GEI A;  2ZJS E;  4JBZ A;  1F1M A;  2E74 C;  2YL0 A;  2KW3 C;  2XLH A;  3LLK A;  2AEM A;  1GQA A;  2PNO A;  1KIL E;  1RKE B;  1TQG A;  1VK5 A;  1PCX A;  3HD7 B;  4PJL A;  1P84 H;  3NMJ A;  4OGQ D;  5FZT A;  2V3C C;  3JCU H;  3L72 G;  2WVQ A;  1SQV E;  1GW3 A;  2E5Y A;  4YK5 A;  3LW5 J;  1ZHZ A;  4ULV A;  4R4M A;  3WOD F;  3CCL P;  1OW6 A;  3I5Q A;  2YLD A;  3PP5 A;  4PD4 D;  4GDO A;  4JVS A;  4YWQ A;  2GM4 A;  1LTJ B;  3AEG C;  2ZXO A;  1MUU A;  3WUT A;  2J46 A;  3NMI A;  1PPJ G;  3CXH I;  3R4Y A;  1JY3 P;  1QQ3 A;  2A68 F;  1JPJ A;  1LTB C;  1NFO A;  1JUN A;  1WGW A;  2OEX A;  2IZ0 A;  5KTB A;  3US6 A;  1YJG A;  2JD3 A;  1VQ4 P;  3DE8 A;  1SQP K;  2QRX A;  3K1I A;  4PD4 E;  4K7B A;  5BVZ A;  5KLV J;  3TOL A;  3ZWI A;  5KJ7 D;  4ER9 A;  4RJT A;  2XLM A;  3T4R A;  2YQY A;  1VQ5 P;  2WZ7 A;  3U8P A;  3U8V A;  3HJC A;  3T6J A;  3L72 D;  1OCZ C;  5DQZ A;  4DCK A;  4LLE A;  5AVU B;  3J06 A;  1VPC A;  3CSK A;  4ZKU A;  3U2M A;  3TJ6 A;  3NMK A;  3H1L G;  2KJG A;  3WMM 0;  4EDF A;  3POV A;  1AEP A;  2RN0 A;  2Q1K A;  2ZXR A;  3L71 E;  1BSH A;  4DBR A;  4AK9 A;  1X79 B;  4Q7C A;  2RKL A;  2P1J A;  1BDJ B;  2R7U A;  4I7Z C;  2Y69 C;  2CYD A;  3AQB A;  1HWT C;  1JY3 N;  3CC7 P;  5COG A;  4CBE A;  5AW5 B;  4XLN F;  2H7H A;  1Z56 A;  1B68 A;  4PJ0 E;  1NTZ D;  1T5O A;  1OZH A;  2QVA A;  2NSG A;  2H7O A;  4E7Z A;  4XE5 B;  1NBB A;  2L81 A;  3NDB B;  1S5L E;  3W68 A;  4BJ6 C;  4H0L D;  3L71 J;  3B0P A;  2QJP B;  3FXD A;  4AX2 A;  3EGD B;  3HD7 D;  5KJ7 C;  1L0L J;  2I8B A;  2Q9C A;  1PIX A;  2ITA A;  5CI8 A;  3ZDL A;  3EQL F;  1TWC A;  2IBF A;  1KFN A;  3VAY A;  4BEM J;  2ZFC A;  4MTG A;  4FX5 A;  5AVT B;  1EXI A;  1ZN5 A;  1UFB A;  4NPD A;  2GFH A;  2HFI A;  4WBA A;  1S5L H;  1SQB J;  3PHL A;  2FFD A;  4MVM A;  3JSZ A;  3FDQ A;  5EK0 A;  1NHL A;  3UGP A;  1KNY A;  4G7Z F;  3AE5 C;  4Q5S F;  3C18 A;  3MP7 B;  1NTZ G;  3HTK B;  3CME P;  2Q9I A;  1BSN A;  1ORJ A;  3N4X A;  3F46 A;  2OKU A;  2KLV A;  3U3B A;  2XSE A;  1GW4 A;  3RF3 A;  3CWB G;  1T6A A;  1ZW2 A;  4JEB A;  4JCH A;  1KB9 I;  1KYO E;  2FYU D;  3FAJ A;  1N7S A;  3QMK A;  4O6Y A;  3CX5 I;  3IQ5 A;  3H1J J;  5GPG B;  1Q0G A;  3HE5 B;  2XU6 A;  1SLQ A;  2QEX P;  2MWQ A;  3RK2 B;  1WT6 A;  3ZG1 A;  256B A;  1NU9 C;  1PGJ A;  4L75 A;  2EPL X;  2NPS C;  1L0L G;  4DVY P;  1AVO A;  1MQV A;  2WSS H;  2EIL C;  4PFO A;  1OXZ A;  4H54 A;  2H8P D;  3L70 G;  4BJ5 A;  4Z9H A;  5KAI H;  3BAS A;  5BU5 A;  2HJM A;  4RBN A;  3CZ6 A;  2IPP A;  4I44 A;  1S05 A;  3RFY A;  4LDK A;  4Y99 B;  3NKE A;  4DRH B;  3ASO C;  3L8I A;  3I55 P;  3DI5 A;  2Q3T A;  3DKA A;  2B88 A;  1TFO B;  1T6Q A;  1CI6 A;  2YLI A;  3MYF A;  2D2C C;  1LI7 A;  3NXS A;  3BCC E;  2ZVO B;  3AG4 C;  1VQK P;  2J9B A;  1ZU4 A;  2W83 C;  1L4A B;  4CPG A;  3DM5 A;  4JC7 A;  3Q2Y A;  3RBX A;  1BE3 J;  1MMN A;  3EG9 A;  5KLV K;  1L0L K;  1NU1 E;  3AE7 C;  4JJF A;  2WL8 A;  1RF1 C;  2M5A A;  3UMH A;  1LT9 B;  1PFI A;  2LCH A;  1Q7Y Q;  5AW9 B;  2OYI C;  3L73 G;  4Y99 C;  1KTM A;  4L73 A;  3RK3 C;  1OVR A;  3VYW A;  1MZ9 A;  5AVV B;  3SYN A;  3HNI A;  2NUT B;  1L3P A;  3VMZ A;  5JP7 A;  2K88 A;  4JQ0 D;  4AUW A;  2KK1 A;  1V4A A;  4EIJ A;  2BAS A;  1IFD A;  4E18 A;  4YPC A;  3V5X A;  3D6Y A;  2Q00 A;  1BE3 D;  4NCQ A;  3NYL A;  3MLG A;  4OIP F;  4PD4 I;  2O01 N;  1BCC G;  4MW8 A;  5T3W A;  3L4F A;  2YL3 A;  3A0B H;  3NG1 A;  5TJ5 E;  1S3J A;  4QMA A;  2OYI B;  3A11 A;  3HUS A;  4PJN A;  1RQV A;  1IJD B;  3SWK A;  2OYO A;  4NTF A;  4IGG A;  4KT0 J;  3TUL A;  1YJW P;  1SYQ A;  3W4Y A;  4LDQ A;  1NTM K;  4KHX A;  3OAK A;  1N7S C;  1RJ9 B;  2KYH A;  3LEO A;  4EBB A;  2AU5 A;  4DRJ B;  1OW8 A;  4PD4 H;  4OIO F;  4H4K C;  2E5T A;  2KP8 A;  2IXO A;  1SQV K;  4AYC A;  2VB6 A;  4YL3 A;  1TU3 F;  1RHZ B;  3V2Q A;  5AVS B;  1YIJ P;  1WOL A;  3DJU B;  3CCM P;  1Y9B A;  3LUT B;  3RK3 D;  2M5A B;  2WZG A;  2QJP C;  4Z9I A;  4XFJ A;  5KLI C;  1GL2 D;  1HE9 A;  4BRY A;  1L4A A;  1PP9 J;  3ZTZ A;  3GHG C;  1VQL P;  2PGD A;  4DT0 A;  1LPE A;  2WPR A;  4HFK B;  3B71 A;  1NZE A;  2WMM A;  2OU6 A;  1YTZ I;  3M06 A;  1RF1 A;  2HJ3 A;  2G3A A;  1AA0 A;  3OA1 A;  2O01 J;  3B5N C;  2N1T B;  3AE1 C;  2L91 A;  3DM9 B;  1BGY E;  1J1D C;  2V26 A;  3M4B A;  5JT4 A;  4PR9 A;  1IZM A;  2Y9Z A;  4WJ0 A;  3GEH A;  3PTZ A;  4E0H A;  1A0B A;  2CDQ A;  3ECS A;  1HJB A;  5KLI B;  1CSB A;  1NU7 D;  3IR9 A;  3ZSU A;  4PJM A;  1VF5 B;  4DZO A;  4NPE A;  2P7V A;  5AW8 B;  3LEV A;  4FES A;  4N06 A;  3C9I A;  3EH1 A;  5HV9 A;  3V4W A;  1JAF A;  3SSU A;  1EA8 A;  2W9Y A;  3B5N A;  4U5B E;  3LLI A;  2I1J A;  2IXN A;  1JTH A;  3GF7 A;  3TQO A;  3CX5 E;  2H7B A;  2NUP A;  1ST6 A;  2MYS A;  1P84 I;  3QVZ A;  5KYX A;  2EIK C;  3G4Z A;  4L74 A;  5B3I A;  2CPS A;  1HVV A;  2KNH A;  1SFC A;  2Z5I A;  2LD6 A;  4B6I A;  4OIQ F;  1SMY F;  1NKZ B;  1KV4 A;  1SQB G;  1LKX A;  1SQQ G;  3VMX A;  2GUV A;  2FFD B;  2P10 A;  5APU A;  3D71 A;  4U9D A;  2YZS A;  1G1I A;  2QE7 H;  2JEE A;  1NJI Q;  3WUV A;  1NAY A;  3FHD A;  2PP6 A;  4BJ6 A;  1L4A D;  4KNV A;  1GL2 A;  2KXP B;  2LFD A;  5K0I A;  2O3J A;  3RK2 C;  2NG1 A;  3L71 G;  4H13 B;  3G4S P;  1A41 A;  1A02 F;  2HSB A;  1RE4 C;  4D6T D;  4CIP A;  5L0C A;  4N4W A;  3AE9 C;  2BL2 A;  3LNR A;  4NQF A;  1XZP A;  1FNT c;  1EKY A;  2A0U A;  4GYT A;  3KYI A;  1SQQ D; 
#chains in the Genus database with same CATH homology
 1GMJ A;  4PV1 D;  4XEF A;  1ZOY C;  1KMI Z;  2D2C C;  2E76 C;  1JB0 J;  2QSI A;  3GM3 A;  2IDB A;  3O10 A;  3K7D A;  2BEZ F;  1OW7 A;  2E75 C;  4Y28 J;  4H0L D;  3B71 A;  4R4L A;  3Q5P A;  2E74 C;  2YIU C;  1K40 A;  3AE4 C;  3Q2Y A;  2G3A A;  1K04 A;  5M1B A;  2L6H A;  4XEV A;  2O01 J;  3AE8 C;  1K05 A;  1S5L X;  3GF3 A;  3RL0 g;  2LK4 A;  3AE1 C;  1KIL E;  1NYH A;  1PIX A;  1UIX A;  1YQ4 C;  3AE7 C;  4IL6 X;  5L8R J;  1VL2 A;  4YTP C;  3GM1 A;  1FDO A;  3AEE C;  1DD4 A;  3C8G D;  4OGQ D;  3H25 A;  1KTM A;  1EXJ A;  1EXI A;  1ZRT E;  4RKU J;  3U0C A;  2E75 B;  3S9O A;  3G9R A;  1UFB A;  3LW5 J;  4H13 D;  1OMI A;  2WSF J;  4I7Z B;  4R4M A;  2ZT9 D;  1OW6 A;  3IN6 A;  1VF5 B;  4OGQ B;  1ZZP A;  3AEF C;  4GDO A;  2D2C B;  2E76 B;  2KK1 A;  1V4A A;  1MKM A;  3AEG C;  2FYN C;  1KNY A;  2NZ2 A;  1YQ3 C;  1R8E A;  2JX0 A;  3D6Y A;  2JP3 A;  1O3U A;  3AE5 C;  2Q00 A;  1Q90 D;  3R4Y A;  1VF5 C;  3U3F A;  3D6Z A;  2YWA A;  4R32 A;  2WSE J;  3C18 A;  2E75 D;  2H88 C;  4XEK A;  3Q5R A;  2J5U A;  4H0L B;  1KQG B;  2MKV A;  3C8G B;  4H13 C;  3T97 B;  1RQU A;  1WWP A;  3GF7 A;  5F28 E;  4PV1 C;  4EBK A;  4H44 D;  3SFD C;  1KOR A;  3MFN A;  3AJM A;  3BRJ A;  1HF9 A;  2YMK A;  3IAO A;  1RQV A;  3AED C;  4H0L C;  3Q3D A;  4TT3 H;  2WSC J;  1S1C X;  1VF5 D;  4KT0 J;  3SFE C;  3C8G A;  3TUL A;  2L6F A;  3O6Q A;  2ZT9 B;  4H44 C;  2JO1 A;  2H89 C;  2QJK C;  3GLM A;  1DIP A;  1PV3 A;  2QJY C;  3L8J A;  3RQF A;  4OGQ C;  2G8Y A;  3RK3 E;  3RQG A;  4EBJ A;  1WMK A;  4YXD C;  3GMA A;  2E74 B;  2PBE A;  2WPV B;  2FXP A;  2ZT9 C;  1OW8 A;  2QIW A;  2V7Q J;  1PL5 A;  2D2C D;  2E76 D;  3JYY A;  1AJY A;  3RQE A;  5KKZ C;  3FGA D;  4U7J A;  4Z1M H;  2P10 A;  3D71 A;  3Q5S A;  2JPU A;  3AEB C;  3GM2 A;  1DD3 A;  3AEA C;  1JOG A;  2BEQ D;  3JZ0 A;  4PV1 B;  1ZME C;  3ABV C;  3AEC C;  1TU3 F;  1ZP0 C;  1KQF B;  3Q1M A;  1WOL A;  1FDI A;  3AE6 C;  1Y9B A;  1NGM B;  3AE2 C;  4I7Z C;  4H13 B;  2FBW C;  3C8V A;  2K9Y A;  1HJ0 A;  2QJP C;  2WQY C;  2HSB A;  2E74 D;  3L8I A;  4H44 B;  3AE9 C;  3D70 A;  1U57 A;  4NQF A;  3AE3 C;  4XFJ A;  1QVX A;  1WTY A;  5KLI C;  3EWK A;  1IK7 A;  2L6G A;  2OQQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...