1K04A

Crystal structure of the focal adhesion targeting domain of focal adhesion kinase
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
142
structure length
142
Chain Sequence
EISPPPTANLDRSNDKVYENVTGLVKAVIEMSSKIQPAPPEEYVPMVKEVGLALRTLLATVDETIPLLPASTHREIEMAQKLLNSDLGELINKMKLAQQYVMTSLQQEYKKQMLTAAHALAVDAKNLLDVIDQARLKMLGQT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords FOCAL ADHESION KINASE 1
publication title The structural basis of localization and signaling by the focal adhesion targeting domain.
pubmed doi rcsb
source organism Homo sapiens
total genus 56
structure length 142
sequence length 142
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2001-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03623 Focal_AT Focal adhesion targeting region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.540 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 1k04A01
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 1k04A02
3C18A 3SFEC 3JYYA 4YXDC 3AE6C 1WWPA 4EBJA 3TULA 2Q00A 1V4AA 3RQGA 3GM2A 1O3UA 4YTPC 4XEVA 3AE3C 3AE4C 1OW6A 1K05A 4XEFA 3ABVC 1JOGA 1OW8A 4XEKA 3AE8C 3U3FA 4R32A 3AE9C 1KTMA 1YQ3C 1OW7A 1K40A 3AEAC 3RQFA 2YWAA 3MFNA 3C8GA 2HSBA 1KNYA 3L8JA 3AEEC 1WTYA 1ZOYC 3AEGC 4EBKA 3B71A 1YQ4C 3AEFC 1UFBA 2G3AA 1ZP0C 2H89C 3AECC 2LK4A 2WQYC 5F28E 3JZ0A 3O10A 3L8IA 3U0CA 3S9OA 2L6GA 3AEBC 1ZZPA 2L6FA 3AE1C 2PBEA 3SFDC 1PV3A 2FBWC 2JPUA 3RQEA 2JX0A 3GM3A 2L6HA 3GM1A 3C8GD 4NQFA 3C8GB 1K04A 2H88C 3AE5C 3K7DA 3AE7C 2KK1A 1WOLA 3AEDC 3BRJA 3AJMA 1QVXA 3AE2C
chains in the Genus database with same CATH superfamily
3C18A 4XWJA 3CCMP 2GUSA 3DM5A 2D2CB 3HD7D 1L0LE 4LLEA 1KB9I 4HJGH 2OEXA 2KI7B 5DQZA 4YTPC 2K88A 4I6MC 4YWQA 4JRZA 4WGZA 2C03A 2OYHB 5C39A 1A02J 1CPRA 2ZD9A 3LW5J 4NC3A 5F5HA 4EDFA 5JP7A 1P84I 3RK2C 1NGMB 3O6QA 4BG0A 2OTKE 4DBQA 2J58A 4GKGA 3S0XA 1LT9C 3RVZA 4PV1B 1IJDB 1OCCC 4E17A 3FXEA 1HGVA 4DVZA 4N6HA 3X2QC 3L34A 1OCRC 1JPNA 1NU1E 1WRGA 3AG4C 3GG2A 2G3VA 5CJ4A 2ZVNB 1M7LA 1OZHA 3VTPC 5KLIB 3DXJF 4O6NA 3LNRA 1JM0A 2I15A 3ZC4A 2ASRA 2B88A 1ZP0C 3ZTZA 3NFQA 3PTZA 1Y8AA 2PRRA 4C46A 4N78D 3JZ0A 2IFNA 4Q5SF 2J7PD 3LJBA 2O1JA 2L6FA 1VB5A 3PHF2 1VQ8P 2DGJA 1VQMP 1NOHA 4ULWA 4Z9IA 3FXDA 1N73A 4YL3A 2QSIA 2C0XA 2WPQA 3UMIA 4BXLA 3GM1A 3HRNA 4YT5A 3HLZA 2HMZA 3QVYA 3KKBA 4MVRA 1BGYJ 1JMBA 4U5HA 3L35A 1BCCJ 1LT1A 2VCCA 1SQVK 5DS4A 1OQCA 3V5YA 1NTKE 1PIXA 2KK1A 2ZT9D 2C0WA 1ZHWA 2OU6A 1RMVA 1KILD 3IR9A 2A0BA 3SXYA 4I7ZC 3VMZA 4FESA 2LCHA 2ZXXA 4MVQA 3U8PA 3FMSA 1Y9BA 2J9BA 3MD0A 1DX7A 2KSJA 4OGQC 3Q6NA 2OQMA 3U59A 3B0PA 1WWPA 1VL2A 3O8ZA 1ORYA 2QM7A 1DD3A 5GTIH 1NTZG 2JP3A 1D0YA 2YRFA 1N2DC 1SQQE 3FOPA 2PFDA 3V4QA 4M63A 5AVYB 1N73B 2FGYA 1NG1A 3DI5A 3L74D 2XV5A 3HNJA 1LS4A 4N6CA 1NHLA 3N4XA 2KNCA 2B9BA 3S90A 3G4XA 5KAIE 1MUUA 1OXKA 1KB9D 3LEVA 1TFOB 5L0JA 3VM6A 1H7IA 3L8JA 5KYYA 1KFMA 3HD7C 2W90A 1Z7Qc 2XL8A 4WY4A 1YJWP 3L74G 3LLKA 3OJAB 4O9BA 2FFDA 1Q90D 1FZAA 1P84D 4JKVA 3U2LA 3GLMA 2FKWB 2AP3A 1I5NA 1FZFA 3Q3DA 4U5EE 4CS8C 4GOFA 2WVOA 1A7VA 2H8PD 3TGUE 4KHXA 1X8YA 4DOZA 4Y99C 4BEJA 4JE9A 3WMM0 3MZWB 2YKOA 3VMYA 1J8YF 1RF0A 5CBNA 3Q7LA 4KT0J 1FU1A 5AVRB 1OVUA 1N1CA 4JJFA 1BBHA 2LQGA 4NPDA 4PJNA 2R44A 1APCA 2R7QA 2HZ8A 1L0LD 2AXCA 2JX0A 2KNCB 2L6HA 1AA0A 4BEMJ 4NQFA 1CSBA 1K04A 1GU5A 5E3CA 1S5LX 1FZBA 4CJGA 4BRYA 5B66H 4RD9A 5KYYB 3DD7A 1HGZA 4OIQF 2R7WA 2E76D 3CX5I 5EHHA 2FXPA 4EBBA 2FFDB 4BJ1A 4E7ZA 1VF5B 1L0LG 2A45G 4NPFX 2J9WA 1YITP 3J06A 3AE2C 3CCVP 2KB7P 4CPGA 1FR0A 1NU1D 4JEBA 2KP8A 2WL8A 5L0HA 3FOOA 2D2CD 5CCHA 1QX8A 1NLXA 4I3MA 4W8PA 1ZHYA 3CCRP 4BJ6C 3WG7C 3NTNA 1O3UA 2P1JA 2YO2A 1TWHA 2BCCE 2A6HF 3QWOC 1RXQA 2E87A 1NU1G 3RK2B 2QVAA 2N1TC 3CL3D 3BRVB 4KI2A 1KILC 4C7NA 1L2PA 4FAPB 1URQA 4LERA 3SP1A 4IJJA 4XPXA 2QEXP 3V4WA 3BEHA 1RJ9A 3WHNA 3NDBB 2IBZI 5AVVB 3L74J 4CBEA 1YIJP 2IXPA 5TISE 3DE8A 4H54A 3AEGC 1R5LA 1LE2A 2V7QH 3H1KE 4IWBA 1KYOI 3Q5SA 1ZRTE 1JY3N 1VPCA 5K5GB 2YIUC 1Q0FA 4CSAC 1FOSF 3DMDA 3QMKA 3RH3A 1FNTc 1FS0E 4H4KC 3HKKA 1PL5A 3WU2H 3EH1A 4YL0A 2CPSA 4DJGA 2QIWA 1Y47A 1Q0KA 2WTYA 2P6VA 4KNWA 3BRTB 4BJTA 3A0BH 2SPZA 1MNEA 2O01N 4YPCA 1NTMK 4C7NB 2Q1KA 3ITFA 1NTKG 1LTJA 4XA4A 4CJOA 2W45A 3U1CA 1RJ9B 2J0XA 2D5RB 1SQQD 2XKMA 3ZQVA 1L0LJ 1PD0A 2PF4E 1RCPA 2XLMA 2QJYC 2OKUA 1WOLA 2LD6A 1Q0MA 5BUOA 4I7ZB 1ZMEC 1IFDA 5A6JA 2IZ1A 1AEPA 4U5DE 4QI2A 1SQQG 2FYZA 2EIMC 3KPHA 5AGFA 1TU3F 1HF9A 3SFEC 2YLGA 3K33A 4GYTA 2Q9CA 1RE4C 3G4SP 5B5EE 1GTWA 2ZVOB 1ZV8A 3RYLA 1NU1J 3CX5D 4YXWH 3LAYA 2IBFA 3KQGA 5TJ5E 3JC22 1MFZA 2E76C 1LPEA 4EOTA 3U3FA 4ER9A 5AC5A 1LTJB 1ZVZA 2BL2A 2YMKA 1NU9C 4DCKA 3TGUD 3IPMO 1W2BO 2Q9BA 1EQ7A 4OVNF 1NAFA 1EZVE 4E7SA 2D2CC 3EQLF 5KTBA 3CCEP 1HY5A 3P8MC 2JDIH 3I56P 1YI2P 2HUJA 3FHDA 3TGUG 3NKEA 2Y9YA 4EYYQ 3CMEP 2OYHC 1HUCA 1JY2P 5AVXB 3A2AA 2PP4A 1RE3C 2RN0A 1LI5A 1JCCA 1XWJA 1DEBA 2BEQD 3V5ZA 1G4WR 3KZIH 3ASNC 3SYNA 4Y99B 4B6IA 2IBZD 1MKMA 3GORA 2WSCH 4PJ0H 3L72E 1VLSA 1FFHA 4MNDA 5CIVA 2XZRA 2HV6A 2YO3A 3TNUA 3EGDB 1KYOD 5D92A 2HG5D 2N1TA 2BASA 1E84A 5KLIC 4ZKPA 5DLJA 1PPJD 2P2UA 5T1DB 2E42A 3G50A 2IBZG 1LS1A 2ETSA 3M4CA 3H1LD 4DVYP 3PMRA 2FXOA 3UMKA 1NAYA 1SQVD 1G1JA 2BCCD 3IQ6A 1T01A 2GM4A 2WPRA 1ZLLA 4WY4D 4U5BE 3ZIBA 2VCBA 1SQQJ 3P7KA 2Y3BA 3K7DA 4OH8B 1S9KE 3H1LG 2A1DD 2IX7C 1NTME 2W4BA 3L1MA 4ULVA 1HTLC 2BCCG 2B89A 2Y3GA 1H88A 3QTHA 3OW2O 1DH3A 4WBAA 4GDOA 3K66A 4K7BA 1VYIA 3RQGA 5CBOA 3AG1C 3LESA 3ABMC 4LGDE 2RKLA 4E0IA 4OINF 3FGAD 4RESB 1K05A 2N1TB 3K5BA 4DOJA 2L7AA 4EKWA 4N78E 3T6JA 2HYNA 1M6TA 3B8EB 2IDBA 2O01H 2Q4FA 1FZGA 2R7OA 1NYHA 5KKZB 3SEOA 3N24A 1SP4A 1Z5ZA 2KIKA 1K73Q 3BCCD 2XXAA 3TGUJ 3I55P 3EHMA 2R7UA 3ECSA 4CS7A 4AQRD 1GGQA 1OIPA 4LLHA 1UIIA 4JTDB 5H2FE 1TFKB 3ABKC 2IXNA 3DAGA 3UNGC 3BCCG 4M3LA 3MYIA 4ASWA 1KILE 1V54C 4JJGA 3IEEA 5CCHD 2QM8A 1PGPA 2QJPC 2NSFA 2LXCB 4NCQA 4HYTB 4N6JA 4F4BA 1L3PA 4HKZH 4G7HF 3Q6MA 1LTSC 3AE1C 3CPWO 1VMAA 1D1BA 3ZTMA 3GODA 1URQD 1T3UA 5FCLA 5KJ7A 3S4RA 5E79E 1M1KQ 3QVZA 3FWLA 4E18A 2WITA 2XXAB 3O6XA 1N7LA 2LIGA 3PCVA 1QL2A 3L74E 3CCQP 4JZAA 1MMDA 3H1LJ 4A7PA 2C9NY 2XM4A 2HR3A 3U1AA 3AQBA 3BASA 2M64A 1SQVJ 2VRSA 4CIHA 2BCCJ 1KB9E 1DOVA 3A3YB 4GIFA 2V7QJ 2V4HA 4WWIA 1LVKA 3AJMA 3TSIA 2E5TA 4PJJA 4O79A 2W6BA 4CDYA 4EWCA 5TJHA 1T8ZA 1V4AA 2W8ZA 1YVIA 1SLQA 3OAKA 1GK6A 5F5FA 4EIJA 4NY3A 3U8VA 5EK0A 1BSNA 4WY4C 1S05A 4UB6H 1EZVG 2H7VC 2FFDC 2LFFA 2XLOA 1QVGO 1U7JA 5AW2B 4DRHB 2EILC 3L72D 4BPMA 1JY3O 2KS1B 4J7YA 2YWAA 1EA8A 4MVZA 4RO0A 3EQ2A 2BC5A 2OG2A 1S5LE 2FYNB 2Q3TA 4CS9A 1GL2A 2E43A 2WB7A 3RFYA 5BQHA 3B71A 2FFHA 1W2EA 1SR2A 2YXQB 3BCCJ 2M0BA 2Y0EA 1RF0C 4XFJA 3T6GB 3L72G 2X51A 2YHSA 5FZTA 1E5WA 3E1IA 3TK0A 5APVA 4PD4H 2R7TA 1JY3P 3TK1A 2XDJA 5KAFH 4RBNA 2XS8A 2AEMA 1S9KD 1NTMD 1MQVA 4JYBA 2AWYA 1A02F 3H2UA 5AVWB 5JT4A 3D71A 1F1MA 3U5SA 2FYUK 1W5CE 1VLTA 5DS5A 1XTGB 3SFDC 5AC4A 2P7VA 4PD4I 1FMVA 5CHXA 3M9BA 3GM3A 1NTMG 1G4US 5L3VA 3FAPB 3SNHA 3DAFA 5KYNA 2KYHA 5CCHC 1GL2B 3MGNA 1H0TA 2R7VA 2GWWA 2EPKX 1FDOA 2QA4P 4PFPA 2M5AA 2YNYA 5CI9A 2R05A 3V2PA 1TWCA 4JYCA 1SMYF 1PGOA 3H1HE 3RVYA 2XLWA 5IY5C 1QVXA 2RMZA 3O6QB 1ZW3A 5COFA 5D91A 2YL1A 4YN0B 2YXRB 3NRHA 5GTHH 1URQC 4MVOA 4PACA 2NUTA 1JOCA 2GA1A 5CJ0A 4OIRF 1YZAA 1NJIQ 3U3BA 4N06A 5GTIE 4HE8D 3S28A 2UWJE 1IFPA 1KMIZ 4H13B 4MTGA 1LTIC 1IW7F 5T3TA 1OW6A 2N1TD 4C3BA 3JRTA 4XEFA 3JT1A 1OW8A 2KW3C 3T6BA 4AYCA 1KTMA 3RL0B 1S1CX 3NYLA 5KLVK 2XNXA 5L0DA 3QW1A 3G4ZA 5APQA 1BDDA 4JVSA 1G5ZA 3MFNA 2WSSH 1H0TB 4CDAA 4OWFA 1VOMA 2M5AB 1OFCX 1KQLA 3L72J 5T3WA 4NTBA 5B3IA 1FDMA 4ONSA 1GMJA 3LS1A 1KORA 3L71E 2V3CC 4XQ1A 1BZ4A 3SWFA 3S1KA 1AQ5A 3B0VC 2WZ7A 5AW6B 1SFCA 3IHUA 1HMDA 3VYIA 2ZAEB 1SQXK 1LTJC 1U89A 3AQCA 3O55A 2Z5IA 3H1IE 1M2VA 2QJPB 3F89A 3HTKA 1IZNB 3RIPA 2K37A 1EQ1A 1WT6A 4A4AA 2CCYA 4UB8E 256BA 1L4AA 3MUDA 1FAVA 3L8IA 3S9OA 3NXSA 3EFOA 1C17M 1WASA 2BE5F 1NTMJ 2IOQA 3CX5E 1IK9A 3RBXA 2KGOA 2R32A 4LDQA 4D4NA 5AW8B 2J46A 2K9JA 1DOWA 3CCUP 4CDVA 2QE9A 3ABLC 1BR1A 2XM0A 1PCXA 4D4XA 3IFMA 1UIXA 4BJ5A 2H7HA 2W83C 5B66E 2XS1A 1YTZT 5L0IA 1NVOA 4PJLA 3L73E 3A0HH 5BQIA 3MTUE 4WVZA 1BE3E 1VQ6P 2WSFJ 2W6AA 4U9DA 4EHPA 3CI9A 3KXDA 4JTAB 1SFCB 3DE9A 3SWKA 3PH0A 3LUTB 4DRJB 3HTKB 4UDVA 3C63A 1Q82Q 4NTAA 1L4AB 1FAPB 4YK5A 3MYFA 3AE4C 2Q7RA 4WY4B 1KFNA 2IBZE 4I1OB 3EFOB 3S27A 1PZQA 1NU7D 5JVEA 5JSLA 3EH2A 3CQZA 4R32A 5KJ7D 4W7YA 2QG4A 4J7TA 1J2JB 3CCSP 1VQ7P 3P8CE 2K9JB 2WPSA 5AW7B 3WUTA 1YYCA 1QZXA 1KYOE 1FE6A 4WABA 4MW8A 1PPJE 3AG2C 3M06A 2HJ3A 2HSBA 1IFMA 1EDLA 3ATPA 2OARA 2NRGA 2X0CA 3H1LE 1ZW0A 2JR8A 1DD4A 1GS9A 4XLPF 1KU2A 4DZOA 1SQVE 3SXZA 2HSQA 3W8HA 4JCHA 2O1KA 4RDAA 3EFFK 1ORSC 2Y9ZA 3O39A 3KPEA 4OIOF 3VN0A 1T6QA 3NG1A 3GHGA 5L8RJ 3K1HA 5APSA 5A69A 4L75A 1PFIA 2B0HA 3POVA 2Q7CA 2IYOA 4RJTA 3G6EP 1HW1A 4XPYA 3VMXA 5KKZC 4AE4A 3IN6A 2LK4A 4BRYB 1ZW2A 3WU2E 3O10A 2NG1A 1NKNA 3H1HD 3H1JD 4Q7CA 4HEAJ 5COMA 2WSEJ 3L70D 1PGJA 3AEBC 1UG7A 3F46A 3A0BE 3TJ6A 2PBEA 2H7OA 5AW9B 3RK3D 1PV3A 2JD3A 1D0ZA 3PHLA 5A6KA 1YHQP 2CPBA 1Q7YQ 1OXBA 3H1HG 4MVMA 1R5SA 1SQBK 2QJKB 3L70G 1GL2D 3P32A 3D6ZA 2PFXA 1XTCC 1KV4A 5AVZB 5KYWA 2Q3IA 4XLNF 3PRJA 1RKEA 3BCCE 1Z6AA 2AU5A 5A6BA 3B4SA 3TQOA 1JRAA 3GHGB 1CGOA 3BRJA 2OYIA 3B9QA 2IPPA 4I1LA 3Q5PA 1URQB 1MFTA 1AFOA 1JPJA 4YT4A 2HFIA 5AW5B 2GFHA 1RQUA 1XZPA 1NO4A 3CXHH 4AE4B 4EBJA 2Q00A 3N0TA 1YJNP 1VQ5P 1L0NK 3UMHA 4HH2A 1AQTA 3L71D 4H13D 3A11A 4Z9HA 1MV8A 1JO5A 2ZXPA 4JIOA 2W9YA 5E3AA 3DKAA 3AE8C 1O5HA 3HNIA 3RL0D 3H1ID 1HJ0A 3C1LA 3CXHI 4YT8A 2MYSA 4EI2A 1Z23A 2IYLD 3Q7GA 3L71G 4DT0A 3EWKA 3AEAC 1E79H 3SSUA 1LGHB 1YLMA 3KMIA 3FXHA 5KYWB 3H65A 3NYMA 1Z3IX 4W7ZA 2R9RB 1RKEB 2XLEA 3H1IG 3LW5H 5COGA 2A69F 1FJKA 1LTGC 1DEEG 3A9CA 2V26A 3ZVRA 3CMAP 5AVTB 4YJWA 4H44D 4O6MA 3JCUE 1Q86Q 5KJ7C 4ZMDA 1LJ2A 5CMZA 2MHRA 2W6JH 3KH2A 4KBLA 3L75E 3BVHA 3M1CB 3SZRA 1HVVA 3L73D 2FYUD 2KLVA 1BE3D 3OA7A 2JJLA 3CLQA 2FYNC 2GUVA 3T97A 1CI6A 2YEVA 4P9FA 1N86A 2WVNA 2DYRC 2LR2A 3H1HJ 2NPUA 3H1JJ 1FFTC 1NTZK 1NH4A 1CW5A 3E70C 3L73G 3L70J 1YA7O 1BE3G 3HUSA 1NWQA 3LLIA 2AXTE 2J0WA 4NTFA 1LE4A 4IL6H 1QL1A 2VB6A 1N7SA 2R7RA 4JPZB 1VTMP 3A7OA 1YJGA 3HE5A 2R02A 4P6IC 1J1EC 2P61A 3NMJA 1MZ9A 1YZCA 3HNKA 4FX5A 5JRAA 4MVSA 1L7CA 3P8CD 4L74A 1M56D 1SFCD 3W8IA 3G9RA 3C7JA 3RK3C 3JYYA 4C7OA 1Q0GA 1SQBE 4JTCB 5CI8A 4QMAA 4KJMA 2I8BA 1L4AD 1VQPP 2WVQA 3K1IA 1R5ID 4JEAA 4CS9C 3AE3C 3T97B 3HE4A 1GL2C 1CI6B 1PPJG 5KLVD 1J8MF 1YYXA 4JURI 1FDIA 2WPVB 3CWBE 2XLHA 1G1IA 4XEKA 4ZKUA 3IF4A 3L71J 5DQTA 2OQQA 1SQVG 1QSPA 3HUSB 3C9IA 5AW0B 1YQ3C 2PNOA 3CC2P 2NPSA 2QY9A 5DS6A 1N7SB 5KLVG 5L0GA 3H1IJ 1JCDA 4P9TA 1G8XA 2PP6A 1T6UA 3W4YA 3HE5B 3TJ5A 1T5OA 4WGYA 3TNUB 4H13C 4IFDK 2QUPA 4C3EA 1SQXD 1S7ZA 3V2QA 3SWYA 2J9UA 1HE1A 3DWWA 2HODA 2OEVA 2R5DA 4ANJA 1JMMA 4C7OB 4O7GA 3RL0C 1I4YA 2YMYA 1FC2C 1YARO 5CCGA 1KC8Q 3E7KA 5JS5A 1ZU4A 5APWA 3DZAA 4C7RA 3C8ZA 1A41A 4WJ0A 2A6EF 1SQXG 3HE4B 1OCZC 3L36A 3FWNA 2AWCA 1LTTC 4HB1A 3U9MA 1TQGA 4DXWA 3L73J 5K0IA 2FYUJ 1BE3J 2QTVA 2I1JA 2FBWC 3B5NA 3MIWA 2LSEA 1HWTC 2WVRA 1D1AA 4XPWA 3AG3C 2XSEA 3K6BA 4H44C 2IM8A 3QH9A 1RF1A 2H88C 3VYWA 1GQAA 1JAFA 1VDFA 3CZ6A 2EPOA 3WUUA 1GZLA 1Z56A 1TR2A 1A0BA 1T6IA 2ZYDA 2M3EA 2XLDA 2ZXRA 3U9JA 1M1JC 2ZXWC 3US6A 2JKVA 2HODB 1T6AA 2Y0CA 1VQOP 2ZYGA 2UUIA 3V5XA 3S29A 4AUWA 2UUHA 3M9HA 5KYUA 1Z63A 4NPEA 5E33A 2JWAA 3EZIA 2BEZF 4B86A 2E74D 3CCJP 4KNVA 3V7OA 1VQLP 4U5GA 3LIDA 1LWUA 1NZEA 2AEJA 3H25A 1LP1A 2Z4EA 2HS5A 2OTLP 4K35A 3ABVC 2R3CA 4UB6E 4LDRA 3B5NB 3L75D 3AE9C 4TT3H 2R5BA 1M56C 5KLVJ 3GEHA 3JSVC 5APUA 1SFCC 2DW3A 4IL6X 1SQPK 1RF1B 1FOSE 2JO1A 2N9YB 2C04A 2E75B 3GMAA 2OJED 3W2VA 3AGTA 1ZU5A 1DIPA 3KDPB 3AOUA 1MMNA 3FVYA 3HTKC 1J1DC 3ZWIA 3L75G 3LNMB 1QQ3A 2KC3A 1NTKK 1L4AC 3MUDC 5A6BD 1YQ4C 1OMIA 2K1AA 3PLNA 3M4BA 1S72P 2Q9AA 4OD4A 1QLED 1E86A 4G7ZF 1S3JA 5KYUB 1SQXJ 2CDQA 1FTSA 4PD4E 5KAFE 1OX3A 2D4UA 2OGUA 3GF7A 3H32A 5APTA 4JCZA 3ZDLA 5F28E 1HW2A 1LWUB 3IAOA 1Y4CA 3X1OA 4BJ5C 3GEEA 3RW0A 4K3AA 1KB9H 1LP1B 1YYJA 2L6GA 2IZ0A 1BR2A 3TDKA 1JNMA 4PK4A 1WATA 1CPQA 1SQBD 1BDJB 2RSEB 4IFMA 2L5GB 1EXIA 3FX0A 4JQ0D 1ZR4A 1P84H 1BSHA 5BU8B 1YJ9P 3FDQA 4U3FE 2POHA 1U57A 4XE5B 3NMKA 4IARA 1NFNA 3TF5A 3U2MA 2CNWA 3F47A 1H8AA 2W4MA 1H9TA 4MS2A 1J1EB 3C8VA 2P1AA 3CWBD 1IK7A 3EGXA 3OWTA 3EPVA 3L0IA 1SQBG 1HJBA 3GANA 2K3RA 4Y28J 3RK3B 3GEIA 3G71P 4JBZA 5HSWA 1L0ND 1V74B 2J8WA 4LDKA 3CWBG 2ZFCA 5GTHE 1ZHTA 1VYKA 1T3JA 3TULA 3ASOC 3H32B 4MW3A 2IXMA 1S5LH 2A45H 2A68F 3VF0A 1ZHXA 2XRHA 4AK9A 4E0HA 1OWAA 2QJKC 1LIHA 3E9VA 1EKYA 3NMIA 3KYIA 1JY2N 1FJPA 5M1BA 3JTLO 1L0NG 2IYPA 3B29A 3H1JE 2P7JA 3MX3A 3QZCA 2P67A 5JLIA 3L70E 3GHGC 2YL7A 1CZQA 1EDIA 2JWDA 2GDCA 1SS1A 2A45I 3NYJA 5B1BC 2YVKA 4LACB 3RK3E 1IO4A 1N7SD 4N4WA 3L75J 1Q81Q 1R8EA 1KZUB 3GWNA 4K1OA 1ST6A 1KNYA 4ASVA 1JTHA 3EGXB 2R7XA 2Q5UA 2E74C 1GU4A 2WSCJ 1U7MA 2HKVA 2RH0A 4EBKA 3AEFC 3M9QA 4K0DA 1M1JA 1C02A 5EGYA 3TOMA 1RY3A 1FBMA 1PP9D 3VP8A 1SQPE 4R4MA 1OVVA 3WUVA 1TKNA 1TWGA 3AECC 2ZXEB 3E1RA 2J45A 2H43A 1OKKA 2MJZA 2CGEA 2KSEA 4H0LB 2HV7A 1SVFA 1NTZD 1PP9G 1ZZPA 3CCLP 2QLAA 2FAPB 5L0CA 1Y6DA 2XLVA 2CW0F 2WZLA 4AX2A 2OYIC 4OD5A 1OXZA 2NPSD 2FXMA 4D6TE 4H44B 4GODA 1QLEC 2DB4A 2HLOA 2QNLA 1X0TA 2NUTB 1D1CA 1JTHB 1SQBJ 3JYHA 1IZMA 3KL4A 3CC7P 2Q3EA 1U0BB 3A0HE 1V55C 1M1JB 4J30B 2OTJP 3CWBJ 3CSKA 2EPLX 3V2NA 2WWWA 4L6RA 2O01J 4Z9JA 5APXA 5BQGA 5CCGD 2YL3A 2M3BA 2WZFA 2Y39A 1ZXGA 2O9XA 1IC2A 3ITKA 2Y69C 4N3YB 1GW4A 3MHVA 1L0NJ 1LM3B 3M0DC 2Q9IA 2F22A 4ZNCA 3GWLA 3RKOF 2FYUE 2M8RA 2NZ2A 5JUAA 3B5ND 2B87A 2Z5HA 1Q0DA 1MMAA 1NKZB 4PD4D 3EG9A 2P58A 2TMVP 2DYSC 3S84A 4QDLA 5KAIH 2R25A 1M2VB 2E75D 3M91A 3C8GA 1J1DB 5AVQB 4UB8H 4GQHA 1JEKA 2I8DA 2NSGA 1LI7A 2MKVA 5DJUB 3II6A 2LXBA 3CX5H 2KLUA 1UFBA 2G62A 3GF3A 2KK7A 1LT9A 2Q6QA 4U3FD 2LFDA 4YT2A 3M15A 3W2WA 2G3AA 4U7JA 5B1AC 3ZQYA 3HUSC 3EJNA 1H9GA 2VC9A 2YKPA 1JUNA 2ZPAA 1PP9J 1AVOA 5BU5A 1N7SC 5DVWA 4DBRA 3U0CA 1S4XA 3ZG1A 4U3FG 2Y0DA 1LNQA 3C62A 1IFNA 3GW6A 2B87B 3W68A 3EG9B 1AJYA 2GAQA 3VAYA 3USSA 1HE9A 3L4FA 1MMGA 5KLVE 1NTZJ 3RQEA 1FZCC 2B0JA 3Q5RA 1QEXA 2EIJC 4GT1A 2KJGA 2EIKC 3HNLA 3C8GB 2JEEA 2KNHA 1T2KD 2J59M 3AE5C 3K1IC 2CK3H 3R4YA 5APYA 1QVFO 4KC9A 1N8RQ 2ZT9C 1JR8A 4QI0A 1LT9B 2YKQA 2Z15A 1QGKB 4PV1D 3DM9B 1KYOH 4CIPA 3QW0A 3ZSUA 2IFMA 3MP7B 1SQXE 3OEOA 2ZYAA 2NPSC 3H1JG 4Q4ZF 1AVOB 4XTKA 3CXHE 1CGNA 3DJUB 3CD6P 4U5FE 3JSEO 1GW3A 3FAJA 1X9VA 3R2PA 1TWAA 1RH5B 1D7MA 1KQGB 1JOGA 3WODF 5HV9A 1SQPD 2C9LY 4U5CE 3TD7A 1FZEA 1EDKA 2LKMA 4YL1A 3VP9A 4ZLDA 3M79A 3VMAA 1M2OA 4R4LA 2CNWD 1E83A 1NTKD 4U9EA 2E74B 5CCGC 4C3DA 2KUBA 5TISH 3CC4P 1EDJA 1SQPG 3KHUA 2OYOA 2G3KA 2Y3HA 4D6TD 3UGPA 4LC1A 2HMQA 3HJCA 2MWQA 3CEXA 1LTAC 1AVYA 3V5BA 1USDA 1QPUA 2FY8A 3B5NC 3I5CA 4GEHA 1OR3A 1C03A 3DJNB 2KYVA 5L3QA 4AL1A 4U3FJ 4W8KA 1RF1C 3HD7A 1E2XA 4D6TG 1M90Q 2E75C 4H0LD 2K9YA 3AGUA 3M0DA 5L0FA 2KZIA 2N9BA 3BATA 2OYIB 2PX0A 3PJSK 4L73A 4IB4A 3H2VA 5B3SC 2KXPB 4L76A 4OGQB 3UR3C 4DRIB 4G7OF 4CS8A 1VQ4P 3V2RA 4FWVA 1ZR2A 2AVKA 2XL6A 2QRXA 4OIPF 3KZIE 4IL6E 4AL0A 4PJMA 1HH0A 2ZXOA 1S2EA 2KSFA 1EI7A 4PJ0E 1YTZI 1M8OB 4RKUJ 1LWUC 1BR4A 1WGWA 3AE7C 2R3SA 3IQ5A 1HMOA 2EINC 1GD2E 3EGDA 3MBGA 2EPNA 1JY2O 2KQ9A 3UGOA 1RQVA 3A5TA 3T4RA 2H8AA 2J5UA 5AVUB 4EUKB 4DJ9A 2FYUG 2L81A 2KZJA 1A7DA 2NUPA 3AE6C 5B5EH 1GM5A 3UIAA 1OKKD 4IAOA 1BGYE 3HD7B 2XU6A 1W2WA 2A06E 1BCCE 4XEVA 1BDCA 1T2KC 3I5QA 3W67A 2ICWG 3LS0A 2J7PA 3H6PA 1M57D 1KD1Q 2LP4A 4Z1MH 3JCUQ 3KYJA 3LIEA 3JCUH 1YBKA 2YLIA 2QE7H 1D0XA 1RHZB 1FZCA 1ZHZA 3LEOA 1KQSO 4GOEA 1AUEA 1K40A 4PV1C 1SQPJ 1LKXA 2L9JA 2HPCA 4BJ6A 3RF3A 3MLGA 3NMDA 1LTBC 4EIYA 1VQNP 1WTYA 2R7SA 2YL0A 2J9VA 1NTKJ 3RL0g 2KOGA 2W27A 1I4ZA 5AW3B 3T9OA 3B0UX 4BWNA 2OOCA 4J32B 1KILA 2HFED 2ZJSE 3I4UA 2AXTH 5GPGB 1YA9A 2NUPB 1T9KA 2OCCC 1EZVI 4D6TJ 2H89C 4HFFB 4IFFA 1NBBA 2XL4A 3RGUA 4ZLCA 2YLDA 4LLCA 1L0NE 5AW4B 4G78A 1USEA 1SZIA 4W80A 3TYYA 1PGQA 1VF5D 5BVZA 2YZSA 3EFGA 5KYXA 3G3ZA 1MNDA 3M0AA 2I1KA 3RBZA 4O6YA 4MQ9F 4WB4A 1ZYRF 1FZCB 4CSAA 1PD1A 2JPUA 2P0NA 2PGDA 3CXHD 3I5PA 4A2NB 3EHNA 1VK5A 1OR2A 2HPCB 3C8GD 2RD9A 1OVRA 1L0LK 2M4EA 3JRMO 3H1KD 2Y3DA 3NKDA 1GK4A 1AV1A 4CX9A 1ZRTD 1YDIA 4IGGA 3TOLA 2ZT9B 1X22A 4H0LC 1VQ9P 3RK2D 3VRCA 2YKZA 1SYQA 1KILB 2GA0A 4MN4C 1NSGB 4JC7A 1HBWA 3ZDMA 3EZHA 1A7EA 2NPSB 3H1KG 1RKCA 2A0UA 3CAXA 1NFOA 4MVUA 1VQKP 4MTFA 4YXDC 3Q2YA 1IFIA 5E2QA 1ORJA 3OA1A 2ITAA 3F5HA 1WN0A 4IRUA 1PP9E 1YAUO 4PFOA 2VCAA 2EPMX 3GM2A 5AVSB 2WT7A 1NU1K 2R03A 2WSFH 5KYXB 1EC5A 4I44A 1FMWA 4I2LC 2YIUB 3N2ZB 1H6GA 1O87A 1N73C 1GDTA 1NTZE 4TLFA 1OW7A 4MTOA 1RE4A 4HFKB 3RQFA 4PR9A 1X79B 1QKRA 1JMWA 3D6YA 2OJQA 1G2CA 3JSZA 3VOPA 3AEEC 1Q2NA 1EXJA 1ZOYC 2P10A 1SF8A 3Q1MA 1B68A 5H2FH 1K9MQ 4G0HA 1M57C 1KQFB 3WAQA 3V6IA 2AEFA 1WMKA 4IOIH 1K8AQ 1OCOC 1XZQA 2PX3A 1IFJA 3L37A 5DJTB 2E5YA 1H89A 2CYDA 4X0RA 2KS1A 2PAJA 3PDMP 3PP5A 3SXKA 2WT7B 2WMMA 2WQYC 2QJYB 4JW1A 3SXMA 2O3JA 4IAQA 3IQCA 1JB0J 2L91A 3N7NA 2H7BA 2OYHA 2HJMA 1R4TA 2WZGA 3R7CA 1U6HA 5E79H 1RE3A 3KYQA 4OGQD 1CGME 1BGYD 1EZVD 2YQYA 2A06D 1BCCD 1P84E 5A6AA 1G2CB 1ZN5A 4I1MA 2IXOA 2WSEH 1E85A 5EFWB 4JF7A 1SQQK 2E76B 2XNDH 3D70A 3AEDC 1BGYG 1KN7A 2DI3A 2A06G 2G8YA 1VF5C 1BCCG 3H1KJ 2VASA 3IQTA 5AW1B 2VH3A
chains in the Genus database with same CATH topology
3C18A 4PV1D 3Q5PA 3G9RA 1TU3F 2J5UA 2O01J 1HF9A 3SFEC 1Y9BA 3JYYA 4GDOA 4YXDC 4OGQC 3Q2YA 3AE6C 1RQUA 1WWPA 4EBJA 2D2CD 2BEZF 3TULA 1VL2A 2D2CB 2E74D 1V4AA 2Q00A 3RQGA 1DD3A 2JP3A 3GM2A 1O3UA 2QJKC 4YTPC 4H13D 4XEVA 1KMIZ 3AE4C 3AE3C 4H13B 3T97B 3H25A 3FGAD 1OW6A 1FDIA 5M1BA 1KQGB 1K05A 2WPVB 3ABVC 2E76C 4XEFA 1JOGA 3LW5J 4Z1MH 1OW8A 2NZ2A 4XEKA 3AE8C 3U3FA 4R32A 2OQQA 3AE9C 2IDBA 1KTMA 1S1CX 3O6QA 4TT3H 1NGMB 1HJ0A 2YMKA 1NYHA 1YQ3C 4PV1B 1OW7A 4IL6X 1K40A 4PV1C 3EWKA 3RK3E 3AEAC 4R4LA 2JO1A 2YWAA 3MFNA 2E75D 1R8EA 3RQFA 2E75B 3GMAA 3C8GA 2HSBA 2E74B 1DIPA 1KNYA 3D6YA 2D2CC 3L8JA 1DD4A 2E74C 2MKVA 2WSCJ 3AEEC 1WTYA 1EXJA 1ZOYC 3AEGC 4EBKA 3B71A 1YQ4C 3AEFC 3RL0g 1OMIA 4H13C 1GMJA 1Q90D 2P10A 1KORA 1UFBA 4XFJA 3Q1MA 3GF3A 3Q5SA 1KQFB 1ZRTE 5L8RJ 1WMKA 2YIUC 3GLMA 4H44D 2G3AA 1ZP0C 3Q3DA 1KILE 4U7JA 2BEQD 4R4MA 2H89C 3AECC 5KKZC 1PL5A 3GF7A 3IN6A 1MKMA 2LK4A 2WQYC 5F28E 3IAOA 3JZ0A 2QJPC 3O10A 2E75C 4H0LD 2K9YA 4H0LB 2QIWA 3L8IA 3U0CA 3S9OA 1VF5D 2FYNC 2WSEJ 1JB0J 3D71A 2L6GA 3AEBC 1ZZPA 2L6FA 4KT0J 3AE1C 2PBEA 5KLIC 1AJYA 3SFDC 1PV3A 2FBWC 2QSIA 2JPUA 4OGQD 4OGQB 1EXIA 3RQEA 2JX0A 3Q5RA 4H44B 3GM3A 2L6HA 3GM1A 3C8GD 4NQFA 3C8GB 4H44C 1K04A 1U57A 1S5LX 1UIXA 2H88C 3D6ZA 3C8VA 1IK7A 1FDOA 3AE5C 2E76D 2E76B 4RKUJ 2FXPA 2QJYC 3K7DA 1PIXA 3R4YA 3AE7C 2KK1A 2ZT9D 3D70A 3AEDC 2ZT9B 1VF5B 4H0LC 1WOLA 2WSFJ 4I7ZB 1ZMEC 2G8YA 2ZT9C 1VF5C 3BRJA 2V7QJ 4I7ZC 4Y28J 3AJMA 1QVXA 3AE2C 1RQVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C18 A;  3SFE C;  3JYY A;  4YXD C;  3AE6 C;  1WWP A;  4EBJ A;  3TUL A;  2Q00 A;  1V4A A;  3RQG A;  3GM2 A;  1O3U A;  4YTP C;  4XEV A;  3AE3 C;  3AE4 C;  1OW6 A;  1K05 A;  4XEF A;  3ABV C;  1JOG A;  1OW8 A;  4XEK A;  3AE8 C;  3U3F A;  4R32 A;  3AE9 C;  1KTM A;  1YQ3 C;  1OW7 A;  1K40 A;  3AEA C;  3RQF A;  2YWA A;  3MFN A;  3C8G A;  2HSB A;  1KNY A;  3L8J A;  3AEE C;  1WTY A;  1ZOY C;  3AEG C;  4EBK A;  3B71 A;  1YQ4 C;  3AEF C;  1UFB A;  2G3A A;  1ZP0 C;  2H89 C;  3AEC C;  2LK4 A;  2WQY C;  5F28 E;  3JZ0 A;  3O10 A;  3L8I A;  3U0C A;  3S9O A;  2L6G A;  3AEB C;  1ZZP A;  2L6F A;  3AE1 C;  2PBE A;  3SFD C;  1PV3 A;  2FBW C;  2JPU A;  3RQE A;  2JX0 A;  3GM3 A;  2L6H A;  3GM1 A;  3C8G D;  4NQF A;  3C8G B;  1K04 A;  2H88 C;  3AE5 C;  3K7D A;  3AE7 C;  2KK1 A;  1WOL A;  3AED C;  3BRJ A;  3AJM A;  1QVX A;  3AE2 C; 
#chains in the Genus database with same CATH topology
 3C18 A;  4XWJ A;  3CCM P;  2GUS A;  3DM5 A;  2D2C B;  3HD7 D;  1L0L E;  4LLE A;  1KB9 I;  4HJG H;  2OEX A;  2KI7 B;  5DQZ A;  4YTP C;  2K88 A;  4I6M C;  4YWQ A;  4JRZ A;  4WGZ A;  2C03 A;  2OYH B;  5C39 A;  1A02 J;  1CPR A;  2ZD9 A;  3LW5 J;  4NC3 A;  5F5H A;  4EDF A;  5JP7 A;  1P84 I;  3RK2 C;  1NGM B;  3O6Q A;  4BG0 A;  2OTK E;  4DBQ A;  2J58 A;  4GKG A;  3S0X A;  1LT9 C;  3RVZ A;  4PV1 B;  1IJD B;  1OCC C;  4E17 A;  3FXE A;  1HGV A;  4DVZ A;  4N6H A;  3X2Q C;  3L34 A;  1OCR C;  1JPN A;  1NU1 E;  1WRG A;  3AG4 C;  3GG2 A;  2G3V A;  5CJ4 A;  2ZVN B;  1M7L A;  1OZH A;  3VTP C;  5KLI B;  3DXJ F;  4O6N A;  3LNR A;  1JM0 A;  2I15 A;  3ZC4 A;  2ASR A;  2B88 A;  1ZP0 C;  3ZTZ A;  3NFQ A;  3PTZ A;  1Y8A A;  2PRR A;  4C46 A;  4N78 D;  3JZ0 A;  2IFN A;  4Q5S F;  2J7P D;  3LJB A;  2O1J A;  2L6F A;  1VB5 A;  3PHF 2;  1VQ8 P;  2DGJ A;  1VQM P;  1NOH A;  4ULW A;  4Z9I A;  3FXD A;  1N73 A;  4YL3 A;  2QSI A;  2C0X A;  2WPQ A;  3UMI A;  4BXL A;  3GM1 A;  3HRN A;  4YT5 A;  3HLZ A;  2HMZ A;  3QVY A;  3KKB A;  4MVR A;  1BGY J;  1JMB A;  4U5H A;  3L35 A;  1BCC J;  1LT1 A;  2VCC A;  1SQV K;  5DS4 A;  1OQC A;  3V5Y A;  1NTK E;  1PIX A;  2KK1 A;  2ZT9 D;  2C0W A;  1ZHW A;  2OU6 A;  1RMV A;  1KIL D;  3IR9 A;  2A0B A;  3SXY A;  4I7Z C;  3VMZ A;  4FES A;  2LCH A;  2ZXX A;  4MVQ A;  3U8P A;  3FMS A;  1Y9B A;  2J9B A;  3MD0 A;  1DX7 A;  2KSJ A;  4OGQ C;  3Q6N A;  2OQM A;  3U59 A;  3B0P A;  1WWP A;  1VL2 A;  3O8Z A;  1ORY A;  2QM7 A;  1DD3 A;  5GTI H;  1NTZ G;  2JP3 A;  1D0Y A;  2YRF A;  1N2D C;  1SQQ E;  3FOP A;  2PFD A;  3V4Q A;  4M63 A;  5AVY B;  1N73 B;  2FGY A;  1NG1 A;  3DI5 A;  3L74 D;  2XV5 A;  3HNJ A;  1LS4 A;  4N6C A;  1NHL A;  3N4X A;  2KNC A;  2B9B A;  3S90 A;  3G4X A;  5KAI E;  1MUU A;  1OXK A;  1KB9 D;  3LEV A;  1TFO B;  5L0J A;  3VM6 A;  1H7I A;  3L8J A;  5KYY A;  1KFM A;  3HD7 C;  2W90 A;  1Z7Q c;  2XL8 A;  4WY4 A;  1YJW P;  3L74 G;  3LLK A;  3OJA B;  4O9B A;  2FFD A;  1Q90 D;  1FZA A;  1P84 D;  4JKV A;  3U2L A;  3GLM A;  2FKW B;  2AP3 A;  1I5N A;  1FZF A;  3Q3D A;  4U5E E;  4CS8 C;  4GOF A;  2WVO A;  1A7V A;  2H8P D;  3TGU E;  4KHX A;  1X8Y A;  4DOZ A;  4Y99 C;  4BEJ A;  4JE9 A;  3WMM 0;  3MZW B;  2YKO A;  3VMY A;  1J8Y F;  1RF0 A;  5CBN A;  3Q7L A;  4KT0 J;  1FU1 A;  5AVR B;  1OVU A;  1N1C A;  4JJF A;  1BBH A;  2LQG A;  4NPD A;  4PJN A;  2R44 A;  1APC A;  2R7Q A;  2HZ8 A;  1L0L D;  2AXC A;  2JX0 A;  2KNC B;  2L6H A;  1AA0 A;  4BEM J;  4NQF A;  1CSB A;  1K04 A;  1GU5 A;  5E3C A;  1S5L X;  1FZB A;  4CJG A;  4BRY A;  5B66 H;  4RD9 A;  5KYY B;  3DD7 A;  1HGZ A;  4OIQ F;  2R7W A;  2E76 D;  3CX5 I;  5EHH A;  2FXP A;  4EBB A;  2FFD B;  4BJ1 A;  4E7Z A;  1VF5 B;  1L0L G;  2A45 G;  4NPF X;  2J9W A;  1YIT P;  3J06 A;  3AE2 C;  3CCV P;  2KB7 P;  4CPG A;  1FR0 A;  1NU1 D;  4JEB A;  2KP8 A;  2WL8 A;  5L0H A;  3FOO A;  2D2C D;  5CCH A;  1QX8 A;  1NLX A;  4I3M A;  4W8P A;  1ZHY A;  3CCR P;  4BJ6 C;  3WG7 C;  3NTN A;  1O3U A;  2P1J A;  2YO2 A;  1TWH A;  2BCC E;  2A6H F;  3QWO C;  1RXQ A;  2E87 A;  1NU1 G;  3RK2 B;  2QVA A;  2N1T C;  3CL3 D;  3BRV B;  4KI2 A;  1KIL C;  4C7N A;  1L2P A;  4FAP B;  1URQ A;  4LER A;  3SP1 A;  4IJJ A;  4XPX A;  2QEX P;  3V4W A;  3BEH A;  1RJ9 A;  3WHN A;  3NDB B;  2IBZ I;  5AVV B;  3L74 J;  4CBE A;  1YIJ P;  2IXP A;  5TIS E;  3DE8 A;  4H54 A;  3AEG C;  1R5L A;  1LE2 A;  2V7Q H;  3H1K E;  4IWB A;  1KYO I;  3Q5S A;  1ZRT E;  1JY3 N;  1VPC A;  5K5G B;  2YIU C;  1Q0F A;  4CSA C;  1FOS F;  3DMD A;  3QMK A;  3RH3 A;  1FNT c;  1FS0 E;  4H4K C;  3HKK A;  1PL5 A;  3WU2 H;  3EH1 A;  4YL0 A;  2CPS A;  4DJG A;  2QIW A;  1Y47 A;  1Q0K A;  2WTY A;  2P6V A;  4KNW A;  3BRT B;  4BJT A;  3A0B H;  2SPZ A;  1MNE A;  2O01 N;  4YPC A;  1NTM K;  4C7N B;  2Q1K A;  3ITF A;  1NTK G;  1LTJ A;  4XA4 A;  4CJO A;  2W45 A;  3U1C A;  1RJ9 B;  2J0X A;  2D5R B;  1SQQ D;  2XKM A;  3ZQV A;  1L0L J;  1PD0 A;  2PF4 E;  1RCP A;  2XLM A;  2QJY C;  2OKU A;  1WOL A;  2LD6 A;  1Q0M A;  5BUO A;  4I7Z B;  1ZME C;  1IFD A;  5A6J A;  2IZ1 A;  1AEP A;  4U5D E;  4QI2 A;  1SQQ G;  2FYZ A;  2EIM C;  3KPH A;  5AGF A;  1TU3 F;  1HF9 A;  3SFE C;  2YLG A;  3K33 A;  4GYT A;  2Q9C A;  1RE4 C;  3G4S P;  5B5E E;  1GTW A;  2ZVO B;  1ZV8 A;  3RYL A;  1NU1 J;  3CX5 D;  4YXW H;  3LAY A;  2IBF A;  3KQG A;  5TJ5 E;  3JC2 2;  1MFZ A;  2E76 C;  1LPE A;  4EOT A;  3U3F A;  4ER9 A;  5AC5 A;  1LTJ B;  1ZVZ A;  2BL2 A;  2YMK A;  1NU9 C;  4DCK A;  3TGU D;  3IPM O;  1W2B O;  2Q9B A;  1EQ7 A;  4OVN F;  1NAF A;  1EZV E;  4E7S A;  2D2C C;  3EQL F;  5KTB A;  3CCE P;  1HY5 A;  3P8M C;  2JDI H;  3I56 P;  1YI2 P;  2HUJ A;  3FHD A;  3TGU G;  3NKE A;  2Y9Y A;  4EYY Q;  3CME P;  2OYH C;  1HUC A;  1JY2 P;  5AVX B;  3A2A A;  2PP4 A;  1RE3 C;  2RN0 A;  1LI5 A;  1JCC A;  1XWJ A;  1DEB A;  2BEQ D;  3V5Z A;  1G4W R;  3KZI H;  3ASN C;  3SYN A;  4Y99 B;  4B6I A;  2IBZ D;  1MKM A;  3GOR A;  2WSC H;  4PJ0 H;  3L72 E;  1VLS A;  1FFH A;  4MND A;  5CIV A;  2XZR A;  2HV6 A;  2YO3 A;  3TNU A;  3EGD B;  1KYO D;  5D92 A;  2HG5 D;  2N1T A;  2BAS A;  1E84 A;  5KLI C;  4ZKP A;  5DLJ A;  1PPJ D;  2P2U A;  5T1D B;  2E42 A;  3G50 A;  2IBZ G;  1LS1 A;  2ETS A;  3M4C A;  3H1L D;  4DVY P;  3PMR A;  2FXO A;  3UMK A;  1NAY A;  1SQV D;  1G1J A;  2BCC D;  3IQ6 A;  1T01 A;  2GM4 A;  2WPR A;  1ZLL A;  4WY4 D;  4U5B E;  3ZIB A;  2VCB A;  1SQQ J;  3P7K A;  2Y3B A;  3K7D A;  4OH8 B;  1S9K E;  3H1L G;  2A1D D;  2IX7 C;  1NTM E;  2W4B A;  3L1M A;  4ULV A;  1HTL C;  2BCC G;  2B89 A;  2Y3G A;  1H88 A;  3QTH A;  3OW2 O;  1DH3 A;  4WBA A;  4GDO A;  3K66 A;  4K7B A;  1VYI A;  3RQG A;  5CBO A;  3AG1 C;  3LES A;  3ABM C;  4LGD E;  2RKL A;  4E0I A;  4OIN F;  3FGA D;  4RES B;  1K05 A;  2N1T B;  3K5B A;  4DOJ A;  2L7A A;  4EKW A;  4N78 E;  3T6J A;  2HYN A;  1M6T A;  3B8E B;  2IDB A;  2O01 H;  2Q4F A;  1FZG A;  2R7O A;  1NYH A;  5KKZ B;  3SEO A;  3N24 A;  1SP4 A;  1Z5Z A;  2KIK A;  1K73 Q;  3BCC D;  2XXA A;  3TGU J;  3I55 P;  3EHM A;  2R7U A;  3ECS A;  4CS7 A;  4AQR D;  1GGQ A;  1OIP A;  4LLH A;  1UII A;  4JTD B;  5H2F E;  1TFK B;  3ABK C;  2IXN A;  3DAG A;  3UNG C;  3BCC G;  4M3L A;  3MYI A;  4ASW A;  1KIL E;  1V54 C;  4JJG A;  3IEE A;  5CCH D;  2QM8 A;  1PGP A;  2QJP C;  2NSF A;  2LXC B;  4NCQ A;  4HYT B;  4N6J A;  4F4B A;  1L3P A;  4HKZ H;  4G7H F;  3Q6M A;  1LTS C;  3AE1 C;  3CPW O;  1VMA A;  1D1B A;  3ZTM A;  3GOD A;  1URQ D;  1T3U A;  5FCL A;  5KJ7 A;  3S4R A;  5E79 E;  1M1K Q;  3QVZ A;  3FWL A;  4E18 A;  2WIT A;  2XXA B;  3O6X A;  1N7L A;  2LIG A;  3PCV A;  1QL2 A;  3L74 E;  3CCQ P;  4JZA A;  1MMD A;  3H1L J;  4A7P A;  2C9N Y;  2XM4 A;  2HR3 A;  3U1A A;  3AQB A;  3BAS A;  2M64 A;  1SQV J;  2VRS A;  4CIH A;  2BCC J;  1KB9 E;  1DOV A;  3A3Y B;  4GIF A;  2V7Q J;  2V4H A;  4WWI A;  1LVK A;  3AJM A;  3TSI A;  2E5T A;  4PJJ A;  4O79 A;  2W6B A;  4CDY A;  4EWC A;  5TJH A;  1T8Z A;  1V4A A;  2W8Z A;  1YVI A;  1SLQ A;  3OAK A;  1GK6 A;  5F5F A;  4EIJ A;  4NY3 A;  3U8V A;  5EK0 A;  1BSN A;  4WY4 C;  1S05 A;  4UB6 H;  1EZV G;  2H7V C;  2FFD C;  2LFF A;  2XLO A;  1QVG O;  1U7J A;  5AW2 B;  4DRH B;  2EIL C;  3L72 D;  4BPM A;  1JY3 O;  2KS1 B;  4J7Y A;  2YWA A;  1EA8 A;  4MVZ A;  4RO0 A;  3EQ2 A;  2BC5 A;  2OG2 A;  1S5L E;  2FYN B;  2Q3T A;  4CS9 A;  1GL2 A;  2E43 A;  2WB7 A;  3RFY A;  5BQH A;  3B71 A;  2FFH A;  1W2E A;  1SR2 A;  2YXQ B;  3BCC J;  2M0B A;  2Y0E A;  1RF0 C;  4XFJ A;  3T6G B;  3L72 G;  2X51 A;  2YHS A;  5FZT A;  1E5W A;  3E1I A;  3TK0 A;  5APV A;  4PD4 H;  2R7T A;  1JY3 P;  3TK1 A;  2XDJ A;  5KAF H;  4RBN A;  2XS8 A;  2AEM A;  1S9K D;  1NTM D;  1MQV A;  4JYB A;  2AWY A;  1A02 F;  3H2U A;  5AVW B;  5JT4 A;  3D71 A;  1F1M A;  3U5S A;  2FYU K;  1W5C E;  1VLT A;  5DS5 A;  1XTG B;  3SFD C;  5AC4 A;  2P7V A;  4PD4 I;  1FMV A;  5CHX A;  3M9B A;  3GM3 A;  1NTM G;  1G4U S;  5L3V A;  3FAP B;  3SNH A;  3DAF A;  5KYN A;  2KYH A;  5CCH C;  1GL2 B;  3MGN A;  1H0T A;  2R7V A;  2GWW A;  2EPK X;  1FDO A;  2QA4 P;  4PFP A;  2M5A A;  2YNY A;  5CI9 A;  2R05 A;  3V2P A;  1TWC A;  4JYC A;  1SMY F;  1PGO A;  3H1H E;  3RVY A;  2XLW A;  5IY5 C;  1QVX A;  2RMZ A;  3O6Q B;  1ZW3 A;  5COF A;  5D91 A;  2YL1 A;  4YN0 B;  2YXR B;  3NRH A;  5GTH H;  1URQ C;  4MVO A;  4PAC A;  2NUT A;  1JOC A;  2GA1 A;  5CJ0 A;  4OIR F;  1YZA A;  1NJI Q;  3U3B A;  4N06 A;  5GTI E;  4HE8 D;  3S28 A;  2UWJ E;  1IFP A;  1KMI Z;  4H13 B;  4MTG A;  1LTI C;  1IW7 F;  5T3T A;  1OW6 A;  2N1T D;  4C3B A;  3JRT A;  4XEF A;  3JT1 A;  1OW8 A;  2KW3 C;  3T6B A;  4AYC A;  1KTM A;  3RL0 B;  1S1C X;  3NYL A;  5KLV K;  2XNX A;  5L0D A;  3QW1 A;  3G4Z A;  5APQ A;  1BDD A;  4JVS A;  1G5Z A;  3MFN A;  2WSS H;  1H0T B;  4CDA A;  4OWF A;  1VOM A;  2M5A B;  1OFC X;  1KQL A;  3L72 J;  5T3W A;  4NTB A;  5B3I A;  1FDM A;  4ONS A;  1GMJ A;  3LS1 A;  1KOR A;  3L71 E;  2V3C C;  4XQ1 A;  1BZ4 A;  3SWF A;  3S1K A;  1AQ5 A;  3B0V C;  2WZ7 A;  5AW6 B;  1SFC A;  3IHU A;  1HMD A;  3VYI A;  2ZAE B;  1SQX K;  1LTJ C;  1U89 A;  3AQC A;  3O55 A;  2Z5I A;  3H1I E;  1M2V A;  2QJP B;  3F89 A;  3HTK A;  1IZN B;  3RIP A;  2K37 A;  1EQ1 A;  1WT6 A;  4A4A A;  2CCY A;  4UB8 E;  256B A;  1L4A A;  3MUD A;  1FAV A;  3L8I A;  3S9O A;  3NXS A;  3EFO A;  1C17 M;  1WAS A;  2BE5 F;  1NTM J;  2IOQ A;  3CX5 E;  1IK9 A;  3RBX A;  2KGO A;  2R32 A;  4LDQ A;  4D4N A;  5AW8 B;  2J46 A;  2K9J A;  1DOW A;  3CCU P;  4CDV A;  2QE9 A;  3ABL C;  1BR1 A;  2XM0 A;  1PCX A;  4D4X A;  3IFM A;  1UIX A;  4BJ5 A;  2H7H A;  2W83 C;  5B66 E;  2XS1 A;  1YTZ T;  5L0I A;  1NVO A;  4PJL A;  3L73 E;  3A0H H;  5BQI A;  3MTU E;  4WVZ A;  1BE3 E;  1VQ6 P;  2WSF J;  2W6A A;  4U9D A;  4EHP A;  3CI9 A;  3KXD A;  4JTA B;  1SFC B;  3DE9 A;  3SWK A;  3PH0 A;  3LUT B;  4DRJ B;  3HTK B;  4UDV A;  3C63 A;  1Q82 Q;  4NTA A;  1L4A B;  1FAP B;  4YK5 A;  3MYF A;  3AE4 C;  2Q7R A;  4WY4 B;  1KFN A;  2IBZ E;  4I1O B;  3EFO B;  3S27 A;  1PZQ A;  1NU7 D;  5JVE A;  5JSL A;  3EH2 A;  3CQZ A;  4R32 A;  5KJ7 D;  4W7Y A;  2QG4 A;  4J7T A;  1J2J B;  3CCS P;  1VQ7 P;  3P8C E;  2K9J B;  2WPS A;  5AW7 B;  3WUT A;  1YYC A;  1QZX A;  1KYO E;  1FE6 A;  4WAB A;  4MW8 A;  1PPJ E;  3AG2 C;  3M06 A;  2HJ3 A;  2HSB A;  1IFM A;  1EDL A;  3ATP A;  2OAR A;  2NRG A;  2X0C A;  3H1L E;  1ZW0 A;  2JR8 A;  1DD4 A;  1GS9 A;  4XLP F;  1KU2 A;  4DZO A;  1SQV E;  3SXZ A;  2HSQ A;  3W8H A;  4JCH A;  2O1K A;  4RDA A;  3EFF K;  1ORS C;  2Y9Z A;  3O39 A;  3KPE A;  4OIO F;  3VN0 A;  1T6Q A;  3NG1 A;  3GHG A;  5L8R J;  3K1H A;  5APS A;  5A69 A;  4L75 A;  1PFI A;  2B0H A;  3POV A;  2Q7C A;  2IYO A;  4RJT A;  3G6E P;  1HW1 A;  4XPY A;  3VMX A;  5KKZ C;  4AE4 A;  3IN6 A;  2LK4 A;  4BRY B;  1ZW2 A;  3WU2 E;  3O10 A;  2NG1 A;  1NKN A;  3H1H D;  3H1J D;  4Q7C A;  4HEA J;  5COM A;  2WSE J;  3L70 D;  1PGJ A;  3AEB C;  1UG7 A;  3F46 A;  3A0B E;  3TJ6 A;  2PBE A;  2H7O A;  5AW9 B;  3RK3 D;  1PV3 A;  2JD3 A;  1D0Z A;  3PHL A;  5A6K A;  1YHQ P;  2CPB A;  1Q7Y Q;  1OXB A;  3H1H G;  4MVM A;  1R5S A;  1SQB K;  2QJK B;  3L70 G;  1GL2 D;  3P32 A;  3D6Z A;  2PFX A;  1XTC C;  1KV4 A;  5AVZ B;  5KYW A;  2Q3I A;  4XLN F;  3PRJ A;  1RKE A;  3BCC E;  1Z6A A;  2AU5 A;  5A6B A;  3B4S A;  3TQO A;  1JRA A;  3GHG B;  1CGO A;  3BRJ A;  2OYI A;  3B9Q A;  2IPP A;  4I1L A;  3Q5P A;  1URQ B;  1MFT A;  1AFO A;  1JPJ A;  4YT4 A;  2HFI A;  5AW5 B;  2GFH A;  1RQU A;  1XZP A;  1NO4 A;  3CXH H;  4AE4 B;  4EBJ A;  2Q00 A;  3N0T A;  1YJN P;  1VQ5 P;  1L0N K;  3UMH A;  4HH2 A;  1AQT A;  3L71 D;  4H13 D;  3A11 A;  4Z9H A;  1MV8 A;  1JO5 A;  2ZXP A;  4JIO A;  2W9Y A;  5E3A A;  3DKA A;  3AE8 C;  1O5H A;  3HNI A;  3RL0 D;  3H1I D;  1HJ0 A;  3C1L A;  3CXH I;  4YT8 A;  2MYS A;  4EI2 A;  1Z23 A;  2IYL D;  3Q7G A;  3L71 G;  4DT0 A;  3EWK A;  3AEA C;  1E79 H;  3SSU A;  1LGH B;  1YLM A;  3KMI A;  3FXH A;  5KYW B;  3H65 A;  3NYM A;  1Z3I X;  4W7Z A;  2R9R B;  1RKE B;  2XLE A;  3H1I G;  3LW5 H;  5COG A;  2A69 F;  1FJK A;  1LTG C;  1DEE G;  3A9C A;  2V26 A;  3ZVR A;  3CMA P;  5AVT B;  4YJW A;  4H44 D;  4O6M A;  3JCU E;  1Q86 Q;  5KJ7 C;  4ZMD A;  1LJ2 A;  5CMZ A;  2MHR A;  2W6J H;  3KH2 A;  4KBL A;  3L75 E;  3BVH A;  3M1C B;  3SZR A;  1HVV A;  3L73 D;  2FYU D;  2KLV A;  1BE3 D;  3OA7 A;  2JJL A;  3CLQ A;  2FYN C;  2GUV A;  3T97 A;  1CI6 A;  2YEV A;  4P9F A;  1N86 A;  2WVN A;  2DYR C;  2LR2 A;  3H1H J;  2NPU A;  3H1J J;  1FFT C;  1NTZ K;  1NH4 A;  1CW5 A;  3E70 C;  3L73 G;  3L70 J;  1YA7 O;  1BE3 G;  3HUS A;  1NWQ A;  3LLI A;  2AXT E;  2J0W A;  4NTF A;  1LE4 A;  4IL6 H;  1QL1 A;  2VB6 A;  1N7S A;  2R7R A;  4JPZ B;  1VTM P;  3A7O A;  1YJG A;  3HE5 A;  2R02 A;  4P6I C;  1J1E C;  2P61 A;  3NMJ A;  1MZ9 A;  1YZC A;  3HNK A;  4FX5 A;  5JRA A;  4MVS A;  1L7C A;  3P8C D;  4L74 A;  1M56 D;  1SFC D;  3W8I A;  3G9R A;  3C7J A;  3RK3 C;  3JYY A;  4C7O A;  1Q0G A;  1SQB E;  4JTC B;  5CI8 A;  4QMA A;  4KJM A;  2I8B A;  1L4A D;  1VQP P;  2WVQ A;  3K1I A;  1R5I D;  4JEA A;  4CS9 C;  3AE3 C;  3T97 B;  3HE4 A;  1GL2 C;  1CI6 B;  1PPJ G;  5KLV D;  1J8M F;  1YYX A;  4JUR I;  1FDI A;  2WPV B;  3CWB E;  2XLH A;  1G1I A;  4XEK A;  4ZKU A;  3IF4 A;  3L71 J;  5DQT A;  2OQQ A;  1SQV G;  1QSP A;  3HUS B;  3C9I A;  5AW0 B;  1YQ3 C;  2PNO A;  3CC2 P;  2NPS A;  2QY9 A;  5DS6 A;  1N7S B;  5KLV G;  5L0G A;  3H1I J;  1JCD A;  4P9T A;  1G8X A;  2PP6 A;  1T6U A;  3W4Y A;  3HE5 B;  3TJ5 A;  1T5O A;  4WGY A;  3TNU B;  4H13 C;  4IFD K;  2QUP A;  4C3E A;  1SQX D;  1S7Z A;  3V2Q A;  3SWY A;  2J9U A;  1HE1 A;  3DWW A;  2HOD A;  2OEV A;  2R5D A;  4ANJ A;  1JMM A;  4C7O B;  4O7G A;  3RL0 C;  1I4Y A;  2YMY A;  1FC2 C;  1YAR O;  5CCG A;  1KC8 Q;  3E7K A;  5JS5 A;  1ZU4 A;  5APW A;  3DZA A;  4C7R A;  3C8Z A;  1A41 A;  4WJ0 A;  2A6E F;  1SQX G;  3HE4 B;  1OCZ C;  3L36 A;  3FWN A;  2AWC A;  1LTT C;  4HB1 A;  3U9M A;  1TQG A;  4DXW A;  3L73 J;  5K0I A;  2FYU J;  1BE3 J;  2QTV A;  2I1J A;  2FBW C;  3B5N A;  3MIW A;  2LSE A;  1HWT C;  2WVR A;  1D1A A;  4XPW A;  3AG3 C;  2XSE A;  3K6B A;  4H44 C;  2IM8 A;  3QH9 A;  1RF1 A;  2H88 C;  3VYW A;  1GQA A;  1JAF A;  1VDF A;  3CZ6 A;  2EPO A;  3WUU A;  1GZL A;  1Z56 A;  1TR2 A;  1A0B A;  1T6I A;  2ZYD A;  2M3E A;  2XLD A;  2ZXR A;  3U9J A;  1M1J C;  2ZXW C;  3US6 A;  2JKV A;  2HOD B;  1T6A A;  2Y0C A;  1VQO P;  2ZYG A;  2UUI A;  3V5X A;  3S29 A;  4AUW A;  2UUH A;  3M9H A;  5KYU A;  1Z63 A;  4NPE A;  5E33 A;  2JWA A;  3EZI A;  2BEZ F;  4B86 A;  2E74 D;  3CCJ P;  4KNV A;  3V7O A;  1VQL P;  4U5G A;  3LID A;  1LWU A;  1NZE A;  2AEJ A;  3H25 A;  1LP1 A;  2Z4E A;  2HS5 A;  2OTL P;  4K35 A;  3ABV C;  2R3C A;  4UB6 E;  4LDR A;  3B5N B;  3L75 D;  3AE9 C;  4TT3 H;  2R5B A;  1M56 C;  5KLV J;  3GEH A;  3JSV C;  5APU A;  1SFC C;  2DW3 A;  4IL6 X;  1SQP K;  1RF1 B;  1FOS E;  2JO1 A;  2N9Y B;  2C04 A;  2E75 B;  3GMA A;  2OJE D;  3W2V A;  3AGT A;  1ZU5 A;  1DIP A;  3KDP B;  3AOU A;  1MMN A;  3FVY A;  3HTK C;  1J1D C;  3ZWI A;  3L75 G;  3LNM B;  1QQ3 A;  2KC3 A;  1NTK K;  1L4A C;  3MUD C;  5A6B D;  1YQ4 C;  1OMI A;  2K1A A;  3PLN A;  3M4B A;  1S72 P;  2Q9A A;  4OD4 A;  1QLE D;  1E86 A;  4G7Z F;  1S3J A;  5KYU B;  1SQX J;  2CDQ A;  1FTS A;  4PD4 E;  5KAF E;  1OX3 A;  2D4U A;  2OGU A;  3GF7 A;  3H32 A;  5APT A;  4JCZ A;  3ZDL A;  5F28 E;  1HW2 A;  1LWU B;  3IAO A;  1Y4C A;  3X1O A;  4BJ5 C;  3GEE A;  3RW0 A;  4K3A A;  1KB9 H;  1LP1 B;  1YYJ A;  2L6G A;  2IZ0 A;  1BR2 A;  3TDK A;  1JNM A;  4PK4 A;  1WAT A;  1CPQ A;  1SQB D;  1BDJ B;  2RSE B;  4IFM A;  2L5G B;  1EXI A;  3FX0 A;  4JQ0 D;  1ZR4 A;  1P84 H;  1BSH A;  5BU8 B;  1YJ9 P;  3FDQ A;  4U3F E;  2POH A;  1U57 A;  4XE5 B;  3NMK A;  4IAR A;  1NFN A;  3TF5 A;  3U2M A;  2CNW A;  3F47 A;  1H8A A;  2W4M A;  1H9T A;  4MS2 A;  1J1E B;  3C8V A;  2P1A A;  3CWB D;  1IK7 A;  3EGX A;  3OWT A;  3EPV A;  3L0I A;  1SQB G;  1HJB A;  3GAN A;  2K3R A;  4Y28 J;  3RK3 B;  3GEI A;  3G71 P;  4JBZ A;  5HSW A;  1L0N D;  1V74 B;  2J8W A;  4LDK A;  3CWB G;  2ZFC A;  5GTH E;  1ZHT A;  1VYK A;  1T3J A;  3TUL A;  3ASO C;  3H32 B;  4MW3 A;  2IXM A;  1S5L H;  2A45 H;  2A68 F;  3VF0 A;  1ZHX A;  2XRH A;  4AK9 A;  4E0H A;  1OWA A;  2QJK C;  1LIH A;  3E9V A;  1EKY A;  3NMI A;  3KYI A;  1JY2 N;  1FJP A;  5M1B A;  3JTL O;  1L0N G;  2IYP A;  3B29 A;  3H1J E;  2P7J A;  3MX3 A;  3QZC A;  2P67 A;  5JLI A;  3L70 E;  3GHG C;  2YL7 A;  1CZQ A;  1EDI A;  2JWD A;  2GDC A;  1SS1 A;  2A45 I;  3NYJ A;  5B1B C;  2YVK A;  4LAC B;  3RK3 E;  1IO4 A;  1N7S D;  4N4W A;  3L75 J;  1Q81 Q;  1R8E A;  1KZU B;  3GWN A;  4K1O A;  1ST6 A;  1KNY A;  4ASV A;  1JTH A;  3EGX B;  2R7X A;  2Q5U A;  2E74 C;  1GU4 A;  2WSC J;  1U7M A;  2HKV A;  2RH0 A;  4EBK A;  3AEF C;  3M9Q A;  4K0D A;  1M1J A;  1C02 A;  5EGY A;  3TOM A;  1RY3 A;  1FBM A;  1PP9 D;  3VP8 A;  1SQP E;  4R4M A;  1OVV A;  3WUV A;  1TKN A;  1TWG A;  3AEC C;  2ZXE B;  3E1R A;  2J45 A;  2H43 A;  1OKK A;  2MJZ A;  2CGE A;  2KSE A;  4H0L B;  2HV7 A;  1SVF A;  1NTZ D;  1PP9 G;  1ZZP A;  3CCL P;  2QLA A;  2FAP B;  5L0C A;  1Y6D A;  2XLV A;  2CW0 F;  2WZL A;  4AX2 A;  2OYI C;  4OD5 A;  1OXZ A;  2NPS D;  2FXM A;  4D6T E;  4H44 B;  4GOD A;  1QLE C;  2DB4 A;  2HLO A;  2QNL A;  1X0T A;  2NUT B;  1D1C A;  1JTH B;  1SQB J;  3JYH A;  1IZM A;  3KL4 A;  3CC7 P;  2Q3E A;  1U0B B;  3A0H E;  1V55 C;  1M1J B;  4J30 B;  2OTJ P;  3CWB J;  3CSK A;  2EPL X;  3V2N A;  2WWW A;  4L6R A;  2O01 J;  4Z9J A;  5APX A;  5BQG A;  5CCG D;  2YL3 A;  2M3B A;  2WZF A;  2Y39 A;  1ZXG A;  2O9X A;  1IC2 A;  3ITK A;  2Y69 C;  4N3Y B;  1GW4 A;  3MHV A;  1L0N J;  1LM3 B;  3M0D C;  2Q9I A;  2F22 A;  4ZNC A;  3GWL A;  3RKO F;  2FYU E;  2M8R A;  2NZ2 A;  5JUA A;  3B5N D;  2B87 A;  2Z5H A;  1Q0D A;  1MMA A;  1NKZ B;  4PD4 D;  3EG9 A;  2P58 A;  2TMV P;  2DYS C;  3S84 A;  4QDL A;  5KAI H;  2R25 A;  1M2V B;  2E75 D;  3M91 A;  3C8G A;  1J1D B;  5AVQ B;  4UB8 H;  4GQH A;  1JEK A;  2I8D A;  2NSG A;  1LI7 A;  2MKV A;  5DJU B;  3II6 A;  2LXB A;  3CX5 H;  2KLU A;  1UFB A;  2G62 A;  3GF3 A;  2KK7 A;  1LT9 A;  2Q6Q A;  4U3F D;  2LFD A;  4YT2 A;  3M15 A;  3W2W A;  2G3A A;  4U7J A;  5B1A C;  3ZQY A;  3HUS C;  3EJN A;  1H9G A;  2VC9 A;  2YKP A;  1JUN A;  2ZPA A;  1PP9 J;  1AVO A;  5BU5 A;  1N7S C;  5DVW A;  4DBR A;  3U0C A;  1S4X A;  3ZG1 A;  4U3F G;  2Y0D A;  1LNQ A;  3C62 A;  1IFN A;  3GW6 A;  2B87 B;  3W68 A;  3EG9 B;  1AJY A;  2GAQ A;  3VAY A;  3USS A;  1HE9 A;  3L4F A;  1MMG A;  5KLV E;  1NTZ J;  3RQE A;  1FZC C;  2B0J A;  3Q5R A;  1QEX A;  2EIJ C;  4GT1 A;  2KJG A;  2EIK C;  3HNL A;  3C8G B;  2JEE A;  2KNH A;  1T2K D;  2J59 M;  3AE5 C;  3K1I C;  2CK3 H;  3R4Y A;  5APY A;  1QVF O;  4KC9 A;  1N8R Q;  2ZT9 C;  1JR8 A;  4QI0 A;  1LT9 B;  2YKQ A;  2Z15 A;  1QGK B;  4PV1 D;  3DM9 B;  1KYO H;  4CIP A;  3QW0 A;  3ZSU A;  2IFM A;  3MP7 B;  1SQX E;  3OEO A;  2ZYA A;  2NPS C;  3H1J G;  4Q4Z F;  1AVO B;  4XTK A;  3CXH E;  1CGN A;  3DJU B;  3CD6 P;  4U5F E;  3JSE O;  1GW3 A;  3FAJ A;  1X9V A;  3R2P A;  1TWA A;  1RH5 B;  1D7M A;  1KQG B;  1JOG A;  3WOD F;  5HV9 A;  1SQP D;  2C9L Y;  4U5C E;  3TD7 A;  1FZE A;  1EDK A;  2LKM A;  4YL1 A;  3VP9 A;  4ZLD A;  3M79 A;  3VMA A;  1M2O A;  4R4L A;  2CNW D;  1E83 A;  1NTK D;  4U9E A;  2E74 B;  5CCG C;  4C3D A;  2KUB A;  5TIS H;  3CC4 P;  1EDJ A;  1SQP G;  3KHU A;  2OYO A;  2G3K A;  2Y3H A;  4D6T D;  3UGP A;  4LC1 A;  2HMQ A;  3HJC A;  2MWQ A;  3CEX A;  1LTA C;  1AVY A;  3V5B A;  1USD A;  1QPU A;  2FY8 A;  3B5N C;  3I5C A;  4GEH A;  1OR3 A;  1C03 A;  3DJN B;  2KYV A;  5L3Q A;  4AL1 A;  4U3F J;  4W8K A;  1RF1 C;  3HD7 A;  1E2X A;  4D6T G;  1M90 Q;  2E75 C;  4H0L D;  2K9Y A;  3AGU A;  3M0D A;  5L0F A;  2KZI A;  2N9B A;  3BAT A;  2OYI B;  2PX0 A;  3PJS K;  4L73 A;  4IB4 A;  3H2V A;  5B3S C;  2KXP B;  4L76 A;  4OGQ B;  3UR3 C;  4DRI B;  4G7O F;  4CS8 A;  1VQ4 P;  3V2R A;  4FWV A;  1ZR2 A;  2AVK A;  2XL6 A;  2QRX A;  4OIP F;  3KZI E;  4IL6 E;  4AL0 A;  4PJM A;  1HH0 A;  2ZXO A;  1S2E A;  2KSF A;  1EI7 A;  4PJ0 E;  1YTZ I;  1M8O B;  4RKU J;  1LWU C;  1BR4 A;  1WGW A;  3AE7 C;  2R3S A;  3IQ5 A;  1HMO A;  2EIN C;  1GD2 E;  3EGD A;  3MBG A;  2EPN A;  1JY2 O;  2KQ9 A;  3UGO A;  1RQV A;  3A5T A;  3T4R A;  2H8A A;  2J5U A;  5AVU B;  4EUK B;  4DJ9 A;  2FYU G;  2L81 A;  2KZJ A;  1A7D A;  2NUP A;  3AE6 C;  5B5E H;  1GM5 A;  3UIA A;  1OKK D;  4IAO A;  1BGY E;  3HD7 B;  2XU6 A;  1W2W A;  2A06 E;  1BCC E;  4XEV A;  1BDC A;  1T2K C;  3I5Q A;  3W67 A;  2ICW G;  3LS0 A;  2J7P A;  3H6P A;  1M57 D;  1KD1 Q;  2LP4 A;  4Z1M H;  3JCU Q;  3KYJ A;  3LIE A;  3JCU H;  1YBK A;  2YLI A;  2QE7 H;  1D0X A;  1RHZ B;  1FZC A;  1ZHZ A;  3LEO A;  1KQS O;  4GOE A;  1AUE A;  1K40 A;  4PV1 C;  1SQP J;  1LKX A;  2L9J A;  2HPC A;  4BJ6 A;  3RF3 A;  3MLG A;  3NMD A;  1LTB C;  4EIY A;  1VQN P;  1WTY A;  2R7S A;  2YL0 A;  2J9V A;  1NTK J;  3RL0 g;  2KOG A;  2W27 A;  1I4Z A;  5AW3 B;  3T9O A;  3B0U X;  4BWN A;  2OOC A;  4J32 B;  1KIL A;  2HFE D;  2ZJS E;  3I4U A;  2AXT H;  5GPG B;  1YA9 A;  2NUP B;  1T9K A;  2OCC C;  1EZV I;  4D6T J;  2H89 C;  4HFF B;  4IFF A;  1NBB A;  2XL4 A;  3RGU A;  4ZLC A;  2YLD A;  4LLC A;  1L0N E;  5AW4 B;  4G78 A;  1USE A;  1SZI A;  4W80 A;  3TYY A;  1PGQ A;  1VF5 D;  5BVZ A;  2YZS A;  3EFG A;  5KYX A;  3G3Z A;  1MND A;  3M0A A;  2I1K A;  3RBZ A;  4O6Y A;  4MQ9 F;  4WB4 A;  1ZYR F;  1FZC B;  4CSA A;  1PD1 A;  2JPU A;  2P0N A;  2PGD A;  3CXH D;  3I5P A;  4A2N B;  3EHN A;  1VK5 A;  1OR2 A;  2HPC B;  3C8G D;  2RD9 A;  1OVR A;  1L0L K;  2M4E A;  3JRM O;  3H1K D;  2Y3D A;  3NKD A;  1GK4 A;  1AV1 A;  4CX9 A;  1ZRT D;  1YDI A;  4IGG A;  3TOL A;  2ZT9 B;  1X22 A;  4H0L C;  1VQ9 P;  3RK2 D;  3VRC A;  2YKZ A;  1SYQ A;  1KIL B;  2GA0 A;  4MN4 C;  1NSG B;  4JC7 A;  1HBW A;  3ZDM A;  3EZH A;  1A7E A;  2NPS B;  3H1K G;  1RKC A;  2A0U A;  3CAX A;  1NFO A;  4MVU A;  1VQK P;  4MTF A;  4YXD C;  3Q2Y A;  1IFI A;  5E2Q A;  1ORJ A;  3OA1 A;  2ITA A;  3F5H A;  1WN0 A;  4IRU A;  1PP9 E;  1YAU O;  4PFO A;  2VCA A;  2EPM X;  3GM2 A;  5AVS B;  2WT7 A;  1NU1 K;  2R03 A;  2WSF H;  5KYX B;  1EC5 A;  4I44 A;  1FMW A;  4I2L C;  2YIU B;  3N2Z B;  1H6G A;  1O87 A;  1N73 C;  1GDT A;  1NTZ E;  4TLF A;  1OW7 A;  4MTO A;  1RE4 A;  4HFK B;  3RQF A;  4PR9 A;  1X79 B;  1QKR A;  1JMW A;  3D6Y A;  2OJQ A;  1G2C A;  3JSZ A;  3VOP A;  3AEE C;  1Q2N A;  1EXJ A;  1ZOY C;  2P10 A;  1SF8 A;  3Q1M A;  1B68 A;  5H2F H;  1K9M Q;  4G0H A;  1M57 C;  1KQF B;  3WAQ A;  3V6I A;  2AEF A;  1WMK A;  4IOI H;  1K8A Q;  1OCO C;  1XZQ A;  2PX3 A;  1IFJ A;  3L37 A;  5DJT B;  2E5Y A;  1H89 A;  2CYD A;  4X0R A;  2KS1 A;  2PAJ A;  3PDM P;  3PP5 A;  3SXK A;  2WT7 B;  2WMM A;  2WQY C;  2QJY B;  4JW1 A;  3SXM A;  2O3J A;  4IAQ A;  3IQC A;  1JB0 J;  2L91 A;  3N7N A;  2H7B A;  2OYH A;  2HJM A;  1R4T A;  2WZG A;  3R7C A;  1U6H A;  5E79 H;  1RE3 A;  3KYQ A;  4OGQ D;  1CGM E;  1BGY D;  1EZV D;  2YQY A;  2A06 D;  1BCC D;  1P84 E;  5A6A A;  1G2C B;  1ZN5 A;  4I1M A;  2IXO A;  2WSE H;  1E85 A;  5EFW B;  4JF7 A;  1SQQ K;  2E76 B;  2XND H;  3D70 A;  3AED C;  1BGY G;  1KN7 A;  2DI3 A;  2A06 G;  2G8Y A;  1VF5 C;  1BCC G;  3H1K J;  2VAS A;  3IQT A;  5AW1 B;  2VH3 A; 
#chains in the Genus database with same CATH homology
 3C18 A;  4PV1 D;  3Q5P A;  3G9R A;  1TU3 F;  2J5U A;  2O01 J;  1HF9 A;  3SFE C;  1Y9B A;  3JYY A;  4GDO A;  4YXD C;  4OGQ C;  3Q2Y A;  3AE6 C;  1RQU A;  1WWP A;  4EBJ A;  2D2C D;  2BEZ F;  3TUL A;  1VL2 A;  2D2C B;  2E74 D;  1V4A A;  2Q00 A;  3RQG A;  1DD3 A;  2JP3 A;  3GM2 A;  1O3U A;  2QJK C;  4YTP C;  4H13 D;  4XEV A;  1KMI Z;  3AE4 C;  3AE3 C;  4H13 B;  3T97 B;  3H25 A;  3FGA D;  1OW6 A;  1FDI A;  5M1B A;  1KQG B;  1K05 A;  2WPV B;  3ABV C;  2E76 C;  4XEF A;  1JOG A;  3LW5 J;  4Z1M H;  1OW8 A;  2NZ2 A;  4XEK A;  3AE8 C;  3U3F A;  4R32 A;  2OQQ A;  3AE9 C;  2IDB A;  1KTM A;  1S1C X;  3O6Q A;  4TT3 H;  1NGM B;  1HJ0 A;  2YMK A;  1NYH A;  1YQ3 C;  4PV1 B;  1OW7 A;  4IL6 X;  1K40 A;  4PV1 C;  3EWK A;  3RK3 E;  3AEA C;  4R4L A;  2JO1 A;  2YWA A;  3MFN A;  2E75 D;  1R8E A;  3RQF A;  2E75 B;  3GMA A;  3C8G A;  2HSB A;  2E74 B;  1DIP A;  1KNY A;  3D6Y A;  2D2C C;  3L8J A;  1DD4 A;  2E74 C;  2MKV A;  2WSC J;  3AEE C;  1WTY A;  1EXJ A;  1ZOY C;  3AEG C;  4EBK A;  3B71 A;  1YQ4 C;  3AEF C;  3RL0 g;  1OMI A;  4H13 C;  1GMJ A;  1Q90 D;  2P10 A;  1KOR A;  1UFB A;  4XFJ A;  3Q1M A;  3GF3 A;  3Q5S A;  1KQF B;  1ZRT E;  5L8R J;  1WMK A;  2YIU C;  3GLM A;  4H44 D;  2G3A A;  1ZP0 C;  3Q3D A;  1KIL E;  4U7J A;  2BEQ D;  4R4M A;  2H89 C;  3AEC C;  5KKZ C;  1PL5 A;  3GF7 A;  3IN6 A;  1MKM A;  2LK4 A;  2WQY C;  5F28 E;  3IAO A;  3JZ0 A;  2QJP C;  3O10 A;  2E75 C;  4H0L D;  2K9Y A;  4H0L B;  2QIW A;  3L8I A;  3U0C A;  3S9O A;  1VF5 D;  2FYN C;  2WSE J;  1JB0 J;  3D71 A;  2L6G A;  3AEB C;  1ZZP A;  2L6F A;  4KT0 J;  3AE1 C;  2PBE A;  5KLI C;  1AJY A;  3SFD C;  1PV3 A;  2FBW C;  2QSI A;  2JPU A;  4OGQ D;  4OGQ B;  1EXI A;  3RQE A;  2JX0 A;  3Q5R A;  4H44 B;  3GM3 A;  2L6H A;  3GM1 A;  3C8G D;  4NQF A;  3C8G B;  4H44 C;  1K04 A;  1U57 A;  1S5L X;  1UIX A;  2H88 C;  3D6Z A;  3C8V A;  1IK7 A;  1FDO A;  3AE5 C;  2E76 D;  2E76 B;  4RKU J;  2FXP A;  2QJY C;  3K7D A;  1PIX A;  3R4Y A;  3AE7 C;  2KK1 A;  2ZT9 D;  3D70 A;  3AED C;  2ZT9 B;  1VF5 B;  4H0L C;  1WOL A;  2WSF J;  4I7Z B;  1ZME C;  2G8Y A;  2ZT9 C;  1VF5 C;  3BRJ A;  2V7Q J;  4I7Z C;  4Y28 J;  3AJM A;  1QVX A;  3AE2 C;  1RQV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...