1K04A

Crystal structure of the focal adhesion targeting domain of focal adhesion kinase
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
142
structure length
142
Chain Sequence
EISPPPTANLDRSNDKVYENVTGLVKAVIEMSSKIQPAPPEEYVPMVKEVGLALRTLLATVDETIPLLPASTHREIEMAQKLLNSDLGELINKMKLAQQYVMTSLQQEYKKQMLTAAHALAVDAKNLLDVIDQARLKMLGQT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The structural basis of localization and signaling by the focal adhesion targeting domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords FOCAL ADHESION KINASE 1
total genus 56
structure length 142
sequence length 142
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2001-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03623 Focal_AT Focal adhesion targeting region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.540 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 1k04A01
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 1k04A02
3L8IA 1KTMA 3C8GD 3SFEC 1QVXA 3B71A 1O3UA 3GM3A 4XEFA 3AJMA 4EBKA 3C8GB 1ZOYC 3K7DA 2YWAA 1K05A 3SFDC 3JZ0A 1JOGA 3L8JA 3AE7C 2JX0A 1WWPA 3AEAC 2L6GA 3TULA 1OW8A 3BRJA 1ZP0C 3AE4C 3C18A 3AE2C 3ABVC 1KNYA 2L6HA 1UFBA 3AEDC 2JPUA 4YXDC 1K40A 1WTYA 4EBJA 3AE1C 2L6FA 3AE9C 2Q00A 4XEVA 3AEBC 3RQGA 3AECC 3RQFA 2G3AA 3U3FA 3AE6C 2LK4A 4XEKA 3S9OA 1PV3A 2FBWC 1OW6A 3AE3C 4NQFA 2KK1A 1V4AA 2PBEA 3AEGC 3AEFC 3GM1A 1YQ4C 4YTPC 3AE8C 1K04A 3AEEC 2HSBA 3MFNA 3U0CA 2H89C 1OW7A 5F28E 3JYYA 1YQ3C 2H88C 2WQYC 3RQEA 4R32A 3AE5C 3GM2A 3C8GA 1WOLA 3O10A 1ZZPA
chains in the Genus database with same CATH superfamily
3H1IJ 4JC7A 1Y47A 2L91A 3SWFA 3T9OA 3B71A 5AVRB 4G78A 4L74A 3L75E 1KQSO 3RK2C 1BE3J 4MNDA 2OYIA 1K05A 2NSGA 4PACA 3CCLP 5CCGA 3V5ZA 2D2CB 3NTNA 1MMAA 3G9RA 1PZQA 3VMAA 3ZQVA 2FYUJ 1LVKA 2QJKC 3DM5A 1URQB 1KNYA 1FNTc 4DOJA 5EFWB 1KQGB 3OAKA 3TK0A 1M8OB 3U9JA 5L0FA 4WY4A 3H1JG 2D5RB 3GW6A 1NTMG 4M63A 1YTZI 1H9TA 1KB9E 3V5YA 1GDTA 5A69A 2V26A 4HFFB 2YO2A 2NPSB 1JNMA 3R7CA 2E75C 4IL6E 1RKCA 3FGAD 1LT9A 5F5HA 2OG2A 2PX3A 2O01J 1E2XA 3AE6C 3A2AA 1G2CB 2IZ1A 2W4BA 3JCUH 3ABMC 1NWQA 1IZNB 5KYYA 2EILC 4JZAA 3S27A 3L71E 3AQCA 2W4MA 3SWYA 4O6NA 4C7NB 1AQ5A 4U5GA 4Q4ZF 3JTLO 3SSUA 1T3UA 1BZ4A 2M0BA 2NPSC 2E42A 2NUPA 5IY5C 1KYOH 3OWTA 4Z9JA 2PFXA 2R7SA 3CL3D 1N8RQ 4EYYQ 1L0LD 1G4WR 2PAJA 1FZCC 1L4AA 3CXHE 5AC5A 3B0PA 2ZT9B 3AG2C 2XXAA 1L0LG 2I15A 2GAQA 3O39A 4CIPA 3A0HH 2LFDA 2O3JA 4DBQA 1DOWA 1L0NK 4W8PA 5KAIH 1KC8Q 3AOUA 1KQFB 3Q1MA 1MMNA 2IOQA 2A06E 2WITA 1FDIA 3V6IA 5KYYB 3L34A 1OCCC 4A4AA 2O1JA 2HUJA 2WVQA 1L7CA 3H1HD 1M56D 1LWUB 3IF4A 1Q0FA 4JPZB 4I1MA 2Q5UA 4EBBA 3HLZA 3FWLA 5APWA 3TDKA 3RIPA 4RJTA 1BE3D 1Z23A 1LWUA 1NU1G 2K37A 2CPBA 2OTLP 3CWBJ 3POVA 1Q90D 1M56C 2R25A 1N2DC 2KNCB 4IOIH 2VRSA 1OMIA 3U3BA 3W8IA 1ZXGA 3AE2C 3ABVC 1K8AQ 3M9QA 1N7SA 5L0HA 3FOPA 1M7LA 2HV7A 3DD7A 2HFIA 3CD6P 1NU9C 4CS9A 1ORYA 2FYUG 4EIJA 2YZSA 2XV5A 1J1EC 4YT4A 3L1MA 5DLJA 2ZYDA 4YXWH 3Q5RA 3RL0g 2XL4A 2YL3A 2B88A 1SQXG 2Y0EA 4AL0A 1BGYJ 1V54C 4H44B 2ZXEB 2C9NY 3JC22 4KBLA 3H25A 4PV1C 1TFKB 1AFOA 2LK4A 2OEVA 3TSIA 1KILB 2DGJA 4PJNA 3AE3C 2R7VA 2L81A 1LE4A 2OTKE 1SQQE 3HE5A 3QMKA 2P61A 4IAOA 1QGKB 1FOSE 1KD1Q 5AW9B 3ABLC 2H43A 4AUWA 1HH0A 5APTA 2ZXWC 5CJ4A 2QJPC 1OVRA 4U3FJ 4JIOA 1LGHB 5COFA 1MQVA 1UG7A 3U0CA 2E75D 2QUPA 3BCCG 5T1DB 2BCCD 2NUPB 2WQYC 2KC3A 2PRRA 2FXPA 2JP3A 3UNGC 1J2JB 1NZEA 3KZIE 1R5ID 4QI2A 1HW2A 1LJ2A 4MVMA 5KLIC 5K5GB 3T6JA 3M4BA 2YXRB 1Y4CA 4OD4A 4MVUA 2N1TA 4IL6H 2Y9ZA 3H2VA 1X9VA 4PJLA 2N9YB 1Z56A 1N7SC 3PJSK 2IFNA 2JKVA 1ZHZA 3FWNA 2YXQB 3WG7C 2JEEA 3B4SA 2KQ9A 4JJGA 2FFDB 3L70E 4N06A 3K1IC 3MYFA 4PJMA 4AE4A 1KV4A 3JSZA 3CQZA 3F5HA 3H1HG 3HRNA 1Z7Qc 1Q82Q 3HNJA 3CWBD 3QWOC 2A06G 1HE1A 3IN6A 2NSFA 1VF5D 1O87A 5KYWB 1YJNP 2OYHC 4CBEA 1YBKA 3NYLA 3W2VA 1S5LH 2BL2A 1LIHA 3GMAA 3NDBB 2FYUK 1NTZG 3GEIA 5KYWA 1RF1C 3HD7A 4NTFA 2KUBA 4NPEA 3AE9C 3GHGB 4JYCA 1OKKA 1ST6A 5CHXA 2R44A 2HV6A 5AVQB 1VDFA 1SQPJ 2MJZA 1SQBD 3P7KA 1NH4A 1GL2B 3G50A 3Q5SA 1CSBA 1X0TA 1AVOA 3N2ZB 2R03A 3CX5H 2XLOA 1M57D 2PNOA 4MVQA 4QMAA 3M9HA 3S1KA 4PD4E 4JQ0D 3HD7C 3G71P 2FYNC 1Z6AA 2ZT9C 4XA4A 2CNWD 3CCUP 2Y39A 1S7ZA 4G7ZF 1C02A 2Y3GA 4GT1A 3CPWO 1NVOA 4OWFA 1QPUA 1SFCC 3L71G 1WRGA 2KLVA 2CDQA 1QVFO 1JR8A 2Y69C 2OCCC 3EPVA 2GFHA 2Z4EA 1YQ4C 1KYOD 3IPMO 1MNDA 3CWBE 1MFTA 1TWAA 2I1KA 4IAQA 3HTKC 4WGYA 1ZRTE 5E79H 1NU1D 1SF8A 2K9JB 1E86A 5CCHA 3GF7A 3Q2YA 5F28E 1OXKA 3MZWB 2HMZA 1ZW3A 1G4US 1IC2A 3HD7B 2LSEA 1KB9D 3H1JE 1OCRC 3MLGA 3CX5D 2QJPB 1WOLA 3RBXA 2ZT9D 1J1DC 2XSEA 3B5NC 1FMWA 1K9MQ 1S3JA 1XZQA 2ZVNB 2JR8A 1JPNA 4MN4C 4YT8A 3GEEA 2XZRA 5CBNA 2LKMA 1X22A 2QJYB 4DXWA 1FC2C 2LP4A 1NTKG 5KKZC 3WUTA 4I6MC 2IBZE 3V2QA 4NTAA 4PK4A 3NRHA 4JYBA 4QDLA 2TMVP 5B5EE 1KYOE 1AJYA 2H7OA 3HUSC 4ZNCA 3PDMP 2L6HA 1QQ3A 4KJMA 2WVRA 1EXIA 1PPJE 2Q9BA 5DJTB 2BEZF 4GIFA 2LD6A 4U7JA 1E79H 1I4ZA 1SZIA 1SFCB 2R3CA 5JRAA 1NU1K 1M2OA 5D92A 2P10A 3R4YA 3T4RA 2VCAA 3H65A 1VQLP 1V55C 2G3AA 1SQBJ 2J9BA 3EQLF 3U2MA 1KMIZ 2Q3IA 3N0TA 1SQBE 2OYIB 1AV1A 3C7JA 2J46A 1R8EA 4XEKA 2XLVA 3OW2O 2LQGA 1VQ9P 2M5AB 2OU6A 5AW1B 5DQZA 4O7GA 3H1HJ 2KK1A 3MUDC 2Q7CA 3A0BE 2QJYC 2DW3A 3FXEA 4O79A 4O9BA 2J8WA 2RN0A 5DJUB 2J9UA 1S72P 3AG1C 3DE8A 3CMEP 2OEXA 2YIUC 3TF5A 3H2UA 1M1KQ 5L0CA 4JEBA 3GANA 2C9LY 2KSFA 2J9WA 2K9JA 3MFNA 1Q0GA 5T3TA 3CCVP 4WWIA 1JB0J 1YA9A 3KYJA 3RH3A 1LM3B 4OIRF 1EDLA 2KYHA 1NU1J 3K1HA 1LE2A 3VTPC 1NU1E 2P7VA 3NMIA 3ZC4A 4BJ5C 3L37A 2AXCA 2UWJE 1X79B 1HMOA 2ZPAA 2K1AA 2A0BA 2AEFA 1BGYD 3CC2P 3SXZA 4IFDK 1FZAA 1LTIC 4RBNA 1FZCA 2Y3BA 1JEKA 4H0LD 3US6A 4XPXA 4G7HF 2OYHA 2YL7A 3EFOB 3KXDA 4K3AA 3L8JA 1X8YA 4KT0J 2ZXRA 1N73A 3BRJA 1ZP0C 1VTMP 1W2WA 3C63A 3AE4C 4PJ0E 3CX5I 1ZV8A 1IW7F 5B66E 4E0HA 3B0UX 1JY3P 4EWCA 3P8CD 2ZXXA 2XM0A 3CSKA 4L75A 2A45H 2QVAA 4IGGA 2R7XA 3K33A 3GWLA 2V3CC 3AE1C 5BU5A 4PJJA 1HVVA 2D4UA 2YKQA 2UUIA 3BASA 5E2QA 1KILC 1NTME 3L74J 1BDCA 5L0GA 3TGUE 3HTKB 3EGXA 1VQ8P 3S90A 5AW2B 4BEJA 1JY2N 2D2CC 1R5LA 2BCCE 2N9BA 5AVXB 4Z9IA 1PGJA 4H0LB 4WY4C 3CMAP 4IARA 2NPUA 2P0NA 2EPMX 4FX5A 4BRYA 1AEPA 2I8BA 1QLED 1OW6A 3L36A 3P32A 3M79A 2KZIA 2WMMA 5CCHD 3CCQP 4J30B 2B0JA 3PRJA 4EDFA 3H1IE 5KAIE 4AYCA 1VB5A 5AVZB 2IXNA 2ZJSE 3LIEA 5CCGC 2EIJC 1L4AB 2C0XA 2BC5A 1PP9E 3LIDA 3D6YA 3UMIA 4JKVA 1OW7A 1UIIA 3VYIA 1FDMA 4CJOA 1R4TA 2IX7C 1RE3C 1PFIA 1QLEC 3LEOA 1NAYA 3EWKA 3NYJA 4YT5A 3IQTA 4WY4D 4DCKA 4H44D 3IFMA 1FTSA 2L9JA 3G6EP 1KTMA 2YVKA 1QVXA 3EG9A 3OEOA 3RF3A 2QJKB 4MS2A 3U8VA 4G0HA 4UB8H 1AQTA 1H6GA 3OA7A 1KFNA 3RGUA 2MYSA 4IWBA 5FZTA 4XLPF 2AXTE 4I2LC 1FZCB 2XRHA 3RK3D 1WWPA 3G4XA 3AEAC 3ASOC 5HV9A 1NKNA 4NTBA 3Q3DA 1YVIA 1BCCE 4I3MA 4D6TD 4F4BA 2GWWA 3WUVA 3D6ZA 2YL0A 2B87B 3M4CA 1N86A 4YXDC 2KS1A 1YYXA 2EPNA 2XLDA 3MTUE 1OVUA 2YKOA 1OKKD 3KYQA 5F5FA 2C03A 3LESA 2R32A 3AEBC 1FDOA 3T97B 4C7RA 3ITFA 3RQGA 2W6BA 1PPJG 2IFMA 3L74D 2IBZI 2W45A 3A0HE 3LLKA 3EJNA 4U3FG 1Q0DA 3HTKA 1OR3A 3CCSP 2H8AA 3IQ6A 1M57C 2Y9YA 1LWUC 3H1KD 3RK3E 4CDYA 2IYOA 1UIXA 4XFJA 2YO3A 3NG1A 1USEA 4RDAA 4ZLDA 2XXAB 2R7QA 3G3ZA 2N1TD 1EC5A 1JY3O 2J5UA 1T8ZA 3N24A 4H13D 1FJPA 4HKZH 4BXLA 1PCXA 3JRMO 4C3EA 2H89C 1PPJD 3QZCA 5KYNA 1PP9G 2YMYA 2JJLA 3BRTB 3L0IA 2W8ZA 3CAXA 3X2QC 5EGYA 4B86A 2QEXP 4O6MA 4JTCB 4L6RA 4R32A 1PP9D 2V7QJ 1USDA 1VQ6P 5AVUB 4EIYA 1ZHTA 4H13C 3U9MA 2WSSH 2RMZA 4BPMA 4KI2A 1V74B 2Q1KA 1YA7O 1M2VB 2G3VA 3CCRP 1CGOA 1W2BO 1LS1A 5GPGB 4N78D 2QA4P 3FXHA 5DQTA 2ZVOB 1SQVD 1VQ7P 2NUTA 3MBGA 5AC4A 1ZOYC 2P58A 2OJQA 2EPKX 1E83A 4XTKA 1BE3G 1NFNA 5A6AA 3M9BA 2YQYA 1RY3A 4Q7CA 1JOGA 4NC3A 2VH3A 1H9GA 2VC9A 3N7NA 2Y0CA 1OCOC 3VM6A 1VLTA 1OW8A 1Y9BA 3WAQA 5H2FH 3VMYA 3R2PA 3JYHA 5KLVE 2V4HA 1ORSC 2A68F 5M1BA 4CS8C 4E7SA 1JCCA 4NPFX 3DI5A 2PGDA 2GM4A 4WABA 1S1CX 2B9BA 1DEEG 3IAOA 2N1TC 1GW3A 3MD0A 2H7BA 1JTHA 5B5EH 5KLVJ 2Q3TA 5AVWB 2KB7P 2H7HA 2LFFA 1N7LA 2W6JH 1SQVE 2HFED 1MKMA 2XU6A 2K9YA 2ZYAA 1OIPA 3AECC 3A7OA 3I56P 1BGYE 3DJNB 5COGA 3RYLA 3U3FA 1SR2A 1RE3A 1AUEA 1EDIA 4EKWA 2GDCA 4IB4A 256BA 3Q7LA 5DS5A 3BRVB 1WN0A 3S9OA 2KGOA 3V4QA 3B8EB 3OA1A 1ZU5A 1BR1A 4CS8A 1ZW0A 3T6BA 1D7MA 2WPVB 2ZYGA 3L35A 3UIAA 1SQQK 1ZR4A 3H1KE 1E85A 4HE8D 1A7DA 3DMDA 3ECSA 3ASNC 2AVKA 3TGUG 1RJ9A 1FE6A 3JYYA 2KW3C 3I5CA 2NG1A 1VF5C 1HW1A 1FR0A 1GS9A 4Y28J 3UR3C 4E17A 2WT7A 3PHF2 1YTZT 1PP9J 1ZZPA 3KKBA 4I44A 3P8CE 1LTBC 3VYWA 1TWHA 1D1CA 1KZUB 3CCEP 3CC7P 2ZXOA 1VL2A 3K5BA 4J7TA 1VK5A 5CIVA 5GTIH 3GEHA 1DIPA 2HR3A 2R5BA 2R7RA 3Q6NA 3EFFK 1XWJA 5T3WA 1H0TA 2HZ8A 4EUKB 1IFPA 1U7JA 4H44C 3SFDC 2WPQA 4D4NA 1BBHA 1RKEA 2JX0A 4EHPA 1WMKA 2G3KA 1NLXA 1SFCA 3TNUA 4U5HA 3JCUQ 4OGQD 2YMKA 2C0WA 1ORJA 3BEHA 2FY8A 5C39A 5TJHA 3K66A 4XWJA 4K1OA 3L72J 4Q5SF 1MMGA 3LEVA 1ZMEC 4NCQA 5CCGD 1T5OA 3NXSA 1HE9A 3HE5B 1HJ0A 5BU8B 4YN0B 5AVYB 5KYXB 2OARA 5AW4B 5JSLA 5B3SC 3SP1A 4R4LA 5APUA 4BJTA 3DWWA 2WTYA 2OOCA 2R7UA 2E74C 3ZTMA 3GORA 2SPZA 3NMJA 1KQLA 3WMM0 3ITKA 1JAFA 2YKZA 1GU4A 1HMDA 3IQCA 3PH0A 4JE9A 3A5TA 3KDPB 3IEEA 1LKXA 1RF1A 3IHUA 4KNWA 5A6JA 4IRUA 3KQGA 2AU5A 1J8YF 4OIPF 2FBWC 2HSQA 3UGPA 2JWDA 1LP1B 2JDIH 1YJGA 1SQXE 2AP3A 3TK1A 1IFDA 1HY5A 1RCPA 1JRAA 5E3AA 3L75J 1U89A 1OCZC 1URQD 2DB4A 4YL1A 5APVA 3CCMP 1OXBA 2NZ2A 4CDAA 1A41A 2EPLX 3LS1A 2I1JA 5TISH 4JEAA 1SQQJ 3L70D 4U5BE 4DVZA 5EK0A 4H4KC 1LT9C 4MVSA 4D6TJ 2E76C 2OTJP 2IXMA 3VOPA 5KKZB 1MUUA 4N78E 3RL0B 4CSAA 4YK5A 1JMBA 4LLEA 3L73G 4RKUJ 4DOZA 1G5ZA 3LW5J 1VYKA 5KJ7A 3E7KA 5AW8B 2WVNA 4K0DA 4EBKA 3WHNA 1RF1B 3C8GB 4OVNF 3M1CB 3EHNA 3F47A 1WT6A 3TOMA 1YJ9P 1NBBA 3CCJP 1LT9B 3AGTA 4H54A 3KL4A 1U7MA 4PFPA 4B6IA 3L74E 1NU7D 2WWWA 1L0LE 3VMXA 2DYRC 3HNLA 5A6BA 1DEBA 2BEQD 1PGQA 3H1KJ 5AGFA 1B68A 1NTKK 5H2FE 3ZSUA 1JTHB 1T3JA 2G8YA 2Q3EA 3L73D 5KJ7C 3AEDC 5L0IA 3JCUE 3V7OA 1QKRA 3L72D 4G7OF 2K3RA 3PMRA 1NTZJ 5CI9A 2FFHA 2DI3A 2YL1A 4MVOA 2MWQA 1S5LE 4OGQC 1BE3E 3CWBG 1ZRTD 5CCHC 3QVYA 2OQMA 1NYHA 3H1LG 5GTIE 3S4RA 1GL2C 2PP6A 3U59A 1KFMA 3II6A 2KZJA 2WZFA 3VAYA 4IFFA 4CS9C 4BEMJ 4XE5B 4BWNA 2CK3H 3SXYA 2BASA 3S28A 1SQVJ 1IFNA 1CGME 1RF0C 2IPPA 2D2CD 1YI2P 2PBEA 2XL6A 2B87A 2CCYA 2XDJA 4I7ZB 2XKMA 2XM4A 3UGOA 1TR2A 4O6YA 1S4XA 2R5DA 1L3PA 1KILD 2CNWA 3V5BA 2QNLA 1BCCD 4YTPC 2HPCB 3L75D 3I55P 1ZW2A 2W83C 3B0VC 1LT1A 2M64A 3BCCE 1OXZA 1SP4A 3L73E 2R9RB 2HPCA 2KLUA 1CW5A 3L70J 3M0AA 2IM8A 4I1LA 5KLVD 2V7QH 3AE5C 1ZN5A 4GYTA 1FS0E 2FXOA 5L3QA 2NUTB 2M3BA 3NKDA 4PR9A 3G4SP 4PJ0H 4HJGH 3L8IA 2O1KA 4GDOA 4I7ZC 3FAJA 2M8RA 2QG4A 4ONSA 3W4YA 2M5AA 3H1JJ 1D0YA 3SNHA 1L2PA 1NTMJ 3GHGC 4HFKB 2J45A 1NGMB 1D1AA 3RL0C 4LGDE 4N6JA 2K88A 3BCCD 3AG3C 2NPSA 5TJ5E 3RVZA 1MFZA 4Z9HA 2L6GA 2AEJA 1KB9I 1LNQA 5BVZA 2KJGA 1E84A 4ZKPA 3MUDA 4DJGA 1OWAA 2KK7A 2KS1B 2HS5A 2E75B 3BVHA 2IBZG 5JP7A 4DT0A 1JY2P 1SQPE 2YLGA 1GK6A 1HGVA 4BJ6A 3V5XA 3FVYA 3L73J 1J8MF 3I5PA 3RVYA 1SYQA 2A0UA 4PV1B 4AE4B 3MX3A 2CYDA 1S9KE 2L5GB 2GUVA 1SFCD 2R02A 4U9EA 1NTMK 5AW6B 5DS6A 5E79E 2YIUB 1SQBG 3U1AA 1L0LK 4CS7A 2X0CA 1KORA 3C8VA 1EQ1A 2ZD9A 1DD3A 4D6TE 3HNKA 3EQ2A 1APCA 1RQUA 3TYYA 3D70A 2YLDA 1XTGB 1VOMA 3HUSA 5APXA 1HBWA 1T6QA 2ZFCA 1JCDA 3AEFC 1YARO 3GM1A 2A45I 3SZRA 1YAUO 3H32B 1K73Q 2VCBA 1EZVG 1C17M 4UDVA 3I4UA 1RQVA 1GL2D 1QEXA 1HGZA 5AW7B 2LCHA 2E43A 3AE8C 3AEEC 3FOOA 1VLSA 1RJ9B 1YZAA 5BUOA 1NTZE 1YQ3C 1LI5A 3NFQA 3RK3B 4AQRD 3U1CA 1VQ5P 2XLHA 4MVRA 1NTKE 3GF3A 3DAFA 4JW1A 1N7SB 2JD3A 4CSAC 1PD0A 3U8PA 1FMVA 1SMYF 2E76D 4JBZA 2RSEB 1GU5A 5E3CA 3FAPB 4JTDB 2IYLD 1NTMD 3PTZA 1Q0MA 3RFYA 3V2RA 4LACB 5BQGA 2I8DA 3DAGA 4CJGA 3RK3C 2Q7RA 1URQC 1ZHWA 1MV8A 1J1EB 3C8ZA 3DM9B 1VQKP 3BCCJ 2Q4FA 3AG4C 3WUUA 1FJKA 3RL0D 2N1TB 1FZBA 3GHGA 3C18A 1IK9A 3EZIA 1OZHA 4CDVA 2WSCJ 1UFBA 1NTZK 1SQXD 1ZLLA 1FFTC 4DBRA 1WTYA 2Y0DA 3RW0A 1SQQD 2ITAA 1T01A 3LNMB 3GODA 2VB6A 2YKPA 4E0IA 1PIXA 1NG1A 1KILA 1H89A 1CI6B 3SXMA 1LTGC 2IBZD 4J32B 4OINF 3CEXA 2OQQA 2DYSC 1TWCA 1EDKA 2FFDA 4N4WA 5JVEA 2OYHB 3IR9A 2E5YA 1H0TB 2R3SA 4PFOA 1BDDA 2XNXA 4ASWA 3L4FA 3TGUJ 1BR2A 4A7PA 5AW0B 3W2WA 1M6TA 3JT1A 2J58A 1I5NA 3EHMA 2EIKC 2IXOA 4LDQA 1SS1A 3C9IA 5APYA 1V4AA 5JT4A 2OJED 3DKAA 4Y99B 1PGPA 1RF0A 1RE4C 3S0XA 1RXQA 1JOCA 2HODB 1OR2A 4TLFA 2AWYA 1K04A 4YPCA 1GL2A 2HSBA 3NMKA 1FOSF 3SYNA 4HB1A 2KP8A 3UMKA 4CX9A 4DRHB 2XLWA 3O8ZA 4YL3A 4E18A 3KMIA 1TQGA 5CMZA 5AVVB 3RK2B 3CXHI 4IFMA 4BJ5A 1M90Q 3JSEO 4U3FE 3J06A 2KYVA 4ULVA 3USSA 3O55A 1NTZD 1Z5ZA 1VYIA 5A6BD 2J0WA 3O10A 3HKKA 4JTAB 1LI7A 4LC1A 1BR4A 3LW5H 1ZR2A 3C8GD 3LS0A 2CGEA 3PLNA 2W90A 1BSNA 2Q6QA 1NFOA 2AWCA 2C04A 5JS5A 4XLNF 3GM3A 1P84I 1NO4A 3O6QB 1S5LX 1SQBK 4KNVA 1WATA 1SQPG 2E5TA 1TFOB 1JY3N 4U5FE 3DZAA 5L8RJ 3JZ0A 3MIWA 4FESA 3L75G 3QW1A 2G62A 1EDJA 1YYJA 4H0LC 2HODA 1M2VA 2KNHA 2FAPB 3H32A 3L71J 2QM8A 2EINC 1QL2A 1BCCJ 4GOEA 3EGDA 3M15A 3NMDA 2IDBA 3Q7GA 4N6CA 2XS1A 2E74B 1SQXJ 2GA0A 4GQHA 4WJ0A 5APSA 4P9FA 4XEVA 3DE9A 3SXKA 4PD4D 3WU2E 2XNDH 5KAFH 2B0HA 3RQFA 3KH2A 1HUCA 2J59M 4HEAJ 1M1JC 4C7OA 3EH2A 4D4XA 1VQ4P 4P9TA 4BJ6C 3M06A 2X51A 3O6QA 2J9VA 1BDJB 1U57A 1DH3A 3H1JD 3LNRA 4Z1MH 4AL1A 2XLEA 3TQOA 3E1IA 3KPHA 3H1LE 1VQPP 3AEGC 3LJBA 4ULWA 1L0NG 2PP4A 4ASVA 4YJWA 4N3YB 1SLQA 1FZEA 1JUNA 1JPJA 2ICWG 1P84D 1QZXA 1RHZB 1J1DB 1AVYA 4KC9A 3BATA 4JCHA 4M3LA 2JO1A 3CX5E 1Q81Q 3EZHA 1HTLC 5AVTB 1C03A 4C3BA 5COMA 4U5DE 5DS4A 1WASA 4GKGA 1W5CE 2E74D 2ASRA 5L0JA 3JSVC 2OYOA 2O01N 4JVSA 3VP8A 1O5HA 3DXJF 3ZVRA 3QVZA 2R7WA 4YWQA 2HG5D 3IQ5A 2ETSA 4LERA 1IO4A 3A3YB 3H1LD 3SFEC 3A0BH 4ZMDA 3HNIA 3L74G 1I4YA 1U0BB 1L0ND 3P8MC 2YLIA 1PL5A 2O9XA 3ZWIA 1W2EA 2GUSA 1T2KD 2A6HF 3U2LA 3X1OA 2YWAA 4OH8B 1N73C 1ZHYA 5FCLA 1Z63A 4OD5A 3PHLA 1S9KD 2Z5IA 2CW0F 4AX2A 2WSFJ 1T6AA 2QSIA 2WPRA 2UUHA 5JLIA 2KOGA 4FWVA 3A9CA 1HF9A 1A02F 3ZTZA 2B89A 3KHUA 2LXCB 1LTJC 4MTOA 1K40A 3L71D 1G1IA 4HH2A 3DJUB 4MVZA 3ZDLA 2L6FA 5KLVG 4BRYB 1D0ZA 4JCZA 3ABKC 2KSEA 4TT3H 1GM5A 3MP7B 2WSEH 1N73B 1VQMP 1Q7YQ 2WVOA 1MNEA 3LAYA 4U9DA 1NAFA 1YJWP 2YHSA 1CPQA 2KI7B 5CJ0A 1A7VA 2LR2A 4JJFA 4GEHA 1VF5B 1S2EA 2RH0A 2MKVA 1G1JA 2RD9A 1PV3A 4WBAA 3FHDA 2HJ3A 1L4AD 2HYNA 5AW3B 3L72E 1IZMA 1QL1A 4ZLCA 4DRJB 3Q5PA 3K1IA 2VCCA 5AW5B 2IXPA 1SQVK 4NPDA 4U5EE 2J0XA 4PV1D 1BCCG 3F89A 2PF4E 3CXHD 2QIWA 5KLIB 3VRCA 3FMSA 1CI6A 1Y6DA 2Y3HA 4CPGA 2KXPB 1KILE 5KYUB 3B29A 3W8HA 1D1BA 3EFOA 2AXTH 5E33A 1QSPA 1HWTC 1JO5A 4LDRA 3V2NA 1KN7A 1GQAA 3T6GB 1F1MA 2M4EA 5B1BC 1T6UA 2P2UA 4ZKUA 4AK9A 5KAFE 2ZXPA 2QM7A 5D91A 3WU2H 1O3UA 2QTVA 4LLCA 1QX8A 1NTKJ 1VMAA 4A2NB 1FZFA 3V2PA 4H13B 3F46A 4C7OB 1JMWA 1ZYRF 1L0NJ 3MYIA 4GOFA 3NYMA 4RESB 2IYPA 3TGUD 1RMVA 1LPEA 1ZHXA 3EGXB 4JRZA 4WVZA 2FGYA 3T97A 3SWKA 3N4XA 1KYOI 2A1DD 1A0BA 1TWGA 2WZGA 3TD7A 5HSWA 3AQBA 3VMZA 2FYUE 2PX0A 1A7EA 1YYCA 4X0RA 1N7SD 3LUTB 4GODA 4DRIB 2FXMA 2WSCH 2Q9CA 3JRTA 5B3IA 1E5WA 3CC4P 2JPUA 1GTWA 4L73A 1OFCX 2W6AA 2FKWB 1S05A 2XL8A 2POHA 3O6XA 3H1ID 1N1CA 1T2KC 3RBZA 4LDKA 2P1AA 1H88A 3M0DA 4XPWA 1MZ9A 4E7ZA 2A06D 1SQPK 3KYIA 2O01H 1LTTC 2ZAEB 2NPSD 3QW0A 2P1JA 2LIGA 2E76B 4EOTA 4U5CE 4LLHA 1HJBA 1GK4A 1RE4A 4RD9A 4NQFA 3QH9A 3SEOA 1DD4A 1FFHA 1R5SA 1Y8AA 3ZDMA 1LS4A 1IFMA 3FXDA 3GG2A 4FAPB 1FU1A 4BJ1A 4PD4I 4K7BA 3KPEA 1NKZB 3EH1A 4C46A 3D71A 1T9KA 5GTHH 2PFDA 2KNCA 1U6HA 4ANJA 2FFDC 1JY2O 3TOLA 1AA0A 3M0DC 2FYZA 4IL6X 3TJ5A 3VF0A 3QTHA 2L7AA 1Z3IX 3MHVA 3S84A 1SQXK 1IJDB 1BGYG 3H6PA 5CI8A 1LP1A 4XPYA 5CBOA 2HKVA 3EFGA 1T6IA 2E87A 1GGQA 5EHHA 1Q86Q 1JMMA 3M91A 3C62A 5AVSB 1TU3F 2BCCG 4UB6H 3CI9A 3AE7C 4IJJA 2QRXA 3RK2D 3E1RA 5B66H 3PCVA 3B9QA 2CPSA 2WL8A 1H7IA 3ZIBA 1NOHA 1CZQA 3H1KG 3EGDB 1M1JA 1DOVA 1GD2E 3FDQA 4ER9A 2H8PD 1FAPB 2W9YA 4EBJA 1NHLA 2XS8A 1IK7A 3TNUB 2KIKA 4HYTB 2HLOA 4MTFA 5DVWA 1RKEB 5K0IA 4W7YA 1WGWA 3E9VA 1NJIQ 1LTSC 5TISE 1BSHA 2QE7H 2H7VC 1VPCA 3H1IG 3CZ6A 3UMHA 3H1LJ 1EZVD 3PP5A 3H1HE 1NSGB 2R7TA 1EI7A 3FX0A 2EIMC 3L72G 2RKLA 2J7PD 2Q9AA 3I5QA 2FYNB 1H8AA 1D0XA 1FZGA 1SQVG 4YL0A 4K35A 1M1JB 3CXHH 3GWNA 1CGNA 5GTHE 1CPRA 4MW3A 2OYIC 5L3VA 2OKUA 1XZPA 2VASA 3ZG1A 1DX7A 4OGQB 3B5NB 1OX3A 5APQA 2A6EF 5KYUA 4I1OB 1KB9H 4XQ1A 3KZIH 4OIQF 4WB4A 3B5NA 2M3EA 2W27A 2H88C 2J7PA 3HE4B 2WZ7A 1SVFA 1YZCA 3MGNA 4WY4B 2EPOA 3RQEA 5L0DA 2WB7A 1VQOP 3L70G 3B5ND 3C8GA 3GM2A 5JUAA 2Z5HA 2P67A 3ATPA 4BG0A 3ZQYA 3HUSB 1KU2A 2P6VA 1G8XA 3RKOF 5KLVK 2WZLA 3AGUA 4MTGA 4Y99C 1JM0A 2NRGA 4W7ZA 4L76A 1YLMA 3VN0A 1TKNA 4XEFA 3AJMA 1GZLA 1EZVE 2HMQA 2MHRA 4J7YA 1LTJA 4UB6E 1IFIA 3K7DA 3S29A 4W8KA 1YITP 4C3DA 1SQQG 4RO0A 1PGOA 3HJCA 2FYUD 1LTJB 2YNYA 1XTCC 3CLQA 1ZVZA 1A02J 2P7JA 3TULA 4D6TG 2WSFH 4U3FD 4P6IC 3U5SA 5BQHA 4DVYP 1YIJP 1PD1A 1EQ7A 1MMDA 5KYXA 4YT2A 2BCCJ 2Y3DA 3NKEA 2WT7B 4R4MA 1Q2NA 1YDIA 4MQ9F 4C7NA 4OIOF 2IBFA 1EXJA 3K6BA 2Q9IA 1EA8A 2Q00A 2KSJA 2XLMA 1LTAC 2AEMA 2GA1A 2WSEJ 2YRFA 1FBMA 3A11A 3G4ZA 3W67A 5BQIA 2QE9A 3V4WA 1L4AC 2R7OA 1Q0KA 4JF7A 4PD4H 1IFJA 2A69F 1AVOB 1OVVA 3TJ6A 4MW8A 1RH5B 2F22A 1L0NE 2QLAA 3WODF 1GW4A 3EG9B 3W68A 4EI2A 2HJMA 2YEVA 1NTKD 4NY3A 1G2CA 1OQCA 2LXBA 3VP9A 1YHQP 4JURI 4N6HA 2BE5F 3GLMA 2WPSA 3HD7D 3OJAB 3C1LA 5B1AC 1URQA 3HE4A 1GMJA 4W80A 1ZU4A 5KJ7D 1L0LJ 1QVGO 2QY9A 4QI0A 1EKYA 1P84H 2IZ0A 3Q6MA 4UB8E 3LLIA 1VQNP 4CIHA 1P84E 1SQPD 2OGUA 3E70C 5KTBA 4DJ9A 1EZVI 4DZOA 2A45G 4KHXA 2JWAA 5A6KA 4WGZA 2Z15A 2R05A 1FAVA
chains in the Genus database with same CATH topology
5KLIC 3L8IA 1KQFB 3Q1MA 3LW5J 1KTMA 4GDOA 4I7ZC 3C8GD 3SFEC 1FDIA 1QVXA 3B71A 2E76D 1VL2A 1O3UA 3GM3A 1PL5A 1DIPA 1S5LX 3AJMA 4XEFA 4EBKA 3C8GB 4H0LD 1NGMB 4H13B 1ZOYC 3K7DA 5KKZC 2YWAA 1K05A 4H44C 1TU3F 3SFDC 5L8RJ 3JZ0A 1JOGA 3L8JA 3AE7C 4KT0J 2JX0A 1WMKA 1WWPA 2D2CB 3AEAC 1Q90D 2L6GA 3TULA 2WSFJ 2QSIA 1OW8A 1Y9BA 3G9RA 1ZP0C 3BRJA 3Q3DA 2BEQD 2QJKC 4OGQD 1OMIA 3AE4C 2YMKA 5M1BA 1AJYA 3AE2C 3ABVC 4H0LC 3IN6A 3C18A 1KNYA 1VF5D 1HF9A 2L6HA 2E75B 2G8YA 1KQGB 4R4MA 2WSCJ 1UFBA 1S1CX 1ZMEC 3IAOA 3D6ZA 3AEDC 3GMAA 1EXIA 1EXJA 1HJ0A 2JPUA 4YXDC 1K40A 2IDBA 1WTYA 4EBJA 2E74B 3AE1C 2BEZF 2L6FA 3AE9C 1IK7A 4U7JA 3Q5RA 2Q00A 1PIXA 1MKMA 3RL0g 4R4LA 4TT3H 4XEVA 2K9YA 2WSEJ 3AEBC 1FDOA 3T97B 3RQGA 4H44B 4PV1B 2E74C 2P10A 3R4YA 2OQQA 3Q5SA 2E75C 3AECC 4OGQC 3FGAD 3RQFA 2G3AA 3U3FA 2D2CC 1NYHA 2O01J 1KMIZ 3H25A 4PV1C 3AE6C 2LK4A 2E76B 4H0LB 2FYNC 1R8EA 1KORA 1VF5B 2ZT9C 3C8VA 2MKVA 3O6QA 4XEKA 3S9OA 1DD3A 1U57A 1PV3A 2FBWC 4Z1MH 1RQUA 3D70A 1OW6A 3AE3C 4NQFA 2KK1A 2D2CD 1V4AA 1DD4A 3Q5PA 2QJYC 2PBEA 3AEGC 4I7ZB 3RK3E 2WPVB 1UIXA 3AEFC 4XFJA 3GM1A 1YQ4C 3GLMA 2YIUC 1RQVA 4PV1D 1GMJA 2QJPC 3D71A 4OGQB 2NZ2A 1K04A 2QIWA 3AE8C 2J5UA 3AEEC 4YTPC 1ZRTE 2HSBA 4H13D 3MFNA 3U0CA 3D6YA 2E75D 2H89C 2JO1A 3GF7A 1JB0J 1OW7A 3Q2YA 5F28E 3JYYA 1KILE 1YQ3C 2H88C 2WQYC 4IL6X 2E76C 2FXPA 2JP3A 3RQEA 1VF5C 2ZT9B 2E74D 4R32A 2V7QJ 3EWKA 3AE5C 4H13C 3GM2A 3C8GA 4Y28J 1WOLA 3GF3A 3O10A 4RKUJ 2ZT9D 1ZZPA 4H44D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L8I A;  1KTM A;  3C8G D;  3SFE C;  1QVX A;  3B71 A;  1O3U A;  3GM3 A;  4XEF A;  3AJM A;  4EBK A;  3C8G B;  1ZOY C;  3K7D A;  2YWA A;  1K05 A;  3SFD C;  3JZ0 A;  1JOG A;  3L8J A;  3AE7 C;  2JX0 A;  1WWP A;  3AEA C;  2L6G A;  3TUL A;  1OW8 A;  3BRJ A;  1ZP0 C;  3AE4 C;  3C18 A;  3AE2 C;  3ABV C;  1KNY A;  2L6H A;  1UFB A;  3AED C;  2JPU A;  4YXD C;  1K40 A;  1WTY A;  4EBJ A;  3AE1 C;  2L6F A;  3AE9 C;  2Q00 A;  4XEV A;  3AEB C;  3RQG A;  3AEC C;  3RQF A;  2G3A A;  3U3F A;  3AE6 C;  2LK4 A;  4XEK A;  3S9O A;  1PV3 A;  2FBW C;  1OW6 A;  3AE3 C;  4NQF A;  2KK1 A;  1V4A A;  2PBE A;  3AEG C;  3AEF C;  3GM1 A;  1YQ4 C;  4YTP C;  3AE8 C;  1K04 A;  3AEE C;  2HSB A;  3MFN A;  3U0C A;  2H89 C;  1OW7 A;  5F28 E;  3JYY A;  1YQ3 C;  2H88 C;  2WQY C;  3RQE A;  4R32 A;  3AE5 C;  3GM2 A;  3C8G A;  1WOL A;  3O10 A;  1ZZP A; 
#chains in the Genus database with same CATH topology
 3H1I J;  4JC7 A;  1Y47 A;  2L91 A;  3SWF A;  3T9O A;  3B71 A;  5AVR B;  4G78 A;  4L74 A;  3L75 E;  1KQS O;  3RK2 C;  1BE3 J;  4MND A;  2OYI A;  1K05 A;  2NSG A;  4PAC A;  3CCL P;  5CCG A;  3V5Z A;  2D2C B;  3NTN A;  1MMA A;  3G9R A;  1PZQ A;  3VMA A;  3ZQV A;  2FYU J;  1LVK A;  2QJK C;  3DM5 A;  1URQ B;  1KNY A;  1FNT c;  4DOJ A;  5EFW B;  1KQG B;  3OAK A;  3TK0 A;  1M8O B;  3U9J A;  5L0F A;  4WY4 A;  3H1J G;  2D5R B;  3GW6 A;  1NTM G;  4M63 A;  1YTZ I;  1H9T A;  1KB9 E;  3V5Y A;  1GDT A;  5A69 A;  2V26 A;  4HFF B;  2YO2 A;  2NPS B;  1JNM A;  3R7C A;  2E75 C;  4IL6 E;  1RKC A;  3FGA D;  1LT9 A;  5F5H A;  2OG2 A;  2PX3 A;  2O01 J;  1E2X A;  3AE6 C;  3A2A A;  1G2C B;  2IZ1 A;  2W4B A;  3JCU H;  3ABM C;  1NWQ A;  1IZN B;  5KYY A;  2EIL C;  4JZA A;  3S27 A;  3L71 E;  3AQC A;  2W4M A;  3SWY A;  4O6N A;  4C7N B;  1AQ5 A;  4U5G A;  4Q4Z F;  3JTL O;  3SSU A;  1T3U A;  1BZ4 A;  2M0B A;  2NPS C;  2E42 A;  2NUP A;  5IY5 C;  1KYO H;  3OWT A;  4Z9J A;  2PFX A;  2R7S A;  3CL3 D;  1N8R Q;  4EYY Q;  1L0L D;  1G4W R;  2PAJ A;  1FZC C;  1L4A A;  3CXH E;  5AC5 A;  3B0P A;  2ZT9 B;  3AG2 C;  2XXA A;  1L0L G;  2I15 A;  2GAQ A;  3O39 A;  4CIP A;  3A0H H;  2LFD A;  2O3J A;  4DBQ A;  1DOW A;  1L0N K;  4W8P A;  5KAI H;  1KC8 Q;  3AOU A;  1KQF B;  3Q1M A;  1MMN A;  2IOQ A;  2A06 E;  2WIT A;  1FDI A;  3V6I A;  5KYY B;  3L34 A;  1OCC C;  4A4A A;  2O1J A;  2HUJ A;  2WVQ A;  1L7C A;  3H1H D;  1M56 D;  1LWU B;  3IF4 A;  1Q0F A;  4JPZ B;  4I1M A;  2Q5U A;  4EBB A;  3HLZ A;  3FWL A;  5APW A;  3TDK A;  3RIP A;  4RJT A;  1BE3 D;  1Z23 A;  1LWU A;  1NU1 G;  2K37 A;  2CPB A;  2OTL P;  3CWB J;  3POV A;  1Q90 D;  1M56 C;  2R25 A;  1N2D C;  2KNC B;  4IOI H;  2VRS A;  1OMI A;  3U3B A;  3W8I A;  1ZXG A;  3AE2 C;  3ABV C;  1K8A Q;  3M9Q A;  1N7S A;  5L0H A;  3FOP A;  1M7L A;  2HV7 A;  3DD7 A;  2HFI A;  3CD6 P;  1NU9 C;  4CS9 A;  1ORY A;  2FYU G;  4EIJ A;  2YZS A;  2XV5 A;  1J1E C;  4YT4 A;  3L1M A;  5DLJ A;  2ZYD A;  4YXW H;  3Q5R A;  3RL0 g;  2XL4 A;  2YL3 A;  2B88 A;  1SQX G;  2Y0E A;  4AL0 A;  1BGY J;  1V54 C;  4H44 B;  2ZXE B;  2C9N Y;  3JC2 2;  4KBL A;  3H25 A;  4PV1 C;  1TFK B;  1AFO A;  2LK4 A;  2OEV A;  3TSI A;  1KIL B;  2DGJ A;  4PJN A;  3AE3 C;  2R7V A;  2L81 A;  1LE4 A;  2OTK E;  1SQQ E;  3HE5 A;  3QMK A;  2P61 A;  4IAO A;  1QGK B;  1FOS E;  1KD1 Q;  5AW9 B;  3ABL C;  2H43 A;  4AUW A;  1HH0 A;  5APT A;  2ZXW C;  5CJ4 A;  2QJP C;  1OVR A;  4U3F J;  4JIO A;  1LGH B;  5COF A;  1MQV A;  1UG7 A;  3U0C A;  2E75 D;  2QUP A;  3BCC G;  5T1D B;  2BCC D;  2NUP B;  2WQY C;  2KC3 A;  2PRR A;  2FXP A;  2JP3 A;  3UNG C;  1J2J B;  1NZE A;  3KZI E;  1R5I D;  4QI2 A;  1HW2 A;  1LJ2 A;  4MVM A;  5KLI C;  5K5G B;  3T6J A;  3M4B A;  2YXR B;  1Y4C A;  4OD4 A;  4MVU A;  2N1T A;  4IL6 H;  2Y9Z A;  3H2V A;  1X9V A;  4PJL A;  2N9Y B;  1Z56 A;  1N7S C;  3PJS K;  2IFN A;  2JKV A;  1ZHZ A;  3FWN A;  2YXQ B;  3WG7 C;  2JEE A;  3B4S A;  2KQ9 A;  4JJG A;  2FFD B;  3L70 E;  4N06 A;  3K1I C;  3MYF A;  4PJM A;  4AE4 A;  1KV4 A;  3JSZ A;  3CQZ A;  3F5H A;  3H1H G;  3HRN A;  1Z7Q c;  1Q82 Q;  3HNJ A;  3CWB D;  3QWO C;  2A06 G;  1HE1 A;  3IN6 A;  2NSF A;  1VF5 D;  1O87 A;  5KYW B;  1YJN P;  2OYH C;  4CBE A;  1YBK A;  3NYL A;  3W2V A;  1S5L H;  2BL2 A;  1LIH A;  3GMA A;  3NDB B;  2FYU K;  1NTZ G;  3GEI A;  5KYW A;  1RF1 C;  3HD7 A;  4NTF A;  2KUB A;  4NPE A;  3AE9 C;  3GHG B;  4JYC A;  1OKK A;  1ST6 A;  5CHX A;  2R44 A;  2HV6 A;  5AVQ B;  1VDF A;  1SQP J;  2MJZ A;  1SQB D;  3P7K A;  1NH4 A;  1GL2 B;  3G50 A;  3Q5S A;  1CSB A;  1X0T A;  1AVO A;  3N2Z B;  2R03 A;  3CX5 H;  2XLO A;  1M57 D;  2PNO A;  4MVQ A;  4QMA A;  3M9H A;  3S1K A;  4PD4 E;  4JQ0 D;  3HD7 C;  3G71 P;  2FYN C;  1Z6A A;  2ZT9 C;  4XA4 A;  2CNW D;  3CCU P;  2Y39 A;  1S7Z A;  4G7Z F;  1C02 A;  2Y3G A;  4GT1 A;  3CPW O;  1NVO A;  4OWF A;  1QPU A;  1SFC C;  3L71 G;  1WRG A;  2KLV A;  2CDQ A;  1QVF O;  1JR8 A;  2Y69 C;  2OCC C;  3EPV A;  2GFH A;  2Z4E A;  1YQ4 C;  1KYO D;  3IPM O;  1MND A;  3CWB E;  1MFT A;  1TWA A;  2I1K A;  4IAQ A;  3HTK C;  4WGY A;  1ZRT E;  5E79 H;  1NU1 D;  1SF8 A;  2K9J B;  1E86 A;  5CCH A;  3GF7 A;  3Q2Y A;  5F28 E;  1OXK A;  3MZW B;  2HMZ A;  1ZW3 A;  1G4U S;  1IC2 A;  3HD7 B;  2LSE A;  1KB9 D;  3H1J E;  1OCR C;  3MLG A;  3CX5 D;  2QJP B;  1WOL A;  3RBX A;  2ZT9 D;  1J1D C;  2XSE A;  3B5N C;  1FMW A;  1K9M Q;  1S3J A;  1XZQ A;  2ZVN B;  2JR8 A;  1JPN A;  4MN4 C;  4YT8 A;  3GEE A;  2XZR A;  5CBN A;  2LKM A;  1X22 A;  2QJY B;  4DXW A;  1FC2 C;  2LP4 A;  1NTK G;  5KKZ C;  3WUT A;  4I6M C;  2IBZ E;  3V2Q A;  4NTA A;  4PK4 A;  3NRH A;  4JYB A;  4QDL A;  2TMV P;  5B5E E;  1KYO E;  1AJY A;  2H7O A;  3HUS C;  4ZNC A;  3PDM P;  2L6H A;  1QQ3 A;  4KJM A;  2WVR A;  1EXI A;  1PPJ E;  2Q9B A;  5DJT B;  2BEZ F;  4GIF A;  2LD6 A;  4U7J A;  1E79 H;  1I4Z A;  1SZI A;  1SFC B;  2R3C A;  5JRA A;  1NU1 K;  1M2O A;  5D92 A;  2P10 A;  3R4Y A;  3T4R A;  2VCA A;  3H65 A;  1VQL P;  1V55 C;  2G3A A;  1SQB J;  2J9B A;  3EQL F;  3U2M A;  1KMI Z;  2Q3I A;  3N0T A;  1SQB E;  2OYI B;  1AV1 A;  3C7J A;  2J46 A;  1R8E A;  4XEK A;  2XLV A;  3OW2 O;  2LQG A;  1VQ9 P;  2M5A B;  2OU6 A;  5AW1 B;  5DQZ A;  4O7G A;  3H1H J;  2KK1 A;  3MUD C;  2Q7C A;  3A0B E;  2QJY C;  2DW3 A;  3FXE A;  4O79 A;  4O9B A;  2J8W A;  2RN0 A;  5DJU B;  2J9U A;  1S72 P;  3AG1 C;  3DE8 A;  3CME P;  2OEX A;  2YIU C;  3TF5 A;  3H2U A;  1M1K Q;  5L0C A;  4JEB A;  3GAN A;  2C9L Y;  2KSF A;  2J9W A;  2K9J A;  3MFN A;  1Q0G A;  5T3T A;  3CCV P;  4WWI A;  1JB0 J;  1YA9 A;  3KYJ A;  3RH3 A;  1LM3 B;  4OIR F;  1EDL A;  2KYH A;  1NU1 J;  3K1H A;  1LE2 A;  3VTP C;  1NU1 E;  2P7V A;  3NMI A;  3ZC4 A;  4BJ5 C;  3L37 A;  2AXC A;  2UWJ E;  1X79 B;  1HMO A;  2ZPA A;  2K1A A;  2A0B A;  2AEF A;  1BGY D;  3CC2 P;  3SXZ A;  4IFD K;  1FZA A;  1LTI C;  4RBN A;  1FZC A;  2Y3B A;  1JEK A;  4H0L D;  3US6 A;  4XPX A;  4G7H F;  2OYH A;  2YL7 A;  3EFO B;  3KXD A;  4K3A A;  3L8J A;  1X8Y A;  4KT0 J;  2ZXR A;  1N73 A;  3BRJ A;  1ZP0 C;  1VTM P;  1W2W A;  3C63 A;  3AE4 C;  4PJ0 E;  3CX5 I;  1ZV8 A;  1IW7 F;  5B66 E;  4E0H A;  3B0U X;  1JY3 P;  4EWC A;  3P8C D;  2ZXX A;  2XM0 A;  3CSK A;  4L75 A;  2A45 H;  2QVA A;  4IGG A;  2R7X A;  3K33 A;  3GWL A;  2V3C C;  3AE1 C;  5BU5 A;  4PJJ A;  1HVV A;  2D4U A;  2YKQ A;  2UUI A;  3BAS A;  5E2Q A;  1KIL C;  1NTM E;  3L74 J;  1BDC A;  5L0G A;  3TGU E;  3HTK B;  3EGX A;  1VQ8 P;  3S90 A;  5AW2 B;  4BEJ A;  1JY2 N;  2D2C C;  1R5L A;  2BCC E;  2N9B A;  5AVX B;  4Z9I A;  1PGJ A;  4H0L B;  4WY4 C;  3CMA P;  4IAR A;  2NPU A;  2P0N A;  2EPM X;  4FX5 A;  4BRY A;  1AEP A;  2I8B A;  1QLE D;  1OW6 A;  3L36 A;  3P32 A;  3M79 A;  2KZI A;  2WMM A;  5CCH D;  3CCQ P;  4J30 B;  2B0J A;  3PRJ A;  4EDF A;  3H1I E;  5KAI E;  4AYC A;  1VB5 A;  5AVZ B;  2IXN A;  2ZJS E;  3LIE A;  5CCG C;  2EIJ C;  1L4A B;  2C0X A;  2BC5 A;  1PP9 E;  3LID A;  3D6Y A;  3UMI A;  4JKV A;  1OW7 A;  1UII A;  3VYI A;  1FDM A;  4CJO A;  1R4T A;  2IX7 C;  1RE3 C;  1PFI A;  1QLE C;  3LEO A;  1NAY A;  3EWK A;  3NYJ A;  4YT5 A;  3IQT A;  4WY4 D;  4DCK A;  4H44 D;  3IFM A;  1FTS A;  2L9J A;  3G6E P;  1KTM A;  2YVK A;  1QVX A;  3EG9 A;  3OEO A;  3RF3 A;  2QJK B;  4MS2 A;  3U8V A;  4G0H A;  4UB8 H;  1AQT A;  1H6G A;  3OA7 A;  1KFN A;  3RGU A;  2MYS A;  4IWB A;  5FZT A;  4XLP F;  2AXT E;  4I2L C;  1FZC B;  2XRH A;  3RK3 D;  1WWP A;  3G4X A;  3AEA C;  3ASO C;  5HV9 A;  1NKN A;  4NTB A;  3Q3D A;  1YVI A;  1BCC E;  4I3M A;  4D6T D;  4F4B A;  2GWW A;  3WUV A;  3D6Z A;  2YL0 A;  2B87 B;  3M4C A;  1N86 A;  4YXD C;  2KS1 A;  1YYX A;  2EPN A;  2XLD A;  3MTU E;  1OVU A;  2YKO A;  1OKK D;  3KYQ A;  5F5F A;  2C03 A;  3LES A;  2R32 A;  3AEB C;  1FDO A;  3T97 B;  4C7R A;  3ITF A;  3RQG A;  2W6B A;  1PPJ G;  2IFM A;  3L74 D;  2IBZ I;  2W45 A;  3A0H E;  3LLK A;  3EJN A;  4U3F G;  1Q0D A;  3HTK A;  1OR3 A;  3CCS P;  2H8A A;  3IQ6 A;  1M57 C;  2Y9Y A;  1LWU C;  3H1K D;  3RK3 E;  4CDY A;  2IYO A;  1UIX A;  4XFJ A;  2YO3 A;  3NG1 A;  1USE A;  4RDA A;  4ZLD A;  2XXA B;  2R7Q A;  3G3Z A;  2N1T D;  1EC5 A;  1JY3 O;  2J5U A;  1T8Z A;  3N24 A;  4H13 D;  1FJP A;  4HKZ H;  4BXL A;  1PCX A;  3JRM O;  4C3E A;  2H89 C;  1PPJ D;  3QZC A;  5KYN A;  1PP9 G;  2YMY A;  2JJL A;  3BRT B;  3L0I A;  2W8Z A;  3CAX A;  3X2Q C;  5EGY A;  4B86 A;  2QEX P;  4O6M A;  4JTC B;  4L6R A;  4R32 A;  1PP9 D;  2V7Q J;  1USD A;  1VQ6 P;  5AVU B;  4EIY A;  1ZHT A;  4H13 C;  3U9M A;  2WSS H;  2RMZ A;  4BPM A;  4KI2 A;  1V74 B;  2Q1K A;  1YA7 O;  1M2V B;  2G3V A;  3CCR P;  1CGO A;  1W2B O;  1LS1 A;  5GPG B;  4N78 D;  2QA4 P;  3FXH A;  5DQT A;  2ZVO B;  1SQV D;  1VQ7 P;  2NUT A;  3MBG A;  5AC4 A;  1ZOY C;  2P58 A;  2OJQ A;  2EPK X;  1E83 A;  4XTK A;  1BE3 G;  1NFN A;  5A6A A;  3M9B A;  2YQY A;  1RY3 A;  4Q7C A;  1JOG A;  4NC3 A;  2VH3 A;  1H9G A;  2VC9 A;  3N7N A;  2Y0C A;  1OCO C;  3VM6 A;  1VLT A;  1OW8 A;  1Y9B A;  3WAQ A;  5H2F H;  3VMY A;  3R2P A;  3JYH A;  5KLV E;  2V4H A;  1ORS C;  2A68 F;  5M1B A;  4CS8 C;  4E7S A;  1JCC A;  4NPF X;  3DI5 A;  2PGD A;  2GM4 A;  4WAB A;  1S1C X;  2B9B A;  1DEE G;  3IAO A;  2N1T C;  1GW3 A;  3MD0 A;  2H7B A;  1JTH A;  5B5E H;  5KLV J;  2Q3T A;  5AVW B;  2KB7 P;  2H7H A;  2LFF A;  1N7L A;  2W6J H;  1SQV E;  2HFE D;  1MKM A;  2XU6 A;  2K9Y A;  2ZYA A;  1OIP A;  3AEC C;  3A7O A;  3I56 P;  1BGY E;  3DJN B;  5COG A;  3RYL A;  3U3F A;  1SR2 A;  1RE3 A;  1AUE A;  1EDI A;  4EKW A;  2GDC A;  4IB4 A;  256B A;  3Q7L A;  5DS5 A;  3BRV B;  1WN0 A;  3S9O A;  2KGO A;  3V4Q A;  3B8E B;  3OA1 A;  1ZU5 A;  1BR1 A;  4CS8 A;  1ZW0 A;  3T6B A;  1D7M A;  2WPV B;  2ZYG A;  3L35 A;  3UIA A;  1SQQ K;  1ZR4 A;  3H1K E;  1E85 A;  4HE8 D;  1A7D A;  3DMD A;  3ECS A;  3ASN C;  2AVK A;  3TGU G;  1RJ9 A;  1FE6 A;  3JYY A;  2KW3 C;  3I5C A;  2NG1 A;  1VF5 C;  1HW1 A;  1FR0 A;  1GS9 A;  4Y28 J;  3UR3 C;  4E17 A;  2WT7 A;  3PHF 2;  1YTZ T;  1PP9 J;  1ZZP A;  3KKB A;  4I44 A;  3P8C E;  1LTB C;  3VYW A;  1TWH A;  1D1C A;  1KZU B;  3CCE P;  3CC7 P;  2ZXO A;  1VL2 A;  3K5B A;  4J7T A;  1VK5 A;  5CIV A;  5GTI H;  3GEH A;  1DIP A;  2HR3 A;  2R5B A;  2R7R A;  3Q6N A;  3EFF K;  1XWJ A;  5T3W A;  1H0T A;  2HZ8 A;  4EUK B;  1IFP A;  1U7J A;  4H44 C;  3SFD C;  2WPQ A;  4D4N A;  1BBH A;  1RKE A;  2JX0 A;  4EHP A;  1WMK A;  2G3K A;  1NLX A;  1SFC A;  3TNU A;  4U5H A;  3JCU Q;  4OGQ D;  2YMK A;  2C0W A;  1ORJ A;  3BEH A;  2FY8 A;  5C39 A;  5TJH A;  3K66 A;  4XWJ A;  4K1O A;  3L72 J;  4Q5S F;  1MMG A;  3LEV A;  1ZME C;  4NCQ A;  5CCG D;  1T5O A;  3NXS A;  1HE9 A;  3HE5 B;  1HJ0 A;  5BU8 B;  4YN0 B;  5AVY B;  5KYX B;  2OAR A;  5AW4 B;  5JSL A;  5B3S C;  3SP1 A;  4R4L A;  5APU A;  4BJT A;  3DWW A;  2WTY A;  2OOC A;  2R7U A;  2E74 C;  3ZTM A;  3GOR A;  2SPZ A;  3NMJ A;  1KQL A;  3WMM 0;  3ITK A;  1JAF A;  2YKZ A;  1GU4 A;  1HMD A;  3IQC A;  3PH0 A;  4JE9 A;  3A5T A;  3KDP B;  3IEE A;  1LKX A;  1RF1 A;  3IHU A;  4KNW A;  5A6J A;  4IRU A;  3KQG A;  2AU5 A;  1J8Y F;  4OIP F;  2FBW C;  2HSQ A;  3UGP A;  2JWD A;  1LP1 B;  2JDI H;  1YJG A;  1SQX E;  2AP3 A;  3TK1 A;  1IFD A;  1HY5 A;  1RCP A;  1JRA A;  5E3A A;  3L75 J;  1U89 A;  1OCZ C;  1URQ D;  2DB4 A;  4YL1 A;  5APV A;  3CCM P;  1OXB A;  2NZ2 A;  4CDA A;  1A41 A;  2EPL X;  3LS1 A;  2I1J A;  5TIS H;  4JEA A;  1SQQ J;  3L70 D;  4U5B E;  4DVZ A;  5EK0 A;  4H4K C;  1LT9 C;  4MVS A;  4D6T J;  2E76 C;  2OTJ P;  2IXM A;  3VOP A;  5KKZ B;  1MUU A;  4N78 E;  3RL0 B;  4CSA A;  4YK5 A;  1JMB A;  4LLE A;  3L73 G;  4RKU J;  4DOZ A;  1G5Z A;  3LW5 J;  1VYK A;  5KJ7 A;  3E7K A;  5AW8 B;  2WVN A;  4K0D A;  4EBK A;  3WHN A;  1RF1 B;  3C8G B;  4OVN F;  3M1C B;  3EHN A;  3F47 A;  1WT6 A;  3TOM A;  1YJ9 P;  1NBB A;  3CCJ P;  1LT9 B;  3AGT A;  4H54 A;  3KL4 A;  1U7M A;  4PFP A;  4B6I A;  3L74 E;  1NU7 D;  2WWW A;  1L0L E;  3VMX A;  2DYR C;  3HNL A;  5A6B A;  1DEB A;  2BEQ D;  1PGQ A;  3H1K J;  5AGF A;  1B68 A;  1NTK K;  5H2F E;  3ZSU A;  1JTH B;  1T3J A;  2G8Y A;  2Q3E A;  3L73 D;  5KJ7 C;  3AED C;  5L0I A;  3JCU E;  3V7O A;  1QKR A;  3L72 D;  4G7O F;  2K3R A;  3PMR A;  1NTZ J;  5CI9 A;  2FFH A;  2DI3 A;  2YL1 A;  4MVO A;  2MWQ A;  1S5L E;  4OGQ C;  1BE3 E;  3CWB G;  1ZRT D;  5CCH C;  3QVY A;  2OQM A;  1NYH A;  3H1L G;  5GTI E;  3S4R A;  1GL2 C;  2PP6 A;  3U59 A;  1KFM A;  3II6 A;  2KZJ A;  2WZF A;  3VAY A;  4IFF A;  4CS9 C;  4BEM J;  4XE5 B;  4BWN A;  2CK3 H;  3SXY A;  2BAS A;  3S28 A;  1SQV J;  1IFN A;  1CGM E;  1RF0 C;  2IPP A;  2D2C D;  1YI2 P;  2PBE A;  2XL6 A;  2B87 A;  2CCY A;  2XDJ A;  4I7Z B;  2XKM A;  2XM4 A;  3UGO A;  1TR2 A;  4O6Y A;  1S4X A;  2R5D A;  1L3P A;  1KIL D;  2CNW A;  3V5B A;  2QNL A;  1BCC D;  4YTP C;  2HPC B;  3L75 D;  3I55 P;  1ZW2 A;  2W83 C;  3B0V C;  1LT1 A;  2M64 A;  3BCC E;  1OXZ A;  1SP4 A;  3L73 E;  2R9R B;  2HPC A;  2KLU A;  1CW5 A;  3L70 J;  3M0A A;  2IM8 A;  4I1L A;  5KLV D;  2V7Q H;  3AE5 C;  1ZN5 A;  4GYT A;  1FS0 E;  2FXO A;  5L3Q A;  2NUT B;  2M3B A;  3NKD A;  4PR9 A;  3G4S P;  4PJ0 H;  4HJG H;  3L8I A;  2O1K A;  4GDO A;  4I7Z C;  3FAJ A;  2M8R A;  2QG4 A;  4ONS A;  3W4Y A;  2M5A A;  3H1J J;  1D0Y A;  3SNH A;  1L2P A;  1NTM J;  3GHG C;  4HFK B;  2J45 A;  1NGM B;  1D1A A;  3RL0 C;  4LGD E;  4N6J A;  2K88 A;  3BCC D;  3AG3 C;  2NPS A;  5TJ5 E;  3RVZ A;  1MFZ A;  4Z9H A;  2L6G A;  2AEJ A;  1KB9 I;  1LNQ A;  5BVZ A;  2KJG A;  1E84 A;  4ZKP A;  3MUD A;  4DJG A;  1OWA A;  2KK7 A;  2KS1 B;  2HS5 A;  2E75 B;  3BVH A;  2IBZ G;  5JP7 A;  4DT0 A;  1JY2 P;  1SQP E;  2YLG A;  1GK6 A;  1HGV A;  4BJ6 A;  3V5X A;  3FVY A;  3L73 J;  1J8M F;  3I5P A;  3RVY A;  1SYQ A;  2A0U A;  4PV1 B;  4AE4 B;  3MX3 A;  2CYD A;  1S9K E;  2L5G B;  2GUV A;  1SFC D;  2R02 A;  4U9E A;  1NTM K;  5AW6 B;  5DS6 A;  5E79 E;  2YIU B;  1SQB G;  3U1A A;  1L0L K;  4CS7 A;  2X0C A;  1KOR A;  3C8V A;  1EQ1 A;  2ZD9 A;  1DD3 A;  4D6T E;  3HNK A;  3EQ2 A;  1APC A;  1RQU A;  3TYY A;  3D70 A;  2YLD A;  1XTG B;  1VOM A;  3HUS A;  5APX A;  1HBW A;  1T6Q A;  2ZFC A;  1JCD A;  3AEF C;  1YAR O;  3GM1 A;  2A45 I;  3SZR A;  1YAU O;  3H32 B;  1K73 Q;  2VCB A;  1EZV G;  1C17 M;  4UDV A;  3I4U A;  1RQV A;  1GL2 D;  1QEX A;  1HGZ A;  5AW7 B;  2LCH A;  2E43 A;  3AE8 C;  3AEE C;  3FOO A;  1VLS A;  1RJ9 B;  1YZA A;  5BUO A;  1NTZ E;  1YQ3 C;  1LI5 A;  3NFQ A;  3RK3 B;  4AQR D;  3U1C A;  1VQ5 P;  2XLH A;  4MVR A;  1NTK E;  3GF3 A;  3DAF A;  4JW1 A;  1N7S B;  2JD3 A;  4CSA C;  1PD0 A;  3U8P A;  1FMV A;  1SMY F;  2E76 D;  4JBZ A;  2RSE B;  1GU5 A;  5E3C A;  3FAP B;  4JTD B;  2IYL D;  1NTM D;  3PTZ A;  1Q0M A;  3RFY A;  3V2R A;  4LAC B;  5BQG A;  2I8D A;  3DAG A;  4CJG A;  3RK3 C;  2Q7R A;  1URQ C;  1ZHW A;  1MV8 A;  1J1E B;  3C8Z A;  3DM9 B;  1VQK P;  3BCC J;  2Q4F A;  3AG4 C;  3WUU A;  1FJK A;  3RL0 D;  2N1T B;  1FZB A;  3GHG A;  3C18 A;  1IK9 A;  3EZI A;  1OZH A;  4CDV A;  2WSC J;  1UFB A;  1NTZ K;  1SQX D;  1ZLL A;  1FFT C;  4DBR A;  1WTY A;  2Y0D A;  3RW0 A;  1SQQ D;  2ITA A;  1T01 A;  3LNM B;  3GOD A;  2VB6 A;  2YKP A;  4E0I A;  1PIX A;  1NG1 A;  1KIL A;  1H89 A;  1CI6 B;  3SXM A;  1LTG C;  2IBZ D;  4J32 B;  4OIN F;  3CEX A;  2OQQ A;  2DYS C;  1TWC A;  1EDK A;  2FFD A;  4N4W A;  5JVE A;  2OYH B;  3IR9 A;  2E5Y A;  1H0T B;  2R3S A;  4PFO A;  1BDD A;  2XNX A;  4ASW A;  3L4F A;  3TGU J;  1BR2 A;  4A7P A;  5AW0 B;  3W2W A;  1M6T A;  3JT1 A;  2J58 A;  1I5N A;  3EHM A;  2EIK C;  2IXO A;  4LDQ A;  1SS1 A;  3C9I A;  5APY A;  1V4A A;  5JT4 A;  2OJE D;  3DKA A;  4Y99 B;  1PGP A;  1RF0 A;  1RE4 C;  3S0X A;  1RXQ A;  1JOC A;  2HOD B;  1OR2 A;  4TLF A;  2AWY A;  1K04 A;  4YPC A;  1GL2 A;  2HSB A;  3NMK A;  1FOS F;  3SYN A;  4HB1 A;  2KP8 A;  3UMK A;  4CX9 A;  4DRH B;  2XLW A;  3O8Z A;  4YL3 A;  4E18 A;  3KMI A;  1TQG A;  5CMZ A;  5AVV B;  3RK2 B;  3CXH I;  4IFM A;  4BJ5 A;  1M90 Q;  3JSE O;  4U3F E;  3J06 A;  2KYV A;  4ULV A;  3USS A;  3O55 A;  1NTZ D;  1Z5Z A;  1VYI A;  5A6B D;  2J0W A;  3O10 A;  3HKK A;  4JTA B;  1LI7 A;  4LC1 A;  1BR4 A;  3LW5 H;  1ZR2 A;  3C8G D;  3LS0 A;  2CGE A;  3PLN A;  2W90 A;  1BSN A;  2Q6Q A;  1NFO A;  2AWC A;  2C04 A;  5JS5 A;  4XLN F;  3GM3 A;  1P84 I;  1NO4 A;  3O6Q B;  1S5L X;  1SQB K;  4KNV A;  1WAT A;  1SQP G;  2E5T A;  1TFO B;  1JY3 N;  4U5F E;  3DZA A;  5L8R J;  3JZ0 A;  3MIW A;  4FES A;  3L75 G;  3QW1 A;  2G62 A;  1EDJ A;  1YYJ A;  4H0L C;  2HOD A;  1M2V A;  2KNH A;  2FAP B;  3H32 A;  3L71 J;  2QM8 A;  2EIN C;  1QL2 A;  1BCC J;  4GOE A;  3EGD A;  3M15 A;  3NMD A;  2IDB A;  3Q7G A;  4N6C A;  2XS1 A;  2E74 B;  1SQX J;  2GA0 A;  4GQH A;  4WJ0 A;  5APS A;  4P9F A;  4XEV A;  3DE9 A;  3SXK A;  4PD4 D;  3WU2 E;  2XND H;  5KAF H;  2B0H A;  3RQF A;  3KH2 A;  1HUC A;  2J59 M;  4HEA J;  1M1J C;  4C7O A;  3EH2 A;  4D4X A;  1VQ4 P;  4P9T A;  4BJ6 C;  3M06 A;  2X51 A;  3O6Q A;  2J9V A;  1BDJ B;  1U57 A;  1DH3 A;  3H1J D;  3LNR A;  4Z1M H;  4AL1 A;  2XLE A;  3TQO A;  3E1I A;  3KPH A;  3H1L E;  1VQP P;  3AEG C;  3LJB A;  4ULW A;  1L0N G;  2PP4 A;  4ASV A;  4YJW A;  4N3Y B;  1SLQ A;  1FZE A;  1JUN A;  1JPJ A;  2ICW G;  1P84 D;  1QZX A;  1RHZ B;  1J1D B;  1AVY A;  4KC9 A;  3BAT A;  4JCH A;  4M3L A;  2JO1 A;  3CX5 E;  1Q81 Q;  3EZH A;  1HTL C;  5AVT B;  1C03 A;  4C3B A;  5COM A;  4U5D E;  5DS4 A;  1WAS A;  4GKG A;  1W5C E;  2E74 D;  2ASR A;  5L0J A;  3JSV C;  2OYO A;  2O01 N;  4JVS A;  3VP8 A;  1O5H A;  3DXJ F;  3ZVR A;  3QVZ A;  2R7W A;  4YWQ A;  2HG5 D;  3IQ5 A;  2ETS A;  4LER A;  1IO4 A;  3A3Y B;  3H1L D;  3SFE C;  3A0B H;  4ZMD A;  3HNI A;  3L74 G;  1I4Y A;  1U0B B;  1L0N D;  3P8M C;  2YLI A;  1PL5 A;  2O9X A;  3ZWI A;  1W2E A;  2GUS A;  1T2K D;  2A6H F;  3U2L A;  3X1O A;  2YWA A;  4OH8 B;  1N73 C;  1ZHY A;  5FCL A;  1Z63 A;  4OD5 A;  3PHL A;  1S9K D;  2Z5I A;  2CW0 F;  4AX2 A;  2WSF J;  1T6A A;  2QSI A;  2WPR A;  2UUH A;  5JLI A;  2KOG A;  4FWV A;  3A9C A;  1HF9 A;  1A02 F;  3ZTZ A;  2B89 A;  3KHU A;  2LXC B;  1LTJ C;  4MTO A;  1K40 A;  3L71 D;  1G1I A;  4HH2 A;  3DJU B;  4MVZ A;  3ZDL A;  2L6F A;  5KLV G;  4BRY B;  1D0Z A;  4JCZ A;  3ABK C;  2KSE A;  4TT3 H;  1GM5 A;  3MP7 B;  2WSE H;  1N73 B;  1VQM P;  1Q7Y Q;  2WVO A;  1MNE A;  3LAY A;  4U9D A;  1NAF A;  1YJW P;  2YHS A;  1CPQ A;  2KI7 B;  5CJ0 A;  1A7V A;  2LR2 A;  4JJF A;  4GEH A;  1VF5 B;  1S2E A;  2RH0 A;  2MKV A;  1G1J A;  2RD9 A;  1PV3 A;  4WBA A;  3FHD A;  2HJ3 A;  1L4A D;  2HYN A;  5AW3 B;  3L72 E;  1IZM A;  1QL1 A;  4ZLC A;  4DRJ B;  3Q5P A;  3K1I A;  2VCC A;  5AW5 B;  2IXP A;  1SQV K;  4NPD A;  4U5E E;  2J0X A;  4PV1 D;  1BCC G;  3F89 A;  2PF4 E;  3CXH D;  2QIW A;  5KLI B;  3VRC A;  3FMS A;  1CI6 A;  1Y6D A;  2Y3H A;  4CPG A;  2KXP B;  1KIL E;  5KYU B;  3B29 A;  3W8H A;  1D1B A;  3EFO A;  2AXT H;  5E33 A;  1QSP A;  1HWT C;  1JO5 A;  4LDR A;  3V2N A;  1KN7 A;  1GQA A;  3T6G B;  1F1M A;  2M4E A;  5B1B C;  1T6U A;  2P2U A;  4ZKU A;  4AK9 A;  5KAF E;  2ZXP A;  2QM7 A;  5D91 A;  3WU2 H;  1O3U A;  2QTV A;  4LLC A;  1QX8 A;  1NTK J;  1VMA A;  4A2N B;  1FZF A;  3V2P A;  4H13 B;  3F46 A;  4C7O B;  1JMW A;  1ZYR F;  1L0N J;  3MYI A;  4GOF A;  3NYM A;  4RES B;  2IYP A;  3TGU D;  1RMV A;  1LPE A;  1ZHX A;  3EGX B;  4JRZ A;  4WVZ A;  2FGY A;  3T97 A;  3SWK A;  3N4X A;  1KYO I;  2A1D D;  1A0B A;  1TWG A;  2WZG A;  3TD7 A;  5HSW A;  3AQB A;  3VMZ A;  2FYU E;  2PX0 A;  1A7E A;  1YYC A;  4X0R A;  1N7S D;  3LUT B;  4GOD A;  4DRI B;  2FXM A;  2WSC H;  2Q9C A;  3JRT A;  5B3I A;  1E5W A;  3CC4 P;  2JPU A;  1GTW A;  4L73 A;  1OFC X;  2W6A A;  2FKW B;  1S05 A;  2XL8 A;  2POH A;  3O6X A;  3H1I D;  1N1C A;  1T2K C;  3RBZ A;  4LDK A;  2P1A A;  1H88 A;  3M0D A;  4XPW A;  1MZ9 A;  4E7Z A;  2A06 D;  1SQP K;  3KYI A;  2O01 H;  1LTT C;  2ZAE B;  2NPS D;  3QW0 A;  2P1J A;  2LIG A;  2E76 B;  4EOT A;  4U5C E;  4LLH A;  1HJB A;  1GK4 A;  1RE4 A;  4RD9 A;  4NQF A;  3QH9 A;  3SEO A;  1DD4 A;  1FFH A;  1R5S A;  1Y8A A;  3ZDM A;  1LS4 A;  1IFM A;  3FXD A;  3GG2 A;  4FAP B;  1FU1 A;  4BJ1 A;  4PD4 I;  4K7B A;  3KPE A;  1NKZ B;  3EH1 A;  4C46 A;  3D71 A;  1T9K A;  5GTH H;  2PFD A;  2KNC A;  1U6H A;  4ANJ A;  2FFD C;  1JY2 O;  3TOL A;  1AA0 A;  3M0D C;  2FYZ A;  4IL6 X;  3TJ5 A;  3VF0 A;  3QTH A;  2L7A A;  1Z3I X;  3MHV A;  3S84 A;  1SQX K;  1IJD B;  1BGY G;  3H6P A;  5CI8 A;  1LP1 A;  4XPY A;  5CBO A;  2HKV A;  3EFG A;  1T6I A;  2E87 A;  1GGQ A;  5EHH A;  1Q86 Q;  1JMM A;  3M91 A;  3C62 A;  5AVS B;  1TU3 F;  2BCC G;  4UB6 H;  3CI9 A;  3AE7 C;  4IJJ A;  2QRX A;  3RK2 D;  3E1R A;  5B66 H;  3PCV A;  3B9Q A;  2CPS A;  2WL8 A;  1H7I A;  3ZIB A;  1NOH A;  1CZQ A;  3H1K G;  3EGD B;  1M1J A;  1DOV A;  1GD2 E;  3FDQ A;  4ER9 A;  2H8P D;  1FAP B;  2W9Y A;  4EBJ A;  1NHL A;  2XS8 A;  1IK7 A;  3TNU B;  2KIK A;  4HYT B;  2HLO A;  4MTF A;  5DVW A;  1RKE B;  5K0I A;  4W7Y A;  1WGW A;  3E9V A;  1NJI Q;  1LTS C;  5TIS E;  1BSH A;  2QE7 H;  2H7V C;  1VPC A;  3H1I G;  3CZ6 A;  3UMH A;  3H1L J;  1EZV D;  3PP5 A;  3H1H E;  1NSG B;  2R7T A;  1EI7 A;  3FX0 A;  2EIM C;  3L72 G;  2RKL A;  2J7P D;  2Q9A A;  3I5Q A;  2FYN B;  1H8A A;  1D0X A;  1FZG A;  1SQV G;  4YL0 A;  4K35 A;  1M1J B;  3CXH H;  3GWN A;  1CGN A;  5GTH E;  1CPR A;  4MW3 A;  2OYI C;  5L3V A;  2OKU A;  1XZP A;  2VAS A;  3ZG1 A;  1DX7 A;  4OGQ B;  3B5N B;  1OX3 A;  5APQ A;  2A6E F;  5KYU A;  4I1O B;  1KB9 H;  4XQ1 A;  3KZI H;  4OIQ F;  4WB4 A;  3B5N A;  2M3E A;  2W27 A;  2H88 C;  2J7P A;  3HE4 B;  2WZ7 A;  1SVF A;  1YZC A;  3MGN A;  4WY4 B;  2EPO A;  3RQE A;  5L0D A;  2WB7 A;  1VQO P;  3L70 G;  3B5N D;  3C8G A;  3GM2 A;  5JUA A;  2Z5H A;  2P67 A;  3ATP A;  4BG0 A;  3ZQY A;  3HUS B;  1KU2 A;  2P6V A;  1G8X A;  3RKO F;  5KLV K;  2WZL A;  3AGU A;  4MTG A;  4Y99 C;  1JM0 A;  2NRG A;  4W7Z A;  4L76 A;  1YLM A;  3VN0 A;  1TKN A;  4XEF A;  3AJM A;  1GZL A;  1EZV E;  2HMQ A;  2MHR A;  4J7Y A;  1LTJ A;  4UB6 E;  1IFI A;  3K7D A;  3S29 A;  4W8K A;  1YIT P;  4C3D A;  1SQQ G;  4RO0 A;  1PGO A;  3HJC A;  2FYU D;  1LTJ B;  2YNY A;  1XTC C;  3CLQ A;  1ZVZ A;  1A02 J;  2P7J A;  3TUL A;  4D6T G;  2WSF H;  4U3F D;  4P6I C;  3U5S A;  5BQH A;  4DVY P;  1YIJ P;  1PD1 A;  1EQ7 A;  1MMD A;  5KYX A;  4YT2 A;  2BCC J;  2Y3D A;  3NKE A;  2WT7 B;  4R4M A;  1Q2N A;  1YDI A;  4MQ9 F;  4C7N A;  4OIO F;  2IBF A;  1EXJ A;  3K6B A;  2Q9I A;  1EA8 A;  2Q00 A;  2KSJ A;  2XLM A;  1LTA C;  2AEM A;  2GA1 A;  2WSE J;  2YRF A;  1FBM A;  3A11 A;  3G4Z A;  3W67 A;  5BQI A;  2QE9 A;  3V4W A;  1L4A C;  2R7O A;  1Q0K A;  4JF7 A;  4PD4 H;  1IFJ A;  2A69 F;  1AVO B;  1OVV A;  3TJ6 A;  4MW8 A;  1RH5 B;  2F22 A;  1L0N E;  2QLA A;  3WOD F;  1GW4 A;  3EG9 B;  3W68 A;  4EI2 A;  2HJM A;  2YEV A;  1NTK D;  4NY3 A;  1G2C A;  1OQC A;  2LXB A;  3VP9 A;  1YHQ P;  4JUR I;  4N6H A;  2BE5 F;  3GLM A;  2WPS A;  3HD7 D;  3OJA B;  3C1L A;  5B1A C;  1URQ A;  3HE4 A;  1GMJ A;  4W80 A;  1ZU4 A;  5KJ7 D;  1L0L J;  1QVG O;  2QY9 A;  4QI0 A;  1EKY A;  1P84 H;  2IZ0 A;  3Q6M A;  4UB8 E;  3LLI A;  1VQN P;  4CIH A;  1P84 E;  1SQP D;  2OGU A;  3E70 C;  5KTB A;  4DJ9 A;  1EZV I;  4DZO A;  2A45 G;  4KHX A;  2JWA A;  5A6K A;  4WGZ A;  2Z15 A;  2R05 A;  1FAV A; 
#chains in the Genus database with same CATH homology
 5KLI C;  3L8I A;  1KQF B;  3Q1M A;  3LW5 J;  1KTM A;  4GDO A;  4I7Z C;  3C8G D;  3SFE C;  1FDI A;  1QVX A;  3B71 A;  2E76 D;  1VL2 A;  1O3U A;  3GM3 A;  1PL5 A;  1DIP A;  1S5L X;  3AJM A;  4XEF A;  4EBK A;  3C8G B;  4H0L D;  1NGM B;  4H13 B;  1ZOY C;  3K7D A;  5KKZ C;  2YWA A;  1K05 A;  4H44 C;  1TU3 F;  3SFD C;  5L8R J;  3JZ0 A;  1JOG A;  3L8J A;  3AE7 C;  4KT0 J;  2JX0 A;  1WMK A;  1WWP A;  2D2C B;  3AEA C;  1Q90 D;  2L6G A;  3TUL A;  2WSF J;  2QSI A;  1OW8 A;  1Y9B A;  3G9R A;  1ZP0 C;  3BRJ A;  3Q3D A;  2BEQ D;  2QJK C;  4OGQ D;  1OMI A;  3AE4 C;  2YMK A;  5M1B A;  1AJY A;  3AE2 C;  3ABV C;  4H0L C;  3IN6 A;  3C18 A;  1KNY A;  1VF5 D;  1HF9 A;  2L6H A;  2E75 B;  2G8Y A;  1KQG B;  4R4M A;  2WSC J;  1UFB A;  1S1C X;  1ZME C;  3IAO A;  3D6Z A;  3AED C;  3GMA A;  1EXI A;  1EXJ A;  1HJ0 A;  2JPU A;  4YXD C;  1K40 A;  2IDB A;  1WTY A;  4EBJ A;  2E74 B;  3AE1 C;  2BEZ F;  2L6F A;  3AE9 C;  1IK7 A;  4U7J A;  3Q5R A;  2Q00 A;  1PIX A;  1MKM A;  3RL0 g;  4R4L A;  4TT3 H;  4XEV A;  2K9Y A;  2WSE J;  3AEB C;  1FDO A;  3T97 B;  3RQG A;  4H44 B;  4PV1 B;  2E74 C;  2P10 A;  3R4Y A;  2OQQ A;  3Q5S A;  2E75 C;  3AEC C;  4OGQ C;  3FGA D;  3RQF A;  2G3A A;  3U3F A;  2D2C C;  1NYH A;  2O01 J;  1KMI Z;  3H25 A;  4PV1 C;  3AE6 C;  2LK4 A;  2E76 B;  4H0L B;  2FYN C;  1R8E A;  1KOR A;  1VF5 B;  2ZT9 C;  3C8V A;  2MKV A;  3O6Q A;  4XEK A;  3S9O A;  1DD3 A;  1U57 A;  1PV3 A;  2FBW C;  4Z1M H;  1RQU A;  3D70 A;  1OW6 A;  3AE3 C;  4NQF A;  2KK1 A;  2D2C D;  1V4A A;  1DD4 A;  3Q5P A;  2QJY C;  2PBE A;  3AEG C;  4I7Z B;  3RK3 E;  2WPV B;  1UIX A;  3AEF C;  4XFJ A;  3GM1 A;  1YQ4 C;  3GLM A;  2YIU C;  1RQV A;  4PV1 D;  1GMJ A;  2QJP C;  3D71 A;  4OGQ B;  2NZ2 A;  1K04 A;  2QIW A;  3AE8 C;  2J5U A;  3AEE C;  4YTP C;  1ZRT E;  2HSB A;  4H13 D;  3MFN A;  3U0C A;  3D6Y A;  2E75 D;  2H89 C;  2JO1 A;  3GF7 A;  1JB0 J;  1OW7 A;  3Q2Y A;  5F28 E;  3JYY A;  1KIL E;  1YQ3 C;  2H88 C;  2WQY C;  4IL6 X;  2E76 C;  2FXP A;  2JP3 A;  3RQE A;  1VF5 C;  2ZT9 B;  2E74 D;  4R32 A;  2V7Q J;  3EWK A;  3AE5 C;  4H13 C;  3GM2 A;  3C8G A;  4Y28 J;  1WOL A;  3GF3 A;  3O10 A;  4RKU J;  2ZT9 D;  1ZZP A;  4H44 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...