1K04A

Crystal structure of the focal adhesion targeting domain of focal adhesion kinase
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
142
structure length
142
Chain Sequence
b'EISPPPTANLDRSNDKVYENVTGLVKAVIEMSSKIQPAPPEEYVPMVKEVGLALRTLLATVDETIPLLPASTHREIEMAQKLLNSDLGELINKMKLAQQYVMTSLQQEYKKQMLTAAHALAVDAKNLLDVIDQARLKMLGQT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords FOCAL ADHESION KINASE 1
publication title The structural basis of localization and signaling by the focal adhesion targeting domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 56
structure length 142
sequence length 142
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2001-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03623 Focal_AT Focal adhesion targeting region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.540 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 1k04A01
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 1k04A02
3L8IA 3L8JA 1K05A 3SFDC 3AE2C 1ZZPA 4YXDC 1K40A 3AEDC 3AECC 2G3AA 1JOGA 3C8GB 1OW8A 4XEFA 1ZOYC 2LK4A 1YQ3C 4XEKA 3AEFC 4EBKA 3RQGA 3JYYA 4YTPC 3U0CA 3AE5C 3AEEC 2L6GA 1UFBA 4XEVA 3C18A 3BRJA 2JX0A 3AEBC 1V4AA 3AE8C 2YWAA 4EBJA 1WOLA 3RQEA 1O3UA 3S9OA 2H88C 2PBEA 2WQYC 3AEAC 3AEGC 3RQFA 3AE7C 3MFNA 2FBWC 3JZ0A 1OW6A 3C8GD 2L6FA 5F28E 1ZP0C 2KK1A 3AE4C 2L6HA 3U3FA 4NQFA 3O10A 3GM2A 1K04A 3AE9C 1YQ4C 1QVXA 1WTYA 3GM3A 3AE3C 2Q00A 3AJMA 1PV3A 3AE1C 2JPUA 2H89C 1WWPA 3K7DA 3AE6C 2HSBA 3TULA 3C8GA 4R32A 1OW7A 3GM1A 1KTMA 3ABVC 3B71A 3SFEC 1KNYA
chains in the Genus database with same CATH superfamily
3S4RA 1S5LX 5CHXA 3DM5A 3KYJA 5E33A 2O9XA 3Q6MA 4TT3H 3S29A 3L1MA 2OJED 2W4BA 1P84D 1NVOA 2BL2A 1SQVE 2WSFH 1VQOP 1YA9A 4GIFA 4OGQD 4YXDC 5KLVJ 3MYIA 2H7BA 5COFA 1ZR2A 4CS9C 3VYWA 2XM0A 3AEFC 3H32A 3RQGA 3U2MA 3F47A 1I4YA 3M1CB 2AEFA 3IF4A 2WT7B 3H1KJ 1GL2D 2D2CC 2L6GA 2Z15A 1L0NJ 2POHA 4PACA 1VF5C 2QSIA 5B66E 4AK9A 3TSIA 1CW5A 3B0VC 2W6AA 4GYTA 1YBKA 1RKEB 2HMQA 2J0WA 3O6XA 1HE1A 1DOVA 1IFMA 1L0NG 3BCCJ 4KNVA 3P8CD 1QZXA 3R4YA 4YJWA 1VOMA 5E2QA 4KI2A 1GU5A 2FYZA 2OGUA 5KTBA 3RQFA 1JO5A 1NTKJ 4GT1A 4GOEA 1N8RQ 2GWWA 3CMEP 4O6MA 2E5TA 4L73A 1VQ9P 1VQ5P 4N4WA 1BSNA 1VQ6P 1SQXJ 2ZXOA 4KHXA 3JRTA 1SQPE 3GANA 1VQ8P 2ZXPA 3HD7D 4L76A 1JB0J 3OJAB 1JY2O 2KW3C 5DLJA 3WUVA 3AJMA 4O6NA 2W83C 5KYUA 1SQXG 1FTSA 2H7OA 2NZ2A 3R2PA 1HH0A 2OTJP 4GQHA 1EDJA 3RH3A 5KLVE 3KYQA 4PV1D 3FWLA 4EWCA 1PPJG 1X8YA 5CCGC 2PP4A 1NFNA 3GWLA 1HF9A 1H8AA 3K33A 3V2RA 1NZEA 1KD1Q 3H1KE 1JNMA 1LTGC 1QEXA 2QM8A 1KILE 3VMAA 4J32B 2NSFA 2VCCA 1EDLA 1M57C 1GDTA 3B29A 1ZZPA 2L7AA 2Q6QA 2R9RB 3JT1A 2R44A 2DGJA 5HV9A 3D6ZA 1MMGA 2PP6A 3AEDC 3BCCE 3T4RA 1H9TA 3T6BA 3WU2H 4I6MC 4JZAA 3DAGA 3CZ6A 1NTKE 1IK7A 2P7JA 3CX5H 2IXNA 3I5CA 4J7TA 5JUAA 1BZ4A 4W8KA 2CPBA 1EZVE 4JYBA 3TGUD 3L35A 4JVSA 4XWJA 1FDOA 1FZBA 1FZCB 1OKKA 1AVOA 3Q3DA 1PIXA 5GTIH 2P1JA 1NBBA 5AVZB 1BGYG 5AW6B 3WUTA 4N6JA 3G4ZA 2KQ9A 4CSAC 2ZXEB 2PX0A 1T8ZA 2LCHA 1I5NA 2IYOA 3CC7P 2YL3A 1FS0E 1SQVD 3LIDA 3HTKA 3O6QA 3RKOF 4DRJB 2XKMA 2IXOA 3UMHA 4H4KC 3N24A 3KH2A 3S90A 1KMIZ 2OKUA 4Q7CA 1Z7Qc 4CPGA 1NTMG 3IQ6A 3WMM0 3EFGA 5TJHA 1G1JA 1T3UA 3AG3C 3US6A 2R05A 3WU2E 2XXAB 1M1KQ 1PGJA 3L73J 2QJYB 2JR8A 3SYNA 1TU3F 4IFFA 3CX5E 3AE1C 5KKZC 3N0TA 2AVKA 2XLEA 3ABKC 2NUPA 1J1EB 2WVOA 1FMWA 1Q90D 3G6EP 1DEEG 3DXJF 3GF3A 5GTIE 3M9QA 4HKZH 5CCGA 1HE9A 5APXA 1IFPA 2NPSC 1JPJA 1CGNA 2QJKB 3MLGA 1OXBA 2NG1A 2KB7P 4H13C 2KP8A 1SQPD 3E9VA 1EC5A 2ZFCA 3IAOA 4MNDA 2E76C 1LE2A 3G4XA 3QMKA 2M8RA 3DAFA 3TNUA 3FAJA 2P7VA 4NC3A 1QKRA 2KZJA 1MFTA 3GW6A 1KN7A 4AYCA 3FX0A 2A06E 3ZVRA 2YO3A 2L5GB 1LE4A 3S1KA 1OCOC 5KLVD 3QZCA 1VDFA 5KJ7A 1LT9C 2HLOA 3VM6A 1S1CX 4TLFA 4N3YB 2BEZF 4OIRF 2IM8A 3EZHA 2IYLD 1SQBJ 3VMZA 2YWAA 5B3IA 3H1KD 5EGYA 1YAUO 4A4AA 1L0ND 1E79H 1TQGA 2QUPA 1O5HA 2RN0A 3L73E 3AEAC 1Z63A 3M9HA 4UB6H 3IFMA 3H32B 3F46A 2NPUA 2E74C 2DI3A 4N6CA 2Y0DA 1KQLA 3BCCD 4I3MA 3EJNA 2IPPA 2FYUG 4ASWA 3RBZA 1WT6A 1QLED 1S3JA 1D0XA 4H54A 1ZVZA 2D4UA 5CCHD 3U8VA 3IQTA 3BASA 3K6BA 1EZVD 3GORA 1SQXD 3O39A 1S2EA 1AUEA 2QJPB 4JIOA 1MNDA 3T6GB 2IZ1A 4BJ1A 1NKZB 3I56P 3C62A 5JS5A 2JDIH 1NU1K 1PPJD 1MV8A 4IAQA 3L70J 1U6HA 1XZQA 3ZTMA 1T9KA 4IWBA 1L4AC 2AP3A 4DBQA 2QY9A 4JTAB 1OW7A 1E86A 1KTMA 3B0UX 2YXRB 4O9BA 1L0LG 1FZFA 1TWHA 1LGHB 1N2DC 3KPHA 2HFED 2WVRA 2LIGA 3ZDMA 4UB6E 4NTBA 2NUTA 2YZSA 2HODB 5KYUB 4QI2A 1DH3A 1CI6A 1RE3A 1VYKA 3SWYA 5DJTB 1QX8A 1SQBE 5AW1B 4ONSA 3ITFA 2WPVB 4KJMA 2Y9YA 3I5PA 1SQQG 2RD9A 1CZQA 2ZAEB 1CPQA 3RFYA 3CWBJ 3U5SA 1RKCA 3VTPC 5CI9A 3W68A 3MP7B 2Y9ZA 4XEFA 4DRIB 1MZ9A 3CX5D 4YTPC 3CCJP 4ULVA 5DS5A 2WT7A 3CEXA 3IR9A 3LAYA 2AEMA 4DJGA 2J5UA 4NPDA 3PJSK 2FYNB 2FXPA 2IDBA 3HD7A 3BRJA 2YKOA 1U7JA 3M4BA 2A45I 3AEBC 4J7YA 4RD9A 1VL2A 4WWIA 1Z3IX 2BE5F 4HFKB 2BASA 2OYOA 2XU6A 3SXMA 3CI9A 5K0IA 2P10A 3L4FA 4YL3A 3M0AA 3N4XA 2N9BA 2OU6A 1E85A 2XNXA 4YL1A 1E83A 4C7RA 5AW9B 2R02A 5D91A 4CJOA 1JY2P 5E3AA 1ZHWA 4EBBA 4GDOA 1NG1A 3G9RA 3L70E 5DS4A 4YK5A 4GOFA 2A06D 4MTOA 3V5YA 1AVOB 2B89A 1EZVI 256BA 2O01N 2RKLA 2Q7CA 2KJGA 3CCEP 4YT8A 1OVRA 4ZLDA 2OCCC 4Y99B 1N7LA 3VYIA 1G4WR 2I8BA 3RIPA 3HTKB 3O6QB 3EHNA 3LNRA 1JEKA 4PJ0H 4JE9A 1OXZA 1BDDA 1YVIA 1BR2A 3CWBE 3AOUA 1RF0A 3L73D 2R7VA 3SWFA 1OWAA 1RF1A 4KC9A 2IBZE 2D2CD 2B88A 1LPEA 3FOPA 4LERA 2WSEJ 2IYPA 3WODF 1V54C 2VCBA 4XLNF 1K05A 3K1HA 2LXBA 3RK3E 3DD7A 3JC22 2B87A 3V5BA 3ABMC 2P0NA 2GUSA 2IXMA 2NUPB 3TK0A 2WSEH 5DJUB 2OYHC 2KNCB 5AGFA 2JWAA 3B8EB 3CX5I 2K88A 3B4SA 3V4WA 2G3AA 2M4EA 5B1BC 4D4XA 5FCLA 3UMKA 3MUDA 2EILC 1ZW0A 3B5NC 1Y8AA 4OIPF 2VCAA 2KLVA 2J59M 4XEVA 1S4XA 3P32A 5CJ0A 2FXOA 4WGYA 2IFNA 5E79H 4PJ0E 3PHF2 3RK2C 1V4AA 3IHUA 2JKVA 5A6JA 3PDMP 2X0CA 3UMIA 3K1IC 2GA1A 2H88C 1FAVA 1S9KE 4XPWA 5L0FA 3TNUB 5B3SC 1YZAA 3NYLA 3U9MA 2A0UA 3GEIA 1QGKB 2R5DA 1SQBD 3CPWO 2LSEA 3VOPA 1OW6A 2HUJA 4BEMJ 5BU5A 3Q2YA 1KU2A 1FJKA 1VYIA 1DD3A 5AW3B 5CCGD 4FWVA 3Q7GA 3TGUG 1WASA 4G7HF 1GQAA 1VTMP 3H1IE 5APVA 1M56C 3G4SP 1JRAA 2YXQB 5DQTA 2KSEA 3ABLC 1NGMB 3L37A 2XLOA 1HGVA 3MGNA 1EDKA 1J1DC 3EWKA 4EKWA 1VPCA 3CC2P 1YDIA 3EH2A 1SQVG 2M64A 2K9JA 1OCRC 4K1OA 4CX9A 1LWUA 1QPUA 1GK4A 3CCRP 1YHQP 5AC4A 3TYYA 5E79E 2R25A 3EH1A 3OWTA 2W90A 2MHRA 4EIYA 2E75C 5AVTB 3DE8A 3WAQA 2R7RA 4CIHA 2EIMC 4ER9A 2ZT9C 4JCZA 4E7ZA 3OA7A 4CIPA 5FZTA 3H65A 5TISH 4LC1A 1YJ9P 3L70D 4K35A 5CBNA 1KILA 3QW0A 5JLIA 1LP1A 4ZLCA 4DXWA 3LW5J 2R3SA 3RK3B 1KFMA 4LGDE 2Z4EA 4OWFA 4DOZA 3FDQA 1K40A 4EYYQ 2XLHA 1Q86Q 5AW4B 1FZGA 2DYSC 4I7ZB 4N78E 2N1TC 1A02F 4U5BE 2LK4A 5L3VA 1QVFO 4DOJA 1YTZT 4DJ9A 3LW5H 3AE5C 2QTVA 2WPRA 3CWBD 5CCHA 2MYSA 2NUTB 3H1JJ 1Z6AA 1CI6B 1SQPG 1ZW2A 1T6IA 3USSA 3LJBA 2IBZD 2V26A 5JVEA 4I1OB 5D92A 3LS1A 2EPLX 1FFHA 1QL1A 3QW1A 3EGXA 3K1IA 2LP4A 3OEOA 3O55A 3L75J 3VP9A 2WITA 4WABA 3K5BA 3RK3D 1Y4CA 2HJ3A 2TMVP 2KLUA 1NTZK 5L0GA 3TDKA 4BJ6A 3TJ6A 2LD6A 4BXLA 2E42A 2WVNA 5TISE 5KLVG 4PJJA 4C3BA 5AW8B 3JTLO 4EHPA 1LS1A 3LLIA 2LR2A 1NHLA 3HD7B 2KSFA 1ZP0C 2KK1A 2PRRA 4JJGA 3CC4P 1O87A 1LI5A 1GW3A 5BQGA 2JEEA 2WPQA 1RHZB 1BR1A 2A45G 3H1KG 2A45H 3M0DA 2A1DD 1JUNA 5EFWB 1YQ4C 1ZYRF 1IJDB 4H13D 4PFOA 4PV1B 3BRVB 1JCCA 1N1CA 4W7ZA 4NCQA 1Z23A 2J8WA 3K7DA 2E74B 1DOWA 3DI5A 3UNGC 1S9KD 1NU1J 3W4YA 3BCCG 2C9NY 3NKEA 3L36A 4AL1A 2YKQA 2I1KA 3QVZA 1FBMA 1NTKG 1V55C 4R4MA 1YJNP 3AQCA 5EK0A 1ZMEC 3M79A 1SFCA 2I8DA 2FFHA 1PCXA 1AFOA 4OVNF 1XTCC 1EZVG 5AW5B 2HKVA 4XLPF 3B9QA 4U5DE 3H1JE 2HODA 1MUUA 1RE4A 2RH0A 1FNTc 5L0IA 4WY4A 1AEPA 1LTJC 2IFMA 1DX7A 3L75E 4BPMA 2E43A 1JR8A 2O3JA 2UWJE 3JRMO 3E1IA 3RVYA 2E74D 1RF1B 3V2QA 2N1TA 2KC3A 4AUWA 3L34A 1TFOB 4U5EE 3HE5A 3CL3D 3W2VA 3TQOA 3AEEC 3DKAA 2Z5IA 1URQC 2IBZI 2Q7RA 2P6VA 2QA4P 4OD4A 2B87B 5BU8B 3HNJA 3D71A 2CCYA 1IW7F 1FFTC 3Q5PA 1EI7A 4CS9A 2EPNA 3H1HJ 4JTCB 1LTAC 3O8ZA 3U2LA 1NU1E 2C9LY 1HJ0A 2VB6A 2QRXA 2XLDA 3QVYA 4NY3A 3AE4C 2PF4E 4AE4A 1GTWA 1LTBC 2XM4A 1GW4A 2YL0A 3NMKA 4BRYA 1SYQA 2RSEB 3GM2A 4PK4A 1N7SC 1H0TA 2ZD9A 4RO0A 3NDBB 1A7DA 4MN4C 4L75A 1AV1A 4LDKA 1ZXGA 3MX3A 1V74B 1SS1A 1OR3A 1NH4A 3ASOC 4G0HA 1E84A 2D5RB 2OQMA 4WGZA 4XFJA 3RBXA 4CS8C 3II6A 1N73C 4UB8H 3S84A 3H6PA 1FZAA 1FDMA 1ZW3A 2J7PD 2E87A 2A06G 4OH8B 1FC2C 1X22A 3B71A 3C1LA 4GKGA 1Z5ZA 1IFJA 1E2XA 3GHGC 1TR2A 3L8JA 1JY3N 2OTLP 1IZMA 3KL4A 1NU9C 2L91A 2V7QJ 5H2FE 3V7OA 3NG1A 1NFOA 2ZPAA 1YZCA 2AEJA 1K73Q 2K9JB 5EHHA 1QL2A 3R7CA 1LWUB 2KNCA 1M7LA 4U3FJ 2H43A 3L73G 4I1LA 2XDJA 1DD4A 1N86A 2HG5D 5JRAA 2V7QH 3H1HE 3DE9A 4JYCA 2BC5A 1OVUA 2W9YA 3OA1A 1SF8A 1VQ4P 2M3EA 2FFDC 2YEVA 3T6JA 1KILB 5AC5A 1RY3A 2ICWG 5B5EH 4E0HA 2R7UA 1LP1B 1GL2C 1RMVA 2AXCA 3N2ZB 3CMAP 3RQEA 1M1JC 1KQFB 2EPMX 2ZVOB 5APTA 4UB8E 2YNYA 2OYHB 3H1JD 3A9CA 1U57A 1UIIA 3ZDLA 1PGOA 1D1AA 1CSBA 1FOSF 3Q5RA 4BEJA 3L75D 1VQ7P 4JW1A 2H7VC 3I4UA 1Q81Q 1ST6A 1SVFA 2C03A 5T1DB 5BQHA 2OEXA 1AVYA 5AW0B 4U5GA 1ZV8A 1KILD 3CCQP 1T01A 2CNWD 3L71J 3EGXB 4XPYA 3EG9A 4QMAA 4MVSA 2OYIC 4WJ0A 4CSAA 3PHLA 3G71P 3EFOA 1SQBG 2Y39A 1T2KC 2AXTH 2Q3EA 4RKUJ 3A7OA 1BDCA 2HSBA 3L71G 3LLKA 4U3FE 2F22A 4ASVA 4K0DA 5B5EE 3F5HA 1Y9BA 4HFFB 1NTKD 3B5ND 2PX3A 1D7MA 3NYJA 1NO4A 4H0LB 1M90Q 3RL0B 2M3BA 3NYMA 4M3LA 1NU1D 2XLVA 1FZEA 3TOLA 2YIUB 3SFDC 3LS0A 2L9JA 1J1DB 3WG7C 4D6TE 3K66A 2O01J 3TD7A 4IL6X 1W2WA 3BEHA 2YQYA 1OVVA 2JP3A 3IN6A 1M2VA 2FXMA 1BE3J 3KKBA 1BR4A 2K37A 1OW8A 1NU7D 5KLIB 2R7WA 3FMSA 2FY8A 2GUVA 4B6IA 2E75B 1SFCB 2KSJA 1ZN5A 2O01H 3U8PA 5CIVA 5APWA 2NPSA 1OMIA 1Y47A 5F5FA 1LKXA 4H0LD 4PD4H 3KMIA 3L70G 3S0XA 1M56D 1EQ7A 5AVWB 3C18A 3RL0D 3X1OA 4B86A 2JO1A 2AXTE 1WGWA 2AWCA 2GDCA 1SQXK 4OD5A 1HWTC 2VC9A 2QLAA 4WY4B 3L71E 1R8EA 1S7ZA 5L0CA 5M1BA 1M6TA 1R5ID 3SZRA 4WVZA 5B1AC 5K5GB 2XV5A 4BJTA 5JT4A 1LTTC 1HTLC 2N1TB 1R5LA 4CJGA 3AE7C 2XNDH 1GGQA 1F1MA 4K7BA 3HE5B 1NLXA 1RJ9A 2JJLA 2L6FA 2CGEA 3FOOA 3CWBG 4FX5A 1LT9A 1OR2A 4Z9JA 3E70C 4ZKUA 2E75D 1JOCA 5F28E 1SFCD 1LJ2A 1JMWA 2HPCA 1NAYA 2ZT9D 3CCVP 2IBZG 3SNHA 3H1HD 1X79B 1H9GA 4EI2A 2XL6A 4A7PA 3O10A 3QH9A 1K04A 2KUBA 2Q9CA 2C0XA 4C46A 3GM3A 2W6BA 3E1RA 1FMVA 1VLTA 1DIPA 2J9VA 1PP9J 2OYIA 1VQKP 3CSKA 3S27A 3L72J 2BCCJ 4WY4D 3UR3C 3C7JA 1D1CA 5HSWA 1WWPA 1FZCC 2ASRA 3NTNA 1Q0MA 3KHUA 3MD0A 4PD4E 2D2CB 4U7JA 1BE3E 2N1TD 2Q3IA 1P84H 1VF5B 1PP9G 5CJ4A 3NFQA 3L72G 2BCCG 3C8GA 4LDQA 4AE4B 5A6BD 4BRYB 3ZTZA 1HMOA 4AQRD 2FKWB 2C04A 4C3EA 3F89A 3SFEC 2H8PD 1H0TB 4YT4A 4EOTA 1KB9E 3KYIA 4L74A 1OFCX 3AE2C 2J0XA 1CGOA 4MVOA 1H7IA 5L0DA 2Y0EA 1W2EA 1GS9A 4P9TA 1LTSC 1ZHTA 1KV4A 3AECC 4E0IA 3UGOA 1NTZE 2QJYC 2J45A 3H1IJ 1L4AA 2ITAA 4C7NA 2EPOA 2VASA 5AVUB 1VF5D 4YXWH 2Q9AA 2IX7C 2ZYGA 1K8AQ 2ZVNB 1G5ZA 1NTMK 3N7NA 4BJ5C 4U3FD 1PGPA 1D0YA 1J1EC 1KZUB 4XPXA 1ORSC 2QG4A 4Z1MH 2XS1A 3H1IG 3TF5A 3C9IA 1T3JA 3CCUP 1BCCJ 1AQ5A 1HW2A 2Y3HA 4MQ9F 3TK1A 1O3UA 2M5AA 3AGTA 1P84E 1B68A 2WQYC 1PP9E 3AG4C 3L72E 2BCCE 4GEHA 1KYOH 1S5LH 1A41A 5IY5C 3ZQVA 4G7ZF 1Q0KA 1VMAA 2J7PA 4FESA 5DVWA 4LLHA 2A6HF 3P8MC 2WVQA 3KDPB 3V6IA 1NSGB 3NXSA 4MVUA 3A3YB 2AWYA 4HYTB 5GPGB 3BVHA 4MS2A 2Y3DA 1T6AA 2XL4A 2MWQA 5APSA 3PH0A 1JPNA 2DB4A 4W7YA 1KORA 5A6AA 1QLEC 2NRGA 2Q9BA 1QVXA 3AE3C 4PJNA 2XL8A 2EINC 4RJTA 4FAPB 2P1AA 2L81A 4YN0B 3L71D 2K1AA 3L74J 4Z9HA 2XRHA 3U9JA 3AE6C 3ZQYA 4IB4A 1MQVA 2HFIA 4QI0A 4DT0A 2YHSA 1NJIQ 2IXPA 4JCHA 2HS5A 4N6HA 2YRFA 2Y0CA 4AL0A 5KYXA 3NKDA 4BWNA 3VP8A 2J9UA 1NOHA 1M57D 1G8XA 2KGOA 2SPZA 4Q4ZF 3EG9B 2E5YA 5AVXB 2LFDA 1HGZA 1OQCA 3HJCA 1KYOE 1S5LE 1VQLP 3EFOB 1Q82Q 2VH3A 3KPEA 1BCCE 3UIAA 4IAOA 4Y28J 1LI7A 3V4QA 3MIWA 1OCCC 5KYWA 2FAPB 2J46A 3FAPB 1IFNA 1OX3A 4DZOA 2UUHA 4MTGA 1EA8A 4RESB 2QJPC 2FYUK 5CBOA 1IO4A 3JYYA 2OJQA 3U0CA 2I1JA 1ZLLA 1C02A 4DVZA 3JCUH 4U5FE 4F4BA 1BE3D 4JTDB 4H44C 3NMDA 5A6KA 2CNWA 1MFZA 4OINF 1LT1A 5L3QA 1UIXA 5KKZB 2HMZA 2WWWA 1L7CA 1N7SD 3FWNA 1TKNA 1M2VB 3CD6P 3T9OA 2OYHA 5L0HA 1FDIA 3IPMO 1LVKA 3AEGC 2Y3GA 1PL5A 4K3AA 2LFFA 3KQGA 3JZ0A 3RGUA 1OZHA 3B5NA 2WMMA 3L74E 2H7HA 1FJPA 2NPSB 3MYFA 1YA7O 1L0LK 1AJYA 2J9BA 2XZRA 3RYLA 4MVRA 4H13B 2Q5UA 2YO2A 2ZJSE 2E76B 5E3CA 3B0PA 3AE9C 1SQQK 3H1JG 2Q00A 5T3TA 3H2VA 3TOMA 2FYNC 1X9VA 1HW1A 3FXEA 2R7OA 4I2LC 3JCUE 1RJ9B 1LM3B 2X51A 3M15A 3LEVA 1LT9B 3L75G 3FXHA 3VRCA 3U1AA 1PP9D 3L72D 2BCCD 2HPCB 1QSPA 2B0HA 4R32A 2NPSD 2ZXXA 3JYHA 3GM1A 3PRJA 1J8YF 3P7KA 1JTHA 4O7GA 4O6YA 3VN0A 5APUA 4XE5B 3L8IA 2OYIB 3CXHH 5DS6A 4XA4A 2E76D 5AVSB 4U9EA 3L0IA 1GMJA 4CDYA 2WZLA 1X0TA 3PCVA 2WSSH 1RH5B 3ITKA 2UUIA 2CDQA 2HYNA 3CLQA 5F5HA 4MVQA 2Y3BA 2R5BA 3C8GB 1Z56A 4Y99C 4PD4I 3C63A 3GWNA 3HTKC 1NU1G 4O79A 3QTHA 3SSUA 3H1ID 5GTHH 3A11A 3JSEO 3JSVC 1VQNP 4YT2A 2HR3A 3G3ZA 2PNOA 1KB9I 5COMA 5TJ5E 3ZG1A 2EIJC 2KOGA 3SWKA 1KYOD 3G50A 4ANJA 3LEOA 1T2KD 2FGYA 4E7SA 1OCZC 1R4TA 1L4AB 4C7NB 3IEEA 1BCCD 3HUSC 3U59A 2AU5A 3MFNA 1VLSA 5A6BA 2CYDA 4E17A 3C8GD 4JEBA 4CS7A 1YARO 2K9YA 3CXHE 3A0HH 1SMYF 2YLIA 3GEHA 4JEAA 2QE7H 2OG2A 1FE6A 1YJGA 3FHDA 4U5HA 4X0RA 1HUCA 4JBZA 2M5AB 2W45A 1PGQA 3TJ5A 4E18A 4G7OF 2PGDA 4GODA 5BUOA 1HJBA 2YL7A 5COGA 1LTIC 2HV6A 3QWOC 1L0NE 3C8ZA 1D1BA 3JSZA 1P84I 5H2FH 5L0JA 4IRUA 1KQGB 2OTKE 2N9YB 1M8OB 1L4AD 1L3PA 3EGDA 3EQ2A 4NPEA 2LXCB 4N78D 5GTHE 5JSLA 3W2WA 4I44A 1NKNA 1J2JB 2KIKA 3UGPA 5KAFH 1Q0FA 1ZHZA 3H1HG 4PFPA 4Z9IA 1Q2NA 1CGME 3L74D 2A69F 3ABVC 3DMDA 4JF7A 5KJ7C 1BGYJ 3OW2O 1T6QA 3H25A 2Y69C 1Y6DA 4JPZB 1YTZI 1SQXE 1T6UA 2J9WA 4OIOF 3FVYA 4AX2A 2V3CC 3A0HE 1TFKB 1JCDA 2HZ8A 3HRNA 4UDVA 1JY3P 4HB1A 4EIJA 1IFDA 3S28A 5AVVB 3SXZA 2O1KA 3T97A 5KYXB 1PPJE 1ZOYC 3V5ZA 4XEKA 2QM7A 3WHNA 2XSEA 3DM9B 4DBRA 1NTMJ 2A0BA 2YKZA 4IFMA 2LKMA 4IL6H 1UFBA 2GAQA 4EUKB 2JX0A 3BRTB 2HJMA 4M63A 5DQZA 1BSHA 4EBJA 1FAPB 2HSQA 1XZPA 5AW7B 2GM4A 3CCLP 1KYOI 5KYWB 1SQVK 1LTJA 4Q5SF 2WSCJ 1L2PA 3MHVA 2ZYDA 2DYRC 1IK9A 2RMZA 1EKYA 3A0BH 4OGQC 1USDA 5KAFE 1ZRTE 2KNHA 3HLZA 3EZIA 2YLDA 3HUSA 2W6JH 2OEVA 4CBEA 3RK3C 1A02J 2OARA 4U3FG 3GEEA 5KYYA 3V2NA 2WSCH 1URQA 3HNIA 4L6RA 4I7ZC 4D6TJ 2P58A 2P2UA 3GLMA 2BEQD 2XS8A 4W80A 3HKKA 3CCSP 1USEA 2ETSA 2WB7A 2XLMA 1BGYE 3W8HA 3HE4A 1WTYA 2ZXRA 4J30B 1VB5A 3PTZA 4YT5A 4RDAA 4DCKA 1OIPA 4D6TG 1RE3C 4C7OA 2Z5HA 1GM5A 2H89C 3B5NB 3PMRA 2WL8A 2R7QA 3A5TA 1S05A 1T5OA 4ZNCA 1BBHA 4IL6E 4XQ1A 3TULA 4JRZA 4CDAA 3Q6NA 5L8RJ 3MBGA 3DJNB 2KK7A 3VMYA 3RK2B 3IQ5A 1SQPK 2M0BA 2I15A 1NYHA 1C03A 1NTME 1LIHA 3CXHD 1OXKA 4JURI 4U9DA 3A0BE 3X2QC 3POVA 1N7SA 2GFHA 4LLCA 4I1MA 3CAXA 3HD7C 3U3BA 1SZIA 3PLNA 1R5SA 2Q4FA 3SEOA 1SP4A 2KYHA 1YITP 3VAYA 4CS8A 5KLVK 1KC8Q 1N73A 2R3CA 2YLGA 4PV1C 1EDIA 2FYUJ 2YL1A 1YQ3C 1DEBA 4EBKA 2ZXWC 1G2CA 1JTHB 1H88A 1GZLA 3DJUB 1KFNA 3RK2D 1LS4A 3GHGA 3H1LJ 1L0NK 2YVKA 2R7XA 2HV7A 2R32A 1W2BO 2PAJA 4IOIH 5CI8A 1WATA 4DVYP 2KYVA 4P9FA 4LACB 1G1IA 2KI7B 4NTAA 3ASNC 3H1LG 2P61A 3FGAD 2QE9A 2KS1A 1HMDA 2A6EF 3CCMP 1VK5A 1ORJA 4A2NB 3GF7A 3HNKA 4YPCA 1NTKK 2ZT9B 1AA0A 2WZFA 1BE3G 3JCUQ 1VQPP 4JC7A 1L0LJ 1RF0C 2CPSA 4H44B 2FFDA 3NMIA 4LDRA 2WZ7A 1RF1C 3U3FA 1GL2A 4NQFA 1Q7YQ 4ULWA 4MW3A 5A69A 1M1JA 1RQUA 1WMKA 3HNLA 3A2AA 3MZWB 3OAKA 1EQ1A 1SQQJ 1FU1A 3H2UA 3FXDA 1H89A 3AG1C 1NTZJ 1KB9H 3GODA 3ZIBA 3Q7LA 3SXKA 1PV3A 2Q1KA 5KAIH 2IBFA 3LIEA 1TWAA 1MMAA 1MKMA 4P6IC 3AQBA 1HBWA 3GMAA 1ZRTD 3V2PA 4LLEA 1NTZG 1PD1A 2FYUE 5C39A 1VQMP 3J06A 2IOQA 3CXHI 3MUDC 3W67A 3W8IA 4H44D 4HH2A 4WB4A 1A7VA 3WUUA 3H1LE 2QIWA 3VF0A 1TWGA 4KBLA 2G3KA 4WBAA 3SP1A 2YKPA 1PZQA 1RKEA 3M91A 2NSGA 5AVRB 1BGYD 1I4ZA 3EGDB 5T3WA 3DWWA 5JP7A 3NMJA 2OQQA 1WN0A 2YMYA 2PFXA 4HE8D 1IC2A 2J58A 2WPSA 2KXPB 1EXJA 1LNQA 4G78A 4D4NA 1L0LE 1YLMA 2O1JA 3Q1MA 3EQLF 5KYNA 2XLWA 1HVVA 5KAIE 3AE8C 1RXQA 1WOLA 3IQCA 1QQ3A 1NTMD 1JAFA 3NRHA 4W8PA 1SQQE 2G8YA 2QNLA 1IFIA 3M06A 3T97B 4ZKPA 1JY2N 4YL0A 2W27A 4DRHB 1M2OA 1GU4A 3ATPA 3RW0A 2FBWC 1YYCA 1YIJP 1NAFA 1JY3O 1LWUC 4KNWA 3I55P 3D70A 1JMMA 1EXIA 1YYXA 3CQZA 1KQSO 3KZIH 2L6HA 1TWCA 3ZWIA 4BG0A 3AGUA 4IJJA 1LTJB 2MKVA 1MMNA 3EPVA 2QJKC 4EDFA 1S72P 2Q3TA 2EIKC 4D6TD 1U0BB 1OKKD 3EFFK 1KILC 4JQ0D 1JM0A 3EHMA 1BCCG 4NPFX 1W5CE 4PJMA 3ECSA 2JPUA 3HUSB 3U1CA 2H8AA 3LNMB 4U5CE 4JJFA 2A68F 5KYYB 4CDVA 1URQB 3LESA 1A0BA 1ZR4A 4PR9A 3SXYA 2LQGA 4OIQF 1ZU5A 2W4MA 4KT0J 2R7TA 2QVAA 4RBNA 2WZGA 3C8VA 1KNYA 3HE4B 5CCHC 1J8MF 3E7KA 2IZ0A 1ZHXA 3P8CE 5AVYB 3I5QA 4C7OB 1ZHYA 4JKVA 4IARA 2KZIA 4ZMDA 1K9MQ 4IGGA 1MMDA 1SR2A 1FZCA 3ZSUA 3RF3A 4N06A 4MVZA 1A7EA 3VMXA 2PFDA 4HJGH 2WTYA 2C0WA 3KZIE 1APCA 2R7SA 4IFDK 2ZYAA 1JOGA 4QDLA 3TGUJ 3ZC4A 4MTFA 5APQA 1E5WA 1RCPA 4BJ6C 1URQD 2B0JA 3L74G 1WRGA 1N7SB 5CMZA 4HEAJ 4XTKA 3D6YA 2V4HA 1PD0A 1D0ZA 2FYUD 3V5XA 2JWDA 2GA0A 1FR0A 2K3RA 1SQBK 4H0LC 1ZU4A 2Q9IA 1PFIA 1SQVJ 3RL0C 3S9OA 3KXDA 1QVGO 3M0DC 3H1LD 1N73B 5AVQB 2YIUC 2PBEA 1GD2E 2VRSA 2G3VA 2XXAA 3PP5A 3AG2C 5AW2B 1H6GA 3Q5SA 2DW3A 3M9BA 1GK6A 1G2CB 4PD4D 3LUTB 4BJ5A 1BDJB 1CPRA 2P67A 3RL0g 1Q0GA 3GHGB 2YMKA 1FOSE 1NWQA 1G4US 2JD3A 2CK3H 3DZAA 2W8ZA 4MVMA 5KLIC 1C17M 5KJ7D 3BATA 4NTFA 2B9BA 1SLQA 1SFCC 1RQVA 1XWJA 1L0LD 1IZNB 1KB9D 1YJWP 2KS1B 1AQTA 4OGQB 1YI2P 1U7MA 5APYA 1ORYA 5B66H 1RE4C 3MTUE 5BQIA 3RVZA 2OOCA 5BVZA 4R4LA 1MNEA 4YWQA 4WY4C 3M4CA 1SQQD 1U89A 4MW8A 2FFDB 1HY5A 1XTGB 1UG7A 1NTZD 2G62A 2MJZA 1YYJA 3TGUE 1GL2B 1SQPJ 3GG2A 2WSFJ 4C3DA 1JMBA 4PJLA 1M1JB 1Q0DA 2R03A 2CW0F 2QEXP 2EPKX
chains in the Genus database with same CATH topology
3L8IA 1S5LX 3H25A 3L8JA 1K05A 3RK3E 3SFDC 2E76D 4H13C 2V7QJ 3AE2C 1GMJA 4TT3H 1ZZPA 2O01J 4Y28J 3LW5J 2WPVB 4IL6X 3IAOA 2E76C 4OGQD 4YXDC 2JP3A 3IN6A 3D6ZA 1K40A 3AEDC 3AECC 2G3AA 1DD4A 4I7ZB 1JOGA 3C8GB 1OW8A 4XEFA 2QJYC 4PV1C 1ZOYC 2E74D 2QJPC 2LK4A 2OQQA 1YQ3C 4XEKA 3AEFC 2E75B 1IK7A 3RQGA 3JYYA 4EBKA 1VF5D 4YTPC 3U0CA 3AE5C 1EXJA 1OMIA 3AEEC 2J5UA 2L6GA 2D2CC 4H44C 3Q1MA 4H0LD 3D6YA 1UFBA 4XEVA 1VF5C 1S1CX 2FXPA 2IDBA 2QSIA 3BRJA 3C18A 2JX0A 3AEBC 2BEZF 2JO1A 4Z1MH 1UIXA 1FDOA 1V4AA 3AE8C 2YWAA 4H0LC 3Q3DA 1WOLA 3RQEA 1VL2A 4EBJA 1PIXA 1O3UA 1KQFB 3S9OA 3D71A 1R8EA 2WSCJ 2H88C 1FDIA 2G8YA 2YIUC 2PBEA 2WQYC 5M1BA 4OGQC 3AEAC 3FGAD 1U57A 1ZRTE 3AEGC 2P10A 3R4YA 3T97B 1PL5A 3Q5PA 3Q5SA 3RQFA 3AE7C 3MFNA 3GF7A 2FBWC 3JZ0A 1OW6A 3O6QA 2E74C 2ZT9B 3Q5RA 3C8GD 3Q2YA 2L6FA 2K9YA 3RL0g 3D70A 1DD3A 2YMKA 1AJYA 1HJ0A 4GDOA 2E75D 4H44B 1EXIA 5F28E 1ZP0C 2KK1A 3G9RA 4I7ZC 4H13B 1KMIZ 3AE4C 2L6HA 5KLIC 2ZT9D 3U3FA 4NQFA 3GLMA 2BEQD 1RQVA 2E76B 1RQUA 2MKVA 1WMKA 1KORA 1K04A 3GM2A 3O10A 1JB0J 1YQ4C 3AE9C 1NGMB 4H13D 2QJKC 1QVXA 1WTYA 3GM3A 3AE3C 2Q00A 2FYNC 1DIPA 3AJMA 4PV1B 4OGQB 3EWKA 1TU3F 2NZ2A 1PV3A 3AE1C 2JPUA 5KKZC 2H89C 1WWPA 1KQGB 4R4LA 4RKUJ 3K7DA 2E74B 3AE6C 2HSBA 4XFJA 2D2CB 4U7JA 4PV1D 1MKMA 1Q90D 1VF5B 3TULA 1Y9BA 3GMAA 5L8RJ 3C8GA 4R32A 4R4MA 2E75C 1OW7A 3GF3A 4H0LB 2WSFJ 4KT0J 3GM1A 1HF9A 2D2CD 1KTMA 4H44D 1ZMEC 1NYHA 2WSEJ 3ABVC 3B71A 2ZT9C 3SFEC 3C8VA 1KNYA 1KILE 2QIWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L8I A;  3L8J A;  1K05 A;  3SFD C;  3AE2 C;  1ZZP A;  4YXD C;  1K40 A;  3AED C;  3AEC C;  2G3A A;  1JOG A;  3C8G B;  1OW8 A;  4XEF A;  1ZOY C;  2LK4 A;  1YQ3 C;  4XEK A;  3AEF C;  4EBK A;  3RQG A;  3JYY A;  4YTP C;  3U0C A;  3AE5 C;  3AEE C;  2L6G A;  1UFB A;  4XEV A;  3C18 A;  3BRJ A;  2JX0 A;  3AEB C;  1V4A A;  3AE8 C;  2YWA A;  4EBJ A;  1WOL A;  3RQE A;  1O3U A;  3S9O A;  2H88 C;  2PBE A;  2WQY C;  3AEA C;  3AEG C;  3RQF A;  3AE7 C;  3MFN A;  2FBW C;  3JZ0 A;  1OW6 A;  3C8G D;  2L6F A;  5F28 E;  1ZP0 C;  2KK1 A;  3AE4 C;  2L6H A;  3U3F A;  4NQF A;  3O10 A;  3GM2 A;  1K04 A;  3AE9 C;  1YQ4 C;  1QVX A;  1WTY A;  3GM3 A;  3AE3 C;  2Q00 A;  3AJM A;  1PV3 A;  3AE1 C;  2JPU A;  2H89 C;  1WWP A;  3K7D A;  3AE6 C;  2HSB A;  3TUL A;  3C8G A;  4R32 A;  1OW7 A;  3GM1 A;  1KTM A;  3ABV C;  3B71 A;  3SFE C;  1KNY A; 
#chains in the Genus database with same CATH topology
 3S4R A;  1S5L X;  5CHX A;  3DM5 A;  3KYJ A;  5E33 A;  2O9X A;  3Q6M A;  4TT3 H;  3S29 A;  3L1M A;  2OJE D;  2W4B A;  1P84 D;  1NVO A;  2BL2 A;  1SQV E;  2WSF H;  1VQO P;  1YA9 A;  4GIF A;  4OGQ D;  4YXD C;  5KLV J;  3MYI A;  2H7B A;  5COF A;  1ZR2 A;  4CS9 C;  3VYW A;  2XM0 A;  3AEF C;  3H32 A;  3RQG A;  3U2M A;  3F47 A;  1I4Y A;  3M1C B;  2AEF A;  3IF4 A;  2WT7 B;  3H1K J;  1GL2 D;  2D2C C;  2L6G A;  2Z15 A;  1L0N J;  2POH A;  4PAC A;  1VF5 C;  2QSI A;  5B66 E;  4AK9 A;  3TSI A;  1CW5 A;  3B0V C;  2W6A A;  4GYT A;  1YBK A;  1RKE B;  2HMQ A;  2J0W A;  3O6X A;  1HE1 A;  1DOV A;  1IFM A;  1L0N G;  3BCC J;  4KNV A;  3P8C D;  1QZX A;  3R4Y A;  4YJW A;  1VOM A;  5E2Q A;  4KI2 A;  1GU5 A;  2FYZ A;  2OGU A;  5KTB A;  3RQF A;  1JO5 A;  1NTK J;  4GT1 A;  4GOE A;  1N8R Q;  2GWW A;  3CME P;  4O6M A;  2E5T A;  4L73 A;  1VQ9 P;  1VQ5 P;  4N4W A;  1BSN A;  1VQ6 P;  1SQX J;  2ZXO A;  4KHX A;  3JRT A;  1SQP E;  3GAN A;  1VQ8 P;  2ZXP A;  3HD7 D;  4L76 A;  1JB0 J;  3OJA B;  1JY2 O;  2KW3 C;  5DLJ A;  3WUV A;  3AJM A;  4O6N A;  2W83 C;  5KYU A;  1SQX G;  1FTS A;  2H7O A;  2NZ2 A;  3R2P A;  1HH0 A;  2OTJ P;  4GQH A;  1EDJ A;  3RH3 A;  5KLV E;  3KYQ A;  4PV1 D;  3FWL A;  4EWC A;  1PPJ G;  1X8Y A;  5CCG C;  2PP4 A;  1NFN A;  3GWL A;  1HF9 A;  1H8A A;  3K33 A;  3V2R A;  1NZE A;  1KD1 Q;  3H1K E;  1JNM A;  1LTG C;  1QEX A;  2QM8 A;  1KIL E;  3VMA A;  4J32 B;  2NSF A;  2VCC A;  1EDL A;  1M57 C;  1GDT A;  3B29 A;  1ZZP A;  2L7A A;  2Q6Q A;  2R9R B;  3JT1 A;  2R44 A;  2DGJ A;  5HV9 A;  3D6Z A;  1MMG A;  2PP6 A;  3AED C;  3BCC E;  3T4R A;  1H9T A;  3T6B A;  3WU2 H;  4I6M C;  4JZA A;  3DAG A;  3CZ6 A;  1NTK E;  1IK7 A;  2P7J A;  3CX5 H;  2IXN A;  3I5C A;  4J7T A;  5JUA A;  1BZ4 A;  4W8K A;  2CPB A;  1EZV E;  4JYB A;  3TGU D;  3L35 A;  4JVS A;  4XWJ A;  1FDO A;  1FZB A;  1FZC B;  1OKK A;  1AVO A;  3Q3D A;  1PIX A;  5GTI H;  2P1J A;  1NBB A;  5AVZ B;  1BGY G;  5AW6 B;  3WUT A;  4N6J A;  3G4Z A;  2KQ9 A;  4CSA C;  2ZXE B;  2PX0 A;  1T8Z A;  2LCH A;  1I5N A;  2IYO A;  3CC7 P;  2YL3 A;  1FS0 E;  1SQV D;  3LID A;  3HTK A;  3O6Q A;  3RKO F;  4DRJ B;  2XKM A;  2IXO A;  3UMH A;  4H4K C;  3N24 A;  3KH2 A;  3S90 A;  1KMI Z;  2OKU A;  4Q7C A;  1Z7Q c;  4CPG A;  1NTM G;  3IQ6 A;  3WMM 0;  3EFG A;  5TJH A;  1G1J A;  1T3U A;  3AG3 C;  3US6 A;  2R05 A;  3WU2 E;  2XXA B;  1M1K Q;  1PGJ A;  3L73 J;  2QJY B;  2JR8 A;  3SYN A;  1TU3 F;  4IFF A;  3CX5 E;  3AE1 C;  5KKZ C;  3N0T A;  2AVK A;  2XLE A;  3ABK C;  2NUP A;  1J1E B;  2WVO A;  1FMW A;  1Q90 D;  3G6E P;  1DEE G;  3DXJ F;  3GF3 A;  5GTI E;  3M9Q A;  4HKZ H;  5CCG A;  1HE9 A;  5APX A;  1IFP A;  2NPS C;  1JPJ A;  1CGN A;  2QJK B;  3MLG A;  1OXB A;  2NG1 A;  2KB7 P;  4H13 C;  2KP8 A;  1SQP D;  3E9V A;  1EC5 A;  2ZFC A;  3IAO A;  4MND A;  2E76 C;  1LE2 A;  3G4X A;  3QMK A;  2M8R A;  3DAF A;  3TNU A;  3FAJ A;  2P7V A;  4NC3 A;  1QKR A;  2KZJ A;  1MFT A;  3GW6 A;  1KN7 A;  4AYC A;  3FX0 A;  2A06 E;  3ZVR A;  2YO3 A;  2L5G B;  1LE4 A;  3S1K A;  1OCO C;  5KLV D;  3QZC A;  1VDF A;  5KJ7 A;  1LT9 C;  2HLO A;  3VM6 A;  1S1C X;  4TLF A;  4N3Y B;  2BEZ F;  4OIR F;  2IM8 A;  3EZH A;  2IYL D;  1SQB J;  3VMZ A;  2YWA A;  5B3I A;  3H1K D;  5EGY A;  1YAU O;  4A4A A;  1L0N D;  1E79 H;  1TQG A;  2QUP A;  1O5H A;  2RN0 A;  3L73 E;  3AEA C;  1Z63 A;  3M9H A;  4UB6 H;  3IFM A;  3H32 B;  3F46 A;  2NPU A;  2E74 C;  2DI3 A;  4N6C A;  2Y0D A;  1KQL A;  3BCC D;  4I3M A;  3EJN A;  2IPP A;  2FYU G;  4ASW A;  3RBZ A;  1WT6 A;  1QLE D;  1S3J A;  1D0X A;  4H54 A;  1ZVZ A;  2D4U A;  5CCH D;  3U8V A;  3IQT A;  3BAS A;  3K6B A;  1EZV D;  3GOR A;  1SQX D;  3O39 A;  1S2E A;  1AUE A;  2QJP B;  4JIO A;  1MND A;  3T6G B;  2IZ1 A;  4BJ1 A;  1NKZ B;  3I56 P;  3C62 A;  5JS5 A;  2JDI H;  1NU1 K;  1PPJ D;  1MV8 A;  4IAQ A;  3L70 J;  1U6H A;  1XZQ A;  3ZTM A;  1T9K A;  4IWB A;  1L4A C;  2AP3 A;  4DBQ A;  2QY9 A;  4JTA B;  1OW7 A;  1E86 A;  1KTM A;  3B0U X;  2YXR B;  4O9B A;  1L0L G;  1FZF A;  1TWH A;  1LGH B;  1N2D C;  3KPH A;  2HFE D;  2WVR A;  2LIG A;  3ZDM A;  4UB6 E;  4NTB A;  2NUT A;  2YZS A;  2HOD B;  5KYU B;  4QI2 A;  1DH3 A;  1CI6 A;  1RE3 A;  1VYK A;  3SWY A;  5DJT B;  1QX8 A;  1SQB E;  5AW1 B;  4ONS A;  3ITF A;  2WPV B;  4KJM A;  2Y9Y A;  3I5P A;  1SQQ G;  2RD9 A;  1CZQ A;  2ZAE B;  1CPQ A;  3RFY A;  3CWB J;  3U5S A;  1RKC A;  3VTP C;  5CI9 A;  3W68 A;  3MP7 B;  2Y9Z A;  4XEF A;  4DRI B;  1MZ9 A;  3CX5 D;  4YTP C;  3CCJ P;  4ULV A;  5DS5 A;  2WT7 A;  3CEX A;  3IR9 A;  3LAY A;  2AEM A;  4DJG A;  2J5U A;  4NPD A;  3PJS K;  2FYN B;  2FXP A;  2IDB A;  3HD7 A;  3BRJ A;  2YKO A;  1U7J A;  3M4B A;  2A45 I;  3AEB C;  4J7Y A;  4RD9 A;  1VL2 A;  4WWI A;  1Z3I X;  2BE5 F;  4HFK B;  2BAS A;  2OYO A;  2XU6 A;  3SXM A;  3CI9 A;  5K0I A;  2P10 A;  3L4F A;  4YL3 A;  3M0A A;  3N4X A;  2N9B A;  2OU6 A;  1E85 A;  2XNX A;  4YL1 A;  1E83 A;  4C7R A;  5AW9 B;  2R02 A;  5D91 A;  4CJO A;  1JY2 P;  5E3A A;  1ZHW A;  4EBB A;  4GDO A;  1NG1 A;  3G9R A;  3L70 E;  5DS4 A;  4YK5 A;  4GOF A;  2A06 D;  4MTO A;  3V5Y A;  1AVO B;  2B89 A;  1EZV I;  256B A;  2O01 N;  2RKL A;  2Q7C A;  2KJG A;  3CCE P;  4YT8 A;  1OVR A;  4ZLD A;  2OCC C;  4Y99 B;  1N7L A;  3VYI A;  1G4W R;  2I8B A;  3RIP A;  3HTK B;  3O6Q B;  3EHN A;  3LNR A;  1JEK A;  4PJ0 H;  4JE9 A;  1OXZ A;  1BDD A;  1YVI A;  1BR2 A;  3CWB E;  3AOU A;  1RF0 A;  3L73 D;  2R7V A;  3SWF A;  1OWA A;  1RF1 A;  4KC9 A;  2IBZ E;  2D2C D;  2B88 A;  1LPE A;  3FOP A;  4LER A;  2WSE J;  2IYP A;  3WOD F;  1V54 C;  2VCB A;  4XLN F;  1K05 A;  3K1H A;  2LXB A;  3RK3 E;  3DD7 A;  3JC2 2;  2B87 A;  3V5B A;  3ABM C;  2P0N A;  2GUS A;  2IXM A;  2NUP B;  3TK0 A;  2WSE H;  5DJU B;  2OYH C;  2KNC B;  5AGF A;  2JWA A;  3B8E B;  3CX5 I;  2K88 A;  3B4S A;  3V4W A;  2G3A A;  2M4E A;  5B1B C;  4D4X A;  5FCL A;  3UMK A;  3MUD A;  2EIL C;  1ZW0 A;  3B5N C;  1Y8A A;  4OIP F;  2VCA A;  2KLV A;  2J59 M;  4XEV A;  1S4X A;  3P32 A;  5CJ0 A;  2FXO A;  4WGY A;  2IFN A;  5E79 H;  4PJ0 E;  3PHF 2;  3RK2 C;  1V4A A;  3IHU A;  2JKV A;  5A6J A;  3PDM P;  2X0C A;  3UMI A;  3K1I C;  2GA1 A;  2H88 C;  1FAV A;  1S9K E;  4XPW A;  5L0F A;  3TNU B;  5B3S C;  1YZA A;  3NYL A;  3U9M A;  2A0U A;  3GEI A;  1QGK B;  2R5D A;  1SQB D;  3CPW O;  2LSE A;  3VOP A;  1OW6 A;  2HUJ A;  4BEM J;  5BU5 A;  3Q2Y A;  1KU2 A;  1FJK A;  1VYI A;  1DD3 A;  5AW3 B;  5CCG D;  4FWV A;  3Q7G A;  3TGU G;  1WAS A;  4G7H F;  1GQA A;  1VTM P;  3H1I E;  5APV A;  1M56 C;  3G4S P;  1JRA A;  2YXQ B;  5DQT A;  2KSE A;  3ABL C;  1NGM B;  3L37 A;  2XLO A;  1HGV A;  3MGN A;  1EDK A;  1J1D C;  3EWK A;  4EKW A;  1VPC A;  3CC2 P;  1YDI A;  3EH2 A;  1SQV G;  2M64 A;  2K9J A;  1OCR C;  4K1O A;  4CX9 A;  1LWU A;  1QPU A;  1GK4 A;  3CCR P;  1YHQ P;  5AC4 A;  3TYY A;  5E79 E;  2R25 A;  3EH1 A;  3OWT A;  2W90 A;  2MHR A;  4EIY A;  2E75 C;  5AVT B;  3DE8 A;  3WAQ A;  2R7R A;  4CIH A;  2EIM C;  4ER9 A;  2ZT9 C;  4JCZ A;  4E7Z A;  3OA7 A;  4CIP A;  5FZT A;  3H65 A;  5TIS H;  4LC1 A;  1YJ9 P;  3L70 D;  4K35 A;  5CBN A;  1KIL A;  3QW0 A;  5JLI A;  1LP1 A;  4ZLC A;  4DXW A;  3LW5 J;  2R3S A;  3RK3 B;  1KFM A;  4LGD E;  2Z4E A;  4OWF A;  4DOZ A;  3FDQ A;  1K40 A;  4EYY Q;  2XLH A;  1Q86 Q;  5AW4 B;  1FZG A;  2DYS C;  4I7Z B;  4N78 E;  2N1T C;  1A02 F;  4U5B E;  2LK4 A;  5L3V A;  1QVF O;  4DOJ A;  1YTZ T;  4DJ9 A;  3LW5 H;  3AE5 C;  2QTV A;  2WPR A;  3CWB D;  5CCH A;  2MYS A;  2NUT B;  3H1J J;  1Z6A A;  1CI6 B;  1SQP G;  1ZW2 A;  1T6I A;  3USS A;  3LJB A;  2IBZ D;  2V26 A;  5JVE A;  4I1O B;  5D92 A;  3LS1 A;  2EPL X;  1FFH A;  1QL1 A;  3QW1 A;  3EGX A;  3K1I A;  2LP4 A;  3OEO A;  3O55 A;  3L75 J;  3VP9 A;  2WIT A;  4WAB A;  3K5B A;  3RK3 D;  1Y4C A;  2HJ3 A;  2TMV P;  2KLU A;  1NTZ K;  5L0G A;  3TDK A;  4BJ6 A;  3TJ6 A;  2LD6 A;  4BXL A;  2E42 A;  2WVN A;  5TIS E;  5KLV G;  4PJJ A;  4C3B A;  5AW8 B;  3JTL O;  4EHP A;  1LS1 A;  3LLI A;  2LR2 A;  1NHL A;  3HD7 B;  2KSF A;  1ZP0 C;  2KK1 A;  2PRR A;  4JJG A;  3CC4 P;  1O87 A;  1LI5 A;  1GW3 A;  5BQG A;  2JEE A;  2WPQ A;  1RHZ B;  1BR1 A;  2A45 G;  3H1K G;  2A45 H;  3M0D A;  2A1D D;  1JUN A;  5EFW B;  1YQ4 C;  1ZYR F;  1IJD B;  4H13 D;  4PFO A;  4PV1 B;  3BRV B;  1JCC A;  1N1C A;  4W7Z A;  4NCQ A;  1Z23 A;  2J8W A;  3K7D A;  2E74 B;  1DOW A;  3DI5 A;  3UNG C;  1S9K D;  1NU1 J;  3W4Y A;  3BCC G;  2C9N Y;  3NKE A;  3L36 A;  4AL1 A;  2YKQ A;  2I1K A;  3QVZ A;  1FBM A;  1NTK G;  1V55 C;  4R4M A;  1YJN P;  3AQC A;  5EK0 A;  1ZME C;  3M79 A;  1SFC A;  2I8D A;  2FFH A;  1PCX A;  1AFO A;  4OVN F;  1XTC C;  1EZV G;  5AW5 B;  2HKV A;  4XLP F;  3B9Q A;  4U5D E;  3H1J E;  2HOD A;  1MUU A;  1RE4 A;  2RH0 A;  1FNT c;  5L0I A;  4WY4 A;  1AEP A;  1LTJ C;  2IFM A;  1DX7 A;  3L75 E;  4BPM A;  2E43 A;  1JR8 A;  2O3J A;  2UWJ E;  3JRM O;  3E1I A;  3RVY A;  2E74 D;  1RF1 B;  3V2Q A;  2N1T A;  2KC3 A;  4AUW A;  3L34 A;  1TFO B;  4U5E E;  3HE5 A;  3CL3 D;  3W2V A;  3TQO A;  3AEE C;  3DKA A;  2Z5I A;  1URQ C;  2IBZ I;  2Q7R A;  2P6V A;  2QA4 P;  4OD4 A;  2B87 B;  5BU8 B;  3HNJ A;  3D71 A;  2CCY A;  1IW7 F;  1FFT C;  3Q5P A;  1EI7 A;  4CS9 A;  2EPN A;  3H1H J;  4JTC B;  1LTA C;  3O8Z A;  3U2L A;  1NU1 E;  2C9L Y;  1HJ0 A;  2VB6 A;  2QRX A;  2XLD A;  3QVY A;  4NY3 A;  3AE4 C;  2PF4 E;  4AE4 A;  1GTW A;  1LTB C;  2XM4 A;  1GW4 A;  2YL0 A;  3NMK A;  4BRY A;  1SYQ A;  2RSE B;  3GM2 A;  4PK4 A;  1N7S C;  1H0T A;  2ZD9 A;  4RO0 A;  3NDB B;  1A7D A;  4MN4 C;  4L75 A;  1AV1 A;  4LDK A;  1ZXG A;  3MX3 A;  1V74 B;  1SS1 A;  1OR3 A;  1NH4 A;  3ASO C;  4G0H A;  1E84 A;  2D5R B;  2OQM A;  4WGZ A;  4XFJ A;  3RBX A;  4CS8 C;  3II6 A;  1N73 C;  4UB8 H;  3S84 A;  3H6P A;  1FZA A;  1FDM A;  1ZW3 A;  2J7P D;  2E87 A;  2A06 G;  4OH8 B;  1FC2 C;  1X22 A;  3B71 A;  3C1L A;  4GKG A;  1Z5Z A;  1IFJ A;  1E2X A;  3GHG C;  1TR2 A;  3L8J A;  1JY3 N;  2OTL P;  1IZM A;  3KL4 A;  1NU9 C;  2L91 A;  2V7Q J;  5H2F E;  3V7O A;  3NG1 A;  1NFO A;  2ZPA A;  1YZC A;  2AEJ A;  1K73 Q;  2K9J B;  5EHH A;  1QL2 A;  3R7C A;  1LWU B;  2KNC A;  1M7L A;  4U3F J;  2H43 A;  3L73 G;  4I1L A;  2XDJ A;  1DD4 A;  1N86 A;  2HG5 D;  5JRA A;  2V7Q H;  3H1H E;  3DE9 A;  4JYC A;  2BC5 A;  1OVU A;  2W9Y A;  3OA1 A;  1SF8 A;  1VQ4 P;  2M3E A;  2FFD C;  2YEV A;  3T6J A;  1KIL B;  5AC5 A;  1RY3 A;  2ICW G;  5B5E H;  4E0H A;  2R7U A;  1LP1 B;  1GL2 C;  1RMV A;  2AXC A;  3N2Z B;  3CMA P;  3RQE A;  1M1J C;  1KQF B;  2EPM X;  2ZVO B;  5APT A;  4UB8 E;  2YNY A;  2OYH B;  3H1J D;  3A9C A;  1U57 A;  1UII A;  3ZDL A;  1PGO A;  1D1A A;  1CSB A;  1FOS F;  3Q5R A;  4BEJ A;  3L75 D;  1VQ7 P;  4JW1 A;  2H7V C;  3I4U A;  1Q81 Q;  1ST6 A;  1SVF A;  2C03 A;  5T1D B;  5BQH A;  2OEX A;  1AVY A;  5AW0 B;  4U5G A;  1ZV8 A;  1KIL D;  3CCQ P;  1T01 A;  2CNW D;  3L71 J;  3EGX B;  4XPY A;  3EG9 A;  4QMA A;  4MVS A;  2OYI C;  4WJ0 A;  4CSA A;  3PHL A;  3G71 P;  3EFO A;  1SQB G;  2Y39 A;  1T2K C;  2AXT H;  2Q3E A;  4RKU J;  3A7O A;  1BDC A;  2HSB A;  3L71 G;  3LLK A;  4U3F E;  2F22 A;  4ASV A;  4K0D A;  5B5E E;  3F5H A;  1Y9B A;  4HFF B;  1NTK D;  3B5N D;  2PX3 A;  1D7M A;  3NYJ A;  1NO4 A;  4H0L B;  1M90 Q;  3RL0 B;  2M3B A;  3NYM A;  4M3L A;  1NU1 D;  2XLV A;  1FZE A;  3TOL A;  2YIU B;  3SFD C;  3LS0 A;  2L9J A;  1J1D B;  3WG7 C;  4D6T E;  3K66 A;  2O01 J;  3TD7 A;  4IL6 X;  1W2W A;  3BEH A;  2YQY A;  1OVV A;  2JP3 A;  3IN6 A;  1M2V A;  2FXM A;  1BE3 J;  3KKB A;  1BR4 A;  2K37 A;  1OW8 A;  1NU7 D;  5KLI B;  2R7W A;  3FMS A;  2FY8 A;  2GUV A;  4B6I A;  2E75 B;  1SFC B;  2KSJ A;  1ZN5 A;  2O01 H;  3U8P A;  5CIV A;  5APW A;  2NPS A;  1OMI A;  1Y47 A;  5F5F A;  1LKX A;  4H0L D;  4PD4 H;  3KMI A;  3L70 G;  3S0X A;  1M56 D;  1EQ7 A;  5AVW B;  3C18 A;  3RL0 D;  3X1O A;  4B86 A;  2JO1 A;  2AXT E;  1WGW A;  2AWC A;  2GDC A;  1SQX K;  4OD5 A;  1HWT C;  2VC9 A;  2QLA A;  4WY4 B;  3L71 E;  1R8E A;  1S7Z A;  5L0C A;  5M1B A;  1M6T A;  1R5I D;  3SZR A;  4WVZ A;  5B1A C;  5K5G B;  2XV5 A;  4BJT A;  5JT4 A;  1LTT C;  1HTL C;  2N1T B;  1R5L A;  4CJG A;  3AE7 C;  2XND H;  1GGQ A;  1F1M A;  4K7B A;  3HE5 B;  1NLX A;  1RJ9 A;  2JJL A;  2L6F A;  2CGE A;  3FOO A;  3CWB G;  4FX5 A;  1LT9 A;  1OR2 A;  4Z9J A;  3E70 C;  4ZKU A;  2E75 D;  1JOC A;  5F28 E;  1SFC D;  1LJ2 A;  1JMW A;  2HPC A;  1NAY A;  2ZT9 D;  3CCV P;  2IBZ G;  3SNH A;  3H1H D;  1X79 B;  1H9G A;  4EI2 A;  2XL6 A;  4A7P A;  3O10 A;  3QH9 A;  1K04 A;  2KUB A;  2Q9C A;  2C0X A;  4C46 A;  3GM3 A;  2W6B A;  3E1R A;  1FMV A;  1VLT A;  1DIP A;  2J9V A;  1PP9 J;  2OYI A;  1VQK P;  3CSK A;  3S27 A;  3L72 J;  2BCC J;  4WY4 D;  3UR3 C;  3C7J A;  1D1C A;  5HSW A;  1WWP A;  1FZC C;  2ASR A;  3NTN A;  1Q0M A;  3KHU A;  3MD0 A;  4PD4 E;  2D2C B;  4U7J A;  1BE3 E;  2N1T D;  2Q3I A;  1P84 H;  1VF5 B;  1PP9 G;  5CJ4 A;  3NFQ A;  3L72 G;  2BCC G;  3C8G A;  4LDQ A;  4AE4 B;  5A6B D;  4BRY B;  3ZTZ A;  1HMO A;  4AQR D;  2FKW B;  2C04 A;  4C3E A;  3F89 A;  3SFE C;  2H8P D;  1H0T B;  4YT4 A;  4EOT A;  1KB9 E;  3KYI A;  4L74 A;  1OFC X;  3AE2 C;  2J0X A;  1CGO A;  4MVO A;  1H7I A;  5L0D A;  2Y0E A;  1W2E A;  1GS9 A;  4P9T A;  1LTS C;  1ZHT A;  1KV4 A;  3AEC C;  4E0I A;  3UGO A;  1NTZ E;  2QJY C;  2J45 A;  3H1I J;  1L4A A;  2ITA A;  4C7N A;  2EPO A;  2VAS A;  5AVU B;  1VF5 D;  4YXW H;  2Q9A A;  2IX7 C;  2ZYG A;  1K8A Q;  2ZVN B;  1G5Z A;  1NTM K;  3N7N A;  4BJ5 C;  4U3F D;  1PGP A;  1D0Y A;  1J1E C;  1KZU B;  4XPX A;  1ORS C;  2QG4 A;  4Z1M H;  2XS1 A;  3H1I G;  3TF5 A;  3C9I A;  1T3J A;  3CCU P;  1BCC J;  1AQ5 A;  1HW2 A;  2Y3H A;  4MQ9 F;  3TK1 A;  1O3U A;  2M5A A;  3AGT A;  1P84 E;  1B68 A;  2WQY C;  1PP9 E;  3AG4 C;  3L72 E;  2BCC E;  4GEH A;  1KYO H;  1S5L H;  1A41 A;  5IY5 C;  3ZQV A;  4G7Z F;  1Q0K A;  1VMA A;  2J7P A;  4FES A;  5DVW A;  4LLH A;  2A6H F;  3P8M C;  2WVQ A;  3KDP B;  3V6I A;  1NSG B;  3NXS A;  4MVU A;  3A3Y B;  2AWY A;  4HYT B;  5GPG B;  3BVH A;  4MS2 A;  2Y3D A;  1T6A A;  2XL4 A;  2MWQ A;  5APS A;  3PH0 A;  1JPN A;  2DB4 A;  4W7Y A;  1KOR A;  5A6A A;  1QLE C;  2NRG A;  2Q9B A;  1QVX A;  3AE3 C;  4PJN A;  2XL8 A;  2EIN C;  4RJT A;  4FAP B;  2P1A A;  2L81 A;  4YN0 B;  3L71 D;  2K1A A;  3L74 J;  4Z9H A;  2XRH A;  3U9J A;  3AE6 C;  3ZQY A;  4IB4 A;  1MQV A;  2HFI A;  4QI0 A;  4DT0 A;  2YHS A;  1NJI Q;  2IXP A;  4JCH A;  2HS5 A;  4N6H A;  2YRF A;  2Y0C A;  4AL0 A;  5KYX A;  3NKD A;  4BWN A;  3VP8 A;  2J9U A;  1NOH A;  1M57 D;  1G8X A;  2KGO A;  2SPZ A;  4Q4Z F;  3EG9 B;  2E5Y A;  5AVX B;  2LFD A;  1HGZ A;  1OQC A;  3HJC A;  1KYO E;  1S5L E;  1VQL P;  3EFO B;  1Q82 Q;  2VH3 A;  3KPE A;  1BCC E;  3UIA A;  4IAO A;  4Y28 J;  1LI7 A;  3V4Q A;  3MIW A;  1OCC C;  5KYW A;  2FAP B;  2J46 A;  3FAP B;  1IFN A;  1OX3 A;  4DZO A;  2UUH A;  4MTG A;  1EA8 A;  4RES B;  2QJP C;  2FYU K;  5CBO A;  1IO4 A;  3JYY A;  2OJQ A;  3U0C A;  2I1J A;  1ZLL A;  1C02 A;  4DVZ A;  3JCU H;  4U5F E;  4F4B A;  1BE3 D;  4JTD B;  4H44 C;  3NMD A;  5A6K A;  2CNW A;  1MFZ A;  4OIN F;  1LT1 A;  5L3Q A;  1UIX A;  5KKZ B;  2HMZ A;  2WWW A;  1L7C A;  1N7S D;  3FWN A;  1TKN A;  1M2V B;  3CD6 P;  3T9O A;  2OYH A;  5L0H A;  1FDI A;  3IPM O;  1LVK A;  3AEG C;  2Y3G A;  1PL5 A;  4K3A A;  2LFF A;  3KQG A;  3JZ0 A;  3RGU A;  1OZH A;  3B5N A;  2WMM A;  3L74 E;  2H7H A;  1FJP A;  2NPS B;  3MYF A;  1YA7 O;  1L0L K;  1AJY A;  2J9B A;  2XZR A;  3RYL A;  4MVR A;  4H13 B;  2Q5U A;  2YO2 A;  2ZJS E;  2E76 B;  5E3C A;  3B0P A;  3AE9 C;  1SQQ K;  3H1J G;  2Q00 A;  5T3T A;  3H2V A;  3TOM A;  2FYN C;  1X9V A;  1HW1 A;  3FXE A;  2R7O A;  4I2L C;  3JCU E;  1RJ9 B;  1LM3 B;  2X51 A;  3M15 A;  3LEV A;  1LT9 B;  3L75 G;  3FXH A;  3VRC A;  3U1A A;  1PP9 D;  3L72 D;  2BCC D;  2HPC B;  1QSP A;  2B0H A;  4R32 A;  2NPS D;  2ZXX A;  3JYH A;  3GM1 A;  3PRJ A;  1J8Y F;  3P7K A;  1JTH A;  4O7G A;  4O6Y A;  3VN0 A;  5APU A;  4XE5 B;  3L8I A;  2OYI B;  3CXH H;  5DS6 A;  4XA4 A;  2E76 D;  5AVS B;  4U9E A;  3L0I A;  1GMJ A;  4CDY A;  2WZL A;  1X0T A;  3PCV A;  2WSS H;  1RH5 B;  3ITK A;  2UUI A;  2CDQ A;  2HYN A;  3CLQ A;  5F5H A;  4MVQ A;  2Y3B A;  2R5B A;  3C8G B;  1Z56 A;  4Y99 C;  4PD4 I;  3C63 A;  3GWN A;  3HTK C;  1NU1 G;  4O79 A;  3QTH A;  3SSU A;  3H1I D;  5GTH H;  3A11 A;  3JSE O;  3JSV C;  1VQN P;  4YT2 A;  2HR3 A;  3G3Z A;  2PNO A;  1KB9 I;  5COM A;  5TJ5 E;  3ZG1 A;  2EIJ C;  2KOG A;  3SWK A;  1KYO D;  3G50 A;  4ANJ A;  3LEO A;  1T2K D;  2FGY A;  4E7S A;  1OCZ C;  1R4T A;  1L4A B;  4C7N B;  3IEE A;  1BCC D;  3HUS C;  3U59 A;  2AU5 A;  3MFN A;  1VLS A;  5A6B A;  2CYD A;  4E17 A;  3C8G D;  4JEB A;  4CS7 A;  1YAR O;  2K9Y A;  3CXH E;  3A0H H;  1SMY F;  2YLI A;  3GEH A;  4JEA A;  2QE7 H;  2OG2 A;  1FE6 A;  1YJG A;  3FHD A;  4U5H A;  4X0R A;  1HUC A;  4JBZ A;  2M5A B;  2W45 A;  1PGQ A;  3TJ5 A;  4E18 A;  4G7O F;  2PGD A;  4GOD A;  5BUO A;  1HJB A;  2YL7 A;  5COG A;  1LTI C;  2HV6 A;  3QWO C;  1L0N E;  3C8Z A;  1D1B A;  3JSZ A;  1P84 I;  5H2F H;  5L0J A;  4IRU A;  1KQG B;  2OTK E;  2N9Y B;  1M8O B;  1L4A D;  1L3P A;  3EGD A;  3EQ2 A;  4NPE A;  2LXC B;  4N78 D;  5GTH E;  5JSL A;  3W2W A;  4I44 A;  1NKN A;  1J2J B;  2KIK A;  3UGP A;  5KAF H;  1Q0F A;  1ZHZ A;  3H1H G;  4PFP A;  4Z9I A;  1Q2N A;  1CGM E;  3L74 D;  2A69 F;  3ABV C;  3DMD A;  4JF7 A;  5KJ7 C;  1BGY J;  3OW2 O;  1T6Q A;  3H25 A;  2Y69 C;  1Y6D A;  4JPZ B;  1YTZ I;  1SQX E;  1T6U A;  2J9W A;  4OIO F;  3FVY A;  4AX2 A;  2V3C C;  3A0H E;  1TFK B;  1JCD A;  2HZ8 A;  3HRN A;  4UDV A;  1JY3 P;  4HB1 A;  4EIJ A;  1IFD A;  3S28 A;  5AVV B;  3SXZ A;  2O1K A;  3T97 A;  5KYX B;  1PPJ E;  1ZOY C;  3V5Z A;  4XEK A;  2QM7 A;  3WHN A;  2XSE A;  3DM9 B;  4DBR A;  1NTM J;  2A0B A;  2YKZ A;  4IFM A;  2LKM A;  4IL6 H;  1UFB A;  2GAQ A;  4EUK B;  2JX0 A;  3BRT B;  2HJM A;  4M63 A;  5DQZ A;  1BSH A;  4EBJ A;  1FAP B;  2HSQ A;  1XZP A;  5AW7 B;  2GM4 A;  3CCL P;  1KYO I;  5KYW B;  1SQV K;  1LTJ A;  4Q5S F;  2WSC J;  1L2P A;  3MHV A;  2ZYD A;  2DYR C;  1IK9 A;  2RMZ A;  1EKY A;  3A0B H;  4OGQ C;  1USD A;  5KAF E;  1ZRT E;  2KNH A;  3HLZ A;  3EZI A;  2YLD A;  3HUS A;  2W6J H;  2OEV A;  4CBE A;  3RK3 C;  1A02 J;  2OAR A;  4U3F G;  3GEE A;  5KYY A;  3V2N A;  2WSC H;  1URQ A;  3HNI A;  4L6R A;  4I7Z C;  4D6T J;  2P58 A;  2P2U A;  3GLM A;  2BEQ D;  2XS8 A;  4W80 A;  3HKK A;  3CCS P;  1USE A;  2ETS A;  2WB7 A;  2XLM A;  1BGY E;  3W8H A;  3HE4 A;  1WTY A;  2ZXR A;  4J30 B;  1VB5 A;  3PTZ A;  4YT5 A;  4RDA A;  4DCK A;  1OIP A;  4D6T G;  1RE3 C;  4C7O A;  2Z5H A;  1GM5 A;  2H89 C;  3B5N B;  3PMR A;  2WL8 A;  2R7Q A;  3A5T A;  1S05 A;  1T5O A;  4ZNC A;  1BBH A;  4IL6 E;  4XQ1 A;  3TUL A;  4JRZ A;  4CDA A;  3Q6N A;  5L8R J;  3MBG A;  3DJN B;  2KK7 A;  3VMY A;  3RK2 B;  3IQ5 A;  1SQP K;  2M0B A;  2I15 A;  1NYH A;  1C03 A;  1NTM E;  1LIH A;  3CXH D;  1OXK A;  4JUR I;  4U9D A;  3A0B E;  3X2Q C;  3POV A;  1N7S A;  2GFH A;  4LLC A;  4I1M A;  3CAX A;  3HD7 C;  3U3B A;  1SZI A;  3PLN A;  1R5S A;  2Q4F A;  3SEO A;  1SP4 A;  2KYH A;  1YIT P;  3VAY A;  4CS8 A;  5KLV K;  1KC8 Q;  1N73 A;  2R3C A;  2YLG A;  4PV1 C;  1EDI A;  2FYU J;  2YL1 A;  1YQ3 C;  1DEB A;  4EBK A;  2ZXW C;  1G2C A;  1JTH B;  1H88 A;  1GZL A;  3DJU B;  1KFN A;  3RK2 D;  1LS4 A;  3GHG A;  3H1L J;  1L0N K;  2YVK A;  2R7X A;  2HV7 A;  2R32 A;  1W2B O;  2PAJ A;  4IOI H;  5CI8 A;  1WAT A;  4DVY P;  2KYV A;  4P9F A;  4LAC B;  1G1I A;  2KI7 B;  4NTA A;  3ASN C;  3H1L G;  2P61 A;  3FGA D;  2QE9 A;  2KS1 A;  1HMD A;  2A6E F;  3CCM P;  1VK5 A;  1ORJ A;  4A2N B;  3GF7 A;  3HNK A;  4YPC A;  1NTK K;  2ZT9 B;  1AA0 A;  2WZF A;  1BE3 G;  3JCU Q;  1VQP P;  4JC7 A;  1L0L J;  1RF0 C;  2CPS A;  4H44 B;  2FFD A;  3NMI A;  4LDR A;  2WZ7 A;  1RF1 C;  3U3F A;  1GL2 A;  4NQF A;  1Q7Y Q;  4ULW A;  4MW3 A;  5A69 A;  1M1J A;  1RQU A;  1WMK A;  3HNL A;  3A2A A;  3MZW B;  3OAK A;  1EQ1 A;  1SQQ J;  1FU1 A;  3H2U A;  3FXD A;  1H89 A;  3AG1 C;  1NTZ J;  1KB9 H;  3GOD A;  3ZIB A;  3Q7L A;  3SXK A;  1PV3 A;  2Q1K A;  5KAI H;  2IBF A;  3LIE A;  1TWA A;  1MMA A;  1MKM A;  4P6I C;  3AQB A;  1HBW A;  3GMA A;  1ZRT D;  3V2P A;  4LLE A;  1NTZ G;  1PD1 A;  2FYU E;  5C39 A;  1VQM P;  3J06 A;  2IOQ A;  3CXH I;  3MUD C;  3W67 A;  3W8I A;  4H44 D;  4HH2 A;  4WB4 A;  1A7V A;  3WUU A;  3H1L E;  2QIW A;  3VF0 A;  1TWG A;  4KBL A;  2G3K A;  4WBA A;  3SP1 A;  2YKP A;  1PZQ A;  1RKE A;  3M91 A;  2NSG A;  5AVR B;  1BGY D;  1I4Z A;  3EGD B;  5T3W A;  3DWW A;  5JP7 A;  3NMJ A;  2OQQ A;  1WN0 A;  2YMY A;  2PFX A;  4HE8 D;  1IC2 A;  2J58 A;  2WPS A;  2KXP B;  1EXJ A;  1LNQ A;  4G78 A;  4D4N A;  1L0L E;  1YLM A;  2O1J A;  3Q1M A;  3EQL F;  5KYN A;  2XLW A;  1HVV A;  5KAI E;  3AE8 C;  1RXQ A;  1WOL A;  3IQC A;  1QQ3 A;  1NTM D;  1JAF A;  3NRH A;  4W8P A;  1SQQ E;  2G8Y A;  2QNL A;  1IFI A;  3M06 A;  3T97 B;  4ZKP A;  1JY2 N;  4YL0 A;  2W27 A;  4DRH B;  1M2O A;  1GU4 A;  3ATP A;  3RW0 A;  2FBW C;  1YYC A;  1YIJ P;  1NAF A;  1JY3 O;  1LWU C;  4KNW A;  3I55 P;  3D70 A;  1JMM A;  1EXI A;  1YYX A;  3CQZ A;  1KQS O;  3KZI H;  2L6H A;  1TWC A;  3ZWI A;  4BG0 A;  3AGU A;  4IJJ A;  1LTJ B;  2MKV A;  1MMN A;  3EPV A;  2QJK C;  4EDF A;  1S72 P;  2Q3T A;  2EIK C;  4D6T D;  1U0B B;  1OKK D;  3EFF K;  1KIL C;  4JQ0 D;  1JM0 A;  3EHM A;  1BCC G;  4NPF X;  1W5C E;  4PJM A;  3ECS A;  2JPU A;  3HUS B;  3U1C A;  2H8A A;  3LNM B;  4U5C E;  4JJF A;  2A68 F;  5KYY B;  4CDV A;  1URQ B;  3LES A;  1A0B A;  1ZR4 A;  4PR9 A;  3SXY A;  2LQG A;  4OIQ F;  1ZU5 A;  2W4M A;  4KT0 J;  2R7T A;  2QVA A;  4RBN A;  2WZG A;  3C8V A;  1KNY A;  3HE4 B;  5CCH C;  1J8M F;  3E7K A;  2IZ0 A;  1ZHX A;  3P8C E;  5AVY B;  3I5Q A;  4C7O B;  1ZHY A;  4JKV A;  4IAR A;  2KZI A;  4ZMD A;  1K9M Q;  4IGG A;  1MMD A;  1SR2 A;  1FZC A;  3ZSU A;  3RF3 A;  4N06 A;  4MVZ A;  1A7E A;  3VMX A;  2PFD A;  4HJG H;  2WTY A;  2C0W A;  3KZI E;  1APC A;  2R7S A;  4IFD K;  2ZYA A;  1JOG A;  4QDL A;  3TGU J;  3ZC4 A;  4MTF A;  5APQ A;  1E5W A;  1RCP A;  4BJ6 C;  1URQ D;  2B0J A;  3L74 G;  1WRG A;  1N7S B;  5CMZ A;  4HEA J;  4XTK A;  3D6Y A;  2V4H A;  1PD0 A;  1D0Z A;  2FYU D;  3V5X A;  2JWD A;  2GA0 A;  1FR0 A;  2K3R A;  1SQB K;  4H0L C;  1ZU4 A;  2Q9I A;  1PFI A;  1SQV J;  3RL0 C;  3S9O A;  3KXD A;  1QVG O;  3M0D C;  3H1L D;  1N73 B;  5AVQ B;  2YIU C;  2PBE A;  1GD2 E;  2VRS A;  2G3V A;  2XXA A;  3PP5 A;  3AG2 C;  5AW2 B;  1H6G A;  3Q5S A;  2DW3 A;  3M9B A;  1GK6 A;  1G2C B;  4PD4 D;  3LUT B;  4BJ5 A;  1BDJ B;  1CPR A;  2P67 A;  3RL0 g;  1Q0G A;  3GHG B;  2YMK A;  1FOS E;  1NWQ A;  1G4U S;  2JD3 A;  2CK3 H;  3DZA A;  2W8Z A;  4MVM A;  5KLI C;  1C17 M;  5KJ7 D;  3BAT A;  4NTF A;  2B9B A;  1SLQ A;  1SFC C;  1RQV A;  1XWJ A;  1L0L D;  1IZN B;  1KB9 D;  1YJW P;  2KS1 B;  1AQT A;  4OGQ B;  1YI2 P;  1U7M A;  5APY A;  1ORY A;  5B66 H;  1RE4 C;  3MTU E;  5BQI A;  3RVZ A;  2OOC A;  5BVZ A;  4R4L A;  1MNE A;  4YWQ A;  4WY4 C;  3M4C A;  1SQQ D;  1U89 A;  4MW8 A;  2FFD B;  1HY5 A;  1XTG B;  1UG7 A;  1NTZ D;  2G62 A;  2MJZ A;  1YYJ A;  3TGU E;  1GL2 B;  1SQP J;  3GG2 A;  2WSF J;  4C3D A;  1JMB A;  4PJL A;  1M1J B;  1Q0D A;  2R03 A;  2CW0 F;  2QEX P;  2EPK X; 
#chains in the Genus database with same CATH homology
 3L8I A;  1S5L X;  3H25 A;  3L8J A;  1K05 A;  3RK3 E;  3SFD C;  2E76 D;  4H13 C;  2V7Q J;  3AE2 C;  1GMJ A;  4TT3 H;  1ZZP A;  2O01 J;  4Y28 J;  3LW5 J;  2WPV B;  4IL6 X;  3IAO A;  2E76 C;  4OGQ D;  4YXD C;  2JP3 A;  3IN6 A;  3D6Z A;  1K40 A;  3AED C;  3AEC C;  2G3A A;  1DD4 A;  4I7Z B;  1JOG A;  3C8G B;  1OW8 A;  4XEF A;  2QJY C;  4PV1 C;  1ZOY C;  2E74 D;  2QJP C;  2LK4 A;  2OQQ A;  1YQ3 C;  4XEK A;  3AEF C;  2E75 B;  1IK7 A;  3RQG A;  3JYY A;  4EBK A;  1VF5 D;  4YTP C;  3U0C A;  3AE5 C;  1EXJ A;  1OMI A;  3AEE C;  2J5U A;  2L6G A;  2D2C C;  4H44 C;  3Q1M A;  4H0L D;  3D6Y A;  1UFB A;  4XEV A;  1VF5 C;  1S1C X;  2FXP A;  2IDB A;  2QSI A;  3BRJ A;  3C18 A;  2JX0 A;  3AEB C;  2BEZ F;  2JO1 A;  4Z1M H;  1UIX A;  1FDO A;  1V4A A;  3AE8 C;  2YWA A;  4H0L C;  3Q3D A;  1WOL A;  3RQE A;  1VL2 A;  4EBJ A;  1PIX A;  1O3U A;  1KQF B;  3S9O A;  3D71 A;  1R8E A;  2WSC J;  2H88 C;  1FDI A;  2G8Y A;  2YIU C;  2PBE A;  2WQY C;  5M1B A;  4OGQ C;  3AEA C;  3FGA D;  1U57 A;  1ZRT E;  3AEG C;  2P10 A;  3R4Y A;  3T97 B;  1PL5 A;  3Q5P A;  3Q5S A;  3RQF A;  3AE7 C;  3MFN A;  3GF7 A;  2FBW C;  3JZ0 A;  1OW6 A;  3O6Q A;  2E74 C;  2ZT9 B;  3Q5R A;  3C8G D;  3Q2Y A;  2L6F A;  2K9Y A;  3RL0 g;  3D70 A;  1DD3 A;  2YMK A;  1AJY A;  1HJ0 A;  4GDO A;  2E75 D;  4H44 B;  1EXI A;  5F28 E;  1ZP0 C;  2KK1 A;  3G9R A;  4I7Z C;  4H13 B;  1KMI Z;  3AE4 C;  2L6H A;  5KLI C;  2ZT9 D;  3U3F A;  4NQF A;  3GLM A;  2BEQ D;  1RQV A;  2E76 B;  1RQU A;  2MKV A;  1WMK A;  1KOR A;  1K04 A;  3GM2 A;  3O10 A;  1JB0 J;  1YQ4 C;  3AE9 C;  1NGM B;  4H13 D;  2QJK C;  1QVX A;  1WTY A;  3GM3 A;  3AE3 C;  2Q00 A;  2FYN C;  1DIP A;  3AJM A;  4PV1 B;  4OGQ B;  3EWK A;  1TU3 F;  2NZ2 A;  1PV3 A;  3AE1 C;  2JPU A;  5KKZ C;  2H89 C;  1WWP A;  1KQG B;  4R4L A;  4RKU J;  3K7D A;  2E74 B;  3AE6 C;  2HSB A;  4XFJ A;  2D2C B;  4U7J A;  4PV1 D;  1MKM A;  1Q90 D;  1VF5 B;  3TUL A;  1Y9B A;  3GMA A;  5L8R J;  3C8G A;  4R32 A;  4R4M A;  2E75 C;  1OW7 A;  3GF3 A;  4H0L B;  2WSF J;  4KT0 J;  3GM1 A;  1HF9 A;  2D2C D;  1KTM A;  4H44 D;  1ZME C;  1NYH A;  2WSE J;  3ABV C;  3B71 A;  2ZT9 C;  3SFE C;  3C8V A;  1KNY A;  1KIL E;  2QIW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...