2XLHA

Reduced structure of r124a mutant of cytochrome c' from alcaligenes xylosoxidans
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
126
structure length
125
Chain Sequence
EFAPEDAVKYRQSALTLMASHFGRMTPVVKGQAPYDAAQIKANVEVLKTLSALPWAAFGPGTEGGDARPEIWSDAASFKQKQQAFQDNIVKLSAAADAGDLDKLRAAFGDVGASCKACHDAYAKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords CYTOCHROME C'
publication title Distal-to-Proximal No Conversion in Hemoproteins: The Role of the Proximal Pocket.
pubmed doi rcsb
source organism Achromobacter xylosoxidans
total genus 51
structure length 125
sequence length 126
ec nomenclature
pdb deposition date 2010-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01322 Cytochrom_C_2 Cytochrome C'
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 2xlhA00
5JLIA 3ZTMA 4WGZA 1BBHA 3QVYA 4NC3A 3QW1A 4JE9A 4CDAA 1CGNA 2BC5A 4CDVA 5JRAA 2YL3A 4D4NA 4ULVA 5AGFA 5JUAA 5JVEA 2QLAA 1E85A 1M6TA 2YLDA 3U8PA 256BA 2XM0A 3FOOA 1QPUA 4D4XA 1YZCA 2XLVA 3M4BA 4N4WA 1E83A 1GQAA 3DE9A 2J9BA 4CJOA 4U9DA 3ZWIA 2XLDA 3HNLA 4CJGA 4ER9A 4WGYA 1E84A 1NBBA 1CPQA 3L1MA 4CDYA 5JP7A 2YKZA 2YL0A 3VRCA 3M79A 1A7VA 3NMKA 1YYJA 3TOLA 4IAQA 2J8WA 3ZTZA 2XLOA 1RCPA 3M15A 1LM3B 2XM4A 3C62A 3HNJA 4IB4A 1APCA 1CPRA 2XL8A 1EKYA 4JEBA 3NMJA 1MQVA 4L6RA 3DE8A 4CX9A 3ZQYA 2XLMA 3ZQVA 4EIYA 4JEAA 5JSLA 2XLEA 2XLWA 4CIPA 4JKVA 4U9EA 3QVZA 2YLIA 3FOPA 3TOMA 3HNIA 1CGOA 3IQ5A 5B3IA 2XLHA 1S05A 1JAFA 2CCYA 3M4CA 2YLGA 2YL1A 3NMIA 1YYXA 3IQ6A 4N6HA 1E86A 1QQ3A 5JS5A 2XL6A 4IARA 3QW0A 3HNKA 1YZAA 3C63A 2YL7A 5JT4A
chains in the Genus database with same CATH superfamily
1Q0FA 5L0DA 3ABMC 3FAJA 3ZIBA 2IYLD 3K6BA 4WGZA 5DQTA 2P7VA 4N06A 1FR0A 2UUHA 4NTBA 3JSEO 3TULA 1JR8A 3AG1C 4C3DA 4IRUA 4CS9C 2AU5A 3L34A 2P0NA 4AE4B 4RDAA 1CGNA 2UUIA 1EA8A 1QLEC 2CNWD 2OKUA 5KYNA 2YL3A 1YARO 3CZ6A 4ULVA 2A68F 5AGFA 5AC5A 2EPMX 3L0IA 1Z23A 2JD3A 1UFBA 4KNVA 2QY9A 2QLAA 2EPKX 4W8KA 2OU6A 3EGXB 2J45A 4EWCA 2NUPA 3DM5A 1E85A 1R5ID 1V74B 256BA 1VMAA 4G7HF 4MVSA 2KK1A 5HV9A 2VCCA 2B0JA 3EZHA 3JYHA 3TQOA 1Z63A 2KSFA 3NYLA 3SNHA 2XXAA 2WVNA 1T6UA 2KQ9A 3KMIA 1SR2A 1E83A 1ST6A 1GS9A 3POVA 1NU7D 3DE9A 1OR2A 2IBFA 2Q4FA 3ATPA 1I4YA 2I15A 2W4BA 1RKCA 4CJOA 4DVZA 4EBBA 2V3CC 3SXZA 5BQIA 1FNTc 1R4TA 3ZC4A 1PD1A 1RJ9B 3GM1A 3S90A 2MHRA 3EJNA 2H7BA 2CNWA 2A0UA 2R9RB 1CPQA 3SXMA 4CDYA 3LLKA 2D5RB 2R03A 3ABKC 3GEEA 2L6GA 3KYIA 4Z9HA 3JT1A 1OCRC 2EPNA 4YN0B 1QVXA 2A1DD 1SZIA 3RQGA 2YHSA 4O7GA 2JPUA 2KYHA 1SMYF 3ASOC 2J8WA 3C8GD 4BPMA 5A69A 2XLOA 3NG1A 4JTCB 2WVOA 1LI7A 1RKEB 2PX0A 3B71A 4LDKA 4YL3A 1LM3B 3VF0A 2XM4A 4AK9A 2O9XA 4DRIB 1CPRA 1Q0KA 2XL8A 2FFHA 1F1MA 1OCCC 1V55C 2QE9A 3JCUQ 3AG2C 4YJWA 2RD9A 4U5BE 2R7XA 3E9VA 1BR2A 1H9GA 2HS5A 1WWPA 4IJJA 1JPJA 2R25A 4OD5A 3RQEA 3V7OA 1YVIA 3EQLF 2TMVP 1MMAA 1OXBA 3DE8A 1LPEA 4EKWA 1D0YA 2KJGA 2ZXPA 4GYTA 4RD9A 3EG9A 1OQCA 2Z15A 1K05A 2VC9A 5BQHA 1U0BB 2YRFA 3NYMA 3ZG1A 3NKEA 3CSKA 1YLMA 4JRZA 2H8AA 3UMIA 4CIPA 3DI5A 3RF3A 3RFYA 4BJTA 1ZHZA 3MBGA 2H7VC 3KL4A 5K0IA 4JCHA 3MYIA 4UDVA 2YLIA 3C8GA 1D1AA 1NSGB 1JRAA 2HMZA 1ORSC 2J46A 2IOQA 3JZ0A 3GORA 3M1CB 4MW8A 3W2VA 1RJ9A 1O87A 1O3UA 1Q0MA 2HSQA 3C8ZA 3K1HA 2R7QA 3RVYA 4DRHB 4YT8A 2V26A 5A6BD 1Y4CA 3FXHA 4E0HA 2G3VA 1JAFA 4LACB 4ZLCA 1FFHA 2YL1A 3NMIA 2HZ8A 3O55A 3AGTA 4EBJA 2IXMA 5COFA 3RW0A 2R7RA 3DWWA 1QQ3A 2HKVA 4MVZA 1BZ4A 1DOVA 4U5GA 2R7SA 3MLGA 2MYSA 3AOUA 1I5NA 3L8IA 4CIHA 4JTDB 4MVRA 3R2PA 2I8BA 4CBEA 4J32B 1LIHA 1FTSA 5DQZA 5JS5A 3N2ZB 4RBNA 2XL6A 4IARA 4QI2A 3QW0A 1OKKD 1YZAA 1OR3A 1M57C 3G4XA 3N24A 3C63A 3NYJA 4U9EA 1OW6A 4BG0A 4NY3A 1YJGA 4NQFA 4OIRF 4BJ6C 3F47A 1YAUO 1AEPA 3QVYA 1ORYA 2GWWA 2BE5F 4JE9A 1OXKA 4HEAJ 4WJ0A 3UMKA 4CDAA 5FCLA 2EIKC 1WN0A 5E3AA 3ZVRA 2XXAB 2WL8A 2FAPB 1UG7A 3I4UA 4LDQA 1LVKA 5A6BA 1EQ1A 2WZFA 3DAGA 4MS2A 2BC5A 1ZU4A 4XQ1A 5JRAA 5KYWB 4D4NA 1V4AA 5L0FA 1LI5A 2CDQA 2EILC 1VLTA 5E3CA 4LERA 1A7DA 1D1BA 2Y39A 3GEHA 1M6TA 4E7ZA 3AQBA 1TR2A 2M64A 1T9KA 1DOWA 3FOOA 4XPWA 3UGPA 4OIPF 4YT5A 4G7ZF 2P61A 2ZD9A 3JRTA 3PHF2 1MNDA 2DB4A 2D4UA 4JJGA 1ZHXA 1YZCA 4E18A 1OKKA 3UGOA 1LKXA 2LQGA 4BEMJ 4OIOF 3OWTA 3PCVA 3AG3C 4OIQF 3X2QC 4DOZA 1L7CA 3C18A 5L0IA 2HSBA 3O10A 2Y69C 3FVYA 2L6FA 4XPYA 1TFKB 4ONSA 3ZWIA 4PACA 1Y6DA 3U8VA 2Q9AA 1ZHWA 3HNLA 3DMDA 4MVUA 1RXQA 1ZVZA 1HY5A 1SF8A 2P1AA 3K7DA 4LDRA 4B6IA 4ER9A 2LCHA 2MWQA 5DS5A 2BL2A 2Y3BA 4YL0A 2DI3A 3K33A 3UNGC 2VB6A 1W2WA 3EPVA 3NMKA 4G0HA 2HV6A 4WABA 1YYJA 3H65A 2PX3A 1KNYA 1ORJA 2A0BA 1FFTC 3EG9B 1XWJA 3ZTZA 1RCPA 4FWVA 4K0DA 1Q0GA 3FAPB 2HJ3A 1HW1A 4FESA 4Q4ZF 3HNJA 4MVQA 3U0CA 1EKYA 5KYWA 4G7OF 1T5OA 1G8XA 5B1BC 3C8GB 4KBLA 3US6A 2OQMA 3A11A 3HTKC 1OCZC 4L6RA 5CIVA 4PFPA 3TJ6A 1Q0DA 4FAPB 1A41A 2XLMA 2M4EA 3LNRA 3ZQVA 3B29A 3JYYA 3EH2A 4M63A 4U5CE 5JSLA 1FMWA 2XLEA 2XLWA 3R7CA 4C3BA 3UMHA 3GM2A 4R32A 4JJFA 4JKVA 2XSEA 3HKKA 1FAPB 5F5FA 3QVZA 5KYXA 1QSPA 3WAQA 3I5QA 2XRHA 3V5XA 4AL0A 5DVWA 2LFFA 4I1OB 3NKDA 4XTKA 5DS4A 3TOMA 5DLJA 2DYRC 1CGOA 1VB5A 5EHHA 1M2OA 3EFOA 1T01A 3VAYA 2R7OA 1I4ZA 2Y3DA 2QTVA 3T6BA 1WASA 1RMVA 3WODF 2XLHA 4DRJB 3GWLA 1D1CA 4JTAB 3GWNA 1ZZPA 3ABLC 2VASA 4QI0A 4BJ5A 4EHPA 5COGA 3IQ6A 1OW7A 1ZHYA 2JX0A 4LLEA 1IW7F 2Q00A 3U3FA 2QUPA 2OCCC 3F46A 1KTMA 2J9VA 4J7TA 2X51A 3G4ZA 5EGYA 2CYDA 3KPHA 4HE8D 4LLCA 2X0CA 1S7ZA 3HNKA 2H7OA 1J8YF 3BEHA 2NSGA 4J7YA 5FZTA 3K1IA 4XLPF 2Q3TA 2YL7A 4KNWA 5JT4A 5IY5C 4JIOA 3BRJA 5GPGB 5JLIA 3ZTMA 1BBHA 2OJED 3MX3A 1VYIA 3QW1A 4Q7CA 3SYNA 1MMDA 1NU9C 4XEFA 4PJJA 2Q7RA 3AQCA 2IM8A 3IPMO 4DXWA 4YT4A 1M2VB 5KYYA 4CDVA 2C04A 3S28A 2OG2A 5JUAA 1MMGA 1ZHTA 2RSEB 3A9CA 3W4YA 3PMRA 3X1OA 3O39A 3H2UA 2P6VA 2HFIA 1U6HA 2LK4A 2XM0A 3IQCA 3RH3A 3U3BA 4C7OA 2Y3GA 1QPUA 4IWBA 3S29A 4D4XA 2YZSA 3O6XA 5B3SC 2WVQA 1TFOB 2YQYA 3CEXA 3M4BA 4GQHA 4MTFA 4O79A 1C03A 4I44A 2F22A 5KYUA 1VK5A 3HLZA 3Q6MA 2XS8A 3W2WA 1TWCA 3DD7A 3T6GB 1VLSA 3GM3A 4YK5A 1VTMP 4U9DA 1TWHA 2XLDA 4JC7A 1IZMA 2KNHA 2PBEA 5A6AA 2IXOA 2DYSC 2FGYA 2J0XA 4CJGA 1BR1A 5COMA 3TK0A 4CS8A 1KU2A 1E84A 1NBBA 3L1MA 3EZIA 3ZDLA 1GM5A 3J06A 2YKZA 2YL0A 4I1MA 4BJ5C 1A0BA 3Q7LA 4BJ6A 4XPXA 3VRCA 3M79A 5HSWA 1QZXA 1A7VA 1G4US 3E70C 3IQTA 1LS1A 4DVYP 3LS0A 2KC3A 3WHNA 1Z6AA 2LIGA 2A6EF 2EIMC 2ZPAA 3QTHA 2EINC 3M15A 3ASNC 4EUKB 1D0XA 3ITFA 1H9TA 2LSEA 3NDBB 2DGJA 4JW1A 3LEOA 3LAYA 2OEVA 4IB4A 1Z3IX 4PK4A 5E33A 1M2VA 1PV3A 3ZSUA 5KYXB 2PP4A 3EHNA 3HJCA 3K1IC 5CI9A 2NUTA 1NFOA 4N6CA 3JSZA 3MFNA 1TQGA 1WGWA 3DKAA 4MVMA 3SXKA 2NPUA 3NMJA 4I3MA 1M56C 1XZQA 2VH3A 4P9FA 4XWJA 3EFOB 2EIJC 2EPOA 3LNMB 4XEVA 4NTAA 3SXYA 3ZQYA 4PJNA 2B0HA 4DBRA 1A7EA 3EH1A 2VCAA 4JEAA 3H2VA 3S9OA 4ZLDA 3ECSA 2Q9BA 3QMKA 3RYLA 3Q7GA 1O5HA 3DM9B 3RQFA 1JMWA 3DJUB 3U2LA 1NG1A 3S0XA 2LD6A 3EGDA 3JRMO 5L3QA 1NLXA 1V54C 4Q5SF 2IXNA 2KW3C 3U9JA 3OEOA 1QKRA 5CI8A 1H7IA 3U9MA 5B3IA 2HMQA 4ULWA 4QDLA 2PFDA 1JOGA 3FHDA 1T6QA 1S05A 4J30B 3M4CA 2YLGA 1EI7A 2G3KA 4N6HA 2R05A 5T3WA 1J8MF 5B1AC 1OW8A 2L9JA 4PJMA 3DXJF 2AP3A 3SEOA 2GFHA 2HV7A 2OOCA 2VCBA 1G4WR 3IEEA 2W4MA 2C03A 1PCXA 1XZPA 2W45A 3FMSA 3TD7A 4CS8C 5KYYB 3JTLO 1MMNA 4FX5A 3OA1A 4A4AA 2GDCA 3LLIA 2R02A 2YVKA 4YT2A 1OCOC 2J7PD 4F4BA 3SZRA 3GEIA 3C7JA 4NTFA 2AVKA 3TJ5A 4W8PA 4U5HA 4AX2A 2ZXOA 3NRHA 2Q9CA 3L8JA 1WTYA 4NC3A 3RIPA 3GANA 3T6JA 4PFOA 4C7OB 3PDMP 3QZCA 1U89A 2G62A 2OJQA 2PNOA 4NCQA 5T3TA 4E0IA 3UR3C 2R7WA 1L3PA 4Z9IA 2E87A 5KYUB 2ICWG 5BUOA 3T9OA 5A6KA 4DJ9A 2ETSA 2R7TA 1NFNA 5BQGA 1HE1A 3V5YA 5JVEA 2NG1A 3SP1A 3K66A 3CAXA 3LJBA 1GGQA 2YLDA 2HUJA 1AVOB 3U8PA 4IAOA 4BJ1A 1AUEA 4MQ9F 4U5FE 3B0VC 4OINF 1C17M 1LE2A 2OEXA 1ZYRF 4HFFB 4YWQA 1TWGA 3KH2A 4E17A 2XLVA 2XL4A 4N4WA 1LE4A 3N0TA 4AE4A 1H6GA 1K40A 2J7PA 4P9TA 1G5ZA 2L6HA 2WZGA 1GQAA 2LFDA 3AG4C 3KYJA 4G78A 4MTOA 2J9BA 4BEJA 2L7AA 2YWAA 2Y3HA 2YEVA 4XEKA 1YA9A 5A6JA 3B0PA 2ZXRA 4Z9JA 3S84A 3EGXA 3DAFA 3VM6A 2KGOA 3B9QA 4O6NA 1HE9A 1TWAA 3LESA 2A6HF 4IGGA 5D91A 4GEHA 4WGYA 2R7VA 4U5DE 4DBQA 2W9YA 2NUTB 1CGME 2NSFA 2EPLX 3DJNB 5JP7A 4CSAA 2R7UA 1PD0A 3U2MA 1HMOA 2HJMA 2GA0A 2ZXWC 2J9WA 4K7BA 1FMVA 3CQZA 3IHUA 1B68A 3TOLA 4IAQA 2QNLA 1D0ZA 1K04A 3LEVA 2J9UA 1HMDA 4CS9A 4JCZA 4X0RA 3C62A 4PJLA 1APCA 4CS7A 1LS4A 1SYQA 2LP4A 4YL1A 3WG7C 1HW2A 3B0UX 1ZU5A 4JEBA 3EGDB 4XLNF 4KI2A 2XS1A 2AWCA 4JURI 1MQVA 5DS6A 1WATA 1C02A 1NZEA 3GODA 4ANJA 2CGEA 4O6MA 3U5SA 5L3VA 5T1DB 3FDQA 3W8IA 4CX9A 4EIYA 4KC9A 3LUTB 1RKEA 1TKNA 1YDIA 3V5ZA 3KKBA 5EK0A 1YA7O 3VYWA 4O6YA 2NUPB 1E2XA 3I5PA 1Z5ZA 3MYFA 3RKOF 3FOPA 3S27A 5F5HA 4C3EA 3AGUA 5F28E 3W8HA 3HNIA 5L0CA 3G50A 3IQ5A 5E2QA 2ASRA 2J0WA 1N1CA 1MNEA 4H54A 1VOMA 5L0JA 1ZW3A 3AJMA 5L0GA 2L81A 4AL1A 4A2NB 2CCYA 3RVZA 5L0HA 2PF4E 1VYKA 1YYXA 1WOLA 3DZAA 5TJ5E 3T4RA 4E7SA 3EHMA 1E86A 1T6IA 4MNDA 4HFKB 4MTGA 4PR9A 4H4KC 1BR4A 3Q6NA 4K1OA 4MW3A 1ZW2A 4JZAA 4OD4A 5D92A 1Z7Qc 2AWYA 2CW0F 3LS1A 5AC4A 2A69F 4MVOA 4EBKA 2GAQA 1JPNA 2WZLA 1BDJB 2IXPA 4JVSA 4P6IC 4CSAC 4U5EE 2WB7A
chains in the Genus database with same CATH topology
5JLIA 3ZTMA 4WGZA 1BBHA 3QVYA 4NC3A 3QW1A 4JE9A 4CDAA 1CGNA 2BC5A 4CDVA 5JRAA 2YL3A 4D4NA 4ULVA 5AGFA 5JUAA 5JVEA 2QLAA 1E85A 1M6TA 2YLDA 3U8PA 256BA 2XM0A 3FOOA 1QPUA 4D4XA 1YZCA 2XLVA 3M4BA 4N4WA 1E83A 1GQAA 3DE9A 2J9BA 4CJOA 4U9DA 3ZWIA 2XLDA 3HNLA 4CJGA 4ER9A 4WGYA 1E84A 1NBBA 1CPQA 3L1MA 4CDYA 5JP7A 2YKZA 2YL0A 3VRCA 3M79A 1A7VA 3NMKA 1YYJA 3TOLA 4IAQA 2J8WA 3ZTZA 2XLOA 1RCPA 3M15A 1LM3B 2XM4A 3C62A 3HNJA 4IB4A 1APCA 1CPRA 2XL8A 1EKYA 4JEBA 3NMJA 1MQVA 4L6RA 3DE8A 4CX9A 3ZQYA 2XLMA 3ZQVA 4EIYA 4JEAA 5JSLA 2XLEA 2XLWA 4CIPA 4JKVA 4U9EA 3QVZA 2YLIA 3FOPA 3TOMA 3HNIA 1CGOA 3IQ5A 5B3IA 2XLHA 1S05A 1JAFA 2CCYA 3M4CA 2YLGA 2YL1A 3NMIA 1YYXA 3IQ6A 4N6HA 1E86A 1QQ3A 5JS5A 2XL6A 4IARA 3QW0A 3HNKA 1YZAA 3C63A 2YL7A 5JT4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JLI A;  3ZTM A;  4WGZ A;  1BBH A;  3QVY A;  4NC3 A;  3QW1 A;  4JE9 A;  4CDA A;  1CGN A;  2BC5 A;  4CDV A;  5JRA A;  2YL3 A;  4D4N A;  4ULV A;  5AGF A;  5JUA A;  5JVE A;  2QLA A;  1E85 A;  1M6T A;  2YLD A;  3U8P A;  256B A;  2XM0 A;  3FOO A;  1QPU A;  4D4X A;  1YZC A;  2XLV A;  3M4B A;  4N4W A;  1E83 A;  1GQA A;  3DE9 A;  2J9B A;  4CJO A;  4U9D A;  3ZWI A;  2XLD A;  3HNL A;  4CJG A;  4ER9 A;  4WGY A;  1E84 A;  1NBB A;  1CPQ A;  3L1M A;  4CDY A;  5JP7 A;  2YKZ A;  2YL0 A;  3VRC A;  3M79 A;  1A7V A;  3NMK A;  1YYJ A;  3TOL A;  4IAQ A;  2J8W A;  3ZTZ A;  2XLO A;  1RCP A;  3M15 A;  1LM3 B;  2XM4 A;  3C62 A;  3HNJ A;  4IB4 A;  1APC A;  1CPR A;  2XL8 A;  1EKY A;  4JEB A;  3NMJ A;  1MQV A;  4L6R A;  3DE8 A;  4CX9 A;  3ZQY A;  2XLM A;  3ZQV A;  4EIY A;  4JEA A;  5JSL A;  2XLE A;  2XLW A;  4CIP A;  4JKV A;  4U9E A;  3QVZ A;  2YLI A;  3FOP A;  3TOM A;  3HNI A;  1CGO A;  3IQ5 A;  5B3I A;  2XLH A;  1S05 A;  1JAF A;  2CCY A;  3M4C A;  2YLG A;  2YL1 A;  3NMI A;  1YYX A;  3IQ6 A;  4N6H A;  1E86 A;  1QQ3 A;  5JS5 A;  2XL6 A;  4IAR A;  3QW0 A;  3HNK A;  1YZA A;  3C63 A;  2YL7 A;  5JT4 A; 
#chains in the Genus database with same CATH topology
 1Q0F A;  5L0D A;  3ABM C;  3FAJ A;  3ZIB A;  2IYL D;  3K6B A;  4WGZ A;  5DQT A;  2P7V A;  4N06 A;  1FR0 A;  2UUH A;  4NTB A;  3JSE O;  3TUL A;  1JR8 A;  3AG1 C;  4C3D A;  4IRU A;  4CS9 C;  2AU5 A;  3L34 A;  2P0N A;  4AE4 B;  4RDA A;  1CGN A;  2UUI A;  1EA8 A;  1QLE C;  2CNW D;  2OKU A;  5KYN A;  2YL3 A;  1YAR O;  3CZ6 A;  4ULV A;  2A68 F;  5AGF A;  5AC5 A;  2EPM X;  3L0I A;  1Z23 A;  2JD3 A;  1UFB A;  4KNV A;  2QY9 A;  2QLA A;  2EPK X;  4W8K A;  2OU6 A;  3EGX B;  2J45 A;  4EWC A;  2NUP A;  3DM5 A;  1E85 A;  1R5I D;  1V74 B;  256B A;  1VMA A;  4G7H F;  4MVS A;  2KK1 A;  5HV9 A;  2VCC A;  2B0J A;  3EZH A;  3JYH A;  3TQO A;  1Z63 A;  2KSF A;  3NYL A;  3SNH A;  2XXA A;  2WVN A;  1T6U A;  2KQ9 A;  3KMI A;  1SR2 A;  1E83 A;  1ST6 A;  1GS9 A;  3POV A;  1NU7 D;  3DE9 A;  1OR2 A;  2IBF A;  2Q4F A;  3ATP A;  1I4Y A;  2I15 A;  2W4B A;  1RKC A;  4CJO A;  4DVZ A;  4EBB A;  2V3C C;  3SXZ A;  5BQI A;  1FNT c;  1R4T A;  3ZC4 A;  1PD1 A;  1RJ9 B;  3GM1 A;  3S90 A;  2MHR A;  3EJN A;  2H7B A;  2CNW A;  2A0U A;  2R9R B;  1CPQ A;  3SXM A;  4CDY A;  3LLK A;  2D5R B;  2R03 A;  3ABK C;  3GEE A;  2L6G A;  3KYI A;  4Z9H A;  3JT1 A;  1OCR C;  2EPN A;  4YN0 B;  1QVX A;  2A1D D;  1SZI A;  3RQG A;  2YHS A;  4O7G A;  2JPU A;  2KYH A;  1SMY F;  3ASO C;  2J8W A;  3C8G D;  4BPM A;  5A69 A;  2XLO A;  3NG1 A;  4JTC B;  2WVO A;  1LI7 A;  1RKE B;  2PX0 A;  3B71 A;  4LDK A;  4YL3 A;  1LM3 B;  3VF0 A;  2XM4 A;  4AK9 A;  2O9X A;  4DRI B;  1CPR A;  1Q0K A;  2XL8 A;  2FFH A;  1F1M A;  1OCC C;  1V55 C;  2QE9 A;  3JCU Q;  3AG2 C;  4YJW A;  2RD9 A;  4U5B E;  2R7X A;  3E9V A;  1BR2 A;  1H9G A;  2HS5 A;  1WWP A;  4IJJ A;  1JPJ A;  2R25 A;  4OD5 A;  3RQE A;  3V7O A;  1YVI A;  3EQL F;  2TMV P;  1MMA A;  1OXB A;  3DE8 A;  1LPE A;  4EKW A;  1D0Y A;  2KJG A;  2ZXP A;  4GYT A;  4RD9 A;  3EG9 A;  1OQC A;  2Z15 A;  1K05 A;  2VC9 A;  5BQH A;  1U0B B;  2YRF A;  3NYM A;  3ZG1 A;  3NKE A;  3CSK A;  1YLM A;  4JRZ A;  2H8A A;  3UMI A;  4CIP A;  3DI5 A;  3RF3 A;  3RFY A;  4BJT A;  1ZHZ A;  3MBG A;  2H7V C;  3KL4 A;  5K0I A;  4JCH A;  3MYI A;  4UDV A;  2YLI A;  3C8G A;  1D1A A;  1NSG B;  1JRA A;  2HMZ A;  1ORS C;  2J46 A;  2IOQ A;  3JZ0 A;  3GOR A;  3M1C B;  4MW8 A;  3W2V A;  1RJ9 A;  1O87 A;  1O3U A;  1Q0M A;  2HSQ A;  3C8Z A;  3K1H A;  2R7Q A;  3RVY A;  4DRH B;  4YT8 A;  2V26 A;  5A6B D;  1Y4C A;  3FXH A;  4E0H A;  2G3V A;  1JAF A;  4LAC B;  4ZLC A;  1FFH A;  2YL1 A;  3NMI A;  2HZ8 A;  3O55 A;  3AGT A;  4EBJ A;  2IXM A;  5COF A;  3RW0 A;  2R7R A;  3DWW A;  1QQ3 A;  2HKV A;  4MVZ A;  1BZ4 A;  1DOV A;  4U5G A;  2R7S A;  3MLG A;  2MYS A;  3AOU A;  1I5N A;  3L8I A;  4CIH A;  4JTD B;  4MVR A;  3R2P A;  2I8B A;  4CBE A;  4J32 B;  1LIH A;  1FTS A;  5DQZ A;  5JS5 A;  3N2Z B;  4RBN A;  2XL6 A;  4IAR A;  4QI2 A;  3QW0 A;  1OKK D;  1YZA A;  1OR3 A;  1M57 C;  3G4X A;  3N24 A;  3C63 A;  3NYJ A;  4U9E A;  1OW6 A;  4BG0 A;  4NY3 A;  1YJG A;  4NQF A;  4OIR F;  4BJ6 C;  3F47 A;  1YAU O;  1AEP A;  3QVY A;  1ORY A;  2GWW A;  2BE5 F;  4JE9 A;  1OXK A;  4HEA J;  4WJ0 A;  3UMK A;  4CDA A;  5FCL A;  2EIK C;  1WN0 A;  5E3A A;  3ZVR A;  2XXA B;  2WL8 A;  2FAP B;  1UG7 A;  3I4U A;  4LDQ A;  1LVK A;  5A6B A;  1EQ1 A;  2WZF A;  3DAG A;  4MS2 A;  2BC5 A;  1ZU4 A;  4XQ1 A;  5JRA A;  5KYW B;  4D4N A;  1V4A A;  5L0F A;  1LI5 A;  2CDQ A;  2EIL C;  1VLT A;  5E3C A;  4LER A;  1A7D A;  1D1B A;  2Y39 A;  3GEH A;  1M6T A;  4E7Z A;  3AQB A;  1TR2 A;  2M64 A;  1T9K A;  1DOW A;  3FOO A;  4XPW A;  3UGP A;  4OIP F;  4YT5 A;  4G7Z F;  2P61 A;  2ZD9 A;  3JRT A;  3PHF 2;  1MND A;  2DB4 A;  2D4U A;  4JJG A;  1ZHX A;  1YZC A;  4E18 A;  1OKK A;  3UGO A;  1LKX A;  2LQG A;  4BEM J;  4OIO F;  3OWT A;  3PCV A;  3AG3 C;  4OIQ F;  3X2Q C;  4DOZ A;  1L7C A;  3C18 A;  5L0I A;  2HSB A;  3O10 A;  2Y69 C;  3FVY A;  2L6F A;  4XPY A;  1TFK B;  4ONS A;  3ZWI A;  4PAC A;  1Y6D A;  3U8V A;  2Q9A A;  1ZHW A;  3HNL A;  3DMD A;  4MVU A;  1RXQ A;  1ZVZ A;  1HY5 A;  1SF8 A;  2P1A A;  3K7D A;  4LDR A;  4B6I A;  4ER9 A;  2LCH A;  2MWQ A;  5DS5 A;  2BL2 A;  2Y3B A;  4YL0 A;  2DI3 A;  3K33 A;  3UNG C;  2VB6 A;  1W2W A;  3EPV A;  3NMK A;  4G0H A;  2HV6 A;  4WAB A;  1YYJ A;  3H65 A;  2PX3 A;  1KNY A;  1ORJ A;  2A0B A;  1FFT C;  3EG9 B;  1XWJ A;  3ZTZ A;  1RCP A;  4FWV A;  4K0D A;  1Q0G A;  3FAP B;  2HJ3 A;  1HW1 A;  4FES A;  4Q4Z F;  3HNJ A;  4MVQ A;  3U0C A;  1EKY A;  5KYW A;  4G7O F;  1T5O A;  1G8X A;  5B1B C;  3C8G B;  4KBL A;  3US6 A;  2OQM A;  3A11 A;  3HTK C;  1OCZ C;  4L6R A;  5CIV A;  4PFP A;  3TJ6 A;  1Q0D A;  4FAP B;  1A41 A;  2XLM A;  2M4E A;  3LNR A;  3ZQV A;  3B29 A;  3JYY A;  3EH2 A;  4M63 A;  4U5C E;  5JSL A;  1FMW A;  2XLE A;  2XLW A;  3R7C A;  4C3B A;  3UMH A;  3GM2 A;  4R32 A;  4JJF A;  4JKV A;  2XSE A;  3HKK A;  1FAP B;  5F5F A;  3QVZ A;  5KYX A;  1QSP A;  3WAQ A;  3I5Q A;  2XRH A;  3V5X A;  4AL0 A;  5DVW A;  2LFF A;  4I1O B;  3NKD A;  4XTK A;  5DS4 A;  3TOM A;  5DLJ A;  2DYR C;  1CGO A;  1VB5 A;  5EHH A;  1M2O A;  3EFO A;  1T01 A;  3VAY A;  2R7O A;  1I4Z A;  2Y3D A;  2QTV A;  3T6B A;  1WAS A;  1RMV A;  3WOD F;  2XLH A;  4DRJ B;  3GWL A;  1D1C A;  4JTA B;  3GWN A;  1ZZP A;  3ABL C;  2VAS A;  4QI0 A;  4BJ5 A;  4EHP A;  5COG A;  3IQ6 A;  1OW7 A;  1ZHY A;  2JX0 A;  4LLE A;  1IW7 F;  2Q00 A;  3U3F A;  2QUP A;  2OCC C;  3F46 A;  1KTM A;  2J9V A;  4J7T A;  2X51 A;  3G4Z A;  5EGY A;  2CYD A;  3KPH A;  4HE8 D;  4LLC A;  2X0C A;  1S7Z A;  3HNK A;  2H7O A;  1J8Y F;  3BEH A;  2NSG A;  4J7Y A;  5FZT A;  3K1I A;  4XLP F;  2Q3T A;  2YL7 A;  4KNW A;  5JT4 A;  5IY5 C;  4JIO A;  3BRJ A;  5GPG B;  5JLI A;  3ZTM A;  1BBH A;  2OJE D;  3MX3 A;  1VYI A;  3QW1 A;  4Q7C A;  3SYN A;  1MMD A;  1NU9 C;  4XEF A;  4PJJ A;  2Q7R A;  3AQC A;  2IM8 A;  3IPM O;  4DXW A;  4YT4 A;  1M2V B;  5KYY A;  4CDV A;  2C04 A;  3S28 A;  2OG2 A;  5JUA A;  1MMG A;  1ZHT A;  2RSE B;  3A9C A;  3W4Y A;  3PMR A;  3X1O A;  3O39 A;  3H2U A;  2P6V A;  2HFI A;  1U6H A;  2LK4 A;  2XM0 A;  3IQC A;  3RH3 A;  3U3B A;  4C7O A;  2Y3G A;  1QPU A;  4IWB A;  3S29 A;  4D4X A;  2YZS A;  3O6X A;  5B3S C;  2WVQ A;  1TFO B;  2YQY A;  3CEX A;  3M4B A;  4GQH A;  4MTF A;  4O79 A;  1C03 A;  4I44 A;  2F22 A;  5KYU A;  1VK5 A;  3HLZ A;  3Q6M A;  2XS8 A;  3W2W A;  1TWC A;  3DD7 A;  3T6G B;  1VLS A;  3GM3 A;  4YK5 A;  1VTM P;  4U9D A;  1TWH A;  2XLD A;  4JC7 A;  1IZM A;  2KNH A;  2PBE A;  5A6A A;  2IXO A;  2DYS C;  2FGY A;  2J0X A;  4CJG A;  1BR1 A;  5COM A;  3TK0 A;  4CS8 A;  1KU2 A;  1E84 A;  1NBB A;  3L1M A;  3EZI A;  3ZDL A;  1GM5 A;  3J06 A;  2YKZ A;  2YL0 A;  4I1M A;  4BJ5 C;  1A0B A;  3Q7L A;  4BJ6 A;  4XPX A;  3VRC A;  3M79 A;  5HSW A;  1QZX A;  1A7V A;  1G4U S;  3E70 C;  3IQT A;  1LS1 A;  4DVY P;  3LS0 A;  2KC3 A;  3WHN A;  1Z6A A;  2LIG A;  2A6E F;  2EIM C;  2ZPA A;  3QTH A;  2EIN C;  3M15 A;  3ASN C;  4EUK B;  1D0X A;  3ITF A;  1H9T A;  2LSE A;  3NDB B;  2DGJ A;  4JW1 A;  3LEO A;  3LAY A;  2OEV A;  4IB4 A;  1Z3I X;  4PK4 A;  5E33 A;  1M2V A;  1PV3 A;  3ZSU A;  5KYX B;  2PP4 A;  3EHN A;  3HJC A;  3K1I C;  5CI9 A;  2NUT A;  1NFO A;  4N6C A;  3JSZ A;  3MFN A;  1TQG A;  1WGW A;  3DKA A;  4MVM A;  3SXK A;  2NPU A;  3NMJ A;  4I3M A;  1M56 C;  1XZQ A;  2VH3 A;  4P9F A;  4XWJ A;  3EFO B;  2EIJ C;  2EPO A;  3LNM B;  4XEV A;  4NTA A;  3SXY A;  3ZQY A;  4PJN A;  2B0H A;  4DBR A;  1A7E A;  3EH1 A;  2VCA A;  4JEA A;  3H2V A;  3S9O A;  4ZLD A;  3ECS A;  2Q9B A;  3QMK A;  3RYL A;  3Q7G A;  1O5H A;  3DM9 B;  3RQF A;  1JMW A;  3DJU B;  3U2L A;  1NG1 A;  3S0X A;  2LD6 A;  3EGD A;  3JRM O;  5L3Q A;  1NLX A;  1V54 C;  4Q5S F;  2IXN A;  2KW3 C;  3U9J A;  3OEO A;  1QKR A;  5CI8 A;  1H7I A;  3U9M A;  5B3I A;  2HMQ A;  4ULW A;  4QDL A;  2PFD A;  1JOG A;  3FHD A;  1T6Q A;  1S05 A;  4J30 B;  3M4C A;  2YLG A;  1EI7 A;  2G3K A;  4N6H A;  2R05 A;  5T3W A;  1J8M F;  5B1A C;  1OW8 A;  2L9J A;  4PJM A;  3DXJ F;  2AP3 A;  3SEO A;  2GFH A;  2HV7 A;  2OOC A;  2VCB A;  1G4W R;  3IEE A;  2W4M A;  2C03 A;  1PCX A;  1XZP A;  2W45 A;  3FMS A;  3TD7 A;  4CS8 C;  5KYY B;  3JTL O;  1MMN A;  4FX5 A;  3OA1 A;  4A4A A;  2GDC A;  3LLI A;  2R02 A;  2YVK A;  4YT2 A;  1OCO C;  2J7P D;  4F4B A;  3SZR A;  3GEI A;  3C7J A;  4NTF A;  2AVK A;  3TJ5 A;  4W8P A;  4U5H A;  4AX2 A;  2ZXO A;  3NRH A;  2Q9C A;  3L8J A;  1WTY A;  4NC3 A;  3RIP A;  3GAN A;  3T6J A;  4PFO A;  4C7O B;  3PDM P;  3QZC A;  1U89 A;  2G62 A;  2OJQ A;  2PNO A;  4NCQ A;  5T3T A;  4E0I A;  3UR3 C;  2R7W A;  1L3P A;  4Z9I A;  2E87 A;  5KYU B;  2ICW G;  5BUO A;  3T9O A;  5A6K A;  4DJ9 A;  2ETS A;  2R7T A;  1NFN A;  5BQG A;  1HE1 A;  3V5Y A;  5JVE A;  2NG1 A;  3SP1 A;  3K66 A;  3CAX A;  3LJB A;  1GGQ A;  2YLD A;  2HUJ A;  1AVO B;  3U8P A;  4IAO A;  4BJ1 A;  1AUE A;  4MQ9 F;  4U5F E;  3B0V C;  4OIN F;  1C17 M;  1LE2 A;  2OEX A;  1ZYR F;  4HFF B;  4YWQ A;  1TWG A;  3KH2 A;  4E17 A;  2XLV A;  2XL4 A;  4N4W A;  1LE4 A;  3N0T A;  4AE4 A;  1H6G A;  1K40 A;  2J7P A;  4P9T A;  1G5Z A;  2L6H A;  2WZG A;  1GQA A;  2LFD A;  3AG4 C;  3KYJ A;  4G78 A;  4MTO A;  2J9B A;  4BEJ A;  2L7A A;  2YWA A;  2Y3H A;  2YEV A;  4XEK A;  1YA9 A;  5A6J A;  3B0P A;  2ZXR A;  4Z9J A;  3S84 A;  3EGX A;  3DAF A;  3VM6 A;  2KGO A;  3B9Q A;  4O6N A;  1HE9 A;  1TWA A;  3LES A;  2A6H F;  4IGG A;  5D91 A;  4GEH A;  4WGY A;  2R7V A;  4U5D E;  4DBQ A;  2W9Y A;  2NUT B;  1CGM E;  2NSF A;  2EPL X;  3DJN B;  5JP7 A;  4CSA A;  2R7U A;  1PD0 A;  3U2M A;  1HMO A;  2HJM A;  2GA0 A;  2ZXW C;  2J9W A;  4K7B A;  1FMV A;  3CQZ A;  3IHU A;  1B68 A;  3TOL A;  4IAQ A;  2QNL A;  1D0Z A;  1K04 A;  3LEV A;  2J9U A;  1HMD A;  4CS9 A;  4JCZ A;  4X0R A;  3C62 A;  4PJL A;  1APC A;  4CS7 A;  1LS4 A;  1SYQ A;  2LP4 A;  4YL1 A;  3WG7 C;  1HW2 A;  3B0U X;  1ZU5 A;  4JEB A;  3EGD B;  4XLN F;  4KI2 A;  2XS1 A;  2AWC A;  4JUR I;  1MQV A;  5DS6 A;  1WAT A;  1C02 A;  1NZE A;  3GOD A;  4ANJ A;  2CGE A;  4O6M A;  3U5S A;  5L3V A;  5T1D B;  3FDQ A;  3W8I A;  4CX9 A;  4EIY A;  4KC9 A;  3LUT B;  1RKE A;  1TKN A;  1YDI A;  3V5Z A;  3KKB A;  5EK0 A;  1YA7 O;  3VYW A;  4O6Y A;  2NUP B;  1E2X A;  3I5P A;  1Z5Z A;  3MYF A;  3RKO F;  3FOP A;  3S27 A;  5F5H A;  4C3E A;  3AGU A;  5F28 E;  3W8H A;  3HNI A;  5L0C A;  3G50 A;  3IQ5 A;  5E2Q A;  2ASR A;  2J0W A;  1N1C A;  1MNE A;  4H54 A;  1VOM A;  5L0J A;  1ZW3 A;  3AJM A;  5L0G A;  2L81 A;  4AL1 A;  4A2N B;  2CCY A;  3RVZ A;  5L0H A;  2PF4 E;  1VYK A;  1YYX A;  1WOL A;  3DZA A;  5TJ5 E;  3T4R A;  4E7S A;  3EHM A;  1E86 A;  1T6I A;  4MND A;  4HFK B;  4MTG A;  4PR9 A;  4H4K C;  1BR4 A;  3Q6N A;  4K1O A;  4MW3 A;  1ZW2 A;  4JZA A;  4OD4 A;  5D92 A;  1Z7Q c;  2AWY A;  2CW0 F;  3LS1 A;  5AC4 A;  2A69 F;  4MVO A;  4EBK A;  2GAQ A;  1JPN A;  2WZL A;  1BDJ B;  2IXP A;  4JVS A;  4P6I C;  4CSA C;  4U5E E;  2WB7 A; 
#chains in the Genus database with same CATH homology
 5JLI A;  3ZTM A;  4WGZ A;  1BBH A;  3QVY A;  4NC3 A;  3QW1 A;  4JE9 A;  4CDA A;  1CGN A;  2BC5 A;  4CDV A;  5JRA A;  2YL3 A;  4D4N A;  4ULV A;  5AGF A;  5JUA A;  5JVE A;  2QLA A;  1E85 A;  1M6T A;  2YLD A;  3U8P A;  256B A;  2XM0 A;  3FOO A;  1QPU A;  4D4X A;  1YZC A;  2XLV A;  3M4B A;  4N4W A;  1E83 A;  1GQA A;  3DE9 A;  2J9B A;  4CJO A;  4U9D A;  3ZWI A;  2XLD A;  3HNL A;  4CJG A;  4ER9 A;  4WGY A;  1E84 A;  1NBB A;  1CPQ A;  3L1M A;  4CDY A;  5JP7 A;  2YKZ A;  2YL0 A;  3VRC A;  3M79 A;  1A7V A;  3NMK A;  1YYJ A;  3TOL A;  4IAQ A;  2J8W A;  3ZTZ A;  2XLO A;  1RCP A;  3M15 A;  1LM3 B;  2XM4 A;  3C62 A;  3HNJ A;  4IB4 A;  1APC A;  1CPR A;  2XL8 A;  1EKY A;  4JEB A;  3NMJ A;  1MQV A;  4L6R A;  3DE8 A;  4CX9 A;  3ZQY A;  2XLM A;  3ZQV A;  4EIY A;  4JEA A;  5JSL A;  2XLE A;  2XLW A;  4CIP A;  4JKV A;  4U9E A;  3QVZ A;  2YLI A;  3FOP A;  3TOM A;  3HNI A;  1CGO A;  3IQ5 A;  5B3I A;  2XLH A;  1S05 A;  1JAF A;  2CCY A;  3M4C A;  2YLG A;  2YL1 A;  3NMI A;  1YYX A;  3IQ6 A;  4N6H A;  1E86 A;  1QQ3 A;  5JS5 A;  2XL6 A;  4IAR A;  3QW0 A;  3HNK A;  1YZA A;  3C63 A;  2YL7 A;  5JT4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...