1DOWA

Crystal structure of a chimera of beta-catenin and alpha-catenin
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
205
structure length
205
Chain Sequence
KAHVLAASVEQATENFLEKGDKIAKESQFLKEELVVAVEDVRKQGDLMKSAAGEFADDPCSSVKRGNMVRAARALLSAVTRLLILADMADVYKLLVQLKVVEDGILKLRNAGNEQDLGIQYKALKPEVDKLNIMAAKRQQELKDVGNRDQMAAARGILQKNVPILYTASQACLQHPDVAAYKANRDLIYKQLQQAVTGISNAAQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the dimerization and beta-catenin-binding region of alpha-catenin.
pubmed doi rcsb
source organism Mus musculus
molecule tags Cell adhesion
molecule keywords ALPHA-CATENIN
total genus 84
structure length 205
sequence length 205
ec nomenclature
pdb deposition date 1999-12-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 1dowA00
4PR9A 1RKEB 1XWJA 5L0JA 2HSQA 2B0HA 2L7AA 1ST6A 3H2VA 5L0CA 5L0HA 1YDIA 5FZTA 4E18A 1TR2A 5L0GA 4W8PA 3VF0A 1ZW3A 2GDCA 1H6GA 4K1OA 4ONSA 1RKCA 4E17A 3T6GB 1SYQA 1ZW2A 4DJ9A 5L0IA 3MYIA 1ZVZA 2X0CA 1U89A 5L0FA 5L0DA 3ZDLA 4P9TA 3TJ5A 1DOVA 3RF3A 2GWWA 3S90A 1DOWA 1T01A 3TJ6A 1U6HA 1RKEA 2IBFA 3H2UA 4IGGA 2LQGA 1L7CA 1QKRA 4EHPA
chains in the Genus database with same CATH superfamily
3LNMB 2J7PD 3EG9B 4RBNA 5L0JA 1YLMA 5JLIA 3ZVRA 4WGZA 1SMYF 3HTKC 3ZIBA 1M2VA 2H7VC 1M56C 3CSKA 5T1DB 4OINF 1NBBA 4XWJA 2J9VA 2LK4A 2XLMA 3JYYA 3UNGC 3B9QA 4C3DA 3SZRA 2J9WA 1BZ4A 1BBHA 1JAFA 2WZLA 5K0IA 1C03A 2UUHA 3C63A 2YWAA 2JPUA 4XQ1A 1KTMA 1HE9A 1ZVZA 3K1HA 4LDRA 4MVZA 3TD7A 2W4BA 3I5PA 1AUEA 3H65A 4MVMA 4FAPB 1QVXA 1VK5A 3AJMA 4GYTA 4P9TA 4CIPA 1ZU4A 2KC3A 1D0YA 3U5SA 5CIVA 1Q0GA 2WL8A 3DJUB 1IZMA 2PBEA 1U6HA 1AEPA 1V74B 1UG7A 1V4AA 2XRHA 2XS1A 4LDKA 2L81A 4BPMA 1RKEB 3U0CA 3V5ZA 2JD3A 2B0JA 2D5RB 4BEMJ 1OQCA 2P1AA 3EH1A 1NSGB 1S7ZA 1ZHYA 1IW7F 4BJ5C 3Q6NA 4HE8D 2OU6A 2R05A 1M2OA 1ZW2A 2LSEA 3S28A 4Q4ZF 3IEEA 4QI0A 4J7TA 4Z9IA 3BEHA 3RQFA 1LM3B 3ZG1A 3R2PA 3ZC4A 2L6HA 2Q7RA 1MMNA 3M15A 3U8VA 3UMIA 4BJ1A 1CGME 1YJGA 5F5FA 2XL8A 3GM2A 2LIGA 2TMVP 2LFDA 4OD5A 4X0RA 3HLZA 1TWAA 1YYXA 4HFKB 5KYUA 4C3BA 1L7CA 3DAGA 3UGPA 5EGYA 3QZCA 2HKVA 1LVKA 1Q0DA 2L9JA 3O10A 3G4ZA 3CZ6A 1T6UA 3MX3A 2ZD9A 4MTFA 4RD9A 4NCQA 256BA 2XXAA 2CNWD 1NFNA 2AU5A 2XLHA 3LS0A 3RVZA 4ONSA 2NUPA 4U9DA 3W8HA 4RDAA 2UUIA 1D1CA 4MW3A 3DM9B 2X0CA 1H9GA 4YL3A 1VB5A 4JE9A 3K7DA 1OXKA 4AE4A 5BQHA 3B29A 4O79A 3ASOC 2OKUA 3EFOA 5D92A 1JR8A 3S84A 5A6BD 1Y6DA 2OCCC 5F28E 3T9OA 1LKXA 2XLEA 3C8GA 5E3CA 5FCLA 1TFKB 2DYRC 2KJGA 2OJQA 3JTLO 4ER9A 5JS5A 4AL0A 4UDVA 1YVIA 4U5EE 1XWJA 2OQMA 4Q5SF 1E2XA 3L1MA 3S0XA 3EHNA 3NDBB 2GAQA 3U8PA 1ZHTA 3OEOA 4JTAB 2EIKC 1RCPA 1A7DA 4K7BA 3C62A 4OIOF 3EZIA 1FNTc 2W4MA 3NYMA 1H7IA 4J7YA 3ASNC 1Q0FA 4XEFA 4JW1A 4XLNF 1M57C 1LE4A 1RJ9B 2G62A 2NSGA 1ZHZA 1PD0A 2PX3A 4MNDA 5COGA 3T6JA 1V55C 3ABKC 2P6VA 1ZZPA 4MVOA 5T3WA 4A2NB 1GM5A 3EHMA 3DD7A 2Q9BA 2HS5A 2IBFA 3EZHA 1LPEA 2NPUA 5GPGB 4CS7A 4DRHB 4DVZA 1SF8A 1ORSC 4EBBA 3NRHA 1APCA 1OW8A 2YKZA 5AC4A 3VYWA 5BQIA 1JMWA 2QLAA 2XM0A 3U2MA 4EWCA 4XLPF 2LCHA 3BRJA 3GORA 2CNWA 2J0XA 4J32B 4BJ5A 4CDYA 5JP7A 3IPMO 4IARA 2XLWA 2WZFA 3NKEA 4IB4A 5D91A 2R7TA 4L6RA 1H6GA 2CDQA 2HUJA 1RKCA 5AGFA 2YRFA 4QI2A 2WVNA 1LIHA 2A69F 3WAQA 3KMIA 1A41A 4LERA 2J8WA 4NTFA 4XEKA 3QTHA 3N0TA 5CI8A 1U89A 3EPVA 4EBKA 2XLVA 1EI7A 4DXWA 2YL1A 3ZQYA 5A6BA 2R02A 5A6JA 2ETSA 1T01A 4H4KC 3MBGA 1YA7O 1T9KA 4K0DA 3I5QA 3RIPA 3ZTMA 3FAPB 3X1OA 4DOZA 4JURI 1OR3A 1YYJA 5JUAA 3UGOA 2AVKA 3ZQVA 1L3PA 1BR4A 2ZXWC 3O6XA 3LUTB 2I15A 3Q7LA 1C17M 5DQZA 4NTAA 1ST6A 5KYUB 1NLXA 1OW6A 2NUTA 3OWTA 1HW1A 2XS8A 3AGUA 3K66A 4U5DE 1ZW3A 1I4YA 2PX0A 4YL1A 2QTVA 3TOMA 1RMVA 1HMDA 3I4UA 3U2LA 4DJ9A 3QVZA 5COMA 2OEXA 3TULA 1VLSA 1VLTA 1WN0A 4KNWA 4WABA 5L0FA 3N24A 1ZHXA 3TJ5A 1OCRC 3T6BA 2XL6A 1CPQA 2EINC 2EIJC 3LESA 1WASA 3FMSA 2J7PA 4OD4A 2QE9A 1D1BA 4F4BA 1O87A 1A7VA 1BR1A 2A6HF 2MYSA 2BC5A 1MNEA 1MMDA 2Q00A 4C3EA 3J06A 2FGYA 5EHHA 5L0HA 1YDIA 1JPNA 1LI7A 4B6IA 1JPJA 1I4ZA 1LE2A 1R5ID 1TWGA 4JKVA 3K33A 2Y3DA 2XSEA 4N4WA 4P9FA 5B3IA 1G5ZA 1NG1A 2EPNA 4JCZA 3LEOA 2H7BA 2HFIA 1YA9A 2FFHA 2HJMA 3E9VA 1FAPB 1GGQA 2IXNA 3DAFA 4JCHA 4CBEA 4AX2A 4MQ9F 4R32A 3HNKA 3LJBA 3NMKA 3UMKA 1JRAA 1FR0A 3EJNA 3F47A 4D4XA 2OJED 1Q0KA 2ICWG 3VRCA 3A9CA 4GQHA 5TJ5E 1M2VB 1RXQA 4BJ6A 2HMQA 2KGOA 4D4NA 4YK5A 5L3VA 2HZ8A 2HMZA 1OCZC 2R25A 3KPHA 3GM1A 4W8KA 4CJOA 3LS1A 2ASRA 1QLEC 1E84A 1HE1A 1Q0MA 3H2VA 3LLIA 4O6YA 5L0CA 3FVYA 5L0GA 4M63A 1TWHA 3GM3A 1O3UA 3RQEA 1A0BA 2VASA 2V3CC 2GA0A 2XLDA 4E0IA 1MMAA 3AG1C 3V5YA 1QPUA 5A6AA 2R7XA 2Z15A 2DB4A 2JX0A 2VH3A 2IM8A 4XPYA 3AQCA 4DRJB 5F5HA 1N1CA 3DI5A 2A0BA 2WVQA 2MHRA 4WGYA 1S05A 4DBRA 2Y69C 4LACB 2OOCA 3NMIA 5KYNA 1OCCC 2AWCA 4U5FE 3LEVA 3FDQA 1JOGA 2J46A 1MMGA 3L34A 1OKKA 1T6IA 1VMAA 2LP4A 3JRTA 3RFYA 4XPXA 2J0WA 1QKRA 2YEVA 2O9XA 2M64A 4MTOA 3W2VA 4G7HF 1XZPA 4AK9A 3AGTA 4MTGA 2HV6A 4AL1A 4JZAA 4C7OB 3C18A 3IQTA 4IAOA 4CDAA 1G4WR 2BE5F 2VB6A 3B0UX 3DKAA 3AQBA 3M4BA 1RJ9A 3M1CB 1QQ3A 5B1AC 3T6GB 1OXBA 1SYQA 2KYHA 4J30B 3JSEO 1O5HA 2HSBA 2ZPAA 4G78A 4LDQA 1EKYA 1KNYA 4JTCB 4NTBA 5L0IA 4U9EA 2VCCA 3WG7C 2I8BA 2PNOA 2V26A 4IJJA 3NYJA 1ZU5A 4IWBA 3POVA 3LLKA 2QY9A 2HJ3A 3FXHA 2GWWA 2ZXOA 2MWQA 3CEXA 3MLGA 5L3QA 2KQ9A 2YLIA 5JRAA 1WATA 1Z6AA 4IGGA 2BL2A 3GEHA 3X2QC 1U0BB 1B68A 3QW1A 1Z23A 4OIQF 3S9OA 1CGNA 1GQAA 3B71A 5A6KA 2HV7A 3EFOB 2NUTB 1TWCA 4HEAJ 3DWWA 2F22A 2VCAA 3VF0A 3TQOA 2EPMX 3SNHA 3GODA 2IOQA 2C04A 4N6CA 5DLJA 4E7ZA 1PCXA 4CS8C 3HKKA 4PJLA 2CW0F 2J45A 2YQYA 3EGDB 3GWNA 1NU7D 2YL7A 3L8IA 3MYIA 4YN0B 2R7OA 2WZGA 2AWYA 3R7CA 3C8ZA 3DJNB 1D1AA 4HFFB 2Q3TA 3G4XA 3G50A 4EUKB 3M4CA 1Z63A 1NU9C 3AG2C 2DI3A 3ZTZA 1SZIA 1SR2A 4XEVA 3L0IA 3ECSA 4BJ6C 4DBQA 1WGWA 1QZXA 4NY3A 4PJMA 2R7UA 2KK1A 2NSFA 3DM5A 3PMRA 3IQ6A 1LS4A 3QMKA 4NC3A 4G7OF 1K05A 4MVSA 5KYXB 1YZCA 1F1MA 5DS6A 3JRMO 4DRIB 4YT8A 4XPWA 3RQGA 3K6BA 4YT2A 4LLCA 5COFA 2PP4A 3M79A 4U5CE 1TQGA 2D4UA 2YZSA 3K1IC 2W45A 4W8PA 1WWPA 2YL3A 3DXJF 2P0NA 4KC9A 4YWQA 5HSWA 3SXKA 3CAXA 2Q9AA 2EPLX 4U5GA 3SEOA 3NMJA 3AG3C 4JEBA 2H7OA 3K1IA 4YJWA 2ZXRA 1OR2A 1XZQA 1DOVA 1AVOB 1OKKD 3S90A 1FTSA 1VYIA 3ABMC 4JRZA 1RKEA 3FOPA 3RH3A 5DVWA 4CSAA 1R4TA 4O7GA 3E70C 4PJJA 5JT4A 2IXMA 2P61A 1YAUO 3MFNA 4ULVA 5E3AA 1BDJB 2CYDA 3O39A 2KW3C 3U3BA 3F46A 3B0PA 2YLDA 1OW7A 4FX5A 1TR2A 2DGJA 3CQZA 4P6IC 5FZTA 3ITFA 4E18A 1PV3A 2GDCA 4I1MA 5JVEA 4OIPF 1LS1A 4O6NA 3QW0A 3QVYA 1FMWA 1NZEA 3KH2A 3C8GB 1T5OA 2W9YA 3TK0A 4FESA 4YT4A 2L6FA 1VTMP 2CCYA 2RSEB 1A7EA 2LFFA 4AE4B 4ZLCA 3HJCA 3RF3A 4E0HA 1Z3IX 1NFOA 4CS9C 3C7JA 1M6TA 5B3SC 3PHF2 3H2UA 5E33A 3SXMA 3VM6A 2R9RB 4G0HA 5DS4A 2NUPB 4I3MA 4EHPA 3NKDA 1J8YF 5DQTA 3C8GD 4E7SA 1CPRA 2HSQA 2EIMC 3DE8A 1WTYA 3Q7GA 5JSLA 3SXZA 1FMVA 2XXAB 3MYFA 1PD1A 1Y4CA 3W4YA 5KYYB 2H8AA 2G3KA 1K04A 3ZSUA 3IQ5A 1E83A 3UMHA 4CX9A 4E17A 1EQ1A 3PCVA 4U5HA 1TFOB 2M4EA 3W2WA 1HY5A 1ZYRF 2XM4A 3ATPA 1FFTC 3US6A 2L6GA 2QNLA 4Z9JA 4BG0A 1HMOA 3B0VC 2YVKA 2CGEA 4GEHA 3U9JA 4CDVA 3S27A 2J9UA 3L8JA 2PFDA 3GEEA 2A0UA 2A1DD 4MVQA 4XTKA 4WJ0A 1EA8A 2PF4E 1ORYA 5KYWB 1Z7Qc 3EH2A 3NYLA 4FWVA 4PK4A 4YT5A 3N2ZB 1VYKA 2Y39A 3ABLC 4MS2A 5T3TA 2YHSA 4U5BE 1BR2A 1YZAA 4JIOA 1V54C 4JVSA 5KYXA 4MVUA 2L7AA 1ORJA 3EQLF 3LNRA 5IY5C 3KL4A 1MQVA 2C03A 4PJNA 1E85A 1E86A 4KNVA 2A6EF 4JEAA 4K1OA 4LLEA 5BQGA 5CI9A 3WHNA 2R7WA 1GS9A 4JJGA 4Z9HA 4ZLDA 2R7QA 4CJGA 5AC5A 3SYNA 3AG4C 3EGDA 3KYJA 4JTDB 2IYLD 3JCUQ 3AOUA 3JYHA 3V5XA 1D0XA 3TOLA 2WVOA 2E87A 4IRUA 3ZDLA 5E2QA 3SP1A 2ZXPA 4YL0A 4O6MA 4IAQA 4OIRF 4CSAC 1H9TA 1K40A 2EPOA 3U9MA 2KNHA 2IXOA 2J9BA 2LD6A 2OG2A 2LQGA 2VC9A 3HNIA 2RD9A 2YLGA 4KBLA 4MVRA 4MW8A 4BEJA 3FHDA 2OEVA 4PR9A 4CIHA 3FAJA 5B1BC 3NG1A 1YARO 2Y3HA 3Q6MA 5DS5A 2R7SA 2QUPA 2X51A 3SXYA 4H54A 3RKOF 3RYLA 2XLOA 3EG9A 4G7ZF 4I44A 5A69A 1Z5ZA 1CGOA 1J8MF 3KYIA 3IQCA 4JJFA 3T4RA 4ULWA 2R7VA 2Q9CA 3VAYA 4A4AA 3W8IA 5L0DA 4CS9A 4Q7CA 1VOMA 2VCBA 1T6QA 4KI2A 1DOWA 3S29A 2FAPB 4ANJA 3FOOA 1W2WA 4EBJA 4EKWA 4C7OA 1UFBA 2Q4FA 4PACA 3HNJA 4N6HA 3RW0A 3JZ0A 3JSZA 1KU2A 3GANA 3GEIA 3DMDA 3EGXA 2B0HA 3ZWIA 5KYWA 1TKNA 2XL4A 3IHUA 2DYSC 3JT1A 5EK0A 3GWLA 4PFOA 1LI5A 2P7VA 2EPKX 3EGXB 2Y3BA 2WB7A 4JC7A 4QDLA 3A11A 3OA1A 4CS8A 1I5NA 1C02A 1FFHA 4PFPA 3V7OA 3KKBA 5BUOA 4DVYP 5HV9A 1HW2A 2GFHA 1ZHWA 3DZAA 2NG1A 2YL0A 1MNDA 1WOLA 4BJTA 4I1OB 2EILC 3PDMP 2G3VA 2IXPA 4NQFA 3LAYA 3HNLA 3O55A 3U3FA 4EIYA 1OCOC 2KSFA 5KYYA 1G4US 2Y3GA 2R7RA 2R03A 3TJ6A 3UR3C 4N06A 3WODF 1G8XA 1D0ZA 2A68F 2AP3A 3DE9A 1QSPA 3RVYA
chains in the Genus database with same CATH topology
4PR9A 1RKEB 1XWJA 5L0JA 2HSQA 2B0HA 2L7AA 1ST6A 3H2VA 5L0CA 5L0HA 1YDIA 5FZTA 4E18A 1TR2A 5L0GA 4W8PA 3VF0A 1ZW3A 2GDCA 1H6GA 4K1OA 4ONSA 1RKCA 4E17A 3T6GB 1SYQA 1ZW2A 4DJ9A 5L0IA 3MYIA 1ZVZA 2X0CA 1U89A 5L0FA 5L0DA 3ZDLA 4P9TA 3TJ5A 1DOVA 3RF3A 2GWWA 3S90A 1DOWA 1T01A 3TJ6A 1U6HA 1RKEA 2IBFA 3H2UA 4IGGA 2LQGA 1L7CA 1QKRA 4EHPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PR9 A;  1RKE B;  1XWJ A;  5L0J A;  2HSQ A;  2B0H A;  2L7A A;  1ST6 A;  3H2V A;  5L0C A;  5L0H A;  1YDI A;  5FZT A;  4E18 A;  1TR2 A;  5L0G A;  4W8P A;  3VF0 A;  1ZW3 A;  2GDC A;  1H6G A;  4K1O A;  4ONS A;  1RKC A;  4E17 A;  3T6G B;  1SYQ A;  1ZW2 A;  4DJ9 A;  5L0I A;  3MYI A;  1ZVZ A;  2X0C A;  1U89 A;  5L0F A;  5L0D A;  3ZDL A;  4P9T A;  3TJ5 A;  1DOV A;  3RF3 A;  2GWW A;  3S90 A;  1DOW A;  1T01 A;  3TJ6 A;  1U6H A;  1RKE A;  2IBF A;  3H2U A;  4IGG A;  2LQG A;  1L7C A;  1QKR A;  4EHP A; 
#chains in the Genus database with same CATH topology
 3LNM B;  2J7P D;  3EG9 B;  4RBN A;  5L0J A;  1YLM A;  5JLI A;  3ZVR A;  4WGZ A;  1SMY F;  3HTK C;  3ZIB A;  1M2V A;  2H7V C;  1M56 C;  3CSK A;  5T1D B;  4OIN F;  1NBB A;  4XWJ A;  2J9V A;  2LK4 A;  2XLM A;  3JYY A;  3UNG C;  3B9Q A;  4C3D A;  3SZR A;  2J9W A;  1BZ4 A;  1BBH A;  1JAF A;  2WZL A;  5K0I A;  1C03 A;  2UUH A;  3C63 A;  2YWA A;  2JPU A;  4XQ1 A;  1KTM A;  1HE9 A;  1ZVZ A;  3K1H A;  4LDR A;  4MVZ A;  3TD7 A;  2W4B A;  3I5P A;  1AUE A;  3H65 A;  4MVM A;  4FAP B;  1QVX A;  1VK5 A;  3AJM A;  4GYT A;  4P9T A;  4CIP A;  1ZU4 A;  2KC3 A;  1D0Y A;  3U5S A;  5CIV A;  1Q0G A;  2WL8 A;  3DJU B;  1IZM A;  2PBE A;  1U6H A;  1AEP A;  1V74 B;  1UG7 A;  1V4A A;  2XRH A;  2XS1 A;  4LDK A;  2L81 A;  4BPM A;  1RKE B;  3U0C A;  3V5Z A;  2JD3 A;  2B0J A;  2D5R B;  4BEM J;  1OQC A;  2P1A A;  3EH1 A;  1NSG B;  1S7Z A;  1ZHY A;  1IW7 F;  4BJ5 C;  3Q6N A;  4HE8 D;  2OU6 A;  2R05 A;  1M2O A;  1ZW2 A;  2LSE A;  3S28 A;  4Q4Z F;  3IEE A;  4QI0 A;  4J7T A;  4Z9I A;  3BEH A;  3RQF A;  1LM3 B;  3ZG1 A;  3R2P A;  3ZC4 A;  2L6H A;  2Q7R A;  1MMN A;  3M15 A;  3U8V A;  3UMI A;  4BJ1 A;  1CGM E;  1YJG A;  5F5F A;  2XL8 A;  3GM2 A;  2LIG A;  2TMV P;  2LFD A;  4OD5 A;  4X0R A;  3HLZ A;  1TWA A;  1YYX A;  4HFK B;  5KYU A;  4C3B A;  1L7C A;  3DAG A;  3UGP A;  5EGY A;  3QZC A;  2HKV A;  1LVK A;  1Q0D A;  2L9J A;  3O10 A;  3G4Z A;  3CZ6 A;  1T6U A;  3MX3 A;  2ZD9 A;  4MTF A;  4RD9 A;  4NCQ A;  256B A;  2XXA A;  2CNW D;  1NFN A;  2AU5 A;  2XLH A;  3LS0 A;  3RVZ A;  4ONS A;  2NUP A;  4U9D A;  3W8H A;  4RDA A;  2UUI A;  1D1C A;  4MW3 A;  3DM9 B;  2X0C A;  1H9G A;  4YL3 A;  1VB5 A;  4JE9 A;  3K7D A;  1OXK A;  4AE4 A;  5BQH A;  3B29 A;  4O79 A;  3ASO C;  2OKU A;  3EFO A;  5D92 A;  1JR8 A;  3S84 A;  5A6B D;  1Y6D A;  2OCC C;  5F28 E;  3T9O A;  1LKX A;  2XLE A;  3C8G A;  5E3C A;  5FCL A;  1TFK B;  2DYR C;  2KJG A;  2OJQ A;  3JTL O;  4ER9 A;  5JS5 A;  4AL0 A;  4UDV A;  1YVI A;  4U5E E;  1XWJ A;  2OQM A;  4Q5S F;  1E2X A;  3L1M A;  3S0X A;  3EHN A;  3NDB B;  2GAQ A;  3U8P A;  1ZHT A;  3OEO A;  4JTA B;  2EIK C;  1RCP A;  1A7D A;  4K7B A;  3C62 A;  4OIO F;  3EZI A;  1FNT c;  2W4M A;  3NYM A;  1H7I A;  4J7Y A;  3ASN C;  1Q0F A;  4XEF A;  4JW1 A;  4XLN F;  1M57 C;  1LE4 A;  1RJ9 B;  2G62 A;  2NSG A;  1ZHZ A;  1PD0 A;  2PX3 A;  4MND A;  5COG A;  3T6J A;  1V55 C;  3ABK C;  2P6V A;  1ZZP A;  4MVO A;  5T3W A;  4A2N B;  1GM5 A;  3EHM A;  3DD7 A;  2Q9B A;  2HS5 A;  2IBF A;  3EZH A;  1LPE A;  2NPU A;  5GPG B;  4CS7 A;  4DRH B;  4DVZ A;  1SF8 A;  1ORS C;  4EBB A;  3NRH A;  1APC A;  1OW8 A;  2YKZ A;  5AC4 A;  3VYW A;  5BQI A;  1JMW A;  2QLA A;  2XM0 A;  3U2M A;  4EWC A;  4XLP F;  2LCH A;  3BRJ A;  3GOR A;  2CNW A;  2J0X A;  4J32 B;  4BJ5 A;  4CDY A;  5JP7 A;  3IPM O;  4IAR A;  2XLW A;  2WZF A;  3NKE A;  4IB4 A;  5D91 A;  2R7T A;  4L6R A;  1H6G A;  2CDQ A;  2HUJ A;  1RKC A;  5AGF A;  2YRF A;  4QI2 A;  2WVN A;  1LIH A;  2A69 F;  3WAQ A;  3KMI A;  1A41 A;  4LER A;  2J8W A;  4NTF A;  4XEK A;  3QTH A;  3N0T A;  5CI8 A;  1U89 A;  3EPV A;  4EBK A;  2XLV A;  1EI7 A;  4DXW A;  2YL1 A;  3ZQY A;  5A6B A;  2R02 A;  5A6J A;  2ETS A;  1T01 A;  4H4K C;  3MBG A;  1YA7 O;  1T9K A;  4K0D A;  3I5Q A;  3RIP A;  3ZTM A;  3FAP B;  3X1O A;  4DOZ A;  4JUR I;  1OR3 A;  1YYJ A;  5JUA A;  3UGO A;  2AVK A;  3ZQV A;  1L3P A;  1BR4 A;  2ZXW C;  3O6X A;  3LUT B;  2I15 A;  3Q7L A;  1C17 M;  5DQZ A;  4NTA A;  1ST6 A;  5KYU B;  1NLX A;  1OW6 A;  2NUT A;  3OWT A;  1HW1 A;  2XS8 A;  3AGU A;  3K66 A;  4U5D E;  1ZW3 A;  1I4Y A;  2PX0 A;  4YL1 A;  2QTV A;  3TOM A;  1RMV A;  1HMD A;  3I4U A;  3U2L A;  4DJ9 A;  3QVZ A;  5COM A;  2OEX A;  3TUL A;  1VLS A;  1VLT A;  1WN0 A;  4KNW A;  4WAB A;  5L0F A;  3N24 A;  1ZHX A;  3TJ5 A;  1OCR C;  3T6B A;  2XL6 A;  1CPQ A;  2EIN C;  2EIJ C;  3LES A;  1WAS A;  3FMS A;  2J7P A;  4OD4 A;  2QE9 A;  1D1B A;  4F4B A;  1O87 A;  1A7V A;  1BR1 A;  2A6H F;  2MYS A;  2BC5 A;  1MNE A;  1MMD A;  2Q00 A;  4C3E A;  3J06 A;  2FGY A;  5EHH A;  5L0H A;  1YDI A;  1JPN A;  1LI7 A;  4B6I A;  1JPJ A;  1I4Z A;  1LE2 A;  1R5I D;  1TWG A;  4JKV A;  3K33 A;  2Y3D A;  2XSE A;  4N4W A;  4P9F A;  5B3I A;  1G5Z A;  1NG1 A;  2EPN A;  4JCZ A;  3LEO A;  2H7B A;  2HFI A;  1YA9 A;  2FFH A;  2HJM A;  3E9V A;  1FAP B;  1GGQ A;  2IXN A;  3DAF A;  4JCH A;  4CBE A;  4AX2 A;  4MQ9 F;  4R32 A;  3HNK A;  3LJB A;  3NMK A;  3UMK A;  1JRA A;  1FR0 A;  3EJN A;  3F47 A;  4D4X A;  2OJE D;  1Q0K A;  2ICW G;  3VRC A;  3A9C A;  4GQH A;  5TJ5 E;  1M2V B;  1RXQ A;  4BJ6 A;  2HMQ A;  2KGO A;  4D4N A;  4YK5 A;  5L3V A;  2HZ8 A;  2HMZ A;  1OCZ C;  2R25 A;  3KPH A;  3GM1 A;  4W8K A;  4CJO A;  3LS1 A;  2ASR A;  1QLE C;  1E84 A;  1HE1 A;  1Q0M A;  3H2V A;  3LLI A;  4O6Y A;  5L0C A;  3FVY A;  5L0G A;  4M63 A;  1TWH A;  3GM3 A;  1O3U A;  3RQE A;  1A0B A;  2VAS A;  2V3C C;  2GA0 A;  2XLD A;  4E0I A;  1MMA A;  3AG1 C;  3V5Y A;  1QPU A;  5A6A A;  2R7X A;  2Z15 A;  2DB4 A;  2JX0 A;  2VH3 A;  2IM8 A;  4XPY A;  3AQC A;  4DRJ B;  5F5H A;  1N1C A;  3DI5 A;  2A0B A;  2WVQ A;  2MHR A;  4WGY A;  1S05 A;  4DBR A;  2Y69 C;  4LAC B;  2OOC A;  3NMI A;  5KYN A;  1OCC C;  2AWC A;  4U5F E;  3LEV A;  3FDQ A;  1JOG A;  2J46 A;  1MMG A;  3L34 A;  1OKK A;  1T6I A;  1VMA A;  2LP4 A;  3JRT A;  3RFY A;  4XPX A;  2J0W A;  1QKR A;  2YEV A;  2O9X A;  2M64 A;  4MTO A;  3W2V A;  4G7H F;  1XZP A;  4AK9 A;  3AGT A;  4MTG A;  2HV6 A;  4AL1 A;  4JZA A;  4C7O B;  3C18 A;  3IQT A;  4IAO A;  4CDA A;  1G4W R;  2BE5 F;  2VB6 A;  3B0U X;  3DKA A;  3AQB A;  3M4B A;  1RJ9 A;  3M1C B;  1QQ3 A;  5B1A C;  3T6G B;  1OXB A;  1SYQ A;  2KYH A;  4J30 B;  3JSE O;  1O5H A;  2HSB A;  2ZPA A;  4G78 A;  4LDQ A;  1EKY A;  1KNY A;  4JTC B;  4NTB A;  5L0I A;  4U9E A;  2VCC A;  3WG7 C;  2I8B A;  2PNO A;  2V26 A;  4IJJ A;  3NYJ A;  1ZU5 A;  4IWB A;  3POV A;  3LLK A;  2QY9 A;  2HJ3 A;  3FXH A;  2GWW A;  2ZXO A;  2MWQ A;  3CEX A;  3MLG A;  5L3Q A;  2KQ9 A;  2YLI A;  5JRA A;  1WAT A;  1Z6A A;  4IGG A;  2BL2 A;  3GEH A;  3X2Q C;  1U0B B;  1B68 A;  3QW1 A;  1Z23 A;  4OIQ F;  3S9O A;  1CGN A;  1GQA A;  3B71 A;  5A6K A;  2HV7 A;  3EFO B;  2NUT B;  1TWC A;  4HEA J;  3DWW A;  2F22 A;  2VCA A;  3VF0 A;  3TQO A;  2EPM X;  3SNH A;  3GOD A;  2IOQ A;  2C04 A;  4N6C A;  5DLJ A;  4E7Z A;  1PCX A;  4CS8 C;  3HKK A;  4PJL A;  2CW0 F;  2J45 A;  2YQY A;  3EGD B;  3GWN A;  1NU7 D;  2YL7 A;  3L8I A;  3MYI A;  4YN0 B;  2R7O A;  2WZG A;  2AWY A;  3R7C A;  3C8Z A;  3DJN B;  1D1A A;  4HFF B;  2Q3T A;  3G4X A;  3G50 A;  4EUK B;  3M4C A;  1Z63 A;  1NU9 C;  3AG2 C;  2DI3 A;  3ZTZ A;  1SZI A;  1SR2 A;  4XEV A;  3L0I A;  3ECS A;  4BJ6 C;  4DBQ A;  1WGW A;  1QZX A;  4NY3 A;  4PJM A;  2R7U A;  2KK1 A;  2NSF A;  3DM5 A;  3PMR A;  3IQ6 A;  1LS4 A;  3QMK A;  4NC3 A;  4G7O F;  1K05 A;  4MVS A;  5KYX B;  1YZC A;  1F1M A;  5DS6 A;  3JRM O;  4DRI B;  4YT8 A;  4XPW A;  3RQG A;  3K6B A;  4YT2 A;  4LLC A;  5COF A;  2PP4 A;  3M79 A;  4U5C E;  1TQG A;  2D4U A;  2YZS A;  3K1I C;  2W45 A;  4W8P A;  1WWP A;  2YL3 A;  3DXJ F;  2P0N A;  4KC9 A;  4YWQ A;  5HSW A;  3SXK A;  3CAX A;  2Q9A A;  2EPL X;  4U5G A;  3SEO A;  3NMJ A;  3AG3 C;  4JEB A;  2H7O A;  3K1I A;  4YJW A;  2ZXR A;  1OR2 A;  1XZQ A;  1DOV A;  1AVO B;  1OKK D;  3S90 A;  1FTS A;  1VYI A;  3ABM C;  4JRZ A;  1RKE A;  3FOP A;  3RH3 A;  5DVW A;  4CSA A;  1R4T A;  4O7G A;  3E70 C;  4PJJ A;  5JT4 A;  2IXM A;  2P61 A;  1YAU O;  3MFN A;  4ULV A;  5E3A A;  1BDJ B;  2CYD A;  3O39 A;  2KW3 C;  3U3B A;  3F46 A;  3B0P A;  2YLD A;  1OW7 A;  4FX5 A;  1TR2 A;  2DGJ A;  3CQZ A;  4P6I C;  5FZT A;  3ITF A;  4E18 A;  1PV3 A;  2GDC A;  4I1M A;  5JVE A;  4OIP F;  1LS1 A;  4O6N A;  3QW0 A;  3QVY A;  1FMW A;  1NZE A;  3KH2 A;  3C8G B;  1T5O A;  2W9Y A;  3TK0 A;  4FES A;  4YT4 A;  2L6F A;  1VTM P;  2CCY A;  2RSE B;  1A7E A;  2LFF A;  4AE4 B;  4ZLC A;  3HJC A;  3RF3 A;  4E0H A;  1Z3I X;  1NFO A;  4CS9 C;  3C7J A;  1M6T A;  5B3S C;  3PHF 2;  3H2U A;  5E33 A;  3SXM A;  3VM6 A;  2R9R B;  4G0H A;  5DS4 A;  2NUP B;  4I3M A;  4EHP A;  3NKD A;  1J8Y F;  5DQT A;  3C8G D;  4E7S A;  1CPR A;  2HSQ A;  2EIM C;  3DE8 A;  1WTY A;  3Q7G A;  5JSL A;  3SXZ A;  1FMV A;  2XXA B;  3MYF A;  1PD1 A;  1Y4C A;  3W4Y A;  5KYY B;  2H8A A;  2G3K A;  1K04 A;  3ZSU A;  3IQ5 A;  1E83 A;  3UMH A;  4CX9 A;  4E17 A;  1EQ1 A;  3PCV A;  4U5H A;  1TFO B;  2M4E A;  3W2W A;  1HY5 A;  1ZYR F;  2XM4 A;  3ATP A;  1FFT C;  3US6 A;  2L6G A;  2QNL A;  4Z9J A;  4BG0 A;  1HMO A;  3B0V C;  2YVK A;  2CGE A;  4GEH A;  3U9J A;  4CDV A;  3S27 A;  2J9U A;  3L8J A;  2PFD A;  3GEE A;  2A0U A;  2A1D D;  4MVQ A;  4XTK A;  4WJ0 A;  1EA8 A;  2PF4 E;  1ORY A;  5KYW B;  1Z7Q c;  3EH2 A;  3NYL A;  4FWV A;  4PK4 A;  4YT5 A;  3N2Z B;  1VYK A;  2Y39 A;  3ABL C;  4MS2 A;  5T3T A;  2YHS A;  4U5B E;  1BR2 A;  1YZA A;  4JIO A;  1V54 C;  4JVS A;  5KYX A;  4MVU A;  2L7A A;  1ORJ A;  3EQL F;  3LNR A;  5IY5 C;  3KL4 A;  1MQV A;  2C03 A;  4PJN A;  1E85 A;  1E86 A;  4KNV A;  2A6E F;  4JEA A;  4K1O A;  4LLE A;  5BQG A;  5CI9 A;  3WHN A;  2R7W A;  1GS9 A;  4JJG A;  4Z9H A;  4ZLD A;  2R7Q A;  4CJG A;  5AC5 A;  3SYN A;  3AG4 C;  3EGD A;  3KYJ A;  4JTD B;  2IYL D;  3JCU Q;  3AOU A;  3JYH A;  3V5X A;  1D0X A;  3TOL A;  2WVO A;  2E87 A;  4IRU A;  3ZDL A;  5E2Q A;  3SP1 A;  2ZXP A;  4YL0 A;  4O6M A;  4IAQ A;  4OIR F;  4CSA C;  1H9T A;  1K40 A;  2EPO A;  3U9M A;  2KNH A;  2IXO A;  2J9B A;  2LD6 A;  2OG2 A;  2LQG A;  2VC9 A;  3HNI A;  2RD9 A;  2YLG A;  4KBL A;  4MVR A;  4MW8 A;  4BEJ A;  3FHD A;  2OEV A;  4PR9 A;  4CIH A;  3FAJ A;  5B1B C;  3NG1 A;  1YAR O;  2Y3H A;  3Q6M A;  5DS5 A;  2R7S A;  2QUP A;  2X51 A;  3SXY A;  4H54 A;  3RKO F;  3RYL A;  2XLO A;  3EG9 A;  4G7Z F;  4I44 A;  5A69 A;  1Z5Z A;  1CGO A;  1J8M F;  3KYI A;  3IQC A;  4JJF A;  3T4R A;  4ULW A;  2R7V A;  2Q9C A;  3VAY A;  4A4A A;  3W8I A;  5L0D A;  4CS9 A;  4Q7C A;  1VOM A;  2VCB A;  1T6Q A;  4KI2 A;  1DOW A;  3S29 A;  2FAP B;  4ANJ A;  3FOO A;  1W2W A;  4EBJ A;  4EKW A;  4C7O A;  1UFB A;  2Q4F A;  4PAC A;  3HNJ A;  4N6H A;  3RW0 A;  3JZ0 A;  3JSZ A;  1KU2 A;  3GAN A;  3GEI A;  3DMD A;  3EGX A;  2B0H A;  3ZWI A;  5KYW A;  1TKN A;  2XL4 A;  3IHU A;  2DYS C;  3JT1 A;  5EK0 A;  3GWL A;  4PFO A;  1LI5 A;  2P7V A;  2EPK X;  3EGX B;  2Y3B A;  2WB7 A;  4JC7 A;  4QDL A;  3A11 A;  3OA1 A;  4CS8 A;  1I5N A;  1C02 A;  1FFH A;  4PFP A;  3V7O A;  3KKB A;  5BUO A;  4DVY P;  5HV9 A;  1HW2 A;  2GFH A;  1ZHW A;  3DZA A;  2NG1 A;  2YL0 A;  1MND A;  1WOL A;  4BJT A;  4I1O B;  2EIL C;  3PDM P;  2G3V A;  2IXP A;  4NQF A;  3LAY A;  3HNL A;  3O55 A;  3U3F A;  4EIY A;  1OCO C;  2KSF A;  5KYY A;  1G4U S;  2Y3G A;  2R7R A;  2R03 A;  3TJ6 A;  3UR3 C;  4N06 A;  3WOD F;  1G8X A;  1D0Z A;  2A68 F;  2AP3 A;  3DE9 A;  1QSP A;  3RVY A; 
#chains in the Genus database with same CATH homology
 4PR9 A;  1RKE B;  1XWJ A;  5L0J A;  2HSQ A;  2B0H A;  2L7A A;  1ST6 A;  3H2V A;  5L0C A;  5L0H A;  1YDI A;  5FZT A;  4E18 A;  1TR2 A;  5L0G A;  4W8P A;  3VF0 A;  1ZW3 A;  2GDC A;  1H6G A;  4K1O A;  4ONS A;  1RKC A;  4E17 A;  3T6G B;  1SYQ A;  1ZW2 A;  4DJ9 A;  5L0I A;  3MYI A;  1ZVZ A;  2X0C A;  1U89 A;  5L0F A;  5L0D A;  3ZDL A;  4P9T A;  3TJ5 A;  1DOV A;  3RF3 A;  2GWW A;  3S90 A;  1DOW A;  1T01 A;  3TJ6 A;  1U6H A;  1RKE A;  2IBF A;  3H2U A;  4IGG A;  2LQG A;  1L7C A;  1QKR A;  4EHP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...