1DOWA

Crystal structure of a chimera of beta-catenin and alpha-catenin
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
205
structure length
205
Chain Sequence
b'KAHVLAASVEQATENFLEKGDKIAKESQFLKEELVVAVEDVRKQGDLMKSAAGEFADDPCSSVKRGNMVRAARALLSAVTRLLILADMADVYKLLVQLKVVEDGILKLRNAGNEQDLGIQYKALKPEVDKLNIMAAKRQQELKDVGNRDQMAAARGILQKNVPILYTASQACLQHPDVAAYKANRDLIYKQLQQAVTGISNAAQA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ALPHA-CATENIN
publication title Structure of the dimerization and beta-catenin-binding region of alpha-catenin.
pubmed doi rcsb
source organism Mus musculus
molecule tags Cell adhesion
total genus 84
structure length 205
sequence length 205
ec nomenclature
pdb deposition date 1999-12-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 1dowA00
2HSQA 3MYIA 1QKRA 2GDCA 1SYQA 1TR2A 1YDIA 2X0CA 1RKCA 4ONSA 4P9TA 4PR9A 4W8PA 4EHPA 3S90A 1T01A 1DOWA 5L0CA 1RKEA 3T6GB 2B0HA 1U6HA 4IGGA 3ZDLA 5L0HA 1ZW3A 3TJ6A 2IBFA 5L0IA 2LQGA 1RKEB 4E18A 3RF3A 1ZVZA 4K1OA 1ST6A 1ZW2A 1DOVA 5L0FA 3TJ5A 1XWJA 3VF0A 4E17A 1H6GA 4DJ9A 2L7AA 1U89A 5L0GA 3H2UA 1L7CA 5L0DA 3H2VA 5FZTA 5L0JA 2GWWA
chains in the Genus database with same CATH superfamily
4BEJA 4JKVA 2HSQA 2A0UA 2KK1A 2HUJA 1HY5A 4LDRA 2YL3A 3SNHA 1APCA 3LESA 4BPMA 2IXOA 2YL1A 2WZGA 5JT4A 2OCCC 3O6XA 4BJ1A 2L9JA 1CPRA 2VCAA 2NUTB 1V4AA 3T6GB 3C7JA 5DS5A 1OCOC 3ASNC 3JTLO 4U5HA 1QPUA 4I44A 3WODF 4G7OF 2CNWD 1TWHA 3MFNA 4UDVA 3GM3A 2LK4A 2YL7A 1E86A 3RQFA 4CJOA 3DMDA 3KKBA 1G8XA 3EG9B 3GWNA 2Q9BA 4EUKB 4HFFB 1JPJA 5JRAA 4MTGA 1V55C 4ZLCA 2YKZA 4WGYA 4U5BE 3RYLA 4DBQA 2KC3A 1YA7O 2J8WA 3IQ6A 2VASA 2LD6A 5COGA 1SZIA 1O5HA 1ZHYA 1Z3IX 2P6VA 4I3MA 1A7DA 5KYYB 3EGDA 4CX9A 4RD9A 3LS1A 3C8ZA 4ER9A 3RW0A 3IQCA 2C03A 1D0ZA 3LAYA 4JJFA 1PD1A 1LS4A 3EGXB 1NLXA 2YLDA 3US6A 4D4XA 2P1AA 1OW7A 1RKEA 1C03A 2W4MA 3FAJA 3GEIA 3JCUQ 3KYJA 1KNYA 4FX5A 3S28A 3WHNA 3JRMO 2WVOA 1CPQA 1T6QA 4JCZA 2MWQA 2R7SA 1M56C 1TFKB 4YN0B 2RD9A 4CDAA 1ORJA 1TWAA 1D0YA 2P61A 3K1IA 4FESA 1Q0KA 2CW0F 1JAFA 1C17M 1DOVA 4YT4A 3POVA 1XWJA 5JP7A 1OCRC 5JS5A 4KNVA 1XZQA 3EFOA 3MX3A 1VB5A 2HFIA 3M4BA 3Q6NA 5KYNA 3NYMA 3QMKA 1RMVA 3ZTZA 1T6UA 5A6BA 4XQ1A 4HEAJ 2OEXA 2GWWA 5L0GA 2JD3A 4XPWA 3S84A 1VYKA 3Q6MA 1JRAA 4KNWA 4ULVA 2R7VA 3V5ZA 2ZD9A 1TKNA 1DOWA 2J9WA 2WVNA 2YL0A 3W4YA 3AQCA 4ULWA 3TQOA 5JVEA 3B0UX 3K33A 1M6TA 2J0XA 4Q5SF 3K7DA 1NG1A 1FMVA 1ORSC 2R02A 4OIRF 1LKXA 3T6BA 1HMDA 1BR2A 1GS9A 1OCZC 4ZLDA 2VCBA 3LEVA 4OINF 3VM6A 2FFHA 1G5ZA 2LFFA 4YWQA 5A6BD 1BZ4A 4KBLA 2J7PD 3OA1A 3VF0A 2R7UA 4DBRA 3U2MA 5GPGB 3DI5A 5KYXA 2V26A 5KYWA 2A6EF 5D92A 4H54A 3UNGC 3W2VA 3EHMA 4CS9A 3EGDB 2Y3HA 2X0CA 2MYSA 1JMWA 2ICWG 3MLGA 2AWYA 1RCPA 4IB4A 5AGFA 1ZW3A 3RH3A 1CGOA 4CS8C 1RKEB 4WJ0A 5F28E 3RVYA 3JZ0A 1K04A 3S29A 1IW7F 1A7EA 1OW8A 3DZAA 4N4WA 4U5DE 4NCQA 4A2NB 4HE8D 3FVYA 3RFYA 1WATA 1Q0FA 2X51A 2ZPAA 2HSBA 4NTFA 3TJ5A 3U2LA 4DOZA 3K1HA 4R32A 4XEFA 2XL6A 3EZHA 2ASRA 4MQ9F 1FFHA 1H6GA 3H65A 4FAPB 2XS1A 1L7CA 2KJGA 2WZFA 2YZSA 1J8YF 3EFOB 1BR1A 2Q9CA 2R7QA 3UR3C 1MQVA 3HNJA 4CSAC 3NDBB 2Q9AA 4YK5A 1V54C 3F46A 1TR2A 2E87A 4P6IC 4PJMA 1MNDA 3G4ZA 4WGZA 1JOGA 1VOMA 2YQYA 2LCHA 1V74B 3C63A 3EHNA 4CS8A 1D0XA 1FNTc 2CDQA 1K40A 3ITFA 1H7IA 2XXAA 1ZU5A 5DQZA 2XLMA 2QUPA 4OD5A 1M57C 5HSWA 4OIOF 1XZPA 2OU6A 4YT5A 1UG7A 1FTSA 2PX0A 2BL2A 4CJGA 5L0FA 4O6NA 1MMAA 3C62A 3SXYA 4D4NA 1RXQA 2J46A 4E17A 3FAPB 2CYDA 3EPVA 3OWTA 3CQZA 3OEOA 3ZWIA 4G78A 4QI2A 4CSAA 3L8JA 3HNIA 3KL4A 4E0HA 4JJGA 2YLIA 4K7BA 1LE4A 2R05A 4BJ5C 5CI9A 4YL0A 2RSEB 3IPMO 5EHHA 5KYXB 5KYWB 5E3CA 1YDIA 3SXMA 3PHF2 4LACB 5BQHA 4CIHA 4U9DA 5L0JA 2HKVA 4MNDA 2VC9A 1U0BB 2JPUA 2L81A 3TOLA 2M64A 5CIVA 2QLAA 4WABA 3ABKC 2AVKA 2H7VC 2J9BA 3V7OA 1YYJA 5D91A 2PBEA 3TULA 4Q4ZF 2G3VA 1HE9A 1U89A 5CI8A 1A0BA 5B1BC 2IXNA 5T3WA 4C7OA 1VK5A 1WTYA 2J0WA 2EPOA 2VCCA 2UUIA 5KYUA 1SYQA 3ZG1A 2Y3DA 3NKEA 4ONSA 1SF8A 1G4US 1QSPA 4P9TA 4PR9A 1T01A 3S90A 5L0CA 1NU9C 4IARA 4PK4A 3RVZA 4EBJA 1YZAA 1K05A 1QZXA 3HNKA 3LUTB 3PCVA 3NYLA 3HLZA 1TWCA 3QW1A 4O6YA 4O79A 4JE9A 1E2XA 4RBNA 4XLNF 3U8VA 4LLEA 3HTKC 4EWCA 5A69A 1VLSA 3KH2A 4J32B 1MMGA 1RJ9A 2Y3BA 4YL1A 4YL3A 3E9VA 4DRHB 2XXAB 1WWPA 4RDAA 4EIYA 4Z9IA 4JURI 5E33A 3C8GA 5TJ5E 4DRJB 4P9FA 1Z63A 3GM1A 2EPNA 1R5ID 3LLKA 1GGQA 2Q7RA 2OOCA 3DAFA 3H2UA 4IRUA 4Z9HA 3H2VA 3JYYA 3DWWA 2BE5F 3CAXA 4PJLA 2EIMC 3ZQYA 1EQ1A 4IJJA 1FMWA 2HV6A 1SMYF 2IXPA 4U5FE 3JSEO 2A1DD 3LNRA 3JT1A 1BR4A 3U3FA 2C04A 3IHUA 4FWVA 2QTVA 2M4EA 4YJWA 5DVWA 3ZIBA 4B6IA 4IGGA 1U6HA 2DGJA 1A7VA 2XRHA 3L34A 1ZHZA 1QQ3A 3CZ6A 1S05A 5BQGA 5EGYA 3SXKA 3C8GD 4JVSA 3PDMP 3L8IA 2MHRA 4YT2A 3W2WA 2LIGA 4JIOA 2GA0A 1YAUO 4C3EA 2R9RB 4AE4A 3C18A 3DXJF 3EJNA 1OCCC 2L7AA 2HZ8A 3A9CA 2QY9A 3GANA 4MTFA 5COMA 3DJUB 5DQTA 3AOUA 1WASA 4Z9JA 2OJQA 2XM0A 4NTBA 3JSZA 4AL0A 3KYIA 3BEHA 3NMKA 2XS8A 4C7OB 5F5HA 2WVQA 3O10A 2QNLA 2A68F 2D4UA 3KMIA 4CBEA 5KYUB 1EA8A 2I15A 5E2QA 3K6BA 4YT8A 2YHSA 4PFOA 4CDVA 4EKWA 4MVZA 2DYRC 3Q7LA 4N06A 2LSEA 4XEVA 2JX0A 3FDQA 4AL1A 3CSKA 4DJ9A 1I5NA 3FMSA 2L6HA 1ZW2A 4F4BA 2XLHA 1M2VA 3JYHA 5B3IA 1RJ9B 5COFA 3FXHA 3N24A 5AC4A 3NYJA 4IAOA 4G7ZF 2Z15A 3LS0A 3R7CA 3C8GB 2EIJC 1ZYRF 3QVZA 3RQEA 3HJCA 3HKKA 2ZXPA 5JLIA 2XM4A 3S0XA 2F22A 1QVXA 5DS6A 1YZCA 2PP4A 3HNLA 4DXWA 2EPMX 2Y69C 3O39A 4GYTA 4O6MA 3PMRA 5B3SC 2I8BA 4W8KA 1O3UA 3ASOC 3SXZA 5JUAA 2DYSC 2LP4A 2OEVA 5L0HA 1PD0A 256BA 2HMZA 3U9JA 3Q7GA 3ZDLA 3UMKA 3GORA 4JTAB 2IBFA 4JRZA 2L6FA 1VYIA 2W45A 2EINC 2FAPB 3A11A 3TJ6A 5A6AA 1YJGA 2R7TA 4KC9A 1T5OA 1YA9A 2AU5A 3GWLA 4JEBA 3SYNA 1D1CA 1LPEA 2XLVA 3ABLC 4NY3A 1OKKA 1QLEC 2D5RB 5A6JA 3UGPA 4J30B 3B0PA 1D1BA 1Q0GA 3DE9A 3AG2C 3TK0A 3W8HA 1MNEA 1Z5ZA 2PFDA 2UUHA 3DM5A 3O55A 3QVYA 5JSLA 3T4RA 2EPLX 4AE4B 1LI5A 2J9UA 2Y3GA 4U5CE 2ZXWC 3EGXA 3DJNB 4JEAA 2XLOA 4C3DA 4G7HF 4NC3A 2KQ9A 2LFDA 2WL8A 3V5XA 3ZSUA 3FHDA 2YWAA 4A4AA 5EK0A 2IOQA 4OIPF 2Q4FA 1FAPB 1LE2A 1Y4CA 3TOMA 3N2ZB 4EBBA 1EKYA 2TMVP 1L3PA 4XEKA 2G62A 3AQBA 1ZHXA 3ZTMA 1Y6DA 4CS7A 1ZVZA 1LM3B 1T6IA 4KI2A 5K0IA 1G4WR 4DVZA 4K0DA 5BQIA 1HW2A 4MVQA 2A6HF 5T3TA 3G50A 4LDKA 3AG1C 3T9OA 4M63A 1HE1A 3VYWA 4EBKA 2V3CC 4IAQA 1M2VB 1ZHWA 2IM8A 2L6GA 5E3AA 4MW8A 3FOPA 4MVUA 4MS2A 1Z23A 2GDCA 4U5GA 2KYHA 4BJ5A 1HW1A 2Q00A 2WZLA 3JRTA 4PJNA 3U3BA 4MW3A 4U5EE 4JTCB 5AC5A 2YRFA 4J7TA 1E84A 2B0HA 3VAYA 1CGME 2O9XA 3FOOA 2NSFA 2ETSA 3TD7A 3RKOF 4XLPF 4JCHA 1VTMP 1ZHTA 4J7YA 2P0NA 4JZAA 3S9OA 3K1IC 3IQTA 3DD7A 1E85A 4I1MA 3DM9B 1PCXA 1LI7A 3M4CA 4XWJA 1FFTC 3SEOA 3U5SA 2DB4A 2ZXRA 3B9QA 4QDLA 1I4ZA 2FGYA 2PNOA 2YVKA 3L0IA 5B1AC 1MMNA 3S27A 3LNMB 3ZC4A 4DVYP 3DKAA 3LEOA 3AG3C 3ATPA 2R25A 3MYFA 3VRCA 2B0JA 4MVRA 2G3KA 1KTMA 1SR2A 3U8PA 3EQLF 4CS9C 1JR8A 4G0HA 1Z6AA 4QI0A 2A69F 2W9YA 4LDQA 3GODA 4CIPA 4GQHA 2NG1A 1YARO 4Q7CA 2HJ3A 1GQAA 3B71A 4N6HA 1IZMA 1NSGB 3WG7C 2VB6A 3ABMC 1F1MA 1JPNA 3EH1A 3QTHA 5FCLA 5L0IA 2Q3TA 3J06A 4K1OA 1R4TA 2HMQA 1HMOA 2HS5A 4GEHA 4I1OB 3UMHA 2GAQA 4MVSA 4MVMA 1WN0A 3AG4C 1OR3A 4JTDB 1VMAA 2NPUA 1CGNA 3GEHA 2XLWA 1NFNA 1M2OA 2OQMA 3NMIA 1J8MF 1OW6A 2EIKC 3KPHA 4PACA 3X2QC 4BJ6C 2J7PA 3NG1A 4OIQF 4DRIB 2DI3A 5L0DA 1GM5A 4AK9A 2CGEA 2YLGA 3MYIA 1I4YA 3EZIA 3N0TA 2Y39A 1ZU4A 2IXMA 2J9VA 2NSGA 1A41A 2R03A 3G4XA 3RIPA 4EHPA 2YEVA 5DS4A 2EILC 1H9TA 2NUPA 2ZXOA 2HJMA 1AVOB 2OG2A 5L3QA 3UMIA 4NTAA 4H4KC 2R7XA 2LQGA 1OXBA 1LIHA 4JC7A 4PJJA 1N1CA 4N6CA 5HV9A 4BEMJ 4ANJA 2VH3A 3I4UA 2HV7A 2R7WA 3B0VC 1BDJB 2KW3C 3I5QA 5BUOA 2XLDA 2XLEA 1Q0DA 3AJMA 4BJ6A 1FR0A 2AWCA 3UGOA 2WB7A 3M79A 4L6RA 3T6JA 3W8IA 3AGUA 1H9GA 1NBBA 2H7BA 2IYLD 4BG0A 2H7OA 3NRHA 2GFHA 4E7SA 1QKRA 1NU7D 3R2PA 4LLCA 2XL8A 1UFBA 1TFOB 1ZZPA 2PX3A 1W2WA 3M15A 1Z7Qc 2NUTA 4MTOA 3QW0A 4W8PA 1ORYA 3MBGA 3NKDA 4X0RA 4AX2A 3QZCA 3IEEA 4CDYA 3I5PA 1MMDA 3EG9A 1NZEA 3ZQVA 4E18A 1S7ZA 2EPKX 4XPYA 1YYXA 4HFKB 1WGWA 1TWGA 4XTKA 3BRJA 2KNHA 2KSFA 1KU2A 4XPXA 4OD4A 3GM2A 5KYYA 1Q0MA 2XL4A 1AUEA 5F5FA 1T9KA 3U9MA 1D1AA 4MVOA 3F47A 3DAGA 1EI7A 2QE9A 1O87A 5FZTA 1LS1A 2A0BA 5L3VA 3RQGA 5DLJA 2R7RA 3X1OA 3K66A 4U9EA 1B68A 4C3BA 3DE8A 1LVKA 2AP3A 3L1MA 1RKCA 3NMJA 1E83A 1BBHA 4O7GA 2P7VA 3E70C 4E0IA 1NFOA 3LJBA 1PV3A 2XSEA 1OR2A 3SZRA 3LLIA 2R7OA 1C02A 1WOLA 2BC5A 2J45A 3CEXA 1OXKA 2NUPB 4JW1A 3ECSA 1TQGA 4PFPA 3M1CB 3RF3A 3ZVRA 1OKKD 1ST6A 1YVIA 4E7ZA 2CNWA 2H8AA 2OKUA 3B29A 3EH2A 5IY5C 1OQCA 3V5YA 2W4BA 3AGTA 5T1DB 4LERA 1YLMA 2KGOA 4BJTA 2PF4E 3GEEA 3U0CA 3IQ5A 2CCYA 2OJED 4NQFA 5A6KA 3WAQA 4IWBA 3SP1A 1VLTA 1AEPA
chains in the Genus database with same CATH topology
2HSQA 3MYIA 1QKRA 2GDCA 1SYQA 1TR2A 1YDIA 2X0CA 1RKCA 4ONSA 4P9TA 4PR9A 4W8PA 4EHPA 3S90A 1T01A 1DOWA 5L0CA 1RKEA 3T6GB 2B0HA 1U6HA 4IGGA 3ZDLA 5L0HA 1ZW3A 3TJ6A 2IBFA 5L0IA 2LQGA 1RKEB 4E18A 3RF3A 1ZVZA 4K1OA 1ST6A 1ZW2A 1DOVA 5L0FA 3TJ5A 1XWJA 3VF0A 4E17A 1H6GA 4DJ9A 2L7AA 1U89A 5L0GA 3H2UA 1L7CA 5L0DA 3H2VA 5FZTA 5L0JA 2GWWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HSQ A;  3MYI A;  1QKR A;  2GDC A;  1SYQ A;  1TR2 A;  1YDI A;  2X0C A;  1RKC A;  4ONS A;  4P9T A;  4PR9 A;  4W8P A;  4EHP A;  3S90 A;  1T01 A;  1DOW A;  5L0C A;  1RKE A;  3T6G B;  2B0H A;  1U6H A;  4IGG A;  3ZDL A;  5L0H A;  1ZW3 A;  3TJ6 A;  2IBF A;  5L0I A;  2LQG A;  1RKE B;  4E18 A;  3RF3 A;  1ZVZ A;  4K1O A;  1ST6 A;  1ZW2 A;  1DOV A;  5L0F A;  3TJ5 A;  1XWJ A;  3VF0 A;  4E17 A;  1H6G A;  4DJ9 A;  2L7A A;  1U89 A;  5L0G A;  3H2U A;  1L7C A;  5L0D A;  3H2V A;  5FZT A;  5L0J A;  2GWW A; 
#chains in the Genus database with same CATH topology
 4BEJ A;  4JKV A;  2HSQ A;  2A0U A;  2KK1 A;  2HUJ A;  1HY5 A;  4LDR A;  2YL3 A;  3SNH A;  1APC A;  3LES A;  4BPM A;  2IXO A;  2YL1 A;  2WZG A;  5JT4 A;  2OCC C;  3O6X A;  4BJ1 A;  2L9J A;  1CPR A;  2VCA A;  2NUT B;  1V4A A;  3T6G B;  3C7J A;  5DS5 A;  1OCO C;  3ASN C;  3JTL O;  4U5H A;  1QPU A;  4I44 A;  3WOD F;  4G7O F;  2CNW D;  1TWH A;  3MFN A;  4UDV A;  3GM3 A;  2LK4 A;  2YL7 A;  1E86 A;  3RQF A;  4CJO A;  3DMD A;  3KKB A;  1G8X A;  3EG9 B;  3GWN A;  2Q9B A;  4EUK B;  4HFF B;  1JPJ A;  5JRA A;  4MTG A;  1V55 C;  4ZLC A;  2YKZ A;  4WGY A;  4U5B E;  3RYL A;  4DBQ A;  2KC3 A;  1YA7 O;  2J8W A;  3IQ6 A;  2VAS A;  2LD6 A;  5COG A;  1SZI A;  1O5H A;  1ZHY A;  1Z3I X;  2P6V A;  4I3M A;  1A7D A;  5KYY B;  3EGD A;  4CX9 A;  4RD9 A;  3LS1 A;  3C8Z A;  4ER9 A;  3RW0 A;  3IQC A;  2C03 A;  1D0Z A;  3LAY A;  4JJF A;  1PD1 A;  1LS4 A;  3EGX B;  1NLX A;  2YLD A;  3US6 A;  4D4X A;  2P1A A;  1OW7 A;  1RKE A;  1C03 A;  2W4M A;  3FAJ A;  3GEI A;  3JCU Q;  3KYJ A;  1KNY A;  4FX5 A;  3S28 A;  3WHN A;  3JRM O;  2WVO A;  1CPQ A;  1T6Q A;  4JCZ A;  2MWQ A;  2R7S A;  1M56 C;  1TFK B;  4YN0 B;  2RD9 A;  4CDA A;  1ORJ A;  1TWA A;  1D0Y A;  2P61 A;  3K1I A;  4FES A;  1Q0K A;  2CW0 F;  1JAF A;  1C17 M;  1DOV A;  4YT4 A;  3POV A;  1XWJ A;  5JP7 A;  1OCR C;  5JS5 A;  4KNV A;  1XZQ A;  3EFO A;  3MX3 A;  1VB5 A;  2HFI A;  3M4B A;  3Q6N A;  5KYN A;  3NYM A;  3QMK A;  1RMV A;  3ZTZ A;  1T6U A;  5A6B A;  4XQ1 A;  4HEA J;  2OEX A;  2GWW A;  5L0G A;  2JD3 A;  4XPW A;  3S84 A;  1VYK A;  3Q6M A;  1JRA A;  4KNW A;  4ULV A;  2R7V A;  3V5Z A;  2ZD9 A;  1TKN A;  1DOW A;  2J9W A;  2WVN A;  2YL0 A;  3W4Y A;  3AQC A;  4ULW A;  3TQO A;  5JVE A;  3B0U X;  3K33 A;  1M6T A;  2J0X A;  4Q5S F;  3K7D A;  1NG1 A;  1FMV A;  1ORS C;  2R02 A;  4OIR F;  1LKX A;  3T6B A;  1HMD A;  1BR2 A;  1GS9 A;  1OCZ C;  4ZLD A;  2VCB A;  3LEV A;  4OIN F;  3VM6 A;  2FFH A;  1G5Z A;  2LFF A;  4YWQ A;  5A6B D;  1BZ4 A;  4KBL A;  2J7P D;  3OA1 A;  3VF0 A;  2R7U A;  4DBR A;  3U2M A;  5GPG B;  3DI5 A;  5KYX A;  2V26 A;  5KYW A;  2A6E F;  5D92 A;  4H54 A;  3UNG C;  3W2V A;  3EHM A;  4CS9 A;  3EGD B;  2Y3H A;  2X0C A;  2MYS A;  1JMW A;  2ICW G;  3MLG A;  2AWY A;  1RCP A;  4IB4 A;  5AGF A;  1ZW3 A;  3RH3 A;  1CGO A;  4CS8 C;  1RKE B;  4WJ0 A;  5F28 E;  3RVY A;  3JZ0 A;  1K04 A;  3S29 A;  1IW7 F;  1A7E A;  1OW8 A;  3DZA A;  4N4W A;  4U5D E;  4NCQ A;  4A2N B;  4HE8 D;  3FVY A;  3RFY A;  1WAT A;  1Q0F A;  2X51 A;  2ZPA A;  2HSB A;  4NTF A;  3TJ5 A;  3U2L A;  4DOZ A;  3K1H A;  4R32 A;  4XEF A;  2XL6 A;  3EZH A;  2ASR A;  4MQ9 F;  1FFH A;  1H6G A;  3H65 A;  4FAP B;  2XS1 A;  1L7C A;  2KJG A;  2WZF A;  2YZS A;  1J8Y F;  3EFO B;  1BR1 A;  2Q9C A;  2R7Q A;  3UR3 C;  1MQV A;  3HNJ A;  4CSA C;  3NDB B;  2Q9A A;  4YK5 A;  1V54 C;  3F46 A;  1TR2 A;  2E87 A;  4P6I C;  4PJM A;  1MND A;  3G4Z A;  4WGZ A;  1JOG A;  1VOM A;  2YQY A;  2LCH A;  1V74 B;  3C63 A;  3EHN A;  4CS8 A;  1D0X A;  1FNT c;  2CDQ A;  1K40 A;  3ITF A;  1H7I A;  2XXA A;  1ZU5 A;  5DQZ A;  2XLM A;  2QUP A;  4OD5 A;  1M57 C;  5HSW A;  4OIO F;  1XZP A;  2OU6 A;  4YT5 A;  1UG7 A;  1FTS A;  2PX0 A;  2BL2 A;  4CJG A;  5L0F A;  4O6N A;  1MMA A;  3C62 A;  3SXY A;  4D4N A;  1RXQ A;  2J46 A;  4E17 A;  3FAP B;  2CYD A;  3EPV A;  3OWT A;  3CQZ A;  3OEO A;  3ZWI A;  4G78 A;  4QI2 A;  4CSA A;  3L8J A;  3HNI A;  3KL4 A;  4E0H A;  4JJG A;  2YLI A;  4K7B A;  1LE4 A;  2R05 A;  4BJ5 C;  5CI9 A;  4YL0 A;  2RSE B;  3IPM O;  5EHH A;  5KYX B;  5KYW B;  5E3C A;  1YDI A;  3SXM A;  3PHF 2;  4LAC B;  5BQH A;  4CIH A;  4U9D A;  5L0J A;  2HKV A;  4MND A;  2VC9 A;  1U0B B;  2JPU A;  2L81 A;  3TOL A;  2M64 A;  5CIV A;  2QLA A;  4WAB A;  3ABK C;  2AVK A;  2H7V C;  2J9B A;  3V7O A;  1YYJ A;  5D91 A;  2PBE A;  3TUL A;  4Q4Z F;  2G3V A;  1HE9 A;  1U89 A;  5CI8 A;  1A0B A;  5B1B C;  2IXN A;  5T3W A;  4C7O A;  1VK5 A;  1WTY A;  2J0W A;  2EPO A;  2VCC A;  2UUI A;  5KYU A;  1SYQ A;  3ZG1 A;  2Y3D A;  3NKE A;  4ONS A;  1SF8 A;  1G4U S;  1QSP A;  4P9T A;  4PR9 A;  1T01 A;  3S90 A;  5L0C A;  1NU9 C;  4IAR A;  4PK4 A;  3RVZ A;  4EBJ A;  1YZA A;  1K05 A;  1QZX A;  3HNK A;  3LUT B;  3PCV A;  3NYL A;  3HLZ A;  1TWC A;  3QW1 A;  4O6Y A;  4O79 A;  4JE9 A;  1E2X A;  4RBN A;  4XLN F;  3U8V A;  4LLE A;  3HTK C;  4EWC A;  5A69 A;  1VLS A;  3KH2 A;  4J32 B;  1MMG A;  1RJ9 A;  2Y3B A;  4YL1 A;  4YL3 A;  3E9V A;  4DRH B;  2XXA B;  1WWP A;  4RDA A;  4EIY A;  4Z9I A;  4JUR I;  5E33 A;  3C8G A;  5TJ5 E;  4DRJ B;  4P9F A;  1Z63 A;  3GM1 A;  2EPN A;  1R5I D;  3LLK A;  1GGQ A;  2Q7R A;  2OOC A;  3DAF A;  3H2U A;  4IRU A;  4Z9H A;  3H2V A;  3JYY A;  3DWW A;  2BE5 F;  3CAX A;  4PJL A;  2EIM C;  3ZQY A;  1EQ1 A;  4IJJ A;  1FMW A;  2HV6 A;  1SMY F;  2IXP A;  4U5F E;  3JSE O;  2A1D D;  3LNR A;  3JT1 A;  1BR4 A;  3U3F A;  2C04 A;  3IHU A;  4FWV A;  2QTV A;  2M4E A;  4YJW A;  5DVW A;  3ZIB A;  4B6I A;  4IGG A;  1U6H A;  2DGJ A;  1A7V A;  2XRH A;  3L34 A;  1ZHZ A;  1QQ3 A;  3CZ6 A;  1S05 A;  5BQG A;  5EGY A;  3SXK A;  3C8G D;  4JVS A;  3PDM P;  3L8I A;  2MHR A;  4YT2 A;  3W2W A;  2LIG A;  4JIO A;  2GA0 A;  1YAU O;  4C3E A;  2R9R B;  4AE4 A;  3C18 A;  3DXJ F;  3EJN A;  1OCC C;  2L7A A;  2HZ8 A;  3A9C A;  2QY9 A;  3GAN A;  4MTF A;  5COM A;  3DJU B;  5DQT A;  3AOU A;  1WAS A;  4Z9J A;  2OJQ A;  2XM0 A;  4NTB A;  3JSZ A;  4AL0 A;  3KYI A;  3BEH A;  3NMK A;  2XS8 A;  4C7O B;  5F5H A;  2WVQ A;  3O10 A;  2QNL A;  2A68 F;  2D4U A;  3KMI A;  4CBE A;  5KYU B;  1EA8 A;  2I15 A;  5E2Q A;  3K6B A;  4YT8 A;  2YHS A;  4PFO A;  4CDV A;  4EKW A;  4MVZ A;  2DYR C;  3Q7L A;  4N06 A;  2LSE A;  4XEV A;  2JX0 A;  3FDQ A;  4AL1 A;  3CSK A;  4DJ9 A;  1I5N A;  3FMS A;  2L6H A;  1ZW2 A;  4F4B A;  2XLH A;  1M2V A;  3JYH A;  5B3I A;  1RJ9 B;  5COF A;  3FXH A;  3N24 A;  5AC4 A;  3NYJ A;  4IAO A;  4G7Z F;  2Z15 A;  3LS0 A;  3R7C A;  3C8G B;  2EIJ C;  1ZYR F;  3QVZ A;  3RQE A;  3HJC A;  3HKK A;  2ZXP A;  5JLI A;  2XM4 A;  3S0X A;  2F22 A;  1QVX A;  5DS6 A;  1YZC A;  2PP4 A;  3HNL A;  4DXW A;  2EPM X;  2Y69 C;  3O39 A;  4GYT A;  4O6M A;  3PMR A;  5B3S C;  2I8B A;  4W8K A;  1O3U A;  3ASO C;  3SXZ A;  5JUA A;  2DYS C;  2LP4 A;  2OEV A;  5L0H A;  1PD0 A;  256B A;  2HMZ A;  3U9J A;  3Q7G A;  3ZDL A;  3UMK A;  3GOR A;  4JTA B;  2IBF A;  4JRZ A;  2L6F A;  1VYI A;  2W45 A;  2EIN C;  2FAP B;  3A11 A;  3TJ6 A;  5A6A A;  1YJG A;  2R7T A;  4KC9 A;  1T5O A;  1YA9 A;  2AU5 A;  3GWL A;  4JEB A;  3SYN A;  1D1C A;  1LPE A;  2XLV A;  3ABL C;  4NY3 A;  1OKK A;  1QLE C;  2D5R B;  5A6J A;  3UGP A;  4J30 B;  3B0P A;  1D1B A;  1Q0G A;  3DE9 A;  3AG2 C;  3TK0 A;  3W8H A;  1MNE A;  1Z5Z A;  2PFD A;  2UUH A;  3DM5 A;  3O55 A;  3QVY A;  5JSL A;  3T4R A;  2EPL X;  4AE4 B;  1LI5 A;  2J9U A;  2Y3G A;  4U5C E;  2ZXW C;  3EGX A;  3DJN B;  4JEA A;  2XLO A;  4C3D A;  4G7H F;  4NC3 A;  2KQ9 A;  2LFD A;  2WL8 A;  3V5X A;  3ZSU A;  3FHD A;  2YWA A;  4A4A A;  5EK0 A;  2IOQ A;  4OIP F;  2Q4F A;  1FAP B;  1LE2 A;  1Y4C A;  3TOM A;  3N2Z B;  4EBB A;  1EKY A;  2TMV P;  1L3P A;  4XEK A;  2G62 A;  3AQB A;  1ZHX A;  3ZTM A;  1Y6D A;  4CS7 A;  1ZVZ A;  1LM3 B;  1T6I A;  4KI2 A;  5K0I A;  1G4W R;  4DVZ A;  4K0D A;  5BQI A;  1HW2 A;  4MVQ A;  2A6H F;  5T3T A;  3G50 A;  4LDK A;  3AG1 C;  3T9O A;  4M63 A;  1HE1 A;  3VYW A;  4EBK A;  2V3C C;  4IAQ A;  1M2V B;  1ZHW A;  2IM8 A;  2L6G A;  5E3A A;  4MW8 A;  3FOP A;  4MVU A;  4MS2 A;  1Z23 A;  2GDC A;  4U5G A;  2KYH A;  4BJ5 A;  1HW1 A;  2Q00 A;  2WZL A;  3JRT A;  4PJN A;  3U3B A;  4MW3 A;  4U5E E;  4JTC B;  5AC5 A;  2YRF A;  4J7T A;  1E84 A;  2B0H A;  3VAY A;  1CGM E;  2O9X A;  3FOO A;  2NSF A;  2ETS A;  3TD7 A;  3RKO F;  4XLP F;  4JCH A;  1VTM P;  1ZHT A;  4J7Y A;  2P0N A;  4JZA A;  3S9O A;  3K1I C;  3IQT A;  3DD7 A;  1E85 A;  4I1M A;  3DM9 B;  1PCX A;  1LI7 A;  3M4C A;  4XWJ A;  1FFT C;  3SEO A;  3U5S A;  2DB4 A;  2ZXR A;  3B9Q A;  4QDL A;  1I4Z A;  2FGY A;  2PNO A;  2YVK A;  3L0I A;  5B1A C;  1MMN A;  3S27 A;  3LNM B;  3ZC4 A;  4DVY P;  3DKA A;  3LEO A;  3AG3 C;  3ATP A;  2R25 A;  3MYF A;  3VRC A;  2B0J A;  4MVR A;  2G3K A;  1KTM A;  1SR2 A;  3U8P A;  3EQL F;  4CS9 C;  1JR8 A;  4G0H A;  1Z6A A;  4QI0 A;  2A69 F;  2W9Y A;  4LDQ A;  3GOD A;  4CIP A;  4GQH A;  2NG1 A;  1YAR O;  4Q7C A;  2HJ3 A;  1GQA A;  3B71 A;  4N6H A;  1IZM A;  1NSG B;  3WG7 C;  2VB6 A;  3ABM C;  1F1M A;  1JPN A;  3EH1 A;  3QTH A;  5FCL A;  5L0I A;  2Q3T A;  3J06 A;  4K1O A;  1R4T A;  2HMQ A;  1HMO A;  2HS5 A;  4GEH A;  4I1O B;  3UMH A;  2GAQ A;  4MVS A;  4MVM A;  1WN0 A;  3AG4 C;  1OR3 A;  4JTD B;  1VMA A;  2NPU A;  1CGN A;  3GEH A;  2XLW A;  1NFN A;  1M2O A;  2OQM A;  3NMI A;  1J8M F;  1OW6 A;  2EIK C;  3KPH A;  4PAC A;  3X2Q C;  4BJ6 C;  2J7P A;  3NG1 A;  4OIQ F;  4DRI B;  2DI3 A;  5L0D A;  1GM5 A;  4AK9 A;  2CGE A;  2YLG A;  3MYI A;  1I4Y A;  3EZI A;  3N0T A;  2Y39 A;  1ZU4 A;  2IXM A;  2J9V A;  2NSG A;  1A41 A;  2R03 A;  3G4X A;  3RIP A;  4EHP A;  2YEV A;  5DS4 A;  2EIL C;  1H9T A;  2NUP A;  2ZXO A;  2HJM A;  1AVO B;  2OG2 A;  5L3Q A;  3UMI A;  4NTA A;  4H4K C;  2R7X A;  2LQG A;  1OXB A;  1LIH A;  4JC7 A;  4PJJ A;  1N1C A;  4N6C A;  5HV9 A;  4BEM J;  4ANJ A;  2VH3 A;  3I4U A;  2HV7 A;  2R7W A;  3B0V C;  1BDJ B;  2KW3 C;  3I5Q A;  5BUO A;  2XLD A;  2XLE A;  1Q0D A;  3AJM A;  4BJ6 A;  1FR0 A;  2AWC A;  3UGO A;  2WB7 A;  3M79 A;  4L6R A;  3T6J A;  3W8I A;  3AGU A;  1H9G A;  1NBB A;  2H7B A;  2IYL D;  4BG0 A;  2H7O A;  3NRH A;  2GFH A;  4E7S A;  1QKR A;  1NU7 D;  3R2P A;  4LLC A;  2XL8 A;  1UFB A;  1TFO B;  1ZZP A;  2PX3 A;  1W2W A;  3M15 A;  1Z7Q c;  2NUT A;  4MTO A;  3QW0 A;  4W8P A;  1ORY A;  3MBG A;  3NKD A;  4X0R A;  4AX2 A;  3QZC A;  3IEE A;  4CDY A;  3I5P A;  1MMD A;  3EG9 A;  1NZE A;  3ZQV A;  4E18 A;  1S7Z A;  2EPK X;  4XPY A;  1YYX A;  4HFK B;  1WGW A;  1TWG A;  4XTK A;  3BRJ A;  2KNH A;  2KSF A;  1KU2 A;  4XPX A;  4OD4 A;  3GM2 A;  5KYY A;  1Q0M A;  2XL4 A;  1AUE A;  5F5F A;  1T9K A;  3U9M A;  1D1A A;  4MVO A;  3F47 A;  3DAG A;  1EI7 A;  2QE9 A;  1O87 A;  5FZT A;  1LS1 A;  2A0B A;  5L3V A;  3RQG A;  5DLJ A;  2R7R A;  3X1O A;  3K66 A;  4U9E A;  1B68 A;  4C3B A;  3DE8 A;  1LVK A;  2AP3 A;  3L1M A;  1RKC A;  3NMJ A;  1E83 A;  1BBH A;  4O7G A;  2P7V A;  3E70 C;  4E0I A;  1NFO A;  3LJB A;  1PV3 A;  2XSE A;  1OR2 A;  3SZR A;  3LLI A;  2R7O A;  1C02 A;  1WOL A;  2BC5 A;  2J45 A;  3CEX A;  1OXK A;  2NUP B;  4JW1 A;  3ECS A;  1TQG A;  4PFP A;  3M1C B;  3RF3 A;  3ZVR A;  1OKK D;  1ST6 A;  1YVI A;  4E7Z A;  2CNW A;  2H8A A;  2OKU A;  3B29 A;  3EH2 A;  5IY5 C;  1OQC A;  3V5Y A;  2W4B A;  3AGT A;  5T1D B;  4LER A;  1YLM A;  2KGO A;  4BJT A;  2PF4 E;  3GEE A;  3U0C A;  3IQ5 A;  2CCY A;  2OJE D;  4NQF A;  5A6K A;  3WAQ A;  4IWB A;  3SP1 A;  1VLT A;  1AEP A; 
#chains in the Genus database with same CATH homology
 2HSQ A;  3MYI A;  1QKR A;  2GDC A;  1SYQ A;  1TR2 A;  1YDI A;  2X0C A;  1RKC A;  4ONS A;  4P9T A;  4PR9 A;  4W8P A;  4EHP A;  3S90 A;  1T01 A;  1DOW A;  5L0C A;  1RKE A;  3T6G B;  2B0H A;  1U6H A;  4IGG A;  3ZDL A;  5L0H A;  1ZW3 A;  3TJ6 A;  2IBF A;  5L0I A;  2LQG A;  1RKE B;  4E18 A;  3RF3 A;  1ZVZ A;  4K1O A;  1ST6 A;  1ZW2 A;  1DOV A;  5L0F A;  3TJ5 A;  1XWJ A;  3VF0 A;  4E17 A;  1H6G A;  4DJ9 A;  2L7A A;  1U89 A;  5L0G A;  3H2U A;  1L7C A;  5L0D A;  3H2V A;  5FZT A;  5L0J A;  2GWW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...