1DOWA

Crystal structure of a chimera of beta-catenin and alpha-catenin
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
205
structure length
205
Chain Sequence
KAHVLAASVEQATENFLEKGDKIAKESQFLKEELVVAVEDVRKQGDLMKSAAGEFADDPCSSVKRGNMVRAARALLSAVTRLLILADMADVYKLLVQLKVVEDGILKLRNAGNEQDLGIQYKALKPEVDKLNIMAAKRQQELKDVGNRDQMAAARGILQKNVPILYTASQACLQHPDVAAYKANRDLIYKQLQQAVTGISNAAQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ALPHA-CATENIN
publication title Structure of the dimerization and beta-catenin-binding region of alpha-catenin.
pubmed doi rcsb
source organism Mus musculus
molecule tags Cell adhesion
total genus 84
structure length 205
sequence length 205
ec nomenclature
pdb deposition date 1999-12-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 1dowA00
4K1OA 2IBFA 1TR2A 1QKRA 5L0JA 5L0DA 4IGGA 4E18A 4ONSA 2GWWA 4W8PA 1XWJA 1H6GA 2B0HA 5L0FA 3ZDLA 2LQGA 1DOWA 3MYIA 3VF0A 1ZW3A 2HSQA 4P9TA 4PR9A 5FZTA 1RKCA 1T01A 2GDCA 1ZW2A 1RKEA 3RF3A 4EHPA 3T6GB 3TJ5A 2L7AA 1ZVZA 5L0GA 3S90A 5L0CA 5L0HA 5L0IA 1RKEB 3H2VA 1U89A 1U6HA 1DOVA 4E17A 1ST6A 3TJ6A 1L7CA 3H2UA 4DJ9A 1SYQA 1YDIA 2X0CA
chains in the Genus database with same CATH superfamily
1HW2A 4BPMA 1M2VB 2Q9BA 4CJOA 2HMQA 2M4EA 3AG3C 4U9EA 1MMGA 1TKNA 1YVIA 2GA0A 3C63A 4W8PA 5FCLA 5B1AC 4JCZA 1LI5A 2W4MA 3DWWA 2B0HA 4MVZA 2PX3A 2YL1A 4RDAA 3LJBA 4XTKA 4E0HA 1I4YA 2P1AA 1PD0A 3L0IA 4KC9A 4O6YA 3ASOC 4YT5A 1WN0A 1HMDA 1RCPA 2P7VA 1ZHTA 4HEAJ 4EHPA 3T6GB 3NYJA 4IARA 4NTBA 5CI9A 3U8VA 3N2ZB 2H7BA 1ZHWA 2EPLX 2P61A 4I3MA 5KYNA 3TULA 2TMVP 3FOPA 2FGYA 3LEVA 3TK0A 1ZU4A 4MW3A 1K04A 4HFFB 4YT8A 1RJ9A 3BEHA 3NKDA 3V5ZA 3H2UA 4BEMJ 2R7OA 2BL2A 1QPUA 1YA7O 1SYQA 2JPUA 1LS4A 1YDIA 4I1MA 3IQTA 3Q6NA 1CPQA 1OW8A 3DE8A 4JRZA 2XLVA 4LACB 4EBBA 4ER9A 3ZC4A 5JVEA 5KYWB 1Z63A 4G7OF 3K33A 4ONSA 5COFA 1BBHA 3TD7A 1VYIA 1ZZPA 1FR0A 2W9YA 5BUOA 1H6GA 2ETSA 5F5FA 4IB4A 3BRJA 2HSQA 3DE9A 4QDLA 1SR2A 2XSEA 3WAQA 1BR2A 2BE5F 2NSGA 3PDMP 1J8YF 1JRAA 3LNMB 4JEAA 3I5QA 3JSZA 4X0RA 1S7ZA 3UGOA 1OW7A 3O6XA 5D91A 1G5ZA 4BJ6C 3ABMC 2A69F 1NFOA 1OCOC 1WASA 2EINC 2IXPA 3GM2A 1MNDA 5COMA 1OKKD 3TOLA 1EKYA 2XLHA 2NUTA 2P0NA 1ZHZA 2IBFA 2BC5A 3EFOB 3OEOA 4MTFA 4MNDA 4BJTA 4YT2A 3T9OA 4E18A 1D1AA 4CS8C 5E3AA 4HFKB 1LE4A 3NMJA 3NMIA 1O3UA 2Y3BA 2IOQA 4E0IA 2YQYA 2R7SA 4GEHA 4HE8D 4XEFA 1YARO 3LUTB 3U2MA 4MVUA 2PFDA 3CSKA 3GEEA 3C18A 1T01A 1YZAA 3PMRA 4NC3A 1YYXA 3SXMA 3M4CA 1OR2A 2XRHA 3RIPA 1BR4A 1HW1A 1V55C 2XL8A 4EKWA 3RH3A 2YVKA 2CW0F 3JTLO 1RKEB 3M79A 1WTYA 3H2VA 4AL0A 4YT4A 2QE9A 3EHNA 2UUHA 3DM9B 1ST6A 3HKKA 1M6TA 2A68F 2LIGA 2KW3C 5EK0A 1FAPB 2XL4A 1HMOA 1M2OA 4O6NA 4KNWA 1TFOB 3B9QA 1E85A 2A0BA 1G4US 1VMAA 3HLZA 1FTSA 4K7BA 1C02A 3VAYA 3JT1A 1FNTc 4XLNF 1T5OA 5BQHA 2XLOA 1D1BA 3GEHA 4J7TA 4JTDB 3J06A 1AUEA 2CYDA 2LCHA 3EGXB 3V5YA 2PF4E 3VM6A 1YA9A 4R32A 5KYUB 3AG2C 2XS1A 2LD6A 2Q00A 5FZTA 3FMSA 1VYKA 2ZD9A 4IAQA 1D0ZA 1LIHA 3CEXA 1JR8A 2XM0A 3R7CA 1LM3B 2WVNA 4PJLA 2J9WA 2WZLA 4BJ6A 1NZEA 2Y3DA 3IHUA 2YL0A 3RYLA 3C8GD 5KYYB 4JTCB 1V4AA 2NUPB 4U5HA 1ZYRF 2J0XA 3SNHA 4IAOA 4JEBA 3LLIA 5B1BC 4EIYA 5KYXA 1EI7A 2ZXOA 2Y3HA 2LFFA 1C17M 5B3SC 3VYWA 3EH2A 2Q7RA 5HV9A 3B29A 1GS9A 4CS8A 1R4TA 5DS5A 1YYJA 4JJFA 1TQGA 3QW1A 2AP3A 4H54A 4MVMA 3V7OA 3W2WA 5B3IA 5A6BA 3K7DA 4OIRF 4OINF 3RVYA 1MMNA 3NDBB 3EZIA 4J30B 2A6HF 1ZW3A 4QI0A 2PP4A 4CDAA 2KJGA 4GYTA 2J9UA 1Z3IX 2OG2A 2WZGA 2V26A 2WZFA 2IXOA 2KQ9A 1T6IA 5A6AA 1FFHA 1JMWA 2J0WA 4BEJA 3SEOA 4PK4A 4CDYA 2Q9CA 3NYMA 1K05A 4Z9JA 3S9OA 2E87A 1M2VA 2OJED 1A7VA 2VCAA 1AEPA 3LLKA 3DAFA 4B6IA 1A41A 2CDQA 4LDQA 1SF8A 4U9DA 2ICWG 3JSEO 3UMKA 2Y69C 4DVYP 3ZQVA 1C03A 2LP4A 2A6EF 3QW0A 4JVSA 2DGJA 1H7IA 1QSPA 2CGEA 2LFDA 3NG1A 3AGTA 5L3VA 2EIJC 2R05A 4CS9C 2NPUA 2HJMA 2WVQA 3HNKA 3I4UA 1TWAA 3U2LA 3POVA 1FFTC 1E84A 4QI2A 3ECSA 4IRUA 5L0IA 4H4KC 4LLCA 3EQLF 3RQGA 3C8GB 5A6JA 4KBLA 2HV7A 4MW8A 3ZTMA 3RVZA 4MVRA 3QMKA 3DZAA 2H8AA 5KYWA 2VH3A 1PD1A 3HTKC 2Y39A 2R7UA 4CIPA 2WL8A 3MFNA 3O55A 3DAGA 3SZRA 4U5EE 4XPYA 4EWCA 4C7OB 4JJGA 2KYHA 3HJCA 1LKXA 2XS8A 3H65A 3K1HA 1LVKA 2EPNA 3AOUA 3MX3A 4FWVA 3FXHA 3MYIA 4PACA 1MMAA 4DOZA 4EBJA 4EUKB 2AU5A 4C3EA 1A7DA 2C03A 2H7VC 2H7OA 2J7PA 1S05A 1ZW2A 2W45A 3DI5A 5T1DB 1NG1A 2QY9A 3NKEA 1CGME 4D4XA 1YLMA 1O5HA 3ITFA 4G0HA 5A6KA 2EPMX 3DJUB 3LESA 3S27A 2AWYA 4CJGA 4G7HF 5CI8A 1MQVA 3UMIA 1LPEA 2ZXPA 3U5SA 3ZVRA 4J7YA 3FDQA 3AGUA 3EFOA 3ZWIA 1TFKB 4BG0A 3AJMA 3KMIA 1GM5A 1IW7F 1D0YA 4ZLCA 2YHSA 2CNWD 4OD5A 2HZ8A 2I15A 1NSGB 1K40A 2KGOA 3LEOA 1Y4CA 3Q7GA 3N0TA 2CCYA 3SXYA 3U9JA 2QTVA 3F46A 5F28E 3ZG1A 4CS9A 4MVSA 2Q4FA 4NTAA 4PR9A 2XXAB 1SZIA 2HS5A 5DS4A 5AC4A 1RKEA 2M64A 1OCRC 3JCUQ 2D4UA 2L7AA 3OWTA 2OCCC 3Q7LA 3TJ5A 4CDVA 4F4BA 4CSAC 1ORJA 4ULVA 3ZIBA 1VLTA 2Q9AA 2YLGA 3NMKA 4A4AA 2HV6A 2VCBA 5JP7A 3B0UX 2IXMA 1OQCA 2FAPB 4I1OB 3MYFA 2G3KA 1CGNA 3F47A 4JW1A 3RF3A 3T6BA 4I44A 2MYSA 2Y3GA 4FX5A 3FAJA 5L0JA 1H9GA 3EGXA 1HY5A 3NRHA 5KYUA 3K6BA 3N24A 4N4WA 2J9VA 3U0CA 3DKAA 2P6VA 1G8XA 1FMWA 2OQMA 3A11A 2OEVA 2EILC 3CAXA 4PJJA 5BQGA 3ZDLA 5AGFA 5L0FA 2X51A 5L3QA 4PJNA 1KU2A 1BR1A 3IQCA 3A9CA 5D92A 3ZSUA 1EA8A 3SYNA 1ORSC 2OJQA 1Q0DA 4AE4B 3LS1A 5KYYA 2PNOA 3C8ZA 2NUPA 3IQ5A 4CS7A 5BQIA 2IXNA 3S90A 4OD4A 1A0BA 3PCVA 1Z5ZA 4PFPA 4RD9A 1OKKA 2OU6A 3I5PA 1BDJB 4ZLDA 4J32B 4W8KA 4DRIB 1IZMA 5IY5C 4YN0B 1QLEC 3PHF2 1JPNA 3ATPA 4LLEA 2JD3A 5E3CA 3EG9B 5F5HA 2EIKC 2F22A 4U5FE 4CX9A 4C3BA 1HE9A 1V54C 2YZSA 3QZCA 2X0CA 2L6GA 3RQFA 4MTOA 3L8IA 5JUAA 4OIOF 3S84A 1W2WA 4U5BE 3CQZA 1GQAA 4DXWA 4PJMA 3DM5A 1WOLA 4JKVA 5E2QA 5TJ5E 5EGYA 2NSFA 4IJJA 3US6A 1LI7A 2KNHA 3G4ZA 4WABA 4XEVA 2GDCA 2AWCA 3GORA 4CSAA 1R5ID 3X2QC 2ZPAA 3L8JA 4GQHA 1OR3A 2YL7A 4JURI 3UMHA 3W2VA 2G62A 1U89A 2DI3A 4E17A 3JYHA 2FFHA 2L81A 3CZ6A 4OIQF 2HFIA 4CBEA 1CPRA 3M15A 4Q4ZF 4DRHB 1ZHYA 4N6CA 4YL1A 5GPGB 3TOMA 1NU9C 1BZ4A 1OW6A 4P9FA 3S0XA 4U5CE 5L0DA 2XLWA 1Q0GA 5DLJA 4DRJB 1VOMA 3IEEA 4DBRA 4XEKA 2KC3A 2NG1A 4LDRA 3RKOF 4A2NB 2A1DD 3M4BA 1I4ZA 3GODA 4P9TA 3IPMO 4ANJA 3UR3C 1O87A 2LK4A 2OKUA 3QVYA 3RFYA 2Z15A 3C8GA 2YL3A 1EQ1A 1YZCA 3C7JA 4UDVA 4JE9A 2J7PD 5L0HA 3DXJF 2L9JA 3B71A 2R25A 3EGDB 1NBBA 2AVKA 3QTHA 1KTMA 3AG1C 4E7SA 4MVOA 4NY3A 4N6HA 4O79A 2YWAA 3VRCA 4DVZA 4DJ9A 1HE1A 1XZPA 2YEVA 1GGQA 3GM1A 3GEIA 4EBKA 1CGOA 1T9KA 1SMYF 3KH2A 4C7OA 4L6RA 2PX0A 1J8MF 2R7RA 1Q0KA 5K0IA 3V5XA 3DMDA 2LQGA 4AL1A 2J45A 2EPKX 4YL0A 2ZXRA 4XPXA 1A7EA 1RKCA 2VCCA 3EPVA 1E83A 3AG4C 4DBQA 3R2PA 1Q0MA 4O7GA 1UG7A 2HUJA 2VC9A 3IQ6A 5DS6A 2UUIA 2YLDA 4G78A 5L0GA 1APCA 4JCHA 4WGZA 1U6HA 4N06A 3FVYA 5JT4A 2OEXA 3KL4A 3G4XA 3TJ6A 3SXZA 3TQOA 2XM4A 2EIMC 5HSWA 3W8HA 3GWNA 2RD9A 2D5RB 1RJ9B 1LE2A 3C62A 4Q7CA 4YK5A 1QKRA 1Y6DA 4D4NA 4KNVA 3K1IC 4RBNA 1QZXA 1M56C 2A0UA 4JIOA 2XXAA 2R7VA 3HNLA 2WVOA 1XWJA 2RSEB 3L34A 2R7TA 1ZU5A 1OCCC 3LNRA 4JC7A 2OOCA 1OXKA 2V3CC 4ULWA 3K66A 1WWPA 3MBGA 3AQBA 4XQ1A 3O39A 2R02A 5DQZA 2C04A 2KSFA 2XLMA 3EHMA 4IWBA 1G4WR 4KI2A 3U8PA 3KKBA 1JAFA 5JRAA 4WJ0A 2IM8A 2XLEA 1TWGA 4XPWA 3S29A 3FOOA 4FESA 3S28A 2KK1A 1L7CA 3AQCA 4BJ5C 5T3WA 2MWQA 3HNJA 4NTFA 3U9MA 4PFOA 3FHDA 3ZQYA 3GANA 1Q0FA 4NQFA 4JTAB 3ABLC 3LS0A 1M57C 2NUTB 4YL3A 1T6QA 3SP1A 4LDKA 2QLAA 3SXKA 1ORYA 4Z9HA 3RW0A 1OCZC 1PCXA 1WGWA 3UNGC 3U3FA 5A6BD 4AE4A 3Q6MA 5E33A 3LAYA 2JX0A 2XL6A 1MNEA 3KYIA 2IYLD 2VASA 1MMDA 4E7ZA 1T6UA 2I8BA 4LERA 4U5GA 3W4YA 3QVZA 4BJ1A 2L6FA 2HSBA 2O9XA 2YKZA 1B68A 1QVXA 3B0PA 2XLDA 3M1CB 1VLSA 2GAQA 4CIHA 3EG9A 2Q3TA 3JRTA 3E70C 1VTMP 4NCQA 3T4RA 2CNWA 1V74B 3KYJA 4G7ZF 2J9BA 3VF0A 4C3DA 4K1OA 1TWCA 1I5NA 1ZHXA 2HKVA 3G50A 3K1IA 1VB5A 4MS2A 4AK9A 1RMVA 1D1CA 2DB4A 3JYYA 3OA1A 4IGGA 4YWQA 2GWWA 3E9VA 2LSEA 2ZXWC 3HNIA 1UFBA 3MLGA 3O10A 4MTGA 4O6MA 4AX2A 256BA 5DVWA 1DOWA 3RQEA 1D0XA 4JZAA 2R7XA 5AC5A 3EH1A 1NLXA 2HJ3A 1Z7Qc 1WATA 3U3BA 5EHHA 1KNYA 1Z23A 4XWJA 4Q5SF 1ZVZA 4M63A 1F1MA 3EZHA 1Z6AA 2WB7A 3B0VC 3WG7C 1YAUO 1E86A 4BJ5A 3JZ0A 1TWHA 3ABKC 2R03A 2J8WA 1NU7D 3JRMO 1AVOB 4WGYA 5COGA 2ASRA 4Z9IA 1YJGA 2R9RB 5KYXB 1FMVA 3DD7A 1TR2A 2B0JA 1PV3A 2W4BA 1N1CA 3ZTZA 2R7WA 5JLIA 3L1MA 2VB6A 4K0DA 1XZQA 2L6HA 2R7QA 5A69A 3GWLA 2DYRC 2GFHA 3ASNC 2PBEA 1QQ3A 5DQTA 1E2XA 1L3PA 1U0BB 1JOGA 1RXQA 2YLIA 2MHRA 2QNLA 3WODF 1JPJA 2HMZA 3DJNB 5CIVA 1LS1A 1VK5A 3KPHA 3EGDA 1OXBA 4MQ9F 1NFNA 4OIPF 2QUPA 5JS5A 2YRFA 5L0CA 4YJWA 4XLPF 3EJNA 3FAPB 5T3TA 4U5DE 2G3VA 1DOVA 4MVQA 2J46A 3T6JA 3X1OA 2DYSC 3GM3A 3NYLA 4P6IC 4FAPB 3WHNA 2EPOA 5JSLA 1H9TA 3W8IA 3UGPA
chains in the Genus database with same CATH topology
4K1OA 2IBFA 1TR2A 1QKRA 5L0JA 5L0DA 4IGGA 4E18A 4ONSA 2GWWA 4W8PA 1XWJA 1H6GA 2B0HA 5L0FA 3ZDLA 2LQGA 1DOWA 3MYIA 3VF0A 1ZW3A 2HSQA 4P9TA 4PR9A 5FZTA 1RKCA 1T01A 2GDCA 1ZW2A 1RKEA 3RF3A 4EHPA 3T6GB 3TJ5A 2L7AA 1ZVZA 5L0GA 3S90A 5L0CA 5L0HA 5L0IA 1RKEB 3H2VA 1U89A 1U6HA 1DOVA 4E17A 1ST6A 3TJ6A 1L7CA 3H2UA 4DJ9A 1SYQA 1YDIA 2X0CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4K1O A;  2IBF A;  1TR2 A;  1QKR A;  5L0J A;  5L0D A;  4IGG A;  4E18 A;  4ONS A;  2GWW A;  4W8P A;  1XWJ A;  1H6G A;  2B0H A;  5L0F A;  3ZDL A;  2LQG A;  1DOW A;  3MYI A;  3VF0 A;  1ZW3 A;  2HSQ A;  4P9T A;  4PR9 A;  5FZT A;  1RKC A;  1T01 A;  2GDC A;  1ZW2 A;  1RKE A;  3RF3 A;  4EHP A;  3T6G B;  3TJ5 A;  2L7A A;  1ZVZ A;  5L0G A;  3S90 A;  5L0C A;  5L0H A;  5L0I A;  1RKE B;  3H2V A;  1U89 A;  1U6H A;  1DOV A;  4E17 A;  1ST6 A;  3TJ6 A;  1L7C A;  3H2U A;  4DJ9 A;  1SYQ A;  1YDI A;  2X0C A; 
#chains in the Genus database with same CATH topology
 1HW2 A;  4BPM A;  1M2V B;  2Q9B A;  4CJO A;  2HMQ A;  2M4E A;  3AG3 C;  4U9E A;  1MMG A;  1TKN A;  1YVI A;  2GA0 A;  3C63 A;  4W8P A;  5FCL A;  5B1A C;  4JCZ A;  1LI5 A;  2W4M A;  3DWW A;  2B0H A;  4MVZ A;  2PX3 A;  2YL1 A;  4RDA A;  3LJB A;  4XTK A;  4E0H A;  1I4Y A;  2P1A A;  1PD0 A;  3L0I A;  4KC9 A;  4O6Y A;  3ASO C;  4YT5 A;  1WN0 A;  1HMD A;  1RCP A;  2P7V A;  1ZHT A;  4HEA J;  4EHP A;  3T6G B;  3NYJ A;  4IAR A;  4NTB A;  5CI9 A;  3U8V A;  3N2Z B;  2H7B A;  1ZHW A;  2EPL X;  2P61 A;  4I3M A;  5KYN A;  3TUL A;  2TMV P;  3FOP A;  2FGY A;  3LEV A;  3TK0 A;  1ZU4 A;  4MW3 A;  1K04 A;  4HFF B;  4YT8 A;  1RJ9 A;  3BEH A;  3NKD A;  3V5Z A;  3H2U A;  4BEM J;  2R7O A;  2BL2 A;  1QPU A;  1YA7 O;  1SYQ A;  2JPU A;  1LS4 A;  1YDI A;  4I1M A;  3IQT A;  3Q6N A;  1CPQ A;  1OW8 A;  3DE8 A;  4JRZ A;  2XLV A;  4LAC B;  4EBB A;  4ER9 A;  3ZC4 A;  5JVE A;  5KYW B;  1Z63 A;  4G7O F;  3K33 A;  4ONS A;  5COF A;  1BBH A;  3TD7 A;  1VYI A;  1ZZP A;  1FR0 A;  2W9Y A;  5BUO A;  1H6G A;  2ETS A;  5F5F A;  4IB4 A;  3BRJ A;  2HSQ A;  3DE9 A;  4QDL A;  1SR2 A;  2XSE A;  3WAQ A;  1BR2 A;  2BE5 F;  2NSG A;  3PDM P;  1J8Y F;  1JRA A;  3LNM B;  4JEA A;  3I5Q A;  3JSZ A;  4X0R A;  1S7Z A;  3UGO A;  1OW7 A;  3O6X A;  5D91 A;  1G5Z A;  4BJ6 C;  3ABM C;  2A69 F;  1NFO A;  1OCO C;  1WAS A;  2EIN C;  2IXP A;  3GM2 A;  1MND A;  5COM A;  1OKK D;  3TOL A;  1EKY A;  2XLH A;  2NUT A;  2P0N A;  1ZHZ A;  2IBF A;  2BC5 A;  3EFO B;  3OEO A;  4MTF A;  4MND A;  4BJT A;  4YT2 A;  3T9O A;  4E18 A;  1D1A A;  4CS8 C;  5E3A A;  4HFK B;  1LE4 A;  3NMJ A;  3NMI A;  1O3U A;  2Y3B A;  2IOQ A;  4E0I A;  2YQY A;  2R7S A;  4GEH A;  4HE8 D;  4XEF A;  1YAR O;  3LUT B;  3U2M A;  4MVU A;  2PFD A;  3CSK A;  3GEE A;  3C18 A;  1T01 A;  1YZA A;  3PMR A;  4NC3 A;  1YYX A;  3SXM A;  3M4C A;  1OR2 A;  2XRH A;  3RIP A;  1BR4 A;  1HW1 A;  1V55 C;  2XL8 A;  4EKW A;  3RH3 A;  2YVK A;  2CW0 F;  3JTL O;  1RKE B;  3M79 A;  1WTY A;  3H2V A;  4AL0 A;  4YT4 A;  2QE9 A;  3EHN A;  2UUH A;  3DM9 B;  1ST6 A;  3HKK A;  1M6T A;  2A68 F;  2LIG A;  2KW3 C;  5EK0 A;  1FAP B;  2XL4 A;  1HMO A;  1M2O A;  4O6N A;  4KNW A;  1TFO B;  3B9Q A;  1E85 A;  2A0B A;  1G4U S;  1VMA A;  3HLZ A;  1FTS A;  4K7B A;  1C02 A;  3VAY A;  3JT1 A;  1FNT c;  4XLN F;  1T5O A;  5BQH A;  2XLO A;  1D1B A;  3GEH A;  4J7T A;  4JTD B;  3J06 A;  1AUE A;  2CYD A;  2LCH A;  3EGX B;  3V5Y A;  2PF4 E;  3VM6 A;  1YA9 A;  4R32 A;  5KYU B;  3AG2 C;  2XS1 A;  2LD6 A;  2Q00 A;  5FZT A;  3FMS A;  1VYK A;  2ZD9 A;  4IAQ A;  1D0Z A;  1LIH A;  3CEX A;  1JR8 A;  2XM0 A;  3R7C A;  1LM3 B;  2WVN A;  4PJL A;  2J9W A;  2WZL A;  4BJ6 A;  1NZE A;  2Y3D A;  3IHU A;  2YL0 A;  3RYL A;  3C8G D;  5KYY B;  4JTC B;  1V4A A;  2NUP B;  4U5H A;  1ZYR F;  2J0X A;  3SNH A;  4IAO A;  4JEB A;  3LLI A;  5B1B C;  4EIY A;  5KYX A;  1EI7 A;  2ZXO A;  2Y3H A;  2LFF A;  1C17 M;  5B3S C;  3VYW A;  3EH2 A;  2Q7R A;  5HV9 A;  3B29 A;  1GS9 A;  4CS8 A;  1R4T A;  5DS5 A;  1YYJ A;  4JJF A;  1TQG A;  3QW1 A;  2AP3 A;  4H54 A;  4MVM A;  3V7O A;  3W2W A;  5B3I A;  5A6B A;  3K7D A;  4OIR F;  4OIN F;  3RVY A;  1MMN A;  3NDB B;  3EZI A;  4J30 B;  2A6H F;  1ZW3 A;  4QI0 A;  2PP4 A;  4CDA A;  2KJG A;  4GYT A;  2J9U A;  1Z3I X;  2OG2 A;  2WZG A;  2V26 A;  2WZF A;  2IXO A;  2KQ9 A;  1T6I A;  5A6A A;  1FFH A;  1JMW A;  2J0W A;  4BEJ A;  3SEO A;  4PK4 A;  4CDY A;  2Q9C A;  3NYM A;  1K05 A;  4Z9J A;  3S9O A;  2E87 A;  1M2V A;  2OJE D;  1A7V A;  2VCA A;  1AEP A;  3LLK A;  3DAF A;  4B6I A;  1A41 A;  2CDQ A;  4LDQ A;  1SF8 A;  4U9D A;  2ICW G;  3JSE O;  3UMK A;  2Y69 C;  4DVY P;  3ZQV A;  1C03 A;  2LP4 A;  2A6E F;  3QW0 A;  4JVS A;  2DGJ A;  1H7I A;  1QSP A;  2CGE A;  2LFD A;  3NG1 A;  3AGT A;  5L3V A;  2EIJ C;  2R05 A;  4CS9 C;  2NPU A;  2HJM A;  2WVQ A;  3HNK A;  3I4U A;  1TWA A;  3U2L A;  3POV A;  1FFT C;  1E84 A;  4QI2 A;  3ECS A;  4IRU A;  5L0I A;  4H4K C;  4LLC A;  3EQL F;  3RQG A;  3C8G B;  5A6J A;  4KBL A;  2HV7 A;  4MW8 A;  3ZTM A;  3RVZ A;  4MVR A;  3QMK A;  3DZA A;  2H8A A;  5KYW A;  2VH3 A;  1PD1 A;  3HTK C;  2Y39 A;  2R7U A;  4CIP A;  2WL8 A;  3MFN A;  3O55 A;  3DAG A;  3SZR A;  4U5E E;  4XPY A;  4EWC A;  4C7O B;  4JJG A;  2KYH A;  3HJC A;  1LKX A;  2XS8 A;  3H65 A;  3K1H A;  1LVK A;  2EPN A;  3AOU A;  3MX3 A;  4FWV A;  3FXH A;  3MYI A;  4PAC A;  1MMA A;  4DOZ A;  4EBJ A;  4EUK B;  2AU5 A;  4C3E A;  1A7D A;  2C03 A;  2H7V C;  2H7O A;  2J7P A;  1S05 A;  1ZW2 A;  2W45 A;  3DI5 A;  5T1D B;  1NG1 A;  2QY9 A;  3NKE A;  1CGM E;  4D4X A;  1YLM A;  1O5H A;  3ITF A;  4G0H A;  5A6K A;  2EPM X;  3DJU B;  3LES A;  3S27 A;  2AWY A;  4CJG A;  4G7H F;  5CI8 A;  1MQV A;  3UMI A;  1LPE A;  2ZXP A;  3U5S A;  3ZVR A;  4J7Y A;  3FDQ A;  3AGU A;  3EFO A;  3ZWI A;  1TFK B;  4BG0 A;  3AJM A;  3KMI A;  1GM5 A;  1IW7 F;  1D0Y A;  4ZLC A;  2YHS A;  2CNW D;  4OD5 A;  2HZ8 A;  2I15 A;  1NSG B;  1K40 A;  2KGO A;  3LEO A;  1Y4C A;  3Q7G A;  3N0T A;  2CCY A;  3SXY A;  3U9J A;  2QTV A;  3F46 A;  5F28 E;  3ZG1 A;  4CS9 A;  4MVS A;  2Q4F A;  4NTA A;  4PR9 A;  2XXA B;  1SZI A;  2HS5 A;  5DS4 A;  5AC4 A;  1RKE A;  2M64 A;  1OCR C;  3JCU Q;  2D4U A;  2L7A A;  3OWT A;  2OCC C;  3Q7L A;  3TJ5 A;  4CDV A;  4F4B A;  4CSA C;  1ORJ A;  4ULV A;  3ZIB A;  1VLT A;  2Q9A A;  2YLG A;  3NMK A;  4A4A A;  2HV6 A;  2VCB A;  5JP7 A;  3B0U X;  2IXM A;  1OQC A;  2FAP B;  4I1O B;  3MYF A;  2G3K A;  1CGN A;  3F47 A;  4JW1 A;  3RF3 A;  3T6B A;  4I44 A;  2MYS A;  2Y3G A;  4FX5 A;  3FAJ A;  5L0J A;  1H9G A;  3EGX A;  1HY5 A;  3NRH A;  5KYU A;  3K6B A;  3N24 A;  4N4W A;  2J9V A;  3U0C A;  3DKA A;  2P6V A;  1G8X A;  1FMW A;  2OQM A;  3A11 A;  2OEV A;  2EIL C;  3CAX A;  4PJJ A;  5BQG A;  3ZDL A;  5AGF A;  5L0F A;  2X51 A;  5L3Q A;  4PJN A;  1KU2 A;  1BR1 A;  3IQC A;  3A9C A;  5D92 A;  3ZSU A;  1EA8 A;  3SYN A;  1ORS C;  2OJQ A;  1Q0D A;  4AE4 B;  3LS1 A;  5KYY A;  2PNO A;  3C8Z A;  2NUP A;  3IQ5 A;  4CS7 A;  5BQI A;  2IXN A;  3S90 A;  4OD4 A;  1A0B A;  3PCV A;  1Z5Z A;  4PFP A;  4RD9 A;  1OKK A;  2OU6 A;  3I5P A;  1BDJ B;  4ZLD A;  4J32 B;  4W8K A;  4DRI B;  1IZM A;  5IY5 C;  4YN0 B;  1QLE C;  3PHF 2;  1JPN A;  3ATP A;  4LLE A;  2JD3 A;  5E3C A;  3EG9 B;  5F5H A;  2EIK C;  2F22 A;  4U5F E;  4CX9 A;  4C3B A;  1HE9 A;  1V54 C;  2YZS A;  3QZC A;  2X0C A;  2L6G A;  3RQF A;  4MTO A;  3L8I A;  5JUA A;  4OIO F;  3S84 A;  1W2W A;  4U5B E;  3CQZ A;  1GQA A;  4DXW A;  4PJM A;  3DM5 A;  1WOL A;  4JKV A;  5E2Q A;  5TJ5 E;  5EGY A;  2NSF A;  4IJJ A;  3US6 A;  1LI7 A;  2KNH A;  3G4Z A;  4WAB A;  4XEV A;  2GDC A;  2AWC A;  3GOR A;  4CSA A;  1R5I D;  3X2Q C;  2ZPA A;  3L8J A;  4GQH A;  1OR3 A;  2YL7 A;  4JUR I;  3UMH A;  3W2V A;  2G62 A;  1U89 A;  2DI3 A;  4E17 A;  3JYH A;  2FFH A;  2L81 A;  3CZ6 A;  4OIQ F;  2HFI A;  4CBE A;  1CPR A;  3M15 A;  4Q4Z F;  4DRH B;  1ZHY A;  4N6C A;  4YL1 A;  5GPG B;  3TOM A;  1NU9 C;  1BZ4 A;  1OW6 A;  4P9F A;  3S0X A;  4U5C E;  5L0D A;  2XLW A;  1Q0G A;  5DLJ A;  4DRJ B;  1VOM A;  3IEE A;  4DBR A;  4XEK A;  2KC3 A;  2NG1 A;  4LDR A;  3RKO F;  4A2N B;  2A1D D;  3M4B A;  1I4Z A;  3GOD A;  4P9T A;  3IPM O;  4ANJ A;  3UR3 C;  1O87 A;  2LK4 A;  2OKU A;  3QVY A;  3RFY A;  2Z15 A;  3C8G A;  2YL3 A;  1EQ1 A;  1YZC A;  3C7J A;  4UDV A;  4JE9 A;  2J7P D;  5L0H A;  3DXJ F;  2L9J A;  3B71 A;  2R25 A;  3EGD B;  1NBB A;  2AVK A;  3QTH A;  1KTM A;  3AG1 C;  4E7S A;  4MVO A;  4NY3 A;  4N6H A;  4O79 A;  2YWA A;  3VRC A;  4DVZ A;  4DJ9 A;  1HE1 A;  1XZP A;  2YEV A;  1GGQ A;  3GM1 A;  3GEI A;  4EBK A;  1CGO A;  1T9K A;  1SMY F;  3KH2 A;  4C7O A;  4L6R A;  2PX0 A;  1J8M F;  2R7R A;  1Q0K A;  5K0I A;  3V5X A;  3DMD A;  2LQG A;  4AL1 A;  2J45 A;  2EPK X;  4YL0 A;  2ZXR A;  4XPX A;  1A7E A;  1RKC A;  2VCC A;  3EPV A;  1E83 A;  3AG4 C;  4DBQ A;  3R2P A;  1Q0M A;  4O7G A;  1UG7 A;  2HUJ A;  2VC9 A;  3IQ6 A;  5DS6 A;  2UUI A;  2YLD A;  4G78 A;  5L0G A;  1APC A;  4JCH A;  4WGZ A;  1U6H A;  4N06 A;  3FVY A;  5JT4 A;  2OEX A;  3KL4 A;  3G4X A;  3TJ6 A;  3SXZ A;  3TQO A;  2XM4 A;  2EIM C;  5HSW A;  3W8H A;  3GWN A;  2RD9 A;  2D5R B;  1RJ9 B;  1LE2 A;  3C62 A;  4Q7C A;  4YK5 A;  1QKR A;  1Y6D A;  4D4N A;  4KNV A;  3K1I C;  4RBN A;  1QZX A;  1M56 C;  2A0U A;  4JIO A;  2XXA A;  2R7V A;  3HNL A;  2WVO A;  1XWJ A;  2RSE B;  3L34 A;  2R7T A;  1ZU5 A;  1OCC C;  3LNR A;  4JC7 A;  2OOC A;  1OXK A;  2V3C C;  4ULW A;  3K66 A;  1WWP A;  3MBG A;  3AQB A;  4XQ1 A;  3O39 A;  2R02 A;  5DQZ A;  2C04 A;  2KSF A;  2XLM A;  3EHM A;  4IWB A;  1G4W R;  4KI2 A;  3U8P A;  3KKB A;  1JAF A;  5JRA A;  4WJ0 A;  2IM8 A;  2XLE A;  1TWG A;  4XPW A;  3S29 A;  3FOO A;  4FES A;  3S28 A;  2KK1 A;  1L7C A;  3AQC A;  4BJ5 C;  5T3W A;  2MWQ A;  3HNJ A;  4NTF A;  3U9M A;  4PFO A;  3FHD A;  3ZQY A;  3GAN A;  1Q0F A;  4NQF A;  4JTA B;  3ABL C;  3LS0 A;  1M57 C;  2NUT B;  4YL3 A;  1T6Q A;  3SP1 A;  4LDK A;  2QLA A;  3SXK A;  1ORY A;  4Z9H A;  3RW0 A;  1OCZ C;  1PCX A;  1WGW A;  3UNG C;  3U3F A;  5A6B D;  4AE4 A;  3Q6M A;  5E33 A;  3LAY A;  2JX0 A;  2XL6 A;  1MNE A;  3KYI A;  2IYL D;  2VAS A;  1MMD A;  4E7Z A;  1T6U A;  2I8B A;  4LER A;  4U5G A;  3W4Y A;  3QVZ A;  4BJ1 A;  2L6F A;  2HSB A;  2O9X A;  2YKZ A;  1B68 A;  1QVX A;  3B0P A;  2XLD A;  3M1C B;  1VLS A;  2GAQ A;  4CIH A;  3EG9 A;  2Q3T A;  3JRT A;  3E70 C;  1VTM P;  4NCQ A;  3T4R A;  2CNW A;  1V74 B;  3KYJ A;  4G7Z F;  2J9B A;  3VF0 A;  4C3D A;  4K1O A;  1TWC A;  1I5N A;  1ZHX A;  2HKV A;  3G50 A;  3K1I A;  1VB5 A;  4MS2 A;  4AK9 A;  1RMV A;  1D1C A;  2DB4 A;  3JYY A;  3OA1 A;  4IGG A;  4YWQ A;  2GWW A;  3E9V A;  2LSE A;  2ZXW C;  3HNI A;  1UFB A;  3MLG A;  3O10 A;  4MTG A;  4O6M A;  4AX2 A;  256B A;  5DVW A;  1DOW A;  3RQE A;  1D0X A;  4JZA A;  2R7X A;  5AC5 A;  3EH1 A;  1NLX A;  2HJ3 A;  1Z7Q c;  1WAT A;  3U3B A;  5EHH A;  1KNY A;  1Z23 A;  4XWJ A;  4Q5S F;  1ZVZ A;  4M63 A;  1F1M A;  3EZH A;  1Z6A A;  2WB7 A;  3B0V C;  3WG7 C;  1YAU O;  1E86 A;  4BJ5 A;  3JZ0 A;  1TWH A;  3ABK C;  2R03 A;  2J8W A;  1NU7 D;  3JRM O;  1AVO B;  4WGY A;  5COG A;  2ASR A;  4Z9I A;  1YJG A;  2R9R B;  5KYX B;  1FMV A;  3DD7 A;  1TR2 A;  2B0J A;  1PV3 A;  2W4B A;  1N1C A;  3ZTZ A;  2R7W A;  5JLI A;  3L1M A;  2VB6 A;  4K0D A;  1XZQ A;  2L6H A;  2R7Q A;  5A69 A;  3GWL A;  2DYR C;  2GFH A;  3ASN C;  2PBE A;  1QQ3 A;  5DQT A;  1E2X A;  1L3P A;  1U0B B;  1JOG A;  1RXQ A;  2YLI A;  2MHR A;  2QNL A;  3WOD F;  1JPJ A;  2HMZ A;  3DJN B;  5CIV A;  1LS1 A;  1VK5 A;  3KPH A;  3EGD A;  1OXB A;  4MQ9 F;  1NFN A;  4OIP F;  2QUP A;  5JS5 A;  2YRF A;  5L0C A;  4YJW A;  4XLP F;  3EJN A;  3FAP B;  5T3T A;  4U5D E;  2G3V A;  1DOV A;  4MVQ A;  2J46 A;  3T6J A;  3X1O A;  2DYS C;  3GM3 A;  3NYL A;  4P6I C;  4FAP B;  3WHN A;  2EPO A;  5JSL A;  1H9T A;  3W8I A;  3UGP A; 
#chains in the Genus database with same CATH homology
 4K1O A;  2IBF A;  1TR2 A;  1QKR A;  5L0J A;  5L0D A;  4IGG A;  4E18 A;  4ONS A;  2GWW A;  4W8P A;  1XWJ A;  1H6G A;  2B0H A;  5L0F A;  3ZDL A;  2LQG A;  1DOW A;  3MYI A;  3VF0 A;  1ZW3 A;  2HSQ A;  4P9T A;  4PR9 A;  5FZT A;  1RKC A;  1T01 A;  2GDC A;  1ZW2 A;  1RKE A;  3RF3 A;  4EHP A;  3T6G B;  3TJ5 A;  2L7A A;  1ZVZ A;  5L0G A;  3S90 A;  5L0C A;  5L0H A;  5L0I A;  1RKE B;  3H2V A;  1U89 A;  1U6H A;  1DOV A;  4E17 A;  1ST6 A;  3TJ6 A;  1L7C A;  3H2U A;  4DJ9 A;  1SYQ A;  1YDI A;  2X0C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...