1DOWA

Crystal structure of a chimera of beta-catenin and alpha-catenin
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
205
structure length
205
Chain Sequence
KAHVLAASVEQATENFLEKGDKIAKESQFLKEELVVAVEDVRKQGDLMKSAAGEFADDPCSSVKRGNMVRAARALLSAVTRLLILADMADVYKLLVQLKVVEDGILKLRNAGNEQDLGIQYKALKPEVDKLNIMAAKRQQELKDVGNRDQMAAARGILQKNVPILYTASQACLQHPDVAAYKANRDLIYKQLQQAVTGISNAAQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords ALPHA-CATENIN
publication title Structure of the dimerization and beta-catenin-binding region of alpha-catenin.
pubmed doi rcsb
source organism Mus musculus
total genus 84
structure length 205
sequence length 205
ec nomenclature
pdb deposition date 1999-12-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 1dowA00
1RKEB 1QKRA 1TR2A 4E17A 5L0DA 4IGGA 2X0CA 3S90A 4EHPA 3VF0A 2HSQA 3H2VA 5L0HA 1DOVA 1DOWA 4P9TA 4ONSA 1ST6A 5L0CA 5L0JA 1RKEA 2L7AA 3T6GB 1RKCA 4DJ9A 4PR9A 4K1OA 4W8PA 3ZDLA 1ZW2A 5L0IA 2B0HA 1U89A 1XWJA 5L0FA 1ZW3A 3H2UA 2IBFA 4E18A 1YDIA 3MYIA 5FZTA 2LQGA 1ZVZA 2GDCA 3RF3A 1L7CA 1SYQA 1U6HA 3TJ6A 2GWWA 5L0GA 3TJ5A 1H6GA 1T01A
chains in the Genus database with same CATH superfamily
1OCOC 1VB5A 5DS4A 1AUEA 4OIRF 3RQFA 2YEVA 2R05A 2LK4A 1O5HA 3B0VC 4Q4ZF 1YYXA 3AOUA 3J06A 2ZXOA 3LEOA 3US6A 3WG7C 3UGOA 4BJ5C 1O87A 2HMZA 2KGOA 4U5DE 3UMKA 1T9KA 3HKKA 4EBKA 5COMA 3A11A 5L0IA 1FR0A 2B0HA 4N6HA 1CPQA 2AWYA 2LP4A 4JEBA 3V5ZA 2Q00A 2CYDA 1JMWA 2R7UA 4XPWA 3C7JA 1JPNA 1YZCA 5EHHA 3AJMA 1LIHA 1SF8A 2D4UA 2E87A 2JD3A 2L9JA 3S29A 3TK0A 2FAPB 4RBNA 2NUTB 1MMAA 2OJED 2OCCC 2WB7A 1K40A 3EH2A 4O6NA 4YT5A 3LS1A 4HE8D 1U0BB 4Z9JA 1G8XA 3KKBA 5KYXA 2YLGA 1A41A 1SMYF 2H7BA 2OEXA 1OXBA 3HTKC 4PJNA 3ZSUA 5D91A 5DS5A 1QVXA 5AC4A 1OR2A 1OR3A 3NG1A 3GEEA 4U5HA 3RQGA 3H2UA 4BJTA 2Y3HA 5BQIA 1GM5A 1M6TA 2J9UA 2IXOA 4CIPA 1E2XA 2H8AA 1ZVZA 4E7ZA 2XL8A 3LEVA 4JJGA 2GWWA 3TJ6A 3FAJA 5B1AC 1T01A 3ATPA 4OIQF 2VCAA 3TOMA 4OIOF 2DB4A 1Q0DA 2VB6A 1ZHWA 2Y69C 3DKAA 4MW3A 4U5GA 3SEOA 2ZXPA 4IGGA 4D4NA 4EBJA 4HFKB 2CW0F 1QSPA 2I15A 2KK1A 4KBLA 4PFOA 4XEVA 3O39A 3CQZA 1Q0FA 2L7AA 3F47A 2CGEA 5A6BD 2IM8A 4O7GA 4WABA 2J0XA 3LNRA 4PR9A 3I5PA 3DE8A 2KW3C 3U3FA 1T6UA 3UMIA 3JRMO 4HEAJ 3O55A 4JCZA 4BJ6A 2R7VA 2XLMA 3QTHA 5E3CA 1OCCC 2R9RB 1FNTc 4YT8A 3L8IA 4DXWA 4ZLDA 4RDAA 5COGA 4DVZA 1YJGA 3T6BA 3V7OA 1YDIA 2G3KA 1E84A 2HS5A 2EPLX 2KQ9A 2P61A 4LERA 4DBRA 1Z63A 1L3PA 4EWCA 4JIOA 3QW1A 4NCQA 3U3BA 5L0GA 4LACB 3L0IA 2J9VA 1MQVA 1OQCA 3KMIA 4E17A 3SXZA 1FFHA 1T6IA 3QVYA 4O6MA 4P6IC 3VYWA 5A6BA 3H65A 3U8VA 1S7ZA 4ULWA 2EIMC 4F4BA 3Q6NA 1D1AA 5E33A 5DQZA 1ORSC 2OU6A 1VYIA 2R02A 2KYHA 3HLZA 4G78A 2DI3A 3C8GB 3JYYA 3ZG1A 4G7ZF 2J46A 3R2PA 2WVQA 2QLAA 1H9TA 1NFOA 4G0HA 4MVRA 4O79A 1RMVA 2C03A 1D0ZA 4JTDB 5L0FA 4J7TA 1NSGB 2IBFA 2AU5A 4L6RA 3SP1A 2R25A 5HSWA 4GEHA 2VH3A 3ABKC 1G4WR 1NFNA 3T4RA 3GWNA 3MFNA 4CDYA 3R7CA 3T9OA 4DBQA 3POVA 3S28A 3TJ5A 3NMIA 2A0UA 4XTKA 3IQ5A 3ZVRA 2OKUA 1A7VA 1ZU5A 2XL4A 3JSEO 3KL4A 2M64A 2FFHA 4JURI 4YN0B 1JAFA 1KNYA 2PNOA 3U9JA 3DWWA 1Q0MA 2ETSA 2L6FA 3U0CA 2Q9BA 2P7VA 3CAXA 3RH3A 4KC9A 1OW7A 3NYJA 2EIJC 3FVYA 3EZIA 1PD0A 3RVYA 1BR1A 2R7XA 4M63A 1EQ1A 1WN0A 4CS8C 2W9YA 5DQTA 2L81A 1RCPA 3I4UA 4BPMA 4KNVA 4YL3A 2W45A 5T1DB 3UMHA 5B3SC 3FOOA 2VCBA 2IXNA 4OINF 2ZXWC 4JTAB 4AL0A 1YAUO 2AWCA 1M2VB 4JTCB 5B3IA 4MVZA 3NMJA 2MYSA 3AG3C 5T3TA 1LKXA 2QTVA 1H6GA 2YL7A 3K1HA 4K0DA 1B68A 1ZHYA 3LJBA 2JPUA 2OJQA 3V5YA 1FTSA 1E83A 2BL2A 3S90A 1UFBA 1ZYRF 2O9XA 4DOZA 2AVKA 2XLDA 3IEEA 1SZIA 4WGYA 1DOVA 5L0CA 3UGPA 3DXJF 2MWQA 1JOGA 2LSEA 1A7EA 2P0NA 2AP3A 2PP4A 3T6GB 1JPJA 3E70C 4U5CE 1NG1A 2RSEB 2VC9A 4E0IA 1PCXA 5DVWA 4J30B 3EPVA 5KYUA 2XS8A 1E86A 1VMAA 4C7OA 1RJ9B 5CI9A 4EBBA 2GAQA 2IYLD 3IQTA 1RXQA 3X2QC 3C8GA 4LDRA 4BEJA 2IOQA 1UG7A 3RQEA 5JLIA 5BUOA 1ZU4A 2GDCA 2WL8A 1U6HA 4QDLA 2M4EA 1NU9C 4EUKB 2HFIA 3Q7GA 1MMNA 4HFFB 1HE9A 5EK0A 3M4CA 4MVSA 3MLGA 2HSBA 4IB4A 1MMDA 2QUPA 3VF0A 2YWAA 5BQHA 5AC5A 3FMSA 3JZ0A 1Z5ZA 3Q7LA 4ER9A 2DYSC 2L6GA 1VTMP 2Z15A 4DJ9A 4QI2A 4IARA 5DS6A 2YLIA 3EQLF 4R32A 2DGJA 1HMOA 1Q0KA 1WWPA 2HUJA 3BRJA 1BR2A 3NKEA 2J8WA 3VM6A 2WZLA 1Q0GA 4XPYA 3S84A 1WATA 2FGYA 1LE2A 1OKKD 1I4YA 1GS9A 2W4BA 1YVIA 1M2OA 2KC3A 2UUIA 3O6XA 3S9OA 3W8HA 2H7OA 3O10A 1HMDA 4IWBA 4A4AA 2R7SA 1OW6A 2A6EF 1WOLA 4XEKA 2QNLA 3RF3A 2G3VA 3M1CB 4GYTA 3W8IA 3ZTZA 5A69A 3ZDLA 3C8ZA 1Z3IX 3K33A 4KNWA 3K1IA 2Q9AA 3RFYA 4U9EA 1XZQA 1M2VA 5D92A 1O3UA 3QVZA 1CPRA 3UNGC 4EHPA 5HV9A 2YLDA 2JX0A 3B71A 2KJGA 5F5HA 1ZZPA 3S27A 2P1AA 3AG4C 2TMVP 1J8YF 4OD4A 3GEHA 3ZQYA 1OKKA 1V74B 2BC5A 3AGTA 3HNKA 2J7PD 1VYKA 2NUPA 1OXKA 1SR2A 3ZIBA 2HJMA 3U9MA 2V26A 5CI8A 2UUHA 1Y6DA 2HZ8A 1LI5A 3IHUA 2BE5F 3JYHA 4O6YA 2Q9CA 3KYJA 2F22A 4JEAA 1QQ3A 2OG2A 4I44A 4RD9A 3LAYA 1RJ9A 2YL3A 4FWVA 3Q6MA 2IXMA 3C62A 1YZAA 2LD6A 4XLPF 2KSFA 2EPKX 1A7DA 1MNDA 1ORYA 2Q3TA 4AL1A 5A6KA 4JJFA 1T5OA 1K04A 3MYFA 1HE1A 2OOCA 2X51A 4DRJB 5KYYA 2J7PA 3A9CA 1J8MF 2R7OA 4CSAA 5B1BC 3QZCA 4YT2A 4IRUA 1Z6AA 5L3VA 5KYUB 1YLMA 5DLJA 1MMGA 2Y3BA 4OD5A 4C7OB 3JCUQ 4Z9HA 1PD1A 4K1OA 3FOPA 1T6QA 1V55C 3F46A 4Z9IA 2R7WA 2V3CC 3RKOF 3TD7A 4JC7A 1OCRC 4JKVA 3LLIA 2XL6A 2XLOA 3KPHA 2J9WA 4WGZA 4U5BE 4B6IA 3U2LA 2A0BA 2DYRC 4IAQA 3PDMP 1G4US 3KH2A 3NRHA 4AK9A 2R7RA 3CEXA 4NQFA 3HNLA 3AGUA 1QZXA 4DRIB 2J45A 3K66A 2HKVA 5GPGB 2X0CA 1TWAA 2LCHA 4IJJA 5L0DA 3FDQA 3DZAA 1AEPA 2P6VA 2HSQA 3WODF 4C3BA 2QE9A 3DD7A 4MW8A 3EHMA 1BDJB 1ORJA 3ECSA 4BJ6C 3C63A 1IW7F 2PX3A 1K05A 3ZTMA 2A6HF 5JS5A 3G4XA 4H4KC 2ASRA 2XXAB 3EFOB 3GM3A 3L1MA 1S05A 5F28E 1C02A 1F1MA 2EINC 1ZW3A 3EHNA 3EGXB 1TQGA 3N2ZB 2CDQA 4LLCA 4BJ5A 3ITFA 4YWQA 4OIPF 2XLVA 5JRAA 2A68F 4I1OB 2Y39A 3B29A 5BQGA 3RYLA 4U5FE 1KU2A 2NG1A 3AG2C 3I5QA 2YHSA 4LDKA 1RKEB 1TR2A 4JE9A 3U5SA 1VLSA 2XRHA 4CBEA 3PCVA 2RD9A 4FX5A 2OQMA 4NTFA 2YL1A 4JRZA 2EPOA 4NTBA 1KTMA 1WASA 3ASOC 3K7DA 2NUPB 4P9TA 1XZPA 4Q5SF 3NKDA 3CZ6A 4N6CA 2XS1A 4A2NB 3PHF2 3FHDA 3TULA 1BR4A 1PV3A 2EPNA 4CS9C 3DJUB 4DRHB 5JT4A 1MNEA 1WTYA 1YA9A 2XLEA 5E3AA 4EIYA 2EIKC 5KYWA 2G62A 2XLWA 1HW2A 1H7IA 3B0PA 3N24A 1VLTA 4E18A 4FAPB 3EJNA 3MYIA 3W4YA 2HV7A 2IXPA 3V5XA 2L6HA 2ZD9A 1HW1A 3ABLC 1GGQA 3HJCA 5KYNA 3IQ6A 3AG1C 4JW1A 5AGFA 3RIPA 5KYYB 2XM4A 1FMWA 5EGYA 3GANA 1R4TA 4MVMA 1HY5A 1LPEA 2HV6A 2R03A 3UR3C 3W2VA 3ASNC 2CCYA 2HMQA 4MTOA 3CSKA 5L0HA 3TOLA 2QY9A 3LUTB 3RW0A 1N1CA 4YL0A 3VAYA 2R7QA 3LLKA 1W2WA 2NSGA 3TQOA 1A0BA 3NYLA 2YVKA 1E85A 1FAPB 3IPMO 3FAPB 3B9QA 4PJLA 4YT4A 4XWJA 2NSFA 1YA7O 4MNDA 5L3QA 2XXAA 4AE4A 1BBHA 1EA8A 3EFOA 1QLEC 3EG9A 2WZGA 3JTLO 3L34A 1D1BA 3GORA 2YL0A 1Z23A 2OEVA 1ZHXA 1V54C 1TWCA 3EGXA 4N06A 4U9DA 4CJGA 4E0HA 5K0IA 4UDVA 3EGDB 4BG0A 3S0XA 2PBEA 5JP7A 4I1MA 1AVOB 1YYJA 2I8BA 3HNJA 3SXMA 3WAQA 2Y3GA 1OW8A 1BZ4A 3H2VA 4PJMA 1DOWA 3EZHA 3OWTA 4W8KA 5F5FA 1RKEA 1LS4A 2HJ3A 2WZFA 4NC3A 1LE4A 1TFOB 1TFKB 3DAGA 3KYIA 2PFDA 4YK5A 1NLXA 1TWGA 1ZW2A 2NPUA 3GWLA 3JT1A 4Q7CA 4PK4A 1JRAA 2EPMX 3AQCA 1U89A 2MHRA 4MQ9F 2XM0A 3C18A 4J32B 4NTAA 1XWJA 3M79A 4XPXA 3X1OA 3NDBB 3MX3A 5FZTA 4N4WA 1FMVA 1L7CA 1CGNA 1M56C 3QMKA 1I5NA 4AX2A 3IQCA 3U2MA 3WHNA 3E9VA 1NZEA 2LIGA 4P9FA 3SXYA 3LNMB 2XLHA 1Z7Qc 3M15A 2B0JA 5E2QA 4G7HF 4C3DA 4LDQA 1JR8A 256BA 3BEHA 1V4AA 3GODA 3PMRA 4BJ1A 3DJNB 1R5ID 3VRCA 1D1CA 4JZAA 3DM9B 5CIVA 4U5EE 2A1DD 2J9BA 4E7SA 4KI2A 2WVOA 3G50A 4PJJA 3DAFA 1OCZC 4W8PA 3ZWIA 2GA0A 5T3WA 5KYWB 3G4ZA 1D0XA 2H7VC 1TWHA 1TKNA 2YZSA 3DMDA 3W2WA 1EKYA 3LS0A 4YJWA 3L8JA 3K1IC 1EI7A 2PX0A 4CX9A 3K6BA 4XQ1A 4CS8A 1LM3B 3OEOA 4C3EA 4CJOA 4MVUA 4JCHA 5IY5C 5A6AA 2XSEA 2ZXRA 2GFHA 4FESA 5JUAA 2PF4E 3OA1A 4ULVA 1IZMA 3B0UX 3AQBA 2J0WA 4PACA 1NBBA 2VCCA 3DE9A 2Q7RA 2NUTA 3EGDA 3U8PA 4EKWA 1GQAA 3JRTA 5COFA 4DVYP 1M57C 1RKCA 2ICWG 5JSLA 4GQHA 3ABMC 3QW0A 1FFTC 4JVSA 3T6JA 5A6JA 4PFPA 4AE4B 3EG9B 1C03A 1CGOA 3GM2A 4LLEA 2YQYA 3N0TA 4I3MA 4XEFA 3LESA 2LFFA 4CS9A 4MS2A 4MTGA 4CIHA 1NU7D 3EH1A 2LQGA 4WJ0A 2ZPAA 3FXHA 1SYQA 2CNWD 2VASA 2C04A 3DI5A 5TJ5E 4CSAC 3NYMA 1ZHZA 1G5ZA 5KYXB 1H9GA 3MBGA 4D4XA 1QKRA 4X0RA 1ZHTA 3JSZA 1APCA 4MTFA 1C17M 1WGWA 1YARO 3ZQVA 3NMKA 1VK5A 4CDAA 4XLNF 4H54A 3DM5A 3SNHA 4MVQA 2KNHA 1ST6A 4ONSA 5L0JA 2YRFA 2D5RB 1LI7A 2YKZA 1D0YA 2A69F 3HNIA 3M4BA 4ZLCA 4ANJA 1I4ZA 1VOMA 2WVNA 4QI0A 1LVKA 5FCLA 2EILC 4G7OF 3SZRA 1CGME 2R7TA 2CNWA 1LS1A 4YL1A 3ZC4A 4BEMJ 4K7BA 2Q4FA 1Y4CA 3SYNA 2LFDA 2W4MA 4MVOA 3GM1A 5JVEA 1QPUA 4CS7A 4IAOA 3GEIA 4J7YA 3SXKA 2Y3DA 3C8GD 4NY3A 3RVZA 4CDVA
chains in the Genus database with same CATH topology
1RKEB 1QKRA 1TR2A 4E17A 5L0DA 4IGGA 2X0CA 3S90A 4EHPA 3VF0A 2HSQA 3H2VA 5L0HA 1DOVA 1DOWA 4P9TA 4ONSA 1ST6A 5L0CA 5L0JA 1RKEA 2L7AA 3T6GB 1RKCA 4DJ9A 4PR9A 4K1OA 4W8PA 3ZDLA 1ZW2A 5L0IA 2B0HA 1U89A 1XWJA 5L0FA 1ZW3A 3H2UA 2IBFA 4E18A 1YDIA 3MYIA 5FZTA 2LQGA 1ZVZA 2GDCA 3RF3A 1L7CA 1SYQA 1U6HA 3TJ6A 2GWWA 5L0GA 3TJ5A 1H6GA 1T01A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RKE B;  1QKR A;  1TR2 A;  4E17 A;  5L0D A;  4IGG A;  2X0C A;  3S90 A;  4EHP A;  3VF0 A;  2HSQ A;  3H2V A;  5L0H A;  1DOV A;  1DOW A;  4P9T A;  4ONS A;  1ST6 A;  5L0C A;  5L0J A;  1RKE A;  2L7A A;  3T6G B;  1RKC A;  4DJ9 A;  4PR9 A;  4K1O A;  4W8P A;  3ZDL A;  1ZW2 A;  5L0I A;  2B0H A;  1U89 A;  1XWJ A;  5L0F A;  1ZW3 A;  3H2U A;  2IBF A;  4E18 A;  1YDI A;  3MYI A;  5FZT A;  2LQG A;  1ZVZ A;  2GDC A;  3RF3 A;  1L7C A;  1SYQ A;  1U6H A;  3TJ6 A;  2GWW A;  5L0G A;  3TJ5 A;  1H6G A;  1T01 A; 
#chains in the Genus database with same CATH topology
 1OCO C;  1VB5 A;  5DS4 A;  1AUE A;  4OIR F;  3RQF A;  2YEV A;  2R05 A;  2LK4 A;  1O5H A;  3B0V C;  4Q4Z F;  1YYX A;  3AOU A;  3J06 A;  2ZXO A;  3LEO A;  3US6 A;  3WG7 C;  3UGO A;  4BJ5 C;  1O87 A;  2HMZ A;  2KGO A;  4U5D E;  3UMK A;  1T9K A;  3HKK A;  4EBK A;  5COM A;  3A11 A;  5L0I A;  1FR0 A;  2B0H A;  4N6H A;  1CPQ A;  2AWY A;  2LP4 A;  4JEB A;  3V5Z A;  2Q00 A;  2CYD A;  1JMW A;  2R7U A;  4XPW A;  3C7J A;  1JPN A;  1YZC A;  5EHH A;  3AJM A;  1LIH A;  1SF8 A;  2D4U A;  2E87 A;  2JD3 A;  2L9J A;  3S29 A;  3TK0 A;  2FAP B;  4RBN A;  2NUT B;  1MMA A;  2OJE D;  2OCC C;  2WB7 A;  1K40 A;  3EH2 A;  4O6N A;  4YT5 A;  3LS1 A;  4HE8 D;  1U0B B;  4Z9J A;  1G8X A;  3KKB A;  5KYX A;  2YLG A;  1A41 A;  1SMY F;  2H7B A;  2OEX A;  1OXB A;  3HTK C;  4PJN A;  3ZSU A;  5D91 A;  5DS5 A;  1QVX A;  5AC4 A;  1OR2 A;  1OR3 A;  3NG1 A;  3GEE A;  4U5H A;  3RQG A;  3H2U A;  4BJT A;  2Y3H A;  5BQI A;  1GM5 A;  1M6T A;  2J9U A;  2IXO A;  4CIP A;  1E2X A;  2H8A A;  1ZVZ A;  4E7Z A;  2XL8 A;  3LEV A;  4JJG A;  2GWW A;  3TJ6 A;  3FAJ A;  5B1A C;  1T01 A;  3ATP A;  4OIQ F;  2VCA A;  3TOM A;  4OIO F;  2DB4 A;  1Q0D A;  2VB6 A;  1ZHW A;  2Y69 C;  3DKA A;  4MW3 A;  4U5G A;  3SEO A;  2ZXP A;  4IGG A;  4D4N A;  4EBJ A;  4HFK B;  2CW0 F;  1QSP A;  2I15 A;  2KK1 A;  4KBL A;  4PFO A;  4XEV A;  3O39 A;  3CQZ A;  1Q0F A;  2L7A A;  3F47 A;  2CGE A;  5A6B D;  2IM8 A;  4O7G A;  4WAB A;  2J0X A;  3LNR A;  4PR9 A;  3I5P A;  3DE8 A;  2KW3 C;  3U3F A;  1T6U A;  3UMI A;  3JRM O;  4HEA J;  3O55 A;  4JCZ A;  4BJ6 A;  2R7V A;  2XLM A;  3QTH A;  5E3C A;  1OCC C;  2R9R B;  1FNT c;  4YT8 A;  3L8I A;  4DXW A;  4ZLD A;  4RDA A;  5COG A;  4DVZ A;  1YJG A;  3T6B A;  3V7O A;  1YDI A;  2G3K A;  1E84 A;  2HS5 A;  2EPL X;  2KQ9 A;  2P61 A;  4LER A;  4DBR A;  1Z63 A;  1L3P A;  4EWC A;  4JIO A;  3QW1 A;  4NCQ A;  3U3B A;  5L0G A;  4LAC B;  3L0I A;  2J9V A;  1MQV A;  1OQC A;  3KMI A;  4E17 A;  3SXZ A;  1FFH A;  1T6I A;  3QVY A;  4O6M A;  4P6I C;  3VYW A;  5A6B A;  3H65 A;  3U8V A;  1S7Z A;  4ULW A;  2EIM C;  4F4B A;  3Q6N A;  1D1A A;  5E33 A;  5DQZ A;  1ORS C;  2OU6 A;  1VYI A;  2R02 A;  2KYH A;  3HLZ A;  4G78 A;  2DI3 A;  3C8G B;  3JYY A;  3ZG1 A;  4G7Z F;  2J46 A;  3R2P A;  2WVQ A;  2QLA A;  1H9T A;  1NFO A;  4G0H A;  4MVR A;  4O79 A;  1RMV A;  2C03 A;  1D0Z A;  4JTD B;  5L0F A;  4J7T A;  1NSG B;  2IBF A;  2AU5 A;  4L6R A;  3SP1 A;  2R25 A;  5HSW A;  4GEH A;  2VH3 A;  3ABK C;  1G4W R;  1NFN A;  3T4R A;  3GWN A;  3MFN A;  4CDY A;  3R7C A;  3T9O A;  4DBQ A;  3POV A;  3S28 A;  3TJ5 A;  3NMI A;  2A0U A;  4XTK A;  3IQ5 A;  3ZVR A;  2OKU A;  1A7V A;  1ZU5 A;  2XL4 A;  3JSE O;  3KL4 A;  2M64 A;  2FFH A;  4JUR I;  4YN0 B;  1JAF A;  1KNY A;  2PNO A;  3U9J A;  3DWW A;  1Q0M A;  2ETS A;  2L6F A;  3U0C A;  2Q9B A;  2P7V A;  3CAX A;  3RH3 A;  4KC9 A;  1OW7 A;  3NYJ A;  2EIJ C;  3FVY A;  3EZI A;  1PD0 A;  3RVY A;  1BR1 A;  2R7X A;  4M63 A;  1EQ1 A;  1WN0 A;  4CS8 C;  2W9Y A;  5DQT A;  2L81 A;  1RCP A;  3I4U A;  4BPM A;  4KNV A;  4YL3 A;  2W45 A;  5T1D B;  3UMH A;  5B3S C;  3FOO A;  2VCB A;  2IXN A;  4OIN F;  2ZXW C;  4JTA B;  4AL0 A;  1YAU O;  2AWC A;  1M2V B;  4JTC B;  5B3I A;  4MVZ A;  3NMJ A;  2MYS A;  3AG3 C;  5T3T A;  1LKX A;  2QTV A;  1H6G A;  2YL7 A;  3K1H A;  4K0D A;  1B68 A;  1ZHY A;  3LJB A;  2JPU A;  2OJQ A;  3V5Y A;  1FTS A;  1E83 A;  2BL2 A;  3S90 A;  1UFB A;  1ZYR F;  2O9X A;  4DOZ A;  2AVK A;  2XLD A;  3IEE A;  1SZI A;  4WGY A;  1DOV A;  5L0C A;  3UGP A;  3DXJ F;  2MWQ A;  1JOG A;  2LSE A;  1A7E A;  2P0N A;  2AP3 A;  2PP4 A;  3T6G B;  1JPJ A;  3E70 C;  4U5C E;  1NG1 A;  2RSE B;  2VC9 A;  4E0I A;  1PCX A;  5DVW A;  4J30 B;  3EPV A;  5KYU A;  2XS8 A;  1E86 A;  1VMA A;  4C7O A;  1RJ9 B;  5CI9 A;  4EBB A;  2GAQ A;  2IYL D;  3IQT A;  1RXQ A;  3X2Q C;  3C8G A;  4LDR A;  4BEJ A;  2IOQ A;  1UG7 A;  3RQE A;  5JLI A;  5BUO A;  1ZU4 A;  2GDC A;  2WL8 A;  1U6H A;  4QDL A;  2M4E A;  1NU9 C;  4EUK B;  2HFI A;  3Q7G A;  1MMN A;  4HFF B;  1HE9 A;  5EK0 A;  3M4C A;  4MVS A;  3MLG A;  2HSB A;  4IB4 A;  1MMD A;  2QUP A;  3VF0 A;  2YWA A;  5BQH A;  5AC5 A;  3FMS A;  3JZ0 A;  1Z5Z A;  3Q7L A;  4ER9 A;  2DYS C;  2L6G A;  1VTM P;  2Z15 A;  4DJ9 A;  4QI2 A;  4IAR A;  5DS6 A;  2YLI A;  3EQL F;  4R32 A;  2DGJ A;  1HMO A;  1Q0K A;  1WWP A;  2HUJ A;  3BRJ A;  1BR2 A;  3NKE A;  2J8W A;  3VM6 A;  2WZL A;  1Q0G A;  4XPY A;  3S84 A;  1WAT A;  2FGY A;  1LE2 A;  1OKK D;  1I4Y A;  1GS9 A;  2W4B A;  1YVI A;  1M2O A;  2KC3 A;  2UUI A;  3O6X A;  3S9O A;  3W8H A;  2H7O A;  3O10 A;  1HMD A;  4IWB A;  4A4A A;  2R7S A;  1OW6 A;  2A6E F;  1WOL A;  4XEK A;  2QNL A;  3RF3 A;  2G3V A;  3M1C B;  4GYT A;  3W8I A;  3ZTZ A;  5A69 A;  3ZDL A;  3C8Z A;  1Z3I X;  3K33 A;  4KNW A;  3K1I A;  2Q9A A;  3RFY A;  4U9E A;  1XZQ A;  1M2V A;  5D92 A;  1O3U A;  3QVZ A;  1CPR A;  3UNG C;  4EHP A;  5HV9 A;  2YLD A;  2JX0 A;  3B71 A;  2KJG A;  5F5H A;  1ZZP A;  3S27 A;  2P1A A;  3AG4 C;  2TMV P;  1J8Y F;  4OD4 A;  3GEH A;  3ZQY A;  1OKK A;  1V74 B;  2BC5 A;  3AGT A;  3HNK A;  2J7P D;  1VYK A;  2NUP A;  1OXK A;  1SR2 A;  3ZIB A;  2HJM A;  3U9M A;  2V26 A;  5CI8 A;  2UUH A;  1Y6D A;  2HZ8 A;  1LI5 A;  3IHU A;  2BE5 F;  3JYH A;  4O6Y A;  2Q9C A;  3KYJ A;  2F22 A;  4JEA A;  1QQ3 A;  2OG2 A;  4I44 A;  4RD9 A;  3LAY A;  1RJ9 A;  2YL3 A;  4FWV A;  3Q6M A;  2IXM A;  3C62 A;  1YZA A;  2LD6 A;  4XLP F;  2KSF A;  2EPK X;  1A7D A;  1MND A;  1ORY A;  2Q3T A;  4AL1 A;  5A6K A;  4JJF A;  1T5O A;  1K04 A;  3MYF A;  1HE1 A;  2OOC A;  2X51 A;  4DRJ B;  5KYY A;  2J7P A;  3A9C A;  1J8M F;  2R7O A;  4CSA A;  5B1B C;  3QZC A;  4YT2 A;  4IRU A;  1Z6A A;  5L3V A;  5KYU B;  1YLM A;  5DLJ A;  1MMG A;  2Y3B A;  4OD5 A;  4C7O B;  3JCU Q;  4Z9H A;  1PD1 A;  4K1O A;  3FOP A;  1T6Q A;  1V55 C;  3F46 A;  4Z9I A;  2R7W A;  2V3C C;  3RKO F;  3TD7 A;  4JC7 A;  1OCR C;  4JKV A;  3LLI A;  2XL6 A;  2XLO A;  3KPH A;  2J9W A;  4WGZ A;  4U5B E;  4B6I A;  3U2L A;  2A0B A;  2DYR C;  4IAQ A;  3PDM P;  1G4U S;  3KH2 A;  3NRH A;  4AK9 A;  2R7R A;  3CEX A;  4NQF A;  3HNL A;  3AGU A;  1QZX A;  4DRI B;  2J45 A;  3K66 A;  2HKV A;  5GPG B;  2X0C A;  1TWA A;  2LCH A;  4IJJ A;  5L0D A;  3FDQ A;  3DZA A;  1AEP A;  2P6V A;  2HSQ A;  3WOD F;  4C3B A;  2QE9 A;  3DD7 A;  4MW8 A;  3EHM A;  1BDJ B;  1ORJ A;  3ECS A;  4BJ6 C;  3C63 A;  1IW7 F;  2PX3 A;  1K05 A;  3ZTM A;  2A6H F;  5JS5 A;  3G4X A;  4H4K C;  2ASR A;  2XXA B;  3EFO B;  3GM3 A;  3L1M A;  1S05 A;  5F28 E;  1C02 A;  1F1M A;  2EIN C;  1ZW3 A;  3EHN A;  3EGX B;  1TQG A;  3N2Z B;  2CDQ A;  4LLC A;  4BJ5 A;  3ITF A;  4YWQ A;  4OIP F;  2XLV A;  5JRA A;  2A68 F;  4I1O B;  2Y39 A;  3B29 A;  5BQG A;  3RYL A;  4U5F E;  1KU2 A;  2NG1 A;  3AG2 C;  3I5Q A;  2YHS A;  4LDK A;  1RKE B;  1TR2 A;  4JE9 A;  3U5S A;  1VLS A;  2XRH A;  4CBE A;  3PCV A;  2RD9 A;  4FX5 A;  2OQM A;  4NTF A;  2YL1 A;  4JRZ A;  2EPO A;  4NTB A;  1KTM A;  1WAS A;  3ASO C;  3K7D A;  2NUP B;  4P9T A;  1XZP A;  4Q5S F;  3NKD A;  3CZ6 A;  4N6C A;  2XS1 A;  4A2N B;  3PHF 2;  3FHD A;  3TUL A;  1BR4 A;  1PV3 A;  2EPN A;  4CS9 C;  3DJU B;  4DRH B;  5JT4 A;  1MNE A;  1WTY A;  1YA9 A;  2XLE A;  5E3A A;  4EIY A;  2EIK C;  5KYW A;  2G62 A;  2XLW A;  1HW2 A;  1H7I A;  3B0P A;  3N24 A;  1VLT A;  4E18 A;  4FAP B;  3EJN A;  3MYI A;  3W4Y A;  2HV7 A;  2IXP A;  3V5X A;  2L6H A;  2ZD9 A;  1HW1 A;  3ABL C;  1GGQ A;  3HJC A;  5KYN A;  3IQ6 A;  3AG1 C;  4JW1 A;  5AGF A;  3RIP A;  5KYY B;  2XM4 A;  1FMW A;  5EGY A;  3GAN A;  1R4T A;  4MVM A;  1HY5 A;  1LPE A;  2HV6 A;  2R03 A;  3UR3 C;  3W2V A;  3ASN C;  2CCY A;  2HMQ A;  4MTO A;  3CSK A;  5L0H A;  3TOL A;  2QY9 A;  3LUT B;  3RW0 A;  1N1C A;  4YL0 A;  3VAY A;  2R7Q A;  3LLK A;  1W2W A;  2NSG A;  3TQO A;  1A0B A;  3NYL A;  2YVK A;  1E85 A;  1FAP B;  3IPM O;  3FAP B;  3B9Q A;  4PJL A;  4YT4 A;  4XWJ A;  2NSF A;  1YA7 O;  4MND A;  5L3Q A;  2XXA A;  4AE4 A;  1BBH A;  1EA8 A;  3EFO A;  1QLE C;  3EG9 A;  2WZG A;  3JTL O;  3L34 A;  1D1B A;  3GOR A;  2YL0 A;  1Z23 A;  2OEV A;  1ZHX A;  1V54 C;  1TWC A;  3EGX A;  4N06 A;  4U9D A;  4CJG A;  4E0H A;  5K0I A;  4UDV A;  3EGD B;  4BG0 A;  3S0X A;  2PBE A;  5JP7 A;  4I1M A;  1AVO B;  1YYJ A;  2I8B A;  3HNJ A;  3SXM A;  3WAQ A;  2Y3G A;  1OW8 A;  1BZ4 A;  3H2V A;  4PJM A;  1DOW A;  3EZH A;  3OWT A;  4W8K A;  5F5F A;  1RKE A;  1LS4 A;  2HJ3 A;  2WZF A;  4NC3 A;  1LE4 A;  1TFO B;  1TFK B;  3DAG A;  3KYI A;  2PFD A;  4YK5 A;  1NLX A;  1TWG A;  1ZW2 A;  2NPU A;  3GWL A;  3JT1 A;  4Q7C A;  4PK4 A;  1JRA A;  2EPM X;  3AQC A;  1U89 A;  2MHR A;  4MQ9 F;  2XM0 A;  3C18 A;  4J32 B;  4NTA A;  1XWJ A;  3M79 A;  4XPX A;  3X1O A;  3NDB B;  3MX3 A;  5FZT A;  4N4W A;  1FMV A;  1L7C A;  1CGN A;  1M56 C;  3QMK A;  1I5N A;  4AX2 A;  3IQC A;  3U2M A;  3WHN A;  3E9V A;  1NZE A;  2LIG A;  4P9F A;  3SXY A;  3LNM B;  2XLH A;  1Z7Q c;  3M15 A;  2B0J A;  5E2Q A;  4G7H F;  4C3D A;  4LDQ A;  1JR8 A;  256B A;  3BEH A;  1V4A A;  3GOD A;  3PMR A;  4BJ1 A;  3DJN B;  1R5I D;  3VRC A;  1D1C A;  4JZA A;  3DM9 B;  5CIV A;  4U5E E;  2A1D D;  2J9B A;  4E7S A;  4KI2 A;  2WVO A;  3G50 A;  4PJJ A;  3DAF A;  1OCZ C;  4W8P A;  3ZWI A;  2GA0 A;  5T3W A;  5KYW B;  3G4Z A;  1D0X A;  2H7V C;  1TWH A;  1TKN A;  2YZS A;  3DMD A;  3W2W A;  1EKY A;  3LS0 A;  4YJW A;  3L8J A;  3K1I C;  1EI7 A;  2PX0 A;  4CX9 A;  3K6B A;  4XQ1 A;  4CS8 A;  1LM3 B;  3OEO A;  4C3E A;  4CJO A;  4MVU A;  4JCH A;  5IY5 C;  5A6A A;  2XSE A;  2ZXR A;  2GFH A;  4FES A;  5JUA A;  2PF4 E;  3OA1 A;  4ULV A;  1IZM A;  3B0U X;  3AQB A;  2J0W A;  4PAC A;  1NBB A;  2VCC A;  3DE9 A;  2Q7R A;  2NUT A;  3EGD A;  3U8P A;  4EKW A;  1GQA A;  3JRT A;  5COF A;  4DVY P;  1M57 C;  1RKC A;  2ICW G;  5JSL A;  4GQH A;  3ABM C;  3QW0 A;  1FFT C;  4JVS A;  3T6J A;  5A6J A;  4PFP A;  4AE4 B;  3EG9 B;  1C03 A;  1CGO A;  3GM2 A;  4LLE A;  2YQY A;  3N0T A;  4I3M A;  4XEF A;  3LES A;  2LFF A;  4CS9 A;  4MS2 A;  4MTG A;  4CIH A;  1NU7 D;  3EH1 A;  2LQG A;  4WJ0 A;  2ZPA A;  3FXH A;  1SYQ A;  2CNW D;  2VAS A;  2C04 A;  3DI5 A;  5TJ5 E;  4CSA C;  3NYM A;  1ZHZ A;  1G5Z A;  5KYX B;  1H9G A;  3MBG A;  4D4X A;  1QKR A;  4X0R A;  1ZHT A;  3JSZ A;  1APC A;  4MTF A;  1C17 M;  1WGW A;  1YAR O;  3ZQV A;  3NMK A;  1VK5 A;  4CDA A;  4XLN F;  4H54 A;  3DM5 A;  3SNH A;  4MVQ A;  2KNH A;  1ST6 A;  4ONS A;  5L0J A;  2YRF A;  2D5R B;  1LI7 A;  2YKZ A;  1D0Y A;  2A69 F;  3HNI A;  3M4B A;  4ZLC A;  4ANJ A;  1I4Z A;  1VOM A;  2WVN A;  4QI0 A;  1LVK A;  5FCL A;  2EIL C;  4G7O F;  3SZR A;  1CGM E;  2R7T A;  2CNW A;  1LS1 A;  4YL1 A;  3ZC4 A;  4BEM J;  4K7B A;  2Q4F A;  1Y4C A;  3SYN A;  2LFD A;  2W4M A;  4MVO A;  3GM1 A;  5JVE A;  1QPU A;  4CS7 A;  4IAO A;  3GEI A;  4J7Y A;  3SXK A;  2Y3D A;  3C8G D;  4NY3 A;  3RVZ A;  4CDV A; 
#chains in the Genus database with same CATH homology
 1RKE B;  1QKR A;  1TR2 A;  4E17 A;  5L0D A;  4IGG A;  2X0C A;  3S90 A;  4EHP A;  3VF0 A;  2HSQ A;  3H2V A;  5L0H A;  1DOV A;  1DOW A;  4P9T A;  4ONS A;  1ST6 A;  5L0C A;  5L0J A;  1RKE A;  2L7A A;  3T6G B;  1RKC A;  4DJ9 A;  4PR9 A;  4K1O A;  4W8P A;  3ZDL A;  1ZW2 A;  5L0I A;  2B0H A;  1U89 A;  1XWJ A;  5L0F A;  1ZW3 A;  3H2U A;  2IBF A;  4E18 A;  1YDI A;  3MYI A;  5FZT A;  2LQG A;  1ZVZ A;  2GDC A;  3RF3 A;  1L7C A;  1SYQ A;  1U6H A;  3TJ6 A;  2GWW A;  5L0G A;  3TJ5 A;  1H6G A;  1T01 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...