2UUHA

Crystal structure of human leukotriene c4 synthase in complex with substrate glutathione
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
150
structure length
150
Chain Sequence
b'HHHHHHKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVYRAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALWLLVALAALGLLAHFLPAALRAALLGRLRT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LEUKOTRIENE C4 SYNTHASE
molecule tags Lyase
source organism Homo sapiens
publication title Structural Basis for Synthesis of Inflammatory Mediators by Human Leukotriene C4 Synthase.
pubmed doi rcsb
total genus 57
structure length 150
sequence length 150
ec nomenclature ec 4.4.1.20: Leukotriene-C(4) synthase.
pdb deposition date 2007-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01124 MAPEG MAPEG family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.550 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Membrane associated eicosanoid/glutathione metabolism-like domain 2uuhA00
4WABA 2Q7RA 5BQGA 4YL0A 4YK5A 4AL0A 4YL3A 4AL1A 2UUIA 4NTAA 4JRZA 4YL1A 2H8AA 4NTBA 3LEOA 3PCVA 4BPMA 5HV9A 4JC7A 4J7TA 4NTFA 5BQHA 4JCZA 3HKKA 5BQIA 5K0IA 4J7YA 2UUHA 3B29A 3DWWA 2PNOA
chains in the Genus database with same CATH superfamily
3DJNB 1WTYA 2WZLA 3LLKA 1GQAA 3ABMC 1YYXA 4DJ9A 2GFHA 4MW8A 3S28A 2ZD9A 4YN0B 1NU9C 5AC5A 2XS8A 2YZSA 4PACA 2WZFA 3CEXA 5B3SC 2RSEB 2WVNA 1LS4A 3IQTA 4XPXA 5D92A 1AEPA 1D0ZA 2A0BA 1YAUO 2HUJA 5JVEA 1OXKA 1I5NA 2HV6A 2KJGA 2J9VA 2MYSA 3EGDA 2LD6A 3EJNA 4JW1A 2XM0A 1PCXA 2Q9BA 2XXAB 3OEOA 1TWAA 3TOLA 2YLDA 2EIMC 3C8GA 3ASOC 1NBBA 2DYRC 4CS9A 3RQEA 2EPNA 3U9MA 4IAOA 2D4UA 4BG0A 2YL1A 3AOUA 5KYXA 2YL0A 5JSLA 2VCBA 4EBKA 4P9FA 1G4WR 1YZCA 2OG2A 3KKBA 3RH3A 4KI2A 1ZU4A 3EPVA 3LESA 4K7BA 1YJGA 1CGNA 3C18A 4PJLA 1TWGA 3DE9A 4IRUA 4ANJA 4F4BA 2L6FA 4D4XA 2OJED 4J32B 1D1CA 3EFOA 4Z9IA 4L6RA 1TQGA 5HV9A 1ORSC 2HV7A 3QW0A 4OIPF 1OQCA 2BE5F 1ZZPA 3C8ZA 3QTHA 4JCZA 1FFTC 2A68F 1S7ZA 1M2VB 3UGPA 2HSBA 3JRTA 4N4WA 5DS6A 2A6HF 3EG9B 4IJJA 1LIHA 3ZSUA 4GYTA 5E33A 3J06A 3S0XA 3C7JA 3BRJA 2WL8A 5KYWA 1BDJB 2R02A 3RFYA 3L0IA 4JVSA 1VB5A 1OR3A 5A6AA 3LEVA 3FAJA 4JTCB 4O7GA 2R7RA 4MVOA 4YK5A 3B0PA 4XEKA 1NLXA 2Q4FA 3B9QA 4XQ1A 1E86A 2OEXA 1VMAA 1NZEA 2YWAA 3TK0A 1S05A 1KTMA 4DRIB 1A7VA 1UFBA 4JRZA 2OKUA 4XEVA 3SXYA 4JKVA 4DRJB 5B3IA 1T5OA 3MFNA 1YVIA 1YA9A 5DS4A 3CSKA 3LJBA 4NTFA 3QMKA 4G7ZF 1C02A 2JD3A 1FR0A 1ZHWA 4K1OA 1V55C 3DZAA 1QKRA 4OD5A 2TMVP 1RKCA 1D0XA 4U5HA 1ZHZA 2CCYA 5B1BC 1WWPA 1LI7A 2L6GA 4IAQA 5A6JA 3PDMP 4EIYA 1E84A 2E87A 1MMNA 1D0YA 3ABLC 2H7VC 3DWWA 1I4YA 2V26A 5COFA 2EINC 4AK9A 4EBBA 1A7DA 1C17M 2DGJA 3H2VA 2CDQA 2C03A 2IYLD 3Q6MA 3M1CB 4BEJA 3R7CA 3ZTMA 3E9VA 2YLGA 4QDLA 3DJUB 5E3AA 5KYWB 2ZPAA 3C63A 3A9CA 2ZXRA 3JCUQ 3BEHA 4ULWA 2P0NA 3ZC4A 2EIJC 2YHSA 2FGYA 3AGTA 4NTAA 3T6JA 3G4ZA 1PV3A 4AE4B 4O6NA 2R7TA 2H7OA 4I3MA 2KNHA 5L0FA 3WG7C 3NYJA 2PBEA 2KK1A 1ZVZA 3SZRA 1Y6DA 1LKXA 3S90A 2NUTB 1BZ4A 1F1MA 3GM2A 4EHPA 3SXMA 1V4AA 3GODA 3K1IA 1MNDA 3X2QC 1BR2A 2PNOA 3FHDA 3KL4A 3B0UX 3NKEA 3RVZA 3MYFA 1KU2A 5JLIA 2Q3TA 2GDCA 3EGXA 2NSGA 4JURI 2YRFA 2LCHA 4W8PA 3QVZA 5L3VA 3FAPB 1EA8A 2P7VA 1R4TA 3C8GB 1JPJA 2XS1A 2R7WA 2ZXPA 5TJ5E 1DOVA 1Y4CA 1U0BB 2DB4A 3W8HA 2ZXWC 3EGDB 4GQHA 4JCHA 4MTFA 3WAQA 1QZXA 3CQZA 4E0IA 5HSWA 4EBJA 4PFOA 4DXWA 3QW1A 2OEVA 1OXBA 2Y3DA 3RKOF 3ZWIA 4CS8C 2HKVA 4UDVA 1QQ3A 3JT1A 4MVRA 3DAGA 4EWCA 4JZAA 3TD7A 3ZDLA 3K66A 3B29A 1M56C 3JSZA 3NMJA 3T6GB 3UGOA 4PFPA 3L8IA 4U5GA 3O6XA 4YT5A 2J9UA 2M4EA 3S27A 1BBHA 2PF4E 3QVYA 4E18A 2IXNA 1VOMA 1RMVA 1K05A 2XL6A 1O3UA 3A11A 3DI5A 2XLOA 4M63A 3AG1C 3ATPA 4WGYA 4JTAB 3T6BA 4CS8A 4DVZA 1LS1A 4P6IC 3B0VC 2EILC 4IB4A 2JPUA 1OKKA 4XPWA 5B1AC 3ASNC 3GEHA 1CGME 5CIVA 3ITFA 1T6UA 2CW0F 4B6IA 2EPMX 3RQFA 1G4US 3UMIA 3FXHA 2XM4A 1LVKA 3EZIA 1Q0DA 5A6KA 1MNEA 2J7PD 2RD9A 2R7UA 3IPMO 1OCOC 1ORYA 4FWVA 3ZVRA 1FFHA 3NMIA 2A6EF 3GM1A 3SEOA 5K0IA 1ZU5A 2ICWG 3U3BA 2LQGA 1HW1A 4E17A 2L6HA 1CPQA 4NCQA 2KYHA 1FMWA 4BJTA 1RJ9B 4GEHA 3V5ZA 3W4YA 3K6BA 1O87A 2NG1A 1CPRA 2WVOA 1OCRC 3QZCA 4I44A 2CYDA 2HJMA 2OQMA 3UR3C 4YWQA 3K1IC 3MBGA 1MMDA 4JE9A 5EK0A 3T4RA 3JZ0A 4MW3A 1WASA 2LSEA 4E7ZA 3C8GD 4XPYA 4U9EA 2X0CA 1TWCA 3EH2A 3M79A 2XLEA 3VYWA 3ZIBA 5AC4A 3GM3A 2I8BA 3WODF 2HFIA 2V3CC 4OINF 2R9RB 1VYKA 2LFFA 3V5XA 5KYYB 1TFKB 1N1CA 3I4UA 1IW7F 2J8WA 1RKEA 3UMHA 1VTMP 4LACB 4IARA 5KYUB 3DE8A 1JOGA 3JYYA 1ZYRF 3I5PA 3V7OA 2MHRA 1YA7O 2QNLA 2XLWA 3U5SA 4DRHB 2PX3A 3EZHA 4JJGA 4AL0A 1VYIA 2OJQA 1YYJA 3LAYA 2OCCC 1OCZC 2PFDA 2Q9AA 2G3KA 3G50A 5FZTA 1C03A 3S9OA 4A2NB 2Y3HA 4C3DA 1L3PA 1T6QA 2VCCA 5GPGB 2YL7A 1ZHXA 2XLMA 4NC3A 2W4BA 4NY3A 3H65A 1HE1A 2A1DD 4LLEA 1AVOB 1YDIA 4P9TA 1IZMA 4BJ6C 2J0XA 1H9GA 4U5DE 3LLIA 3NG1A 1JRAA 3TJ6A 1PD1A 4J7YA 2QTVA 1V74B 4NQFA 4U5EE 3UNGC 4G7OF 4E7SA 4KC9A 3Q6NA 1OCCC 2Y69C 2KC3A 2AU5A 4PK4A 2WVQA 3DMDA 4ER9A 3NRHA 5A6BD 2J45A 5BQGA 2LP4A 3VAYA 1JPNA 3F46A 4WGZA 3S29A 4AX2A 2AVKA 3IQ6A 4MS2A 3ZG1A 1XWJA 4CIPA 2GA0A 3POVA 2AWYA 3LEOA 4CBEA 1KNYA 3LNRA 2IXOA 2XLVA 4LDQA 1CGOA 3O55A 4HFKB 3AQBA 5DVWA 1APCA 1OW7A 4BJ1A 5F5HA 4CIHA 2L81A 3AG2C 3KMIA 2Y3GA 4MVSA 4XTKA 3GANA 1Z63A 4ZLDA 2R05A 1YLMA 3L1MA 2EPLX 5L0JA 3GEIA 3K33A 2VH3A 3L8JA 2J46A 2XRHA 5D91A 3KH2A 2HS5A 4ZLCA 3RYLA 2YLIA 2Q7RA 3ZTZA 3IQCA 5L3QA 2R7SA 1TKNA 4BEMJ 3FOOA 1Q0GA 4OIOF 1QPUA 2WB7A 3ECSA 1LM3B 1RKEB 3LS0A 1Z5ZA 4N06A 1LE4A 1HE9A 2NUPA 2R7XA 4C7OA 2H8AA 2P61A 3B71A 2MWQA 4BJ5C 5KYYA 3TJ5A 1LI5A 3JYHA 4IGGA 2Z15A 1G8XA 4J7TA 1EQ1A 5L0DA 4I1MA 2GWWA 2JX0A 5T3WA 1A41A 2NPUA 2W45A 3CZ6A 1HMDA 4ULVA 2YL3A 3FOPA 3JRMO 2BC5A 2L7AA 3RQGA 1GS9A 4G7HF 1RCPA 4MTOA 3OWTA 4O6YA 3U0CA 5JT4A 2Q00A 2R25A 1FMVA 1QVXA 3L34A 3Q7LA 1Z6AA 3M4BA 2D5RB 1HMOA 3S84A 3TULA 2QUPA 4Q4ZF 4CSAA 2FAPB 2HSQA 2G62A 1ST6A 3DAFA 4HEAJ 4Z9HA 3RIPA 5DQZA 3UMKA 1NFOA 4D4NA 4FAPB 4XLPF 4Z9JA 4O6MA 3M4CA 4W8KA 1HW2A 2F22A 4H4KC 2QY9A 1FTSA 4CX9A 4H54A 2ETSA 1A0BA 3N2ZB 4HE8D 1ORJA 2UUIA 4KNWA 4AL1A 4O79A 4MVMA 2CGEA 4ONSA 2Y3BA 5COGA 5DQTA 1EI7A 3LNMB 3W2WA 4N6HA 1WATA 3AG3C 2G3VA 4JC7A 3FMSA 3R2PA 1T01A 3X1OA 3AG4C 3N24A 1QSPA 1QLEC 4MQ9F 4U5FE 2P6VA 4LLCA 3M15A 2KGOA 1T6IA 5E2QA 2J9BA 1FNTc 4YT4A 2IM8A 1K40A 3DD7A 4EUKB 3O39A 3Q7GA 1H7IA 4OIQF 5EGYA 5DS5A 4X0RA 1EKYA 1OKKD 4CDAA 3RF3A 3FDQA 3NKDA 4K0DA 1LPEA 3PMRA 4MNDA 3IEEA 5F28E 3W2VA 4YT2A 2GAQA 1OR2A 2XSEA 4MVQA 1PD0A 5F5FA 1HY5A 1U89A 3ABKC 3MX3A 2C04A 3VRCA 2IXPA 4JTDB 2HMQA 4C3EA 4YL1A 3C62A 4JJFA 5JP7A 1TWHA 2AWCA 3V5YA 5EHHA 2QLAA 1JMWA 3GEEA 4PJNA 5BQHA 1XZQA 4C3BA 4XWJA 2ASRA 1Q0KA 4QI0A 3VF0A 4RDAA 1BR1A 4JEBA 4MVZA 2J9WA 3RW0A 3N0TA 1NFNA 1WOLA 1YZAA 256BA 3LS1A 1BR4A 2VASA 4N6CA 2NUPB 4BJ5A 4C7OB 1E2XA 1WGWA 5IY5C 3I5QA 2XL4A 1D1AA 3AJMA 1R5ID 4Q7CA 4Q5SF 5CI9A 2QE9A 5L0CA 2IOQA 3ZQYA 2KSFA 4FX5A 3EGXB 3TOMA 3KYIA 3DXJF 4JIOA 4WJ0A 2YVKA 3GORA 2HJ3A 2BL2A 2YKZA 2R03A 1MMAA 1JR8A 4CSAC 3U3FA 1Q0FA 1OW6A 1YARO 1JAFA 1NG1A 4MVUA 3PCVA 5AGFA 5E3CA 3FVYA 2NUTA 3U8PA 2CNWA 1D1BA 5JS5A 3SNHA 3SXZA 3T9OA 4U5CE 3G4XA 1J8YF 1OW8A 2IBFA 2HMZA 2A69F 1VLTA 1FAPB 3HKKA 4LERA 4DOZA 3K1HA 3JTLO 3VM6A 2DI3A 1XZPA 3HNKA 4J30B 1Z3IX 2J0WA 3AGUA 4AE4A 5JRAA 1ZHYA 2WZGA 3W8IA 1DOWA 1NU7D 2VB6A 3MYIA 1K04A 1TFOB 2VC9A 5BUOA 3EHNA 1E83A 5A69A 1Z23A 3F47A 1V54C 2KQ9A 3MLGA 2LFDA 2OU6A 1LE2A 2B0HA 3NDBB 1B68A 3AQCA 1ZHTA 4OD4A 4YL3A 1UG7A 4RBNA 3H2UA 4EKWA 5JUAA 3EHMA 3KYJA 4BJ6A 1RXQA 5T3TA 3HNJA 4IWBA 1SMYF 3NYLA 1ZW2A 2VCAA 1E85A 4CDVA 1L7CA 2IXMA 3EH1A 4XLNF 3U2LA 2W9YA 3DKAA 3DM5A 3U2MA 2I15A 3SYNA 3DM9B 1VK5A 5BQIA 3ZQVA 5L0HA 1O5HA 3PHF2 2LK4A 3GWNA 3US6A 4CS7A 1A7EA 4RD9A 2M64A 3WHNA 3K7DA 3TQOA 2Y39A 4G78A 1GM5A 3KPHA 2FFHA 2YQYA 1TR2A 1SYQA 5KYUA 2X51A 2W4MA 4YL0A 3GWLA 2OOCA 3NMKA 1W2WA 2H7BA 2R7QA 4I1OB 3JSEO 3NYMA 3HJCA 4QI2A 3IHUA 2P1AA 2XL8A 5KYNA 4PJMA 1SR2A 3EG9A 2NSFA 1ZW3A 3HTKC 4DBRA 1M2VA 2CNWD 5FCLA 2AP3A 3CAXA 2LIGA 1U6HA 4HFFB 5DLJA 1H9TA 4R32A 1I4ZA 4LDKA 1J8MF 1Z7Qc 3HNLA 2Q9CA 4PR9A 2HZ8A 3EFOB 4FESA 5COMA 1AUEA 4DBQA 3LUTB 2XLDA 3SP1A 4U9DA 3U9JA 1MQVA 1G5ZA 3HNIA 4YJWA 4KNVA 1NSGB 1Q0MA 1M57C 2O9XA 2B0JA 2XLHA 5T1DB 4A4AA 5L0IA 4WABA 1H6GA 1RJ9A 2DYSC 2KW3C 1SF8A 4KBLA 4XEFA 5CI8A 2EIKC 4CS9C 5KYXB 3HLZA 5A6BA 3EQLF 5L0GA 3OA1A 4MTGA 4NTBA 4E0HA 1T9KA 4U5BE 4BPMA 1VLSA 2A0UA 4CJGA 4DVYP 2XXAA 3SXKA 1WN0A 2EPOA 4YT8A 2PX0A 4G0HA 3E70C 3RVYA 4CJOA 2J7PA 2ZXOA 1M6TA 3U8VA 4CDYA 4JEAA 2PP4A 1MMGA 2R7VA 3O10A 1GGQA 2R7OA 3IQ5A 2EPKX 2YEVA 2UUHA 4PJJA 4LDRA 4OIRF 1SZIA 2L9JA 1M2OA
chains in the Genus database with same CATH topology
4WABA 2Q7RA 5BQGA 4YL0A 4YK5A 4AL0A 4YL3A 4AL1A 2UUIA 4NTAA 4JRZA 4YL1A 2H8AA 4NTBA 3LEOA 3PCVA 4BPMA 5HV9A 4JC7A 4J7TA 4NTFA 5BQHA 4JCZA 3HKKA 5BQIA 5K0IA 4J7YA 2UUHA 3B29A 3DWWA 2PNOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WAB A;  2Q7R A;  5BQG A;  4YL0 A;  4YK5 A;  4AL0 A;  4YL3 A;  4AL1 A;  2UUI A;  4NTA A;  4JRZ A;  4YL1 A;  2H8A A;  4NTB A;  3LEO A;  3PCV A;  4BPM A;  5HV9 A;  4JC7 A;  4J7T A;  4NTF A;  5BQH A;  4JCZ A;  3HKK A;  5BQI A;  5K0I A;  4J7Y A;  2UUH A;  3B29 A;  3DWW A;  2PNO A; 
#chains in the Genus database with same CATH topology
 3DJN B;  1WTY A;  2WZL A;  3LLK A;  1GQA A;  3ABM C;  1YYX A;  4DJ9 A;  2GFH A;  4MW8 A;  3S28 A;  2ZD9 A;  4YN0 B;  1NU9 C;  5AC5 A;  2XS8 A;  2YZS A;  4PAC A;  2WZF A;  3CEX A;  5B3S C;  2RSE B;  2WVN A;  1LS4 A;  3IQT A;  4XPX A;  5D92 A;  1AEP A;  1D0Z A;  2A0B A;  1YAU O;  2HUJ A;  5JVE A;  1OXK A;  1I5N A;  2HV6 A;  2KJG A;  2J9V A;  2MYS A;  3EGD A;  2LD6 A;  3EJN A;  4JW1 A;  2XM0 A;  1PCX A;  2Q9B A;  2XXA B;  3OEO A;  1TWA A;  3TOL A;  2YLD A;  2EIM C;  3C8G A;  3ASO C;  1NBB A;  2DYR C;  4CS9 A;  3RQE A;  2EPN A;  3U9M A;  4IAO A;  2D4U A;  4BG0 A;  2YL1 A;  3AOU A;  5KYX A;  2YL0 A;  5JSL A;  2VCB A;  4EBK A;  4P9F A;  1G4W R;  1YZC A;  2OG2 A;  3KKB A;  3RH3 A;  4KI2 A;  1ZU4 A;  3EPV A;  3LES A;  4K7B A;  1YJG A;  1CGN A;  3C18 A;  4PJL A;  1TWG A;  3DE9 A;  4IRU A;  4ANJ A;  4F4B A;  2L6F A;  4D4X A;  2OJE D;  4J32 B;  1D1C A;  3EFO A;  4Z9I A;  4L6R A;  1TQG A;  5HV9 A;  1ORS C;  2HV7 A;  3QW0 A;  4OIP F;  1OQC A;  2BE5 F;  1ZZP A;  3C8Z A;  3QTH A;  4JCZ A;  1FFT C;  2A68 F;  1S7Z A;  1M2V B;  3UGP A;  2HSB A;  3JRT A;  4N4W A;  5DS6 A;  2A6H F;  3EG9 B;  4IJJ A;  1LIH A;  3ZSU A;  4GYT A;  5E33 A;  3J06 A;  3S0X A;  3C7J A;  3BRJ A;  2WL8 A;  5KYW A;  1BDJ B;  2R02 A;  3RFY A;  3L0I A;  4JVS A;  1VB5 A;  1OR3 A;  5A6A A;  3LEV A;  3FAJ A;  4JTC B;  4O7G A;  2R7R A;  4MVO A;  4YK5 A;  3B0P A;  4XEK A;  1NLX A;  2Q4F A;  3B9Q A;  4XQ1 A;  1E86 A;  2OEX A;  1VMA A;  1NZE A;  2YWA A;  3TK0 A;  1S05 A;  1KTM A;  4DRI B;  1A7V A;  1UFB A;  4JRZ A;  2OKU A;  4XEV A;  3SXY A;  4JKV A;  4DRJ B;  5B3I A;  1T5O A;  3MFN A;  1YVI A;  1YA9 A;  5DS4 A;  3CSK A;  3LJB A;  4NTF A;  3QMK A;  4G7Z F;  1C02 A;  2JD3 A;  1FR0 A;  1ZHW A;  4K1O A;  1V55 C;  3DZA A;  1QKR A;  4OD5 A;  2TMV P;  1RKC A;  1D0X A;  4U5H A;  1ZHZ A;  2CCY A;  5B1B C;  1WWP A;  1LI7 A;  2L6G A;  4IAQ A;  5A6J A;  3PDM P;  4EIY A;  1E84 A;  2E87 A;  1MMN A;  1D0Y A;  3ABL C;  2H7V C;  3DWW A;  1I4Y A;  2V26 A;  5COF A;  2EIN C;  4AK9 A;  4EBB A;  1A7D A;  1C17 M;  2DGJ A;  3H2V A;  2CDQ A;  2C03 A;  2IYL D;  3Q6M A;  3M1C B;  4BEJ A;  3R7C A;  3ZTM A;  3E9V A;  2YLG A;  4QDL A;  3DJU B;  5E3A A;  5KYW B;  2ZPA A;  3C63 A;  3A9C A;  2ZXR A;  3JCU Q;  3BEH A;  4ULW A;  2P0N A;  3ZC4 A;  2EIJ C;  2YHS A;  2FGY A;  3AGT A;  4NTA A;  3T6J A;  3G4Z A;  1PV3 A;  4AE4 B;  4O6N A;  2R7T A;  2H7O A;  4I3M A;  2KNH A;  5L0F A;  3WG7 C;  3NYJ A;  2PBE A;  2KK1 A;  1ZVZ A;  3SZR A;  1Y6D A;  1LKX A;  3S90 A;  2NUT B;  1BZ4 A;  1F1M A;  3GM2 A;  4EHP A;  3SXM A;  1V4A A;  3GOD A;  3K1I A;  1MND A;  3X2Q C;  1BR2 A;  2PNO A;  3FHD A;  3KL4 A;  3B0U X;  3NKE A;  3RVZ A;  3MYF A;  1KU2 A;  5JLI A;  2Q3T A;  2GDC A;  3EGX A;  2NSG A;  4JUR I;  2YRF A;  2LCH A;  4W8P A;  3QVZ A;  5L3V A;  3FAP B;  1EA8 A;  2P7V A;  1R4T A;  3C8G B;  1JPJ A;  2XS1 A;  2R7W A;  2ZXP A;  5TJ5 E;  1DOV A;  1Y4C A;  1U0B B;  2DB4 A;  3W8H A;  2ZXW C;  3EGD B;  4GQH A;  4JCH A;  4MTF A;  3WAQ A;  1QZX A;  3CQZ A;  4E0I A;  5HSW A;  4EBJ A;  4PFO A;  4DXW A;  3QW1 A;  2OEV A;  1OXB A;  2Y3D A;  3RKO F;  3ZWI A;  4CS8 C;  2HKV A;  4UDV A;  1QQ3 A;  3JT1 A;  4MVR A;  3DAG A;  4EWC A;  4JZA A;  3TD7 A;  3ZDL A;  3K66 A;  3B29 A;  1M56 C;  3JSZ A;  3NMJ A;  3T6G B;  3UGO A;  4PFP A;  3L8I A;  4U5G A;  3O6X A;  4YT5 A;  2J9U A;  2M4E A;  3S27 A;  1BBH A;  2PF4 E;  3QVY A;  4E18 A;  2IXN A;  1VOM A;  1RMV A;  1K05 A;  2XL6 A;  1O3U A;  3A11 A;  3DI5 A;  2XLO A;  4M63 A;  3AG1 C;  3ATP A;  4WGY A;  4JTA B;  3T6B A;  4CS8 A;  4DVZ A;  1LS1 A;  4P6I C;  3B0V C;  2EIL C;  4IB4 A;  2JPU A;  1OKK A;  4XPW A;  5B1A C;  3ASN C;  3GEH A;  1CGM E;  5CIV A;  3ITF A;  1T6U A;  2CW0 F;  4B6I A;  2EPM X;  3RQF A;  1G4U S;  3UMI A;  3FXH A;  2XM4 A;  1LVK A;  3EZI A;  1Q0D A;  5A6K A;  1MNE A;  2J7P D;  2RD9 A;  2R7U A;  3IPM O;  1OCO C;  1ORY A;  4FWV A;  3ZVR A;  1FFH A;  3NMI A;  2A6E F;  3GM1 A;  3SEO A;  5K0I A;  1ZU5 A;  2ICW G;  3U3B A;  2LQG A;  1HW1 A;  4E17 A;  2L6H A;  1CPQ A;  4NCQ A;  2KYH A;  1FMW A;  4BJT A;  1RJ9 B;  4GEH A;  3V5Z A;  3W4Y A;  3K6B A;  1O87 A;  2NG1 A;  1CPR A;  2WVO A;  1OCR C;  3QZC A;  4I44 A;  2CYD A;  2HJM A;  2OQM A;  3UR3 C;  4YWQ A;  3K1I C;  3MBG A;  1MMD A;  4JE9 A;  5EK0 A;  3T4R A;  3JZ0 A;  4MW3 A;  1WAS A;  2LSE A;  4E7Z A;  3C8G D;  4XPY A;  4U9E A;  2X0C A;  1TWC A;  3EH2 A;  3M79 A;  2XLE A;  3VYW A;  3ZIB A;  5AC4 A;  3GM3 A;  2I8B A;  3WOD F;  2HFI A;  2V3C C;  4OIN F;  2R9R B;  1VYK A;  2LFF A;  3V5X A;  5KYY B;  1TFK B;  1N1C A;  3I4U A;  1IW7 F;  2J8W A;  1RKE A;  3UMH A;  1VTM P;  4LAC B;  4IAR A;  5KYU B;  3DE8 A;  1JOG A;  3JYY A;  1ZYR F;  3I5P A;  3V7O A;  2MHR A;  1YA7 O;  2QNL A;  2XLW A;  3U5S A;  4DRH B;  2PX3 A;  3EZH A;  4JJG A;  4AL0 A;  1VYI A;  2OJQ A;  1YYJ A;  3LAY A;  2OCC C;  1OCZ C;  2PFD A;  2Q9A A;  2G3K A;  3G50 A;  5FZT A;  1C03 A;  3S9O A;  4A2N B;  2Y3H A;  4C3D A;  1L3P A;  1T6Q A;  2VCC A;  5GPG B;  2YL7 A;  1ZHX A;  2XLM A;  4NC3 A;  2W4B A;  4NY3 A;  3H65 A;  1HE1 A;  2A1D D;  4LLE A;  1AVO B;  1YDI A;  4P9T A;  1IZM A;  4BJ6 C;  2J0X A;  1H9G A;  4U5D E;  3LLI A;  3NG1 A;  1JRA A;  3TJ6 A;  1PD1 A;  4J7Y A;  2QTV A;  1V74 B;  4NQF A;  4U5E E;  3UNG C;  4G7O F;  4E7S A;  4KC9 A;  3Q6N A;  1OCC C;  2Y69 C;  2KC3 A;  2AU5 A;  4PK4 A;  2WVQ A;  3DMD A;  4ER9 A;  3NRH A;  5A6B D;  2J45 A;  5BQG A;  2LP4 A;  3VAY A;  1JPN A;  3F46 A;  4WGZ A;  3S29 A;  4AX2 A;  2AVK A;  3IQ6 A;  4MS2 A;  3ZG1 A;  1XWJ A;  4CIP A;  2GA0 A;  3POV A;  2AWY A;  3LEO A;  4CBE A;  1KNY A;  3LNR A;  2IXO A;  2XLV A;  4LDQ A;  1CGO A;  3O55 A;  4HFK B;  3AQB A;  5DVW A;  1APC A;  1OW7 A;  4BJ1 A;  5F5H A;  4CIH A;  2L81 A;  3AG2 C;  3KMI A;  2Y3G A;  4MVS A;  4XTK A;  3GAN A;  1Z63 A;  4ZLD A;  2R05 A;  1YLM A;  3L1M A;  2EPL X;  5L0J A;  3GEI A;  3K33 A;  2VH3 A;  3L8J A;  2J46 A;  2XRH A;  5D91 A;  3KH2 A;  2HS5 A;  4ZLC A;  3RYL A;  2YLI A;  2Q7R A;  3ZTZ A;  3IQC A;  5L3Q A;  2R7S A;  1TKN A;  4BEM J;  3FOO A;  1Q0G A;  4OIO F;  1QPU A;  2WB7 A;  3ECS A;  1LM3 B;  1RKE B;  3LS0 A;  1Z5Z A;  4N06 A;  1LE4 A;  1HE9 A;  2NUP A;  2R7X A;  4C7O A;  2H8A A;  2P61 A;  3B71 A;  2MWQ A;  4BJ5 C;  5KYY A;  3TJ5 A;  1LI5 A;  3JYH A;  4IGG A;  2Z15 A;  1G8X A;  4J7T A;  1EQ1 A;  5L0D A;  4I1M A;  2GWW A;  2JX0 A;  5T3W A;  1A41 A;  2NPU A;  2W45 A;  3CZ6 A;  1HMD A;  4ULV A;  2YL3 A;  3FOP A;  3JRM O;  2BC5 A;  2L7A A;  3RQG A;  1GS9 A;  4G7H F;  1RCP A;  4MTO A;  3OWT A;  4O6Y A;  3U0C A;  5JT4 A;  2Q00 A;  2R25 A;  1FMV A;  1QVX A;  3L34 A;  3Q7L A;  1Z6A A;  3M4B A;  2D5R B;  1HMO A;  3S84 A;  3TUL A;  2QUP A;  4Q4Z F;  4CSA A;  2FAP B;  2HSQ A;  2G62 A;  1ST6 A;  3DAF A;  4HEA J;  4Z9H A;  3RIP A;  5DQZ A;  3UMK A;  1NFO A;  4D4N A;  4FAP B;  4XLP F;  4Z9J A;  4O6M A;  3M4C A;  4W8K A;  1HW2 A;  2F22 A;  4H4K C;  2QY9 A;  1FTS A;  4CX9 A;  4H54 A;  2ETS A;  1A0B A;  3N2Z B;  4HE8 D;  1ORJ A;  2UUI A;  4KNW A;  4AL1 A;  4O79 A;  4MVM A;  2CGE A;  4ONS A;  2Y3B A;  5COG A;  5DQT A;  1EI7 A;  3LNM B;  3W2W A;  4N6H A;  1WAT A;  3AG3 C;  2G3V A;  4JC7 A;  3FMS A;  3R2P A;  1T01 A;  3X1O A;  3AG4 C;  3N24 A;  1QSP A;  1QLE C;  4MQ9 F;  4U5F E;  2P6V A;  4LLC A;  3M15 A;  2KGO A;  1T6I A;  5E2Q A;  2J9B A;  1FNT c;  4YT4 A;  2IM8 A;  1K40 A;  3DD7 A;  4EUK B;  3O39 A;  3Q7G A;  1H7I A;  4OIQ F;  5EGY A;  5DS5 A;  4X0R A;  1EKY A;  1OKK D;  4CDA A;  3RF3 A;  3FDQ A;  3NKD A;  4K0D A;  1LPE A;  3PMR A;  4MND A;  3IEE A;  5F28 E;  3W2V A;  4YT2 A;  2GAQ A;  1OR2 A;  2XSE A;  4MVQ A;  1PD0 A;  5F5F A;  1HY5 A;  1U89 A;  3ABK C;  3MX3 A;  2C04 A;  3VRC A;  2IXP A;  4JTD B;  2HMQ A;  4C3E A;  4YL1 A;  3C62 A;  4JJF A;  5JP7 A;  1TWH A;  2AWC A;  3V5Y A;  5EHH A;  2QLA A;  1JMW A;  3GEE A;  4PJN A;  5BQH A;  1XZQ A;  4C3B A;  4XWJ A;  2ASR A;  1Q0K A;  4QI0 A;  3VF0 A;  4RDA A;  1BR1 A;  4JEB A;  4MVZ A;  2J9W A;  3RW0 A;  3N0T A;  1NFN A;  1WOL A;  1YZA A;  256B A;  3LS1 A;  1BR4 A;  2VAS A;  4N6C A;  2NUP B;  4BJ5 A;  4C7O B;  1E2X A;  1WGW A;  5IY5 C;  3I5Q A;  2XL4 A;  1D1A A;  3AJM A;  1R5I D;  4Q7C A;  4Q5S F;  5CI9 A;  2QE9 A;  5L0C A;  2IOQ A;  3ZQY A;  2KSF A;  4FX5 A;  3EGX B;  3TOM A;  3KYI A;  3DXJ F;  4JIO A;  4WJ0 A;  2YVK A;  3GOR A;  2HJ3 A;  2BL2 A;  2YKZ A;  2R03 A;  1MMA A;  1JR8 A;  4CSA C;  3U3F A;  1Q0F A;  1OW6 A;  1YAR O;  1JAF A;  1NG1 A;  4MVU A;  3PCV A;  5AGF A;  5E3C A;  3FVY A;  2NUT A;  3U8P A;  2CNW A;  1D1B A;  5JS5 A;  3SNH A;  3SXZ A;  3T9O A;  4U5C E;  3G4X A;  1J8Y F;  1OW8 A;  2IBF A;  2HMZ A;  2A69 F;  1VLT A;  1FAP B;  3HKK A;  4LER A;  4DOZ A;  3K1H A;  3JTL O;  3VM6 A;  2DI3 A;  1XZP A;  3HNK A;  4J30 B;  1Z3I X;  2J0W A;  3AGU A;  4AE4 A;  5JRA A;  1ZHY A;  2WZG A;  3W8I A;  1DOW A;  1NU7 D;  2VB6 A;  3MYI A;  1K04 A;  1TFO B;  2VC9 A;  5BUO A;  3EHN A;  1E83 A;  5A69 A;  1Z23 A;  3F47 A;  1V54 C;  2KQ9 A;  3MLG A;  2LFD A;  2OU6 A;  1LE2 A;  2B0H A;  3NDB B;  1B68 A;  3AQC A;  1ZHT A;  4OD4 A;  4YL3 A;  1UG7 A;  4RBN A;  3H2U A;  4EKW A;  5JUA A;  3EHM A;  3KYJ A;  4BJ6 A;  1RXQ A;  5T3T A;  3HNJ A;  4IWB A;  1SMY F;  3NYL A;  1ZW2 A;  2VCA A;  1E85 A;  4CDV A;  1L7C A;  2IXM A;  3EH1 A;  4XLN F;  3U2L A;  2W9Y A;  3DKA A;  3DM5 A;  3U2M A;  2I15 A;  3SYN A;  3DM9 B;  1VK5 A;  5BQI A;  3ZQV A;  5L0H A;  1O5H A;  3PHF 2;  2LK4 A;  3GWN A;  3US6 A;  4CS7 A;  1A7E A;  4RD9 A;  2M64 A;  3WHN A;  3K7D A;  3TQO A;  2Y39 A;  4G78 A;  1GM5 A;  3KPH A;  2FFH A;  2YQY A;  1TR2 A;  1SYQ A;  5KYU A;  2X51 A;  2W4M A;  4YL0 A;  3GWL A;  2OOC A;  3NMK A;  1W2W A;  2H7B A;  2R7Q A;  4I1O B;  3JSE O;  3NYM A;  3HJC A;  4QI2 A;  3IHU A;  2P1A A;  2XL8 A;  5KYN A;  4PJM A;  1SR2 A;  3EG9 A;  2NSF A;  1ZW3 A;  3HTK C;  4DBR A;  1M2V A;  2CNW D;  5FCL A;  2AP3 A;  3CAX A;  2LIG A;  1U6H A;  4HFF B;  5DLJ A;  1H9T A;  4R32 A;  1I4Z A;  4LDK A;  1J8M F;  1Z7Q c;  3HNL A;  2Q9C A;  4PR9 A;  2HZ8 A;  3EFO B;  4FES A;  5COM A;  1AUE A;  4DBQ A;  3LUT B;  2XLD A;  3SP1 A;  4U9D A;  3U9J A;  1MQV A;  1G5Z A;  3HNI A;  4YJW A;  4KNV A;  1NSG B;  1Q0M A;  1M57 C;  2O9X A;  2B0J A;  2XLH A;  5T1D B;  4A4A A;  5L0I A;  4WAB A;  1H6G A;  1RJ9 A;  2DYS C;  2KW3 C;  1SF8 A;  4KBL A;  4XEF A;  5CI8 A;  2EIK C;  4CS9 C;  5KYX B;  3HLZ A;  5A6B A;  3EQL F;  5L0G A;  3OA1 A;  4MTG A;  4NTB A;  4E0H A;  1T9K A;  4U5B E;  4BPM A;  1VLS A;  2A0U A;  4CJG A;  4DVY P;  2XXA A;  3SXK A;  1WN0 A;  2EPO A;  4YT8 A;  2PX0 A;  4G0H A;  3E70 C;  3RVY A;  4CJO A;  2J7P A;  2ZXO A;  1M6T A;  3U8V A;  4CDY A;  4JEA A;  2PP4 A;  1MMG A;  2R7V A;  3O10 A;  1GGQ A;  2R7O A;  3IQ5 A;  2EPK X;  2YEV A;  2UUH A;  4PJJ A;  4LDR A;  4OIR F;  1SZI A;  2L9J A;  1M2O A; 
#chains in the Genus database with same CATH homology
 4WAB A;  2Q7R A;  5BQG A;  4YL0 A;  4YK5 A;  4AL0 A;  4YL3 A;  4AL1 A;  2UUI A;  4NTA A;  4JRZ A;  4YL1 A;  2H8A A;  4NTB A;  3LEO A;  3PCV A;  4BPM A;  5HV9 A;  4JC7 A;  4J7T A;  4NTF A;  5BQH A;  4JCZ A;  3HKK A;  5BQI A;  5K0I A;  4J7Y A;  2UUH A;  3B29 A;  3DWW A;  2PNO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...