2UUHA

Crystal structure of human leukotriene c4 synthase in complex with substrate glutathione
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
150
structure length
150
Chain Sequence
HHHHHHKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVYRAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALWLLVALAALGLLAHFLPAALRAALLGRLRT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords LEUKOTRIENE C4 SYNTHASE
publication title Structural Basis for Synthesis of Inflammatory Mediators by Human Leukotriene C4 Synthase.
pubmed doi rcsb
source organism Homo sapiens
total genus 57
structure length 150
sequence length 150
ec nomenclature ec 4.4.1.20: Leukotriene-C(4) synthase.
pdb deposition date 2007-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01124 MAPEG MAPEG family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.550 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Membrane associated eicosanoid/glutathione metabolism-like domain 2uuhA00
4YL0A 4AL1A 5HV9A 2H8AA 2Q7RA 3HKKA 2UUHA 4J7TA 4AL0A 5BQHA 2UUIA 3DWWA 5K0IA 5BQIA 3LEOA 3PCVA 4J7YA 4YL3A 4JRZA 5BQGA 4BPMA 2PNOA 4NTAA 3B29A 4JC7A 4NTFA 4YK5A 4NTBA 4YL1A 4WABA 4JCZA
chains in the Genus database with same CATH superfamily
1OQCA 2R7OA 1YA9A 1ORYA 3O10A 5FZTA 3ZWIA 3MBGA 2VASA 2ZPAA 2EPMX 4P9TA 1CGOA 3TK0A 3Q7LA 2KQ9A 4XQ1A 3ZQVA 1V74B 2H8AA 1JR8A 4X0RA 1K04A 1T9KA 2Q7RA 2QE9A 2XLMA 3ZTZA 4YJWA 1KTMA 1T5OA 4N6HA 3AQCA 2KGOA 3E70C 1LS1A 3T9OA 2MYSA 1EI7A 1NG1A 3MYFA 1A41A 3EG9B 4E17A 2IOQA 1J8YF 5D91A 1ZHWA 3NDBB 3GM3A 2ASRA 3MYIA 3RW0A 1T6UA 4PK4A 3MFNA 5GPGB 4XTKA 2O9XA 3FAJA 4FAPB 3K1IA 1TFKB 1BR1A 1B68A 4JVSA 5D92A 5A6BD 4JJGA 1CPRA 5HSWA 4MTGA 5JT4A 3Q6MA 3JCUQ 4OIOF 5TJ5E 3HNLA 5A6JA 4JURI 5FCLA 2QLAA 5F5HA 5F28E 1S7ZA 3HKKA 1M56C 1BZ4A 2IXMA 2Z15A 2HSQA 3RF3A 4LACB 4EHPA 2XL8A 1FMWA 1TR2A 3U8VA 2DB4A 3L8IA 5F5FA 1QLEC 1R5ID 2P1AA 4BEMJ 2CGEA 4N4WA 2I8BA 4XLPF 2YL0A 4ZLDA 4E7ZA 1YVIA 2R03A 1JAFA 3O39A 2XLWA 1SMYF 2E87A 5KYWB 4LERA 3FVYA 2WZGA 4ULWA 2JPUA 2LCHA 3DZAA 2OQMA 4JW1A 3HNKA 2V3CC 4RDAA 1FAPB 2AP3A 1RCPA 3E9VA 3K1IC 2GAQA 5DQTA 2J7PA 2M4EA 4Z9IA 5EGYA 3HTKC 1Z5ZA 2M64A 1WTYA 1T01A 3TD7A 3VF0A 4DBRA 1DOVA 2QY9A 1QQ3A 4K7BA 4XEVA 3DAFA 1LI5A 1A0BA 1VOMA 4CSAC 1C17M 1OCCC 1CPQA 4LDQA 3S9OA 5BQIA 4IRUA 2LD6A 4CS8C 2W9YA 3W2VA 1MMGA 1ZW2A 3JTLO 2AWCA 3JYYA 2LIGA 3NYMA 4WJ0A 3T6BA 4EBBA 1FNTc 4CS9C 1LE2A 4KNWA 3L1MA 2EINC 2NSFA 2J9UA 1AUEA 2YLDA 2HV7A 4NTFA 2A0BA 4YK5A 5KYYA 2HMZA 1UFBA 4GYTA 1U6HA 1YJGA 2H7VC 1OXKA 1LM3B 2D5RB 3DJUB 3LLKA 3MLGA 4GEHA 4OIRF 4OIPF 4WGYA 4QI0A 4C7OA 3RFYA 3S29A 3GWNA 4Q4ZF 2LK4A 5E3CA 3W2WA 3NKEA 4ZLCA 2VCAA 3RVYA 1RJ9A 3GEIA 5EHHA 2XXAA 2WVOA 2DYRC 2L9JA 2YLIA 3H65A 3JYHA 4XWJA 5IY5C 3B9QA 1HMDA 2OEVA 1Y4CA 1O87A 2W4MA 1S05A 1F1MA 2DYSC 1XWJA 4IAOA 3RVZA 3RYLA 3WHNA 3C7JA 4MTFA 3X1OA 1JPNA 2HJMA 1QSPA 4E18A 3CQZA 4RD9A 4QI2A 2VCCA 1PD0A 3H2VA 1FR0A 2VC9A 4EBJA 3IPMO 5CIVA 4EKWA 3LS1A 2LQGA 3JSEO 3K6BA 4E7SA 1MQVA 3PDMP 2EILC 4MVUA 2X51A 1Z3IX 3C8GA 4IWBA 2A6EF 4CIPA 3N0TA 4U5DE 2CDQA 3LEVA 2EIJC 1NU9C 2PBEA 2Q9BA 4AL0A 3I5QA 2NUPB 2YL7A 3K7DA 4Q5SF 4I44A 4I1OB 1OCOC 3Q7GA 3LEOA 1G4WR 1R4TA 1VLSA 1YZCA 2J0WA 3AG2C 3IEEA 2HMQA 1I5NA 3GODA 1NZEA 3ZTMA 3M4BA 1HY5A 2WZLA 3BEHA 3OA1A 3O6XA 3U2MA 2OU6A 1JPJA 1YARO 2J45A 1YZAA 3DKAA 3ZIBA 4BJ6C 1XZQA 1WN0A 1M6TA 1G5ZA 4N6CA 1H6GA 3GEHA 4U9DA 2R05A 4AX2A 2YQYA 5B3IA 3U5SA 4MNDA 3U3FA 1C02A 1TFOB 4L6RA 5L0IA 2Q9AA 1NU7D 3FOOA 1DOWA 4F4BA 2YVKA 3EH2A 3V5XA 1N1CA 3L8JA 3G4ZA 5BUOA 4CJGA 1D1BA 2CW0F 2QUPA 4GQHA 3X2QC 1ZU5A 2HZ8A 4LDRA 2WVQA 2LSEA 4YL3A 5DLJA 4YWQA 3UNGC 3RH3A 4Q7CA 4CBEA 1Z23A 4AK9A 3T6GB 2PX0A 5KYUA 2ZXWC 3ABKC 4C3EA 2OJQA 1C03A 4FWVA 1YYXA 1D0YA 4IB4A 3DM5A 4MVMA 1JMWA 2YLGA 4BJ5C 2QTVA 4JJFA 4YL1A 3SXZA 2Y69C 4PJLA 1LI7A 2ETSA 3NMKA 4CX9A 3S84A 3U3BA 2A0UA 4CIHA 1MMNA 3KYIA 4W8KA 2XRHA 3EJNA 5HV9A 1FMVA 1NLXA 2YL1A 3C18A 2R7VA 4D4NA 2RSEB 3C62A 2Y39A 1QPUA 3RQFA 2OJED 2NUTB 3NMJA 4U5CE 2EPKX 1RMVA 3FMSA 4LLEA 4U5GA 2XLOA 3ITFA 4EWCA 1YDIA 3EQLF 3FXHA 2R7TA 3TOLA 3ZG1A 1ZVZA 5CI8A 1HE1A 1ZYRF 1U0BB 3EGXA 5KYXA 2ZXOA 3CZ6A 1J8MF 4O6MA 4BPMA 1EKYA 3U9JA 3LJBA 3TJ5A 4N06A 3S28A 1E2XA 4PR9A 4U5EE 1G8XA 2OKUA 5B3SC 1RKEA 5T3TA 2GA0A 3H2UA 1H9TA 2FAPB 4IAQA 1ZHZA 4G78A 2V26A 4BJTA 2XLHA 2GDCA 4DJ9A 3NRHA 5KYNA 1IW7F 2OEXA 2IM8A 3LUTB 3T4RA 3F47A 3CSKA 3EG9A 4O6YA 1OCRC 3EZHA 2CNWA 4XEKA 3J06A 4AE4A 3EZIA 4G7OF 1JOGA 1NFNA 2LFFA 3DWWA 2KSFA 3KMIA 5E3AA 2X0CA 2KNHA 3NMIA 1LIHA 3C8GD 3PHF2 1RJ9B 2A69F 3CAXA 3JRMO 2CYDA 5AC4A 1VYIA 3UGOA 2XXAB 2W4BA 2P7VA 1ORSC 3G50A 1VYKA 2EPLX 1CGME 1Q0KA 2WVNA 2Y3GA 1OW6A 4JTCB 4U5HA 1E84A 3A11A 1FFHA 3GM2A 3WODF 1NFOA 3HJCA 2ZD9A 1SF8A 2KC3A 1K40A 1OW8A 1Q0DA 4UDVA 2L6HA 2R9RB 3LS0A 2PP4A 2JX0A 1D0XA 3B0UX 1ZHYA 3ECSA 2XLVA 1ORJA 4MS2A 2HV6A 4B6IA 1FFTC 1ZU4A 3IHUA 4MQ9F 4O7GA 3TOMA 4KNVA 3WG7C 2DGJA 3C8GB 5AGFA 5BQHA 4H54A 5L0HA 1L7CA 4FESA 3V5YA 3IQTA 4A2NB 1M2VB 1TWHA 1MMDA 5T3WA 1SZIA 4Z9HA 5A6BA 1WASA 4MW8A 1E86A 1SR2A 4MVRA 2EIMC 1SYQA 4HEAJ 4R32A 5JSLA 3ZQYA 2IYLD 2B0HA 1HE9A 4PJMA 4MVZA 2HKVA 3AG3C 3JSZA 3K33A 4RBNA 4OIQF 2J9WA 3RQGA 1E85A 4W8PA 1HW1A 3SXYA 4P9FA 3ZVRA 2J8WA 1W2WA 2UUHA 4CDVA 4H4KC 1LKXA 1TWAA 1U89A 3DM9B 2G62A 4CS8A 5JUAA 4HFKB 3U9MA 2YHSA 3KH2A 2J9BA 4C3BA 1VK5A 2YZSA 3DD7A 2TMVP 3QVZA 4I3MA 2L6FA 2A6HF 5JP7A 5L0FA 4JE9A 3EFOA 2F22A 4JTDB 1OKKA 3RQEA 4J30B 2GFHA 1A7DA 3TJ6A 1GGQA 2W45A 2PFDA 2XL6A 2YL3A 3FHDA 4JEAA 3AOUA 4ANJA 5L0GA 1UG7A 4JKVA 1BDJB 3ATPA 3IQ5A 4NTAA 5K0IA 3DMDA 2G3VA 1OR3A 4HE8D 3FAPB 3SEOA 2IBFA 4JEBA 1WOLA 1VMAA 2C04A 2BE5F 2GWWA 5COFA 4XPWA 5DS6A 3QZCA 4MW3A 4DRIB 2H7OA 1G4US 3SXMA 3LNMB 4JCZA 2OOCA 1AEPA 1ZZPA 4IARA 3C63A 3C8ZA 3EHMA 4JTAB 4AL1A 3U0CA 1T6QA 1QKRA 4XPYA 1RKCA 2R7QA 1NBBA 2VH3A 5DQZA 1Q0MA 256BA 1GQAA 2EPOA 3PMRA 3SXKA 2R7XA 5COMA 3U2LA 1APCA 2WB7A 4D4XA 5A69A 4DVYP 2KJGA 1OW7A 3M1CB 4YT2A 4A4AA 1V4AA 2J7PD 3EH1A 2NSGA 4EBKA 2P6VA 4NY3A 2AWYA 4IGGA 3M4CA 3T6JA 1TWGA 2P61A 3SNHA 4C3DA 4QDLA 2R7SA 3B0VC 2CNWD 3W4YA 3SYNA 5JS5A 1QZXA 2R25A 3EGXB 2L81A 4FX5A 4KC9A 4LDKA 5L0CA 5KYXB 4G7ZF 3QW0A 4MTOA 2J46A 4OD5A 3I4UA 4MVQA 2NUPA 3RKOF 1HMOA 2ZXPA 3B71A 4CDAA 1VB5A 2ZXRA 1RKEB 3R2PA 3W8HA 3FDQA 3A9CA 1LPEA 1IZMA 4I1MA 2LFDA 4O6NA 2XS1A 3R7CA 1WGWA 1D1AA 2WL8A 5L3VA 2XLEA 1H7IA 2D4UA 3DAGA 4XPXA 5EK0A 3UMHA 4ER9A 2KYHA 1KNYA 2A1DD 1Z7Qc 3VM6A 4AE4B 2Y3HA 3LNRA 4J7YA 4CS7A 3S0XA 2PNOA 2EIKC 4CJOA 1K05A 2HSBA 2KW3C 2OCCC 5JLIA 3EGDA 3OWTA 1BR2A 3VRCA 4CDYA 2XS8A 3VYWA 2Q4FA 1I4YA 4DXWA 3KL4A 1ZHTA 2G3KA 2DI3A 3IQ6A 5B1BC 4WGZA 2RD9A 5T1DB 2OG2A 2EPNA 3AQBA 3Q6NA 3CEXA 4MVSA 1EA8A 3HNJA 2YRFA 3V5ZA 5KYYB 3KYJA 2XLDA 4DOZA 5COGA 3ZDLA 4YT4A 1Z63A 4DVZA 4CSAA 3UR3C 1E83A 3V7OA 4C7OB 3EHNA 4K0DA 4Z9JA 3AGTA 1V55C 1L3PA 3KPHA 2UUIA 2Q3TA 3IQCA 4ULVA 3S27A 3QTHA 1QVXA 5DS5A 1YA7O 3NKDA 4IJJA 4NC3A 1FTSA 5A6KA 4BG0A 1VLTA 3ABLC 2L6GA 2I15A 4CS9A 2KK1A 1YYJA 3JZ0A 4LLCA 1ZHXA 4M63A 3B29A 4MVOA 1D0ZA 3WAQA 1I4ZA 4KBLA 1WWPA 1Y6DA 3JRTA 1Q0GA 1RXQA 2MWQA 4PJNA 4YT5A 1OKKD 4E0HA 2FGYA 4DBQA 1V54C 1O5HA 3K66A 1EQ1A 4YN0B 4PFOA 2A68F 2PF4E 4PACA 1D1CA 2J0XA 1CGNA 1A7VA 3QMKA 3GWLA 1Q0FA 4JZAA 4WABA 2NUTA 3ZSUA 5AC5A 5E33A 2WZFA 2Y3DA 4PFPA 3K1HA 2XL4A 4J32B 3UGPA 3MX3A 3N24A 4JIOA 4NQFA 5E2QA 5DS4A 2Y3BA 2R02A 1ST6A 2R7WA 3L0IA 1LVKA 1BBHA 1PV3A 2B0JA 3M79A 5KYWA 2AVKA 1TQGA 1WATA 2Q00A 4XEFA 2HJ3A 1YAUO 2VB6A 2XM4A 3LAYA 4U9EA 3G4XA 3TULA 3LESA 3AJMA 3FOPA 3EFOB 2IXOA 1A7EA 2R7RA 3ASOC 4K1OA 4BJ1A 4YT8A 5JRAA 2Q9CA 3ZC4A 3GEEA 3M15A 5B1AC 1M2OA 3DE8A 3LLIA 3TQOA 1ZW3A 2LP4A 2NPUA 4NCQA 5CI9A 3ABMC 3SZRA 3VAYA 5A6AA 1JRAA 2HFIA 1PCXA 3HLZA 1TKNA 2PX3A 4JCHA 2J9VA 4E0IA 3DE9A 1VTMP 1M57C 1MMAA 2BL2A 3AG4C 1YLMA 1LS4A 1HW2A 2QNLA 4J7TA 3US6A 1BR4A 1LE4A 4G0HA 1MNDA 1GM5A 2IXNA 4OINF 3L34A 1AVOB 3BRJA 4U5BE 2P0NA 3W8IA 2MHRA 4EIYA 2YWAA 2C03A 1H9GA 3JT1A 3DI5A 3U8PA 2NG1A 4ONSA 3ASNC 4JRZA 4DRJB 2R7UA 3AGUA 3NG1A 3GORA 4JC7A 4BJ6A 1T6IA 4KI2A 2YKZA 2ICWG 1OCZC 3UMKA 4NTBA 1TWCA 3HNIA 1PD1A 3UMIA 5KYUB 3EPVA 3KKBA 2XM0A 1KU2A 2HUJA 4YL0A 4DRHB 2IXPA 2H7BA 1M2VA 2HS5A 2L7AA 3DXJF 4HFFB 5L0DA 4PJJA 2CCYA 3B0PA 3F46A 4P6IC 1NSGB 1XZPA 2AU5A 2XSEA 4BEJA 1OXBA 4OD4A 2YEVA 3QW1A 1OR2A 2FFHA 4U5FE 3NYLA 3O55A 1O3UA 3PCVA 1Z6AA 5DVWA 2VCBA 4O79A 5JVEA 5BQGA 4G7HF 3I5PA 2BC5A 2JD3A 4XLNF 3SP1A 4BJ5A 3NYJA 3QVYA 1GS9A 3GM1A 3OEOA 5L0JA 3DJNB 3S90A 4EUKB 3RIPA 5L3QA 3AG1C 3EGDB 3N2ZB 1MNEA 3GANA 3POVA
chains in the Genus database with same CATH topology
4YL0A 4AL1A 5HV9A 2H8AA 2Q7RA 3HKKA 2UUHA 4J7TA 4AL0A 5BQHA 2UUIA 3DWWA 5K0IA 5BQIA 3LEOA 3PCVA 4J7YA 4YL3A 4JRZA 5BQGA 4BPMA 2PNOA 4NTAA 3B29A 4JC7A 4NTFA 4YK5A 4NTBA 4YL1A 4WABA 4JCZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YL0 A;  4AL1 A;  5HV9 A;  2H8A A;  2Q7R A;  3HKK A;  2UUH A;  4J7T A;  4AL0 A;  5BQH A;  2UUI A;  3DWW A;  5K0I A;  5BQI A;  3LEO A;  3PCV A;  4J7Y A;  4YL3 A;  4JRZ A;  5BQG A;  4BPM A;  2PNO A;  4NTA A;  3B29 A;  4JC7 A;  4NTF A;  4YK5 A;  4NTB A;  4YL1 A;  4WAB A;  4JCZ A; 
#chains in the Genus database with same CATH topology
 1OQC A;  2R7O A;  1YA9 A;  1ORY A;  3O10 A;  5FZT A;  3ZWI A;  3MBG A;  2VAS A;  2ZPA A;  2EPM X;  4P9T A;  1CGO A;  3TK0 A;  3Q7L A;  2KQ9 A;  4XQ1 A;  3ZQV A;  1V74 B;  2H8A A;  1JR8 A;  4X0R A;  1K04 A;  1T9K A;  2Q7R A;  2QE9 A;  2XLM A;  3ZTZ A;  4YJW A;  1KTM A;  1T5O A;  4N6H A;  3AQC A;  2KGO A;  3E70 C;  1LS1 A;  3T9O A;  2MYS A;  1EI7 A;  1NG1 A;  3MYF A;  1A41 A;  3EG9 B;  4E17 A;  2IOQ A;  1J8Y F;  5D91 A;  1ZHW A;  3NDB B;  3GM3 A;  2ASR A;  3MYI A;  3RW0 A;  1T6U A;  4PK4 A;  3MFN A;  5GPG B;  4XTK A;  2O9X A;  3FAJ A;  4FAP B;  3K1I A;  1TFK B;  1BR1 A;  1B68 A;  4JVS A;  5D92 A;  5A6B D;  4JJG A;  1CPR A;  5HSW A;  4MTG A;  5JT4 A;  3Q6M A;  3JCU Q;  4OIO F;  5TJ5 E;  3HNL A;  5A6J A;  4JUR I;  5FCL A;  2QLA A;  5F5H A;  5F28 E;  1S7Z A;  3HKK A;  1M56 C;  1BZ4 A;  2IXM A;  2Z15 A;  2HSQ A;  3RF3 A;  4LAC B;  4EHP A;  2XL8 A;  1FMW A;  1TR2 A;  3U8V A;  2DB4 A;  3L8I A;  5F5F A;  1QLE C;  1R5I D;  2P1A A;  4BEM J;  2CGE A;  4N4W A;  2I8B A;  4XLP F;  2YL0 A;  4ZLD A;  4E7Z A;  1YVI A;  2R03 A;  1JAF A;  3O39 A;  2XLW A;  1SMY F;  2E87 A;  5KYW B;  4LER A;  3FVY A;  2WZG A;  4ULW A;  2JPU A;  2LCH A;  3DZA A;  2OQM A;  4JW1 A;  3HNK A;  2V3C C;  4RDA A;  1FAP B;  2AP3 A;  1RCP A;  3E9V A;  3K1I C;  2GAQ A;  5DQT A;  2J7P A;  2M4E A;  4Z9I A;  5EGY A;  3HTK C;  1Z5Z A;  2M64 A;  1WTY A;  1T01 A;  3TD7 A;  3VF0 A;  4DBR A;  1DOV A;  2QY9 A;  1QQ3 A;  4K7B A;  4XEV A;  3DAF A;  1LI5 A;  1A0B A;  1VOM A;  4CSA C;  1C17 M;  1OCC C;  1CPQ A;  4LDQ A;  3S9O A;  5BQI A;  4IRU A;  2LD6 A;  4CS8 C;  2W9Y A;  3W2V A;  1MMG A;  1ZW2 A;  3JTL O;  2AWC A;  3JYY A;  2LIG A;  3NYM A;  4WJ0 A;  3T6B A;  4EBB A;  1FNT c;  4CS9 C;  1LE2 A;  4KNW A;  3L1M A;  2EIN C;  2NSF A;  2J9U A;  1AUE A;  2YLD A;  2HV7 A;  4NTF A;  2A0B A;  4YK5 A;  5KYY A;  2HMZ A;  1UFB A;  4GYT A;  1U6H A;  1YJG A;  2H7V C;  1OXK A;  1LM3 B;  2D5R B;  3DJU B;  3LLK A;  3MLG A;  4GEH A;  4OIR F;  4OIP F;  4WGY A;  4QI0 A;  4C7O A;  3RFY A;  3S29 A;  3GWN A;  4Q4Z F;  2LK4 A;  5E3C A;  3W2W A;  3NKE A;  4ZLC A;  2VCA A;  3RVY A;  1RJ9 A;  3GEI A;  5EHH A;  2XXA A;  2WVO A;  2DYR C;  2L9J A;  2YLI A;  3H65 A;  3JYH A;  4XWJ A;  5IY5 C;  3B9Q A;  1HMD A;  2OEV A;  1Y4C A;  1O87 A;  2W4M A;  1S05 A;  1F1M A;  2DYS C;  1XWJ A;  4IAO A;  3RVZ A;  3RYL A;  3WHN A;  3C7J A;  4MTF A;  3X1O A;  1JPN A;  2HJM A;  1QSP A;  4E18 A;  3CQZ A;  4RD9 A;  4QI2 A;  2VCC A;  1PD0 A;  3H2V A;  1FR0 A;  2VC9 A;  4EBJ A;  3IPM O;  5CIV A;  4EKW A;  3LS1 A;  2LQG A;  3JSE O;  3K6B A;  4E7S A;  1MQV A;  3PDM P;  2EIL C;  4MVU A;  2X51 A;  1Z3I X;  3C8G A;  4IWB A;  2A6E F;  4CIP A;  3N0T A;  4U5D E;  2CDQ A;  3LEV A;  2EIJ C;  1NU9 C;  2PBE A;  2Q9B A;  4AL0 A;  3I5Q A;  2NUP B;  2YL7 A;  3K7D A;  4Q5S F;  4I44 A;  4I1O B;  1OCO C;  3Q7G A;  3LEO A;  1G4W R;  1R4T A;  1VLS A;  1YZC A;  2J0W A;  3AG2 C;  3IEE A;  2HMQ A;  1I5N A;  3GOD A;  1NZE A;  3ZTM A;  3M4B A;  1HY5 A;  2WZL A;  3BEH A;  3OA1 A;  3O6X A;  3U2M A;  2OU6 A;  1JPJ A;  1YAR O;  2J45 A;  1YZA A;  3DKA A;  3ZIB A;  4BJ6 C;  1XZQ A;  1WN0 A;  1M6T A;  1G5Z A;  4N6C A;  1H6G A;  3GEH A;  4U9D A;  2R05 A;  4AX2 A;  2YQY A;  5B3I A;  3U5S A;  4MND A;  3U3F A;  1C02 A;  1TFO B;  4L6R A;  5L0I A;  2Q9A A;  1NU7 D;  3FOO A;  1DOW A;  4F4B A;  2YVK A;  3EH2 A;  3V5X A;  1N1C A;  3L8J A;  3G4Z A;  5BUO A;  4CJG A;  1D1B A;  2CW0 F;  2QUP A;  4GQH A;  3X2Q C;  1ZU5 A;  2HZ8 A;  4LDR A;  2WVQ A;  2LSE A;  4YL3 A;  5DLJ A;  4YWQ A;  3UNG C;  3RH3 A;  4Q7C A;  4CBE A;  1Z23 A;  4AK9 A;  3T6G B;  2PX0 A;  5KYU A;  2ZXW C;  3ABK C;  4C3E A;  2OJQ A;  1C03 A;  4FWV A;  1YYX A;  1D0Y A;  4IB4 A;  3DM5 A;  4MVM A;  1JMW A;  2YLG A;  4BJ5 C;  2QTV A;  4JJF A;  4YL1 A;  3SXZ A;  2Y69 C;  4PJL A;  1LI7 A;  2ETS A;  3NMK A;  4CX9 A;  3S84 A;  3U3B A;  2A0U A;  4CIH A;  1MMN A;  3KYI A;  4W8K A;  2XRH A;  3EJN A;  5HV9 A;  1FMV A;  1NLX A;  2YL1 A;  3C18 A;  2R7V A;  4D4N A;  2RSE B;  3C62 A;  2Y39 A;  1QPU A;  3RQF A;  2OJE D;  2NUT B;  3NMJ A;  4U5C E;  2EPK X;  1RMV A;  3FMS A;  4LLE A;  4U5G A;  2XLO A;  3ITF A;  4EWC A;  1YDI A;  3EQL F;  3FXH A;  2R7T A;  3TOL A;  3ZG1 A;  1ZVZ A;  5CI8 A;  1HE1 A;  1ZYR F;  1U0B B;  3EGX A;  5KYX A;  2ZXO A;  3CZ6 A;  1J8M F;  4O6M A;  4BPM A;  1EKY A;  3U9J A;  3LJB A;  3TJ5 A;  4N06 A;  3S28 A;  1E2X A;  4PR9 A;  4U5E E;  1G8X A;  2OKU A;  5B3S C;  1RKE A;  5T3T A;  2GA0 A;  3H2U A;  1H9T A;  2FAP B;  4IAQ A;  1ZHZ A;  4G78 A;  2V26 A;  4BJT A;  2XLH A;  2GDC A;  4DJ9 A;  3NRH A;  5KYN A;  1IW7 F;  2OEX A;  2IM8 A;  3LUT B;  3T4R A;  3F47 A;  3CSK A;  3EG9 A;  4O6Y A;  1OCR C;  3EZH A;  2CNW A;  4XEK A;  3J06 A;  4AE4 A;  3EZI A;  4G7O F;  1JOG A;  1NFN A;  2LFF A;  3DWW A;  2KSF A;  3KMI A;  5E3A A;  2X0C A;  2KNH A;  3NMI A;  1LIH A;  3C8G D;  3PHF 2;  1RJ9 B;  2A69 F;  3CAX A;  3JRM O;  2CYD A;  5AC4 A;  1VYI A;  3UGO A;  2XXA B;  2W4B A;  2P7V A;  1ORS C;  3G50 A;  1VYK A;  2EPL X;  1CGM E;  1Q0K A;  2WVN A;  2Y3G A;  1OW6 A;  4JTC B;  4U5H A;  1E84 A;  3A11 A;  1FFH A;  3GM2 A;  3WOD F;  1NFO A;  3HJC A;  2ZD9 A;  1SF8 A;  2KC3 A;  1K40 A;  1OW8 A;  1Q0D A;  4UDV A;  2L6H A;  2R9R B;  3LS0 A;  2PP4 A;  2JX0 A;  1D0X A;  3B0U X;  1ZHY A;  3ECS A;  2XLV A;  1ORJ A;  4MS2 A;  2HV6 A;  4B6I A;  1FFT C;  1ZU4 A;  3IHU A;  4MQ9 F;  4O7G A;  3TOM A;  4KNV A;  3WG7 C;  2DGJ A;  3C8G B;  5AGF A;  5BQH A;  4H54 A;  5L0H A;  1L7C A;  4FES A;  3V5Y A;  3IQT A;  4A2N B;  1M2V B;  1TWH A;  1MMD A;  5T3W A;  1SZI A;  4Z9H A;  5A6B A;  1WAS A;  4MW8 A;  1E86 A;  1SR2 A;  4MVR A;  2EIM C;  1SYQ A;  4HEA J;  4R32 A;  5JSL A;  3ZQY A;  2IYL D;  2B0H A;  1HE9 A;  4PJM A;  4MVZ A;  2HKV A;  3AG3 C;  3JSZ A;  3K33 A;  4RBN A;  4OIQ F;  2J9W A;  3RQG A;  1E85 A;  4W8P A;  1HW1 A;  3SXY A;  4P9F A;  3ZVR A;  2J8W A;  1W2W A;  2UUH A;  4CDV A;  4H4K C;  1LKX A;  1TWA A;  1U89 A;  3DM9 B;  2G62 A;  4CS8 A;  5JUA A;  4HFK B;  3U9M A;  2YHS A;  3KH2 A;  2J9B A;  4C3B A;  1VK5 A;  2YZS A;  3DD7 A;  2TMV P;  3QVZ A;  4I3M A;  2L6F A;  2A6H F;  5JP7 A;  5L0F A;  4JE9 A;  3EFO A;  2F22 A;  4JTD B;  1OKK A;  3RQE A;  4J30 B;  2GFH A;  1A7D A;  3TJ6 A;  1GGQ A;  2W45 A;  2PFD A;  2XL6 A;  2YL3 A;  3FHD A;  4JEA A;  3AOU A;  4ANJ A;  5L0G A;  1UG7 A;  4JKV A;  1BDJ B;  3ATP A;  3IQ5 A;  4NTA A;  5K0I A;  3DMD A;  2G3V A;  1OR3 A;  4HE8 D;  3FAP B;  3SEO A;  2IBF A;  4JEB A;  1WOL A;  1VMA A;  2C04 A;  2BE5 F;  2GWW A;  5COF A;  4XPW A;  5DS6 A;  3QZC A;  4MW3 A;  4DRI B;  2H7O A;  1G4U S;  3SXM A;  3LNM B;  4JCZ A;  2OOC A;  1AEP A;  1ZZP A;  4IAR A;  3C63 A;  3C8Z A;  3EHM A;  4JTA B;  4AL1 A;  3U0C A;  1T6Q A;  1QKR A;  4XPY A;  1RKC A;  2R7Q A;  1NBB A;  2VH3 A;  5DQZ A;  1Q0M A;  256B A;  1GQA A;  2EPO A;  3PMR A;  3SXK A;  2R7X A;  5COM A;  3U2L A;  1APC A;  2WB7 A;  4D4X A;  5A69 A;  4DVY P;  2KJG A;  1OW7 A;  3M1C B;  4YT2 A;  4A4A A;  1V4A A;  2J7P D;  3EH1 A;  2NSG A;  4EBK A;  2P6V A;  4NY3 A;  2AWY A;  4IGG A;  3M4C A;  3T6J A;  1TWG A;  2P61 A;  3SNH A;  4C3D A;  4QDL A;  2R7S A;  3B0V C;  2CNW D;  3W4Y A;  3SYN A;  5JS5 A;  1QZX A;  2R25 A;  3EGX B;  2L81 A;  4FX5 A;  4KC9 A;  4LDK A;  5L0C A;  5KYX B;  4G7Z F;  3QW0 A;  4MTO A;  2J46 A;  4OD5 A;  3I4U A;  4MVQ A;  2NUP A;  3RKO F;  1HMO A;  2ZXP A;  3B71 A;  4CDA A;  1VB5 A;  2ZXR A;  1RKE B;  3R2P A;  3W8H A;  3FDQ A;  3A9C A;  1LPE A;  1IZM A;  4I1M A;  2LFD A;  4O6N A;  2XS1 A;  3R7C A;  1WGW A;  1D1A A;  2WL8 A;  5L3V A;  2XLE A;  1H7I A;  2D4U A;  3DAG A;  4XPX A;  5EK0 A;  3UMH A;  4ER9 A;  2KYH A;  1KNY A;  2A1D D;  1Z7Q c;  3VM6 A;  4AE4 B;  2Y3H A;  3LNR A;  4J7Y A;  4CS7 A;  3S0X A;  2PNO A;  2EIK C;  4CJO A;  1K05 A;  2HSB A;  2KW3 C;  2OCC C;  5JLI A;  3EGD A;  3OWT A;  1BR2 A;  3VRC A;  4CDY A;  2XS8 A;  3VYW A;  2Q4F A;  1I4Y A;  4DXW A;  3KL4 A;  1ZHT A;  2G3K A;  2DI3 A;  3IQ6 A;  5B1B C;  4WGZ A;  2RD9 A;  5T1D B;  2OG2 A;  2EPN A;  3AQB A;  3Q6N A;  3CEX A;  4MVS A;  1EA8 A;  3HNJ A;  2YRF A;  3V5Z A;  5KYY B;  3KYJ A;  2XLD A;  4DOZ A;  5COG A;  3ZDL A;  4YT4 A;  1Z63 A;  4DVZ A;  4CSA A;  3UR3 C;  1E83 A;  3V7O A;  4C7O B;  3EHN A;  4K0D A;  4Z9J A;  3AGT A;  1V55 C;  1L3P A;  3KPH A;  2UUI A;  2Q3T A;  3IQC A;  4ULV A;  3S27 A;  3QTH A;  1QVX A;  5DS5 A;  1YA7 O;  3NKD A;  4IJJ A;  4NC3 A;  1FTS A;  5A6K A;  4BG0 A;  1VLT A;  3ABL C;  2L6G A;  2I15 A;  4CS9 A;  2KK1 A;  1YYJ A;  3JZ0 A;  4LLC A;  1ZHX A;  4M63 A;  3B29 A;  4MVO A;  1D0Z A;  3WAQ A;  1I4Z A;  4KBL A;  1WWP A;  1Y6D A;  3JRT A;  1Q0G A;  1RXQ A;  2MWQ A;  4PJN A;  4YT5 A;  1OKK D;  4E0H A;  2FGY A;  4DBQ A;  1V54 C;  1O5H A;  3K66 A;  1EQ1 A;  4YN0 B;  4PFO A;  2A68 F;  2PF4 E;  4PAC A;  1D1C A;  2J0X A;  1CGN A;  1A7V A;  3QMK A;  3GWL A;  1Q0F A;  4JZA A;  4WAB A;  2NUT A;  3ZSU A;  5AC5 A;  5E33 A;  2WZF A;  2Y3D A;  4PFP A;  3K1H A;  2XL4 A;  4J32 B;  3UGP A;  3MX3 A;  3N24 A;  4JIO A;  4NQF A;  5E2Q A;  5DS4 A;  2Y3B A;  2R02 A;  1ST6 A;  2R7W A;  3L0I A;  1LVK A;  1BBH A;  1PV3 A;  2B0J A;  3M79 A;  5KYW A;  2AVK A;  1TQG A;  1WAT A;  2Q00 A;  4XEF A;  2HJ3 A;  1YAU O;  2VB6 A;  2XM4 A;  3LAY A;  4U9E A;  3G4X A;  3TUL A;  3LES A;  3AJM A;  3FOP A;  3EFO B;  2IXO A;  1A7E A;  2R7R A;  3ASO C;  4K1O A;  4BJ1 A;  4YT8 A;  5JRA A;  2Q9C A;  3ZC4 A;  3GEE A;  3M15 A;  5B1A C;  1M2O A;  3DE8 A;  3LLI A;  3TQO A;  1ZW3 A;  2LP4 A;  2NPU A;  4NCQ A;  5CI9 A;  3ABM C;  3SZR A;  3VAY A;  5A6A A;  1JRA A;  2HFI A;  1PCX A;  3HLZ A;  1TKN A;  2PX3 A;  4JCH A;  2J9V A;  4E0I A;  3DE9 A;  1VTM P;  1M57 C;  1MMA A;  2BL2 A;  3AG4 C;  1YLM A;  1LS4 A;  1HW2 A;  2QNL A;  4J7T A;  3US6 A;  1BR4 A;  1LE4 A;  4G0H A;  1MND A;  1GM5 A;  2IXN A;  4OIN F;  3L34 A;  1AVO B;  3BRJ A;  4U5B E;  2P0N A;  3W8I A;  2MHR A;  4EIY A;  2YWA A;  2C03 A;  1H9G A;  3JT1 A;  3DI5 A;  3U8P A;  2NG1 A;  4ONS A;  3ASN C;  4JRZ A;  4DRJ B;  2R7U A;  3AGU A;  3NG1 A;  3GOR A;  4JC7 A;  4BJ6 A;  1T6I A;  4KI2 A;  2YKZ A;  2ICW G;  1OCZ C;  3UMK A;  4NTB A;  1TWC A;  3HNI A;  1PD1 A;  3UMI A;  5KYU B;  3EPV A;  3KKB A;  2XM0 A;  1KU2 A;  2HUJ A;  4YL0 A;  4DRH B;  2IXP A;  2H7B A;  1M2V A;  2HS5 A;  2L7A A;  3DXJ F;  4HFF B;  5L0D A;  4PJJ A;  2CCY A;  3B0P A;  3F46 A;  4P6I C;  1NSG B;  1XZP A;  2AU5 A;  2XSE A;  4BEJ A;  1OXB A;  4OD4 A;  2YEV A;  3QW1 A;  1OR2 A;  2FFH A;  4U5F E;  3NYL A;  3O55 A;  1O3U A;  3PCV A;  1Z6A A;  5DVW A;  2VCB A;  4O79 A;  5JVE A;  5BQG A;  4G7H F;  3I5P A;  2BC5 A;  2JD3 A;  4XLN F;  3SP1 A;  4BJ5 A;  3NYJ A;  3QVY A;  1GS9 A;  3GM1 A;  3OEO A;  5L0J A;  3DJN B;  3S90 A;  4EUK B;  3RIP A;  5L3Q A;  3AG1 C;  3EGD B;  3N2Z B;  1MNE A;  3GAN A;  3POV A; 
#chains in the Genus database with same CATH homology
 4YL0 A;  4AL1 A;  5HV9 A;  2H8A A;  2Q7R A;  3HKK A;  2UUH A;  4J7T A;  4AL0 A;  5BQH A;  2UUI A;  3DWW A;  5K0I A;  5BQI A;  3LEO A;  3PCV A;  4J7Y A;  4YL3 A;  4JRZ A;  5BQG A;  4BPM A;  2PNO A;  4NTA A;  3B29 A;  4JC7 A;  4NTF A;  4YK5 A;  4NTB A;  4YL1 A;  4WAB A;  4JCZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...