2UUHA

Crystal structure of human leukotriene c4 synthase in complex with substrate glutathione
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
150
structure length
150
Chain Sequence
HHHHHHKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVYRAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALWLLVALAALGLLAHFLPAALRAALLGRLRT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LEUKOTRIENE C4 SYNTHASE
publication title Structural Basis for Synthesis of Inflammatory Mediators by Human Leukotriene C4 Synthase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase
total genus 57
structure length 150
sequence length 150
ec nomenclature ec 4.4.1.20: Leukotriene-C(4) synthase.
pdb deposition date 2007-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01124 MAPEG MAPEG family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.550 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Membrane associated eicosanoid/glutathione metabolism-like domain 2uuhA00
3LEOA 3HKKA 4AL0A 4J7YA 2Q7RA 2H8AA 4NTBA 3B29A 4NTFA 5K0IA 4JC7A 4YL1A 5BQIA 4YL0A 4YL3A 2PNOA 2UUIA 5BQHA 3PCVA 4JCZA 4YK5A 4JRZA 4BPMA 4WABA 2UUHA 4NTAA 5BQGA 5HV9A 4J7TA 3DWWA 4AL1A
chains in the Genus database with same CATH superfamily
1J8YF 1A41A 2L6HA 2J7PA 1FMVA 2VH3A 2RSEB 2L6GA 4PACA 3WAQA 3C8GB 2J9UA 4D4XA 4CS8C 1R4TA 4KC9A 3QW0A 2A1DD 3CEXA 1VLTA 2Q9CA 3IQCA 1SZIA 4FESA 4EWCA 2LQGA 1TWHA 5A6BA 3B0PA 1LPEA 3ZTMA 5JLIA 3UMHA 2G3KA 4E0IA 2HJMA 3K1HA 1TWCA 1GQAA 3NMJA 2YLGA 4LDRA 2XRHA 3LLKA 3KL4A 2WZGA 5TJ5E 3UMKA 3TOMA 5COMA 3PMRA 2QUPA 2QE9A 3KYJA 3LEVA 3U2MA 3I5PA 4FX5A 2WZFA 2XS8A 3NYMA 4D4NA 4MVZA 2R05A 3SYNA 5CI9A 1PD1A 3C18A 2KNHA 2R25A 3CQZA 3QZCA 4XPXA 4JIOA 5CI8A 4AE4A 4DOZA 2VCBA 2MHRA 3B0VC 4BJTA 1YYJA 4CSAA 3DD7A 1NBBA 2NPUA 2HKVA 4JEAA 4QI0A 3U0CA 1GM5A 3H2VA 1LS1A 3EGDA 2CDQA 2R02A 1Z5ZA 4BJ6A 2YHSA 4OIOF 2R7WA 1OQCA 1YVIA 2R7OA 4IGGA 2A0UA 3EG9B 4EBKA 3VM6A 2W9YA 5L0HA 4CSAC 4GEHA 5KYXA 1TFKB 256BA 4WGYA 4Q7CA 5DS5A 2HFIA 2Y3GA 3FMSA 2BL2A 4E7ZA 4BJ6C 1UFBA 1RJ9B 2Z15A 3N24A 2NUTA 3K7DA 3EFOA 4NY3A 4O6MA 1JAFA 5BQGA 1M2OA 4CIHA 3F47A 3S0XA 2J0XA 5KYWA 3EH2A 4BEJA 5L3VA 1SMYF 4QI2A 2HSBA 3HKKA 3LEOA 1VYKA 1CGOA 1LKXA 4M63A 4HEAJ 4OIPF 3C7JA 4B6IA 4IRUA 3CZ6A 4PK4A 1EKYA 1JOGA 2AP3A 2H8AA 2R03A 3GEEA 4YT5A 5GPGB 2YQYA 4ONSA 3RW0A 4E17A 3U5SA 4J32B 5L0JA 2J9WA 1D1CA 4NTFA 4DRIB 5K0IA 4JC7A 4A4AA 4N06A 3MYIA 3GODA 3RF3A 3S27A 4YWQA 1XWJA 2NSFA 3ITFA 4ZLCA 3LAYA 2Y3HA 1TWGA 3AG4C 3M79A 4XLNF 3ASOC 1MMNA 4IAOA 4JVSA 1ZHWA 2W45A 5L0FA 5KYNA 1NU7D 4KNWA 1YARO 2AU5A 3K66A 4KNVA 1G4WR 4DVZA 2LCHA 5T1DB 4BG0A 3C8GD 1H7IA 3ZIBA 1QQ3A 3UNGC 1TFOB 3SXYA 4OIQF 2HMQA 2O9XA 3A11A 3GM2A 3JSEO 4OINF 2H7VC 3Q7GA 3JRMO 3W2WA 3EZHA 1OKKA 2I15A 2J9VA 4P9FA 1APCA 1WATA 2OOCA 3NYJA 4Z9JA 1QPUA 3QTHA 4PJNA 4MTFA 4CBEA 2R7TA 1HY5A 3M15A 1D0XA 2XLDA 4I1MA 2JPUA 5JVEA 1RKEB 1XZQA 4JTCB 4W8PA 1Q0GA 2Y3BA 2YL0A 2YWAA 3MFNA 4JW1A 3RQFA 3U9JA 5A6KA 5L3QA 2LFFA 3IQTA 1M2VB 3JSZA 1T6IA 5FZTA 3TD7A 4AX2A 1R5ID 2OJQA 4OD5A 4WABA 1Z6AA 3FHDA 4NTAA 1D0YA 2RD9A 3E70C 4Z9HA 5HV9A 2J7PD 1LIHA 3AQBA 4EHPA 1YDIA 3DWWA 3G50A 4I44A 3EQLF 4AL0A 1I4YA 1OCOC 3QVYA 5JUAA 2G62A 3HLZA 3T6GB 1A7VA 5A6BD 1CPQA 2R7VA 2PP4A 1O5HA 1BBHA 1OCRC 2E87A 2VCAA 3QMKA 1G4US 3RVYA 1NLXA 3TOLA 3ZWIA 3NKEA 2HUJA 2P6VA 1OW7A 3MLGA 4XEKA 4UDVA 1Y4CA 1ORSC 4O6NA 3NYLA 4JCZA 2P1AA 3FXHA 1QVXA 3L0IA 4PJJA 3NMKA 4E18A 1E85A 4H54A 1D1AA 1Z63A 3R7CA 1W2WA 1U89A 3M4CA 4LACB 4G7HF 4J7TA 4AL1A 1M6TA 2LP4A 2PF4E 3GEHA 3NMIA 1ORJA 2Q00A 4I1OB 2XSEA 3C63A 3NG1A 4U5CE 4CDAA 2KSFA 4RDAA 3DM5A 4N6HA 1B68A 5E33A 1E84A 3LNRA 1JPNA 1ZHYA 3EGXB 4NCQA 4PFPA 1S7ZA 2HJ3A 4DJ9A 4DVYP 2IXPA 1FFHA 5FCLA 2PX3A 4YL0A 2NUPB 3ABMC 4MNDA 4MW8A 1Q0FA 1E83A 2D4UA 5CIVA 1OCZC 1VYIA 1ZU5A 2XM4A 3O39A 3SXKA 3SXMA 3T6BA 1RKCA 4U5EE 5JT4A 1Q0KA 2GDCA 2CNWD 2Q9BA 1V54C 1C17M 2UUHA 5DQZA 3PDMP 1H9TA 3QW1A 4G0HA 3ZG1A 1M57C 1V55C 3EZIA 1WGWA 4ER9A 3AG2C 3WODF 2YEVA 2EPNA 3M1CB 4F4BA 1AVOB 1HE1A 2YLIA 4P6IC 1C02A 4U9DA 4CDVA 1IW7F 3G4XA 4J7YA 4PJLA 2BE5F 4O7GA 2ZXOA 2EIMC 3EG9A 5EGYA 2XLHA 2R7XA 3T4RA 2DYRC 3V5YA 1G8XA 2NSGA 3B71A 2IXOA 1TQGA 3IQ6A 1V4AA 3C62A 1KTMA 2IXNA 1VLSA 2NG1A 4JTDB 4DXWA 1RJ9A 3DXJF 5EHHA 4XTKA 4BJ5A 5JSLA 4MVQA 2EIJC 2JD3A 4OD4A 3ZTZA 1YA9A 1FFTC 4HFKB 1NSGB 1YZAA 2EPLX 3JT1A 3LS0A 1CGNA 2PBEA 4MTOA 1V74B 1LVKA 3MX3A 3MBGA 1T5OA 3EH1A 4AE4B 2QNLA 2WB7A 3TJ6A 4BJ5C 1OKKD 5L0CA 3TULA 1YLMA 3DKAA 4KI2A 5DQTA 2ZXWC 1BDJB 3U2LA 3F46A 3W4YA 3J06A 1AEPA 3GEIA 5IY5C 4C7OB 2DB4A 4MVUA 2Q9AA 2R7RA 1H6GA 3TJ5A 2OEXA 4O79A 4YL1A 3ABKC 3SXZA 5B3IA 5AC4A 4LLEA 5KYXB 3RIPA 3WHNA 2J9BA 2Q4FA 3DM9B 3KYIA 4JKVA 1O87A 3S90A 4IWBA 1OCCC 2KW3C 4CIPA 1PD0A 1VOMA 1YA7O 2NUTB 4KBLA 4IB4A 5DS6A 3EFOB 1NZEA 4RBNA 4ANJA 2CGEA 4XEVA 5F5FA 2VB6A 3V5ZA 3OEOA 2ASRA 3VRCA 3ZC4A 4JZAA 1HE9A 5KYWB 1XZPA 4U9EA 1VTMP 2GWWA 2Q7RA 4WJ0A 2F22A 3QVZA 3LNMB 2KGOA 2KQ9A 3DE9A 4U5BE 3W8HA 1HW1A 4BEMJ 3FDQA 2XXAB 2R7QA 2PX0A 1EI7A 3DJNB 4LLCA 3O10A 3KPHA 1JR8A 2X51A 1Z3IX 3O55A 1I4ZA 2AVKA 2Y39A 3HTKC 4YN0B 5BUOA 1C03A 2EIKC 4X0RA 3BEHA 3S28A 1S05A 4E0HA 5L0DA 2KK1A 2HSQA 2P61A 2YZSA 2ZXPA 4XEFA 3FVYA 1OXBA 3Q6NA 2EPOA 4N6CA 1DOWA 3FOPA 2IBFA 1G5ZA 2KYHA 1KNYA 1O3UA 3GWNA 2ZPAA 1K04A 4XWJA 2XLOA 5COFA 3SEOA 3VF0A 3UGOA 2YRFA 2HV7A 4IARA 3AJMA 4MVOA 4PFOA 2V26A 4G78A 4PR9A 2YL7A 3OA1A 1NG1A 2XLWA 2HMZA 4JTAB 3H2UA 4U5GA 2EINC 3ZDLA 2HV6A 3S84A 4C3EA 4MW3A 2L9JA 2J8WA 2Q3TA 2LFDA 3W2VA 3UMIA 1ST6A 3VAYA 4XPYA 4YK5A 3C8ZA 4I3MA 4OIRF 4JRZA 3DI5A 2B0JA 3DJUB 1L7CA 3FAJA 2CYDA 3IQ5A 5KYUA 1JMWA 3T9OA 2XLVA 2CCYA 1T01A 1TKNA 1F1MA 5E3CA 1E2XA 4ULVA 3ECSA 2ZXRA 4JJGA 1RCPA 4N4WA 3C8GA 1KU2A 2BC5A 1PCXA 2M4EA 4W8KA 3EPVA 5COGA 2KJGA 4H4KC 3EGXA 3AGTA 3AQCA 1T9KA 1ZHXA 1N1CA 4G7ZF 2MWQA 3NKDA 2VASA 3L34A 1BR1A 2WZLA 2YLDA 3B29A 2DGJA 3L8JA 2XLEA 2XM0A 4RD9A 3VYWA 4J30B 1ZZPA 3ZSUA 3Q6MA 1OW6A 4R32A 5BQHA 4K1OA 1QSPA 2DI3A 3PCVA 1MNEA 3KMIA 4NQFA 4EIYA 1WASA 1WOLA 1T6QA 1FAPB 3LJBA 2W4BA 2J45A 1YAUO 3GANA 4U5HA 4LDQA 1BR4A 1LI7A 4MQ9F 2R9RB 5A6JA 3GM3A 2IXMA 2W4MA 4JURI 3RKOF 3POVA 2XXAA 4O6YA 5DVWA 2FGYA 2R7SA 4CDYA 1YYXA 2XS1A 1WN0A 3K6BA 5F28E 1OXKA 2M64A 2YL1A 3MYFA 3EHNA 2WVNA 1LE2A 4MVSA 4YT4A 1MMAA 2OCCC 3KKBA 2EPMX 2OEVA 1MNDA 4NTBA 3U8PA 3S9OA 4PJMA 1U6HA 3W8IA 4EUKB 4ULWA 3PHF2 1JPJA 3LUTB 3GM1A 1GS9A 1MMDA 4XLPF 2GFHA 1SR2A 5KYYB 1SYQA 1MQVA 2YVKA 3SNHA 4G7OF 1QZXA 2OG2A 3A9CA 3L1MA 4ZLDA 1Q0MA 1FR0A 1BR2A 2LK4A 2XL8A 1ZYRF 3CSKA 3OWTA 3LLIA 1Q0DA 2C03A 4NC3A 4QDLA 3S29A 2QTVA 3SP1A 5T3WA 1NFOA 1ZHTA 4JJFA 3X1OA 4MVMA 5A6AA 4HE8D 2A69F 2QLAA 4EBBA 1RXQA 3IHUA 4MVRA 1VB5A 2L81A 1YJGA 2OKUA 3HNLA 5AGFA 3US6A 3ZVRA 1K40A 2WVOA 2I8BA 2ICWG 5DLJA 2FAPB 2OQMA 1Z23A 2FFHA 4DBRA 4A2NB 4YT2A 2IOQA 4C7OA 1LM3B 2XL4A 2WL8A 5JRAA 3U8VA 3DMDA 1JRAA 3K1IA 3EGDB 3V5XA 3RYLA 3AOUA 3GWLA 4MS2A 4MTGA 4Q4ZF 3RVZA 1WWPA 2VCCA 4K0DA 3X2QC 4CJOA 2LD6A 4YL3A 1IZMA 1UG7A 3JCUQ 5F5HA 3U9MA 2A6EF 2MYSA 3CAXA 3WG7C 1SF8A 5L0IA 5T3TA 1FTSA 4FAPB 5A69A 4BPMA 1WTYA 3K1IC 2CW0F 2XLMA 4GQHA 1ZVZA 2IYLD 2KC3A 2CNWA 1NFNA 2QY9A 4CJGA 1RMVA 2AWCA 2LIGA 1ZU4A 1LE4A 3LS1A 4WGZA 2Y3DA 1TWAA 3H65A 3RQGA 3AGUA 3BRJA 3IEEA 4GYTA 5JP7A 1Z7Qc 3R2PA 5B3SC 4IAQA 2P0NA 2OJED 2J0WA 2VC9A 4CX9A 1QKRA 4P9TA 1VK5A 2B0HA 3DAFA 1FNTc 3AG3C 3DE8A 5B1BC 3JRTA 1RKEA 1TR2A 1ZHZA 3N0TA 4JCHA 5BQIA 1ZW3A 5D92A 4BJ1A 4AK9A 1A7EA 1E86A 1CPRA 4CS9A 3DAGA 2UUIA 1M2VA 2EPKX 3M4BA 1A7DA 2Y69C 4DBQA 3ZQVA 2OU6A 2C04A 4C3BA 2V3CC 2JX0A 3U3FA 2HS5A 1DOVA 1VMAA 3L8IA 3IPMO 3HNIA 5E3AA 3O6XA 4HFFB 4CS9C 1HW2A 2ETSA 3LESA 2R7UA 2GA0A 2YKZA 1ORYA 2AWYA 4LERA 4DRJB 4CS7A 3EHMA 2H7OA 4IJJA 1OR3A 1PV3A 1OW8A 1H9GA 2L6FA 1A0BA 1AUEA 1T6UA 2H7BA 3TQOA 3B9QA 3AG1C 2G3VA 2ZD9A 3T6JA 3JYHA 3TK0A 1U0BB 2EILC 4E7SA 3FAPB 3ZQYA 1LS4A 1BZ4A 4LDKA 1YZCA 3G4ZA 4EBJA 3ABLC 4YJWA 3U3BA 2X0CA 1K05A 3FOOA 3K33A 3KH2A 3JTLO 3RFYA 3B0UX 5E2QA 4Z9IA 1HMDA 2A68F 2P7VA 1I5NA 2IM8A 2PFDA 3ATPA 1MMGA 5HSWA 1CGME 4C3DA 2XL6A 2WVQA 3E9VA 1EQ1A 1J8MF 3DZAA 3HNJA 5EK0A 2LSEA 2L7AA 3RH3A 5AC5A 2GAQA 3EJNA 4XPWA 1OR2A 5D91A 3UGPA 4JEBA 2D5RB 1ZW2A 4Q5SF 1NU9C 4JE9A 1L3PA 3SZRA 3Q7LA 1QLEC 2J46A 1D1BA 2NUPA 2A0BA 1FMWA 1M56C 1HMOA 4K7BA 1LI5A 5L0GA 2PNOA 4YT8A 1EA8A 1GGQA 2DYSC 3HJCA 3I5QA 4U5FE 3NRHA 3I4UA 5DS4A 3ASNC 4L6RA 1D0ZA 2TMVP 3HNKA 3RQEA 3JYYA 4CS8A 3GORA 2YL3A 4DRHB 5B1AC 3N2ZB 4U5DE 3UR3C 5JS5A 2A6HF 3JZ0A 2HZ8A 4XQ1A 4EKWA 1Y6DA 3NDBB 4FWVA 5KYYA 5KYUB 3V7OA
chains in the Genus database with same CATH topology
3LEOA 3HKKA 4AL0A 4J7YA 2Q7RA 2H8AA 4NTBA 3B29A 4NTFA 5K0IA 4JC7A 4YL1A 5BQIA 4YL0A 4YL3A 2PNOA 2UUIA 5BQHA 3PCVA 4JCZA 4YK5A 4JRZA 4BPMA 4WABA 2UUHA 4NTAA 5BQGA 5HV9A 4J7TA 3DWWA 4AL1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LEO A;  3HKK A;  4AL0 A;  4J7Y A;  2Q7R A;  2H8A A;  4NTB A;  3B29 A;  4NTF A;  5K0I A;  4JC7 A;  4YL1 A;  5BQI A;  4YL0 A;  4YL3 A;  2PNO A;  2UUI A;  5BQH A;  3PCV A;  4JCZ A;  4YK5 A;  4JRZ A;  4BPM A;  4WAB A;  2UUH A;  4NTA A;  5BQG A;  5HV9 A;  4J7T A;  3DWW A;  4AL1 A; 
#chains in the Genus database with same CATH topology
 1J8Y F;  1A41 A;  2L6H A;  2J7P A;  1FMV A;  2VH3 A;  2RSE B;  2L6G A;  4PAC A;  3WAQ A;  3C8G B;  2J9U A;  4D4X A;  4CS8 C;  1R4T A;  4KC9 A;  3QW0 A;  2A1D D;  3CEX A;  1VLT A;  2Q9C A;  3IQC A;  1SZI A;  4FES A;  4EWC A;  2LQG A;  1TWH A;  5A6B A;  3B0P A;  1LPE A;  3ZTM A;  5JLI A;  3UMH A;  2G3K A;  4E0I A;  2HJM A;  3K1H A;  1TWC A;  1GQA A;  3NMJ A;  2YLG A;  4LDR A;  2XRH A;  3LLK A;  3KL4 A;  2WZG A;  5TJ5 E;  3UMK A;  3TOM A;  5COM A;  3PMR A;  2QUP A;  2QE9 A;  3KYJ A;  3LEV A;  3U2M A;  3I5P A;  4FX5 A;  2WZF A;  2XS8 A;  3NYM A;  4D4N A;  4MVZ A;  2R05 A;  3SYN A;  5CI9 A;  1PD1 A;  3C18 A;  2KNH A;  2R25 A;  3CQZ A;  3QZC A;  4XPX A;  4JIO A;  5CI8 A;  4AE4 A;  4DOZ A;  2VCB A;  2MHR A;  3B0V C;  4BJT A;  1YYJ A;  4CSA A;  3DD7 A;  1NBB A;  2NPU A;  2HKV A;  4JEA A;  4QI0 A;  3U0C A;  1GM5 A;  3H2V A;  1LS1 A;  3EGD A;  2CDQ A;  2R02 A;  1Z5Z A;  4BJ6 A;  2YHS A;  4OIO F;  2R7W A;  1OQC A;  1YVI A;  2R7O A;  4IGG A;  2A0U A;  3EG9 B;  4EBK A;  3VM6 A;  2W9Y A;  5L0H A;  4CSA C;  4GEH A;  5KYX A;  1TFK B;  256B A;  4WGY A;  4Q7C A;  5DS5 A;  2HFI A;  2Y3G A;  3FMS A;  2BL2 A;  4E7Z A;  4BJ6 C;  1UFB A;  1RJ9 B;  2Z15 A;  3N24 A;  2NUT A;  3K7D A;  3EFO A;  4NY3 A;  4O6M A;  1JAF A;  5BQG A;  1M2O A;  4CIH A;  3F47 A;  3S0X A;  2J0X A;  5KYW A;  3EH2 A;  4BEJ A;  5L3V A;  1SMY F;  4QI2 A;  2HSB A;  3HKK A;  3LEO A;  1VYK A;  1CGO A;  1LKX A;  4M63 A;  4HEA J;  4OIP F;  3C7J A;  4B6I A;  4IRU A;  3CZ6 A;  4PK4 A;  1EKY A;  1JOG A;  2AP3 A;  2H8A A;  2R03 A;  3GEE A;  4YT5 A;  5GPG B;  2YQY A;  4ONS A;  3RW0 A;  4E17 A;  3U5S A;  4J32 B;  5L0J A;  2J9W A;  1D1C A;  4NTF A;  4DRI B;  5K0I A;  4JC7 A;  4A4A A;  4N06 A;  3MYI A;  3GOD A;  3RF3 A;  3S27 A;  4YWQ A;  1XWJ A;  2NSF A;  3ITF A;  4ZLC A;  3LAY A;  2Y3H A;  1TWG A;  3AG4 C;  3M79 A;  4XLN F;  3ASO C;  1MMN A;  4IAO A;  4JVS A;  1ZHW A;  2W45 A;  5L0F A;  5KYN A;  1NU7 D;  4KNW A;  1YAR O;  2AU5 A;  3K66 A;  4KNV A;  1G4W R;  4DVZ A;  2LCH A;  5T1D B;  4BG0 A;  3C8G D;  1H7I A;  3ZIB A;  1QQ3 A;  3UNG C;  1TFO B;  3SXY A;  4OIQ F;  2HMQ A;  2O9X A;  3A11 A;  3GM2 A;  3JSE O;  4OIN F;  2H7V C;  3Q7G A;  3JRM O;  3W2W A;  3EZH A;  1OKK A;  2I15 A;  2J9V A;  4P9F A;  1APC A;  1WAT A;  2OOC A;  3NYJ A;  4Z9J A;  1QPU A;  3QTH A;  4PJN A;  4MTF A;  4CBE A;  2R7T A;  1HY5 A;  3M15 A;  1D0X A;  2XLD A;  4I1M A;  2JPU A;  5JVE A;  1RKE B;  1XZQ A;  4JTC B;  4W8P A;  1Q0G A;  2Y3B A;  2YL0 A;  2YWA A;  3MFN A;  4JW1 A;  3RQF A;  3U9J A;  5A6K A;  5L3Q A;  2LFF A;  3IQT A;  1M2V B;  3JSZ A;  1T6I A;  5FZT A;  3TD7 A;  4AX2 A;  1R5I D;  2OJQ A;  4OD5 A;  4WAB A;  1Z6A A;  3FHD A;  4NTA A;  1D0Y A;  2RD9 A;  3E70 C;  4Z9H A;  5HV9 A;  2J7P D;  1LIH A;  3AQB A;  4EHP A;  1YDI A;  3DWW A;  3G50 A;  4I44 A;  3EQL F;  4AL0 A;  1I4Y A;  1OCO C;  3QVY A;  5JUA A;  2G62 A;  3HLZ A;  3T6G B;  1A7V A;  5A6B D;  1CPQ A;  2R7V A;  2PP4 A;  1O5H A;  1BBH A;  1OCR C;  2E87 A;  2VCA A;  3QMK A;  1G4U S;  3RVY A;  1NLX A;  3TOL A;  3ZWI A;  3NKE A;  2HUJ A;  2P6V A;  1OW7 A;  3MLG A;  4XEK A;  4UDV A;  1Y4C A;  1ORS C;  4O6N A;  3NYL A;  4JCZ A;  2P1A A;  3FXH A;  1QVX A;  3L0I A;  4PJJ A;  3NMK A;  4E18 A;  1E85 A;  4H54 A;  1D1A A;  1Z63 A;  3R7C A;  1W2W A;  1U89 A;  3M4C A;  4LAC B;  4G7H F;  4J7T A;  4AL1 A;  1M6T A;  2LP4 A;  2PF4 E;  3GEH A;  3NMI A;  1ORJ A;  2Q00 A;  4I1O B;  2XSE A;  3C63 A;  3NG1 A;  4U5C E;  4CDA A;  2KSF A;  4RDA A;  3DM5 A;  4N6H A;  1B68 A;  5E33 A;  1E84 A;  3LNR A;  1JPN A;  1ZHY A;  3EGX B;  4NCQ A;  4PFP A;  1S7Z A;  2HJ3 A;  4DJ9 A;  4DVY P;  2IXP A;  1FFH A;  5FCL A;  2PX3 A;  4YL0 A;  2NUP B;  3ABM C;  4MND A;  4MW8 A;  1Q0F A;  1E83 A;  2D4U A;  5CIV A;  1OCZ C;  1VYI A;  1ZU5 A;  2XM4 A;  3O39 A;  3SXK A;  3SXM A;  3T6B A;  1RKC A;  4U5E E;  5JT4 A;  1Q0K A;  2GDC A;  2CNW D;  2Q9B A;  1V54 C;  1C17 M;  2UUH A;  5DQZ A;  3PDM P;  1H9T A;  3QW1 A;  4G0H A;  3ZG1 A;  1M57 C;  1V55 C;  3EZI A;  1WGW A;  4ER9 A;  3AG2 C;  3WOD F;  2YEV A;  2EPN A;  3M1C B;  4F4B A;  1AVO B;  1HE1 A;  2YLI A;  4P6I C;  1C02 A;  4U9D A;  4CDV A;  1IW7 F;  3G4X A;  4J7Y A;  4PJL A;  2BE5 F;  4O7G A;  2ZXO A;  2EIM C;  3EG9 A;  5EGY A;  2XLH A;  2R7X A;  3T4R A;  2DYR C;  3V5Y A;  1G8X A;  2NSG A;  3B71 A;  2IXO A;  1TQG A;  3IQ6 A;  1V4A A;  3C62 A;  1KTM A;  2IXN A;  1VLS A;  2NG1 A;  4JTD B;  4DXW A;  1RJ9 A;  3DXJ F;  5EHH A;  4XTK A;  4BJ5 A;  5JSL A;  4MVQ A;  2EIJ C;  2JD3 A;  4OD4 A;  3ZTZ A;  1YA9 A;  1FFT C;  4HFK B;  1NSG B;  1YZA A;  2EPL X;  3JT1 A;  3LS0 A;  1CGN A;  2PBE A;  4MTO A;  1V74 B;  1LVK A;  3MX3 A;  3MBG A;  1T5O A;  3EH1 A;  4AE4 B;  2QNL A;  2WB7 A;  3TJ6 A;  4BJ5 C;  1OKK D;  5L0C A;  3TUL A;  1YLM A;  3DKA A;  4KI2 A;  5DQT A;  2ZXW C;  1BDJ B;  3U2L A;  3F46 A;  3W4Y A;  3J06 A;  1AEP A;  3GEI A;  5IY5 C;  4C7O B;  2DB4 A;  4MVU A;  2Q9A A;  2R7R A;  1H6G A;  3TJ5 A;  2OEX A;  4O79 A;  4YL1 A;  3ABK C;  3SXZ A;  5B3I A;  5AC4 A;  4LLE A;  5KYX B;  3RIP A;  3WHN A;  2J9B A;  2Q4F A;  3DM9 B;  3KYI A;  4JKV A;  1O87 A;  3S90 A;  4IWB A;  1OCC C;  2KW3 C;  4CIP A;  1PD0 A;  1VOM A;  1YA7 O;  2NUT B;  4KBL A;  4IB4 A;  5DS6 A;  3EFO B;  1NZE A;  4RBN A;  4ANJ A;  2CGE A;  4XEV A;  5F5F A;  2VB6 A;  3V5Z A;  3OEO A;  2ASR A;  3VRC A;  3ZC4 A;  4JZA A;  1HE9 A;  5KYW B;  1XZP A;  4U9E A;  1VTM P;  2GWW A;  2Q7R A;  4WJ0 A;  2F22 A;  3QVZ A;  3LNM B;  2KGO A;  2KQ9 A;  3DE9 A;  4U5B E;  3W8H A;  1HW1 A;  4BEM J;  3FDQ A;  2XXA B;  2R7Q A;  2PX0 A;  1EI7 A;  3DJN B;  4LLC A;  3O10 A;  3KPH A;  1JR8 A;  2X51 A;  1Z3I X;  3O55 A;  1I4Z A;  2AVK A;  2Y39 A;  3HTK C;  4YN0 B;  5BUO A;  1C03 A;  2EIK C;  4X0R A;  3BEH A;  3S28 A;  1S05 A;  4E0H A;  5L0D A;  2KK1 A;  2HSQ A;  2P61 A;  2YZS A;  2ZXP A;  4XEF A;  3FVY A;  1OXB A;  3Q6N A;  2EPO A;  4N6C A;  1DOW A;  3FOP A;  2IBF A;  1G5Z A;  2KYH A;  1KNY A;  1O3U A;  3GWN A;  2ZPA A;  1K04 A;  4XWJ A;  2XLO A;  5COF A;  3SEO A;  3VF0 A;  3UGO A;  2YRF A;  2HV7 A;  4IAR A;  3AJM A;  4MVO A;  4PFO A;  2V26 A;  4G78 A;  4PR9 A;  2YL7 A;  3OA1 A;  1NG1 A;  2XLW A;  2HMZ A;  4JTA B;  3H2U A;  4U5G A;  2EIN C;  3ZDL A;  2HV6 A;  3S84 A;  4C3E A;  4MW3 A;  2L9J A;  2J8W A;  2Q3T A;  2LFD A;  3W2V A;  3UMI A;  1ST6 A;  3VAY A;  4XPY A;  4YK5 A;  3C8Z A;  4I3M A;  4OIR F;  4JRZ A;  3DI5 A;  2B0J A;  3DJU B;  1L7C A;  3FAJ A;  2CYD A;  3IQ5 A;  5KYU A;  1JMW A;  3T9O A;  2XLV A;  2CCY A;  1T01 A;  1TKN A;  1F1M A;  5E3C A;  1E2X A;  4ULV A;  3ECS A;  2ZXR A;  4JJG A;  1RCP A;  4N4W A;  3C8G A;  1KU2 A;  2BC5 A;  1PCX A;  2M4E A;  4W8K A;  3EPV A;  5COG A;  2KJG A;  4H4K C;  3EGX A;  3AGT A;  3AQC A;  1T9K A;  1ZHX A;  1N1C A;  4G7Z F;  2MWQ A;  3NKD A;  2VAS A;  3L34 A;  1BR1 A;  2WZL A;  2YLD A;  3B29 A;  2DGJ A;  3L8J A;  2XLE A;  2XM0 A;  4RD9 A;  3VYW A;  4J30 B;  1ZZP A;  3ZSU A;  3Q6M A;  1OW6 A;  4R32 A;  5BQH A;  4K1O A;  1QSP A;  2DI3 A;  3PCV A;  1MNE A;  3KMI A;  4NQF A;  4EIY A;  1WAS A;  1WOL A;  1T6Q A;  1FAP B;  3LJB A;  2W4B A;  2J45 A;  1YAU O;  3GAN A;  4U5H A;  4LDQ A;  1BR4 A;  1LI7 A;  4MQ9 F;  2R9R B;  5A6J A;  3GM3 A;  2IXM A;  2W4M A;  4JUR I;  3RKO F;  3POV A;  2XXA A;  4O6Y A;  5DVW A;  2FGY A;  2R7S A;  4CDY A;  1YYX A;  2XS1 A;  1WN0 A;  3K6B A;  5F28 E;  1OXK A;  2M64 A;  2YL1 A;  3MYF A;  3EHN A;  2WVN A;  1LE2 A;  4MVS A;  4YT4 A;  1MMA A;  2OCC C;  3KKB A;  2EPM X;  2OEV A;  1MND A;  4NTB A;  3U8P A;  3S9O A;  4PJM A;  1U6H A;  3W8I A;  4EUK B;  4ULW A;  3PHF 2;  1JPJ A;  3LUT B;  3GM1 A;  1GS9 A;  1MMD A;  4XLP F;  2GFH A;  1SR2 A;  5KYY B;  1SYQ A;  1MQV A;  2YVK A;  3SNH A;  4G7O F;  1QZX A;  2OG2 A;  3A9C A;  3L1M A;  4ZLD A;  1Q0M A;  1FR0 A;  1BR2 A;  2LK4 A;  2XL8 A;  1ZYR F;  3CSK A;  3OWT A;  3LLI A;  1Q0D A;  2C03 A;  4NC3 A;  4QDL A;  3S29 A;  2QTV A;  3SP1 A;  5T3W A;  1NFO A;  1ZHT A;  4JJF A;  3X1O A;  4MVM A;  5A6A A;  4HE8 D;  2A69 F;  2QLA A;  4EBB A;  1RXQ A;  3IHU A;  4MVR A;  1VB5 A;  2L81 A;  1YJG A;  2OKU A;  3HNL A;  5AGF A;  3US6 A;  3ZVR A;  1K40 A;  2WVO A;  2I8B A;  2ICW G;  5DLJ A;  2FAP B;  2OQM A;  1Z23 A;  2FFH A;  4DBR A;  4A2N B;  4YT2 A;  2IOQ A;  4C7O A;  1LM3 B;  2XL4 A;  2WL8 A;  5JRA A;  3U8V A;  3DMD A;  1JRA A;  3K1I A;  3EGD B;  3V5X A;  3RYL A;  3AOU A;  3GWL A;  4MS2 A;  4MTG A;  4Q4Z F;  3RVZ A;  1WWP A;  2VCC A;  4K0D A;  3X2Q C;  4CJO A;  2LD6 A;  4YL3 A;  1IZM A;  1UG7 A;  3JCU Q;  5F5H A;  3U9M A;  2A6E F;  2MYS A;  3CAX A;  3WG7 C;  1SF8 A;  5L0I A;  5T3T A;  1FTS A;  4FAP B;  5A69 A;  4BPM A;  1WTY A;  3K1I C;  2CW0 F;  2XLM A;  4GQH A;  1ZVZ A;  2IYL D;  2KC3 A;  2CNW A;  1NFN A;  2QY9 A;  4CJG A;  1RMV A;  2AWC A;  2LIG A;  1ZU4 A;  1LE4 A;  3LS1 A;  4WGZ A;  2Y3D A;  1TWA A;  3H65 A;  3RQG A;  3AGU A;  3BRJ A;  3IEE A;  4GYT A;  5JP7 A;  1Z7Q c;  3R2P A;  5B3S C;  4IAQ A;  2P0N A;  2OJE D;  2J0W A;  2VC9 A;  4CX9 A;  1QKR A;  4P9T A;  1VK5 A;  2B0H A;  3DAF A;  1FNT c;  3AG3 C;  3DE8 A;  5B1B C;  3JRT A;  1RKE A;  1TR2 A;  1ZHZ A;  3N0T A;  4JCH A;  5BQI A;  1ZW3 A;  5D92 A;  4BJ1 A;  4AK9 A;  1A7E A;  1E86 A;  1CPR A;  4CS9 A;  3DAG A;  2UUI A;  1M2V A;  2EPK X;  3M4B A;  1A7D A;  2Y69 C;  4DBQ A;  3ZQV A;  2OU6 A;  2C04 A;  4C3B A;  2V3C C;  2JX0 A;  3U3F A;  2HS5 A;  1DOV A;  1VMA A;  3L8I A;  3IPM O;  3HNI A;  5E3A A;  3O6X A;  4HFF B;  4CS9 C;  1HW2 A;  2ETS A;  3LES A;  2R7U A;  2GA0 A;  2YKZ A;  1ORY A;  2AWY A;  4LER A;  4DRJ B;  4CS7 A;  3EHM A;  2H7O A;  4IJJ A;  1OR3 A;  1PV3 A;  1OW8 A;  1H9G A;  2L6F A;  1A0B A;  1AUE A;  1T6U A;  2H7B A;  3TQO A;  3B9Q A;  3AG1 C;  2G3V A;  2ZD9 A;  3T6J A;  3JYH A;  3TK0 A;  1U0B B;  2EIL C;  4E7S A;  3FAP B;  3ZQY A;  1LS4 A;  1BZ4 A;  4LDK A;  1YZC A;  3G4Z A;  4EBJ A;  3ABL C;  4YJW A;  3U3B A;  2X0C A;  1K05 A;  3FOO A;  3K33 A;  3KH2 A;  3JTL O;  3RFY A;  3B0U X;  5E2Q A;  4Z9I A;  1HMD A;  2A68 F;  2P7V A;  1I5N A;  2IM8 A;  2PFD A;  3ATP A;  1MMG A;  5HSW A;  1CGM E;  4C3D A;  2XL6 A;  2WVQ A;  3E9V A;  1EQ1 A;  1J8M F;  3DZA A;  3HNJ A;  5EK0 A;  2LSE A;  2L7A A;  3RH3 A;  5AC5 A;  2GAQ A;  3EJN A;  4XPW A;  1OR2 A;  5D91 A;  3UGP A;  4JEB A;  2D5R B;  1ZW2 A;  4Q5S F;  1NU9 C;  4JE9 A;  1L3P A;  3SZR A;  3Q7L A;  1QLE C;  2J46 A;  1D1B A;  2NUP A;  2A0B A;  1FMW A;  1M56 C;  1HMO A;  4K7B A;  1LI5 A;  5L0G A;  2PNO A;  4YT8 A;  1EA8 A;  1GGQ A;  2DYS C;  3HJC A;  3I5Q A;  4U5F E;  3NRH A;  3I4U A;  5DS4 A;  3ASN C;  4L6R A;  1D0Z A;  2TMV P;  3HNK A;  3RQE A;  3JYY A;  4CS8 A;  3GOR A;  2YL3 A;  4DRH B;  5B1A C;  3N2Z B;  4U5D E;  3UR3 C;  5JS5 A;  2A6H F;  3JZ0 A;  2HZ8 A;  4XQ1 A;  4EKW A;  1Y6D A;  3NDB B;  4FWV A;  5KYY A;  5KYU B;  3V7O A; 
#chains in the Genus database with same CATH homology
 3LEO A;  3HKK A;  4AL0 A;  4J7Y A;  2Q7R A;  2H8A A;  4NTB A;  3B29 A;  4NTF A;  5K0I A;  4JC7 A;  4YL1 A;  5BQI A;  4YL0 A;  4YL3 A;  2PNO A;  2UUI A;  5BQH A;  3PCV A;  4JCZ A;  4YK5 A;  4JRZ A;  4BPM A;  4WAB A;  2UUH A;  4NTA A;  5BQG A;  5HV9 A;  4J7T A;  3DWW A;  4AL1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...