4G78A

Subatomic resolution crystal structure of histidine-containing phosphotransfer protein mthpt2 from medicago truncatula
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
147
structure length
137
Chain Sequence
SNAMDHLHRKLRDHEAAMFQQGYLDDQFSQLQKLQDDTSPDFVIEVMLNNMSRALEQVPVNFKQIDAHAHQQKGSSASVGAARVKNVCGTFRNFCEAQNLEGCVRCLQQLQQEYSLLKNNLKYLFKLQQEIKTAGRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histidine phosphotransfer protein
publication title Subatomic Resolution Crystal Structure of Histidine-containing Phosphotransfer Protein MtHPt2 from Medicago truncatula
rcsb
source organism Medicago truncatula
molecule tags Transferase
total genus 67
structure length 137
sequence length 147
ec nomenclature ec 2.7.3.-:
pdb deposition date 2012-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01627 Hpt Hpt domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.160 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) HPT domain 4g78A00
2OOCA 2A0BA 3U3BA 1Y6DA 1A0BA 1FR0A 1WN0A 3IQTA 2LD6A 4PACA 1OXKA 2Q4FA 1TQGA 3MYFA 1C03A 2LCHA 2LP4A 2R25A 1QSPA 4G78A 1BDJB 3KYJA 1YVIA 1I5NA 3US6A 1SR2A 3KYIA 1C02A 1OXBA 4EUKB
chains in the Genus database with same CATH superfamily
2AWYA 3FMSA 2R7VA 1ZHZA 3KMIA 4LLEA 5JUAA 2PX3A 3VM6A 5COGA 2YWAA 1V54C 2J8WA 3EGDA 3IQTA 2CGEA 3K6BA 3MX3A 1O87A 3NYJA 3TK0A 2VC9A 2Y3GA 1CGOA 5JP7A 4EKWA 1YDIA 2R7QA 2H8AA 1E86A 3U8VA 1YZAA 2ICWG 1YLMA 3KL4A 3GWLA 2YL0A 4J7YA 2R25A 2YVKA 1KNYA 4EIYA 1YYJA 2VCBA 1F1MA 4MW8A 3RF3A 5KYWA 3FDQA 2P1AA 2JPUA 1Z5ZA 3IHUA 1YA9A 3US6A 3Q6MA 4CDAA 4E7SA 2R7TA 2G3KA 3K66A 3W2VA 2QUPA 3HNLA 4J32B 5A6KA 2KGOA 2W4MA 3JSEO 4KNVA 1OXBA 4JZAA 2IXOA 1QVXA 4ULVA 3U0CA 2I8BA 3B9QA 4EBBA 1HE1A 5AC4A 2IBFA 3EGDB 3RFYA 2HMQA 1D0YA 1QLEC 1NLXA 2HZ8A 2GFHA 4PFPA 1OKKD 2NUTB 1Q0FA 2DYRC 4XQ1A 2R7UA 2YZSA 2M4EA 2YQYA 2ZXWC 2J0XA 4JURI 4O6YA 4JEAA 1YJGA 2Q9CA 3ZQYA 5KYWB 1ZHYA 2J0WA 1WASA 3LLIA 3RIPA 3DXJF 3ASNC 5E2QA 4LLCA 3L1MA 2XLVA 1A7DA 3GWNA 3JRTA 4OD4A 3JT1A 1VK5A 1VOMA 3GORA 1KTMA 4QDLA 2IM8A 2VB6A 4C3BA 4CIHA 2LSEA 4N6CA 5DQZA 3NMIA 2O9XA 5BQGA 1Y4CA 4EUKB 1EA8A 1Q0DA 3M15A 4B6IA 3O55A 2A0BA 2XRHA 3UMHA 1ZYRF 2E87A 1EI7A 1SYQA 3EH1A 3FVYA 3PCVA 3PHF2 3AQBA 3FAPB 3E9VA 3JSZA 3N0TA 2TMVP 4KI2A 4C7OB 3PMRA 4AL0A 1LE2A 2OJED 5L0FA 3LUTB 2XS1A 3G50A 5L0HA 3ECSA 1RCPA 3M4CA 2VCAA 4K1OA 4IJJA 2XL4A 2VH3A 3C7JA 4OIRF 4RDAA 1JR8A 1U6HA 4Q7CA 2X0CA 3U5SA 3TULA 2Y3BA 2WL8A 4NY3A 4E17A 3U2MA 4MVZA 3DMDA 4BJ6A 4E0HA 3ZSUA 2KSFA 4G7HF 3K1IA 1TFKB 2CW0F 3EH2A 3ABKC 3R2PA 2FFHA 2MHRA 2YEVA 4XWJA 1BZ4A 3TOLA 1NU9C 3S29A 5BQIA 1L7CA 4JTDB 1FFHA 1GM5A 5F28E 1ZU5A 3QVZA 2XS8A 2HV7A 2PX0A 3C63A 4XEVA 1GS9A 3NKDA 1FMWA 3H65A 3G4ZA 4MVOA 2YL3A 2RD9A 3R7CA 3W4YA 4XLPF 2QTVA 1G5ZA 2VCCA 2NSFA 2J9UA 3ZIBA 1J8YF 2A68F 2WZLA 1VB5A 3B71A 5TJ5E 1KU2A 2L6GA 2A6EF 3DAFA 1OCCC 3L8JA 4I44A 4U5CE 4G7ZF 4ANJA 2FGYA 2F22A 2LCHA 1ZZPA 1CPQA 1DOVA 1LM3B 2P6VA 2QY9A 2XSEA 3DM5A 2R7WA 2OKUA 2IXMA 3ZDLA 4DBQA 3EPVA 4N4WA 2LK4A 4XPWA 1FAPB 5HV9A 2J45A 3DM9B 5E3CA 1IW7F 3GEIA 1XZPA 4IB4A 3T9OA 1WATA 4JC7A 1W2WA 3SZRA 1AUEA 3IQ6A 4KC9A 2ZD9A 3FXHA 5DVWA 1D1AA 3DAGA 3BEHA 2R7XA 1HMOA 2KC3A 4QI2A 3MBGA 2DYSC 4EHPA 1Y6DA 4QI0A 4IRUA 3RVYA 3EQLF 3T6GB 1FR0A 4CX9A 1Z6AA 2Q00A 4LERA 2LD6A 4U5GA 3I5QA 4YL1A 1D1BA 4YT5A 3LS1A 3AG2C 4O6MA 3FHDA 3QW0A 3EHNA 4XLNF 4EBJA 5JLIA 2Y39A 2DGJA 1RJ9A 3CSKA 1TWAA 4JCZA 4PFOA 3S27A 2NUPA 4IAOA 3SXMA 1QSPA 2L81A 1NBBA 4G78A 4RBNA 4CDVA 1EQ1A 3V5XA 1LS1A 3VAYA 1ORSC 2OG2A 3DJUB 3T6JA 1Z7Qc 1O3UA 4LDRA 1MMNA 3NYLA 4CSAC 3HNKA 3ASOC 1BR4A 4DVYP 2XXAA 4DBRA 3IEEA 3RQGA 2L6FA 1OW7A 1JPNA 1PD1A 3FAJA 3W8IA 4IARA 4OD5A 1LVKA 2IXPA 3X2QC 1S05A 1VMAA 2WB7A 2Y69C 3H2VA 2ASRA 3U3BA 4C3EA 4FAPB 5KYXB 2XLHA 3NKEA 4OIQF 3QMKA 3LJBA 3DJNB 2CYDA 1PV3A 4M63A 3RH3A 2NUPB 2PF4E 3C8GB 3KH2A 1YA7O 4Z9JA 1EKYA 2A6HF 4HFFB 4Z9IA 5EHHA 5JRAA 2B0JA 3CEXA 3ZTMA 3ZVRA 2EPNA 2JD3A 2UUHA 3UMKA 2H7OA 5L0CA 3FOOA 3L34A 1T6IA 2J46A 1WTYA 3ABMC 4YN0B 3U2LA 3OWTA 2J9WA 4X0RA 1YYXA 4N06A 5D92A 4NTBA 3CAXA 3AQCA 4CDYA 2HSBA 2R05A 1HW2A 2NSGA 3AJMA 4U5HA 1Q0GA 5CIVA 3J06A 2DI3A 1VYKA 4G7OF 1GGQA 3AG4C 1A0BA 1M2OA 2EIKC 4O7GA 4DXWA 3S9OA 2KNHA 1MMGA 1MMAA 5A6AA 4WGZA 1D1CA 4E7ZA 4K0DA 1AVOB 5A6BD 4XTKA 1VLTA 2M64A 1T9KA 2UUIA 3GM1A 1OW6A 2Q7RA 4EWCA 4YT8A 5L0DA 3NDBB 3W8HA 4MTOA 3S28A 3U8PA 2OQMA 3T4RA 5L3VA 1LPEA 2H7BA 5EK0A 1QPUA 256BA 4IWBA 3LEVA 4YL3A 5CI9A 1OKKA 2WZFA 2OU6A 4U5BE 4CS8C 1UG7A 3UNGC 4HE8D 1SF8A 1RKCA 3EHMA 1H9TA 1OCOC 5GPGB 2CDQA 2HSQA 1T6QA 2EPKX 3Q7LA 1AEPA 2PNOA 1G4US 4JRZA 1WGWA 2LIGA 4CS8A 1OQCA 1TWCA 1A7EA 2AU5A 4OINF 4YT2A 1OW8A 3EJNA 1E2XA 3SXKA 1M57C 1Z3IX 4PJNA 3A9CA 4MNDA 3B29A 2H7VC 1DOWA 1MQVA 4EBKA 3DKAA 2YLGA 3DD7A 3EGXA 3B0UX 5K0IA 1M2VA 1ZW2A 4KNWA 1CGNA 3DI5A 3V7OA 1N1CA 1S7ZA 1GQAA 5E3AA 3U3FA 3GEEA 3T6BA 2YLDA 4K7BA 5L3QA 3EFOA 2L7AA 3GEHA 2V3CC 1B68A 3M1CB 2OOCA 4NQFA 5CI8A 4YWQA 2I15A 2Q9AA 3HKKA 1CPRA 3GM2A 3HNJA 4U9EA 3ZG1A 5JVEA 1IZMA 2OEXA 1FNTc 2W9YA 5L0JA 1OR3A 1BR1A 1G4WR 4DVZA 3F46A 1OCRC 4GQHA 3MYFA 3O6XA 4JKVA 3X1OA 5KYNA 3G4XA 3LNRA 4ER9A 4FX5A 1BR2A 2XM0A 4PK4A 1O5HA 2GAQA 4R32A 5E33A 2LFFA 1FMVA 3LESA 4HEAJ 3RVZA 1ORJA 2EPLX 1ZU4A 4LACB 3TD7A 1MNEA 2EINC 2J9BA 2Q9BA 3EZIA 3QVYA 1RKEA 4MW3A 2IOQA 2R9RB 3UMIA 4U5FE 2PBEA 2XLDA 3UR3C 1XWJA 2A1DD 1E84A 2C03A 5L0GA 3ZWIA 1MNDA 4BG0A 3IQCA 3WAQA 4Q4ZF 3AGTA 1D0ZA 2EIJC 1H7IA 3W2WA 4JTCB 4I1MA 5DLJA 4CIPA 2EILC 1UFBA 2Y3HA 3KPHA 5KYYA 2XL6A 4P9TA 3HLZA 3TOMA 2G62A 3TJ6A 2GWWA 1M6TA 1K40A 2RSEB 3NG1A 3Q7GA 4J30B 2HV6A 1C03A 1NG1A 1FTSA 4JIOA 5T3TA 3WHNA 1LKXA 4XPYA 3JZ0A 5A6JA 2P61A 3IPMO 3AG1C 4E0IA 2KK1A 2W4BA 3KYJA 1NSGB 3JTLO 4MQ9F 4MVSA 5KYUA 1RKEB 2WVNA 4P9FA 4JE9A 2MYSA 4MTFA 1SR2A 3GANA 4DRHB 4MS2A 3TQOA 3EG9A 3HTKC 1NFNA 2CNWD 5DQTA 4BEJA 2LFDA 1TWGA 3DWWA 3RQFA 3JRMO 1G8XA 1ORYA 1TFOB 3QZCA 4E18A 4CJGA 4WGYA 5F5HA 4CSAA 2DB4A 3CQZA 4JEBA 2NG1A 3C8ZA 1M56C 1MMDA 1NFOA 1QZXA 1RJ9B 4Q5SF 2C04A 3ZC4A 4YK5A 1E83A 1D0XA 5BUOA 2CNWA 4L6RA 3SP1A 3POVA 1ZVZA 2G3VA 5KYUB 3L0IA 3U9JA 3MFNA 2ZXPA 3SXYA 1LI7A 5F5FA 4A4AA 1ZW3A 3E70C 2R7RA 3SXZA 1BBHA 2XXAB 3EG9B 1YAUO 2ZPAA 5EGYA 2HUJA 1K04A 4CBEA 2FAPB 5DS6A 1U0BB 2XLOA 4ULWA 2Q3TA 3PDMP 1V74B 4WJ0A 4OIPF 2OEVA 4U5EE 3RYLA 3UGOA 3ABLC 1XZQA 3RKOF 1CGME 3SEOA 1JMWA 1T5OA 1WN0A 2AVKA 4PACA 1E85A 3VRCA 2J9VA 2Q4FA 4IGGA 2NUTA 4GYTA 2BC5A 4WABA 2PFDA 2V26A 3LS0A 2R7SA 2Y3DA 3MLGA 3M4BA 3WODF 4BPMA 5IY5C 4AK9A 2QNLA 1NU7D 5JT4A 2Z15A 4YT4A 3OA1A 1YVIA 3DE8A 2WVQA 4JVSA 5L0IA 5DS4A 2WVOA 1YARO 4IAQA 3O10A 2KW3C 4XEKA 2HFIA 3K33A 4DOZA 5AC5A 1SZIA 3JYHA 3VF0A 2JX0A 4N6HA 4NC3A 3SNHA 3KKBA 1ZHWA 1VYIA 1T6UA 4CS9C 1JOGA 2OJQA 5A6BA 1JRAA 2D4UA 1H9GA 1LS4A 1K05A 1HMDA 3H2UA 2YRFA 4KBLA 4U9DA 2EIMC 1V4AA 2KJGA 4DRIB 2J7PD 5COMA 4C3DA 3RW0A 3N24A 3VYWA 2KQ9A 4I1OB 3OEOA 4CS9A 1TR2A 1T01A 4C7OA 3C62A 4W8KA 4MVUA 5JS5A 3AOUA 1QQ3A 4JCHA 2NPUA 2XL8A 4H4KC 4DRJB 4ZLCA 1PCXA 4F4BA 1Q0KA 1VTMP 3SYNA 5B1BC 1U89A 3LEOA 4MVRA 1I4ZA 4O6NA 1NZEA 3IQ5A 3AGUA 2QE9A 3ITFA 4BJ1A 2ZXOA 2YL1A 5HSWA 2J7PA 2EPOA 2HJ3A 5COFA 5DS5A 4ZLDA 2L9JA 3U9MA 1Q0MA 3L8IA 3RQEA 1VLSA 3C18A 3LLKA 1V55C 3WG7C 3LNMB 4ONSA 2A0UA 3Q6NA 3AG3C 4AE4A 5AGFA 1LE4A 3NMKA 4OIOF 2X51A 2VASA 3MYIA 4D4NA 2L6HA 2AP3A 3B0PA 4AL1A 5D91A 1HW1A 4BJ5C 4BJ6C 1HE9A 3K1IC 3N2ZB 1OXKA 2R03A 4BEMJ 1TQGA 4PJJA 3TJ5A 5B3SC 4JTAB 4NTFA 1QKRA 1ST6A 1J8MF 2IYLD 2LP4A 2XLWA 2QLAA 3S90A 4BJ5A 3EGXB 1LIHA 1M2VB 4JW1A 2WZGA 2YLIA 3F47A 4W8PA 1H6GA 3JYYA 4LDKA 2XLEA 2HJMA 3A11A 4GEHA 1TWHA 3KYIA 3EZHA 4LDQA 4H54A 4A2NB 1C02A 2XM4A 3EFOB 4AE4B 2HMZA 2OCCC 3V5YA 4DJ9A 5T3WA 2IXNA 2KYHA 4FESA 3B0VC 3DE9A 4JJGA 4O79A 4BJTA 2A69F 4NCQA 2HS5A 1WWPA 1Z23A 3HNIA 3DZAA 4PJMA 3I5PA 4PR9A 2AWCA 4JJFA 3S84A 3UGPA 4PJLA 2ZXRA 1JAFA 2BL2A 4I3MA 2GA0A 1A7VA 2XLMA 3M79A 3O39A 4Z9HA 3K1HA 3NMJA 1BDJB 3CZ6A 1APCA 3ZTZA 1I5NA 2R7OA 2EPMX 3LAYA 1PD0A 1RXQA 2PP4A 1OCZC 4YJWA 4MVMA 4NTAA 3FOPA 5T1DB 4FWVA 1R5ID 1FFTC 2MWQA 1ZHTA 3C8GD 2HKVA 4YL0A 4UDVA 3I4UA 1RMVA 1A41A 3GODA 3QW1A 5KYYB 1TKNA 3S0XA 1Z63A 5KYXA 3QTHA 4U5DE 2CCYA 2LQGA 4XPXA 1HY5A 2BE5F 5BQHA 5A69A 1JPJA 1LI5A 1OR2A 4RD9A 2YL7A 4XEFA 3V5ZA 2GDCA 4G0HA 5FCLA 5B3IA 3K7DA 1I4YA 4HFKB 1R4TA 5FZTA 3C8GA 1WOLA 1L3PA 3NYMA 4MTGA 2P0NA 2B0HA 2W45A 2R02A 2YHSA 2YKZA 3NRHA 4CS7A 5JSLA 1YZCA 1ZHXA 2P7VA 3GM3A 3HJCA 4AX2A 4CJOA 4P6IC 2ETSA 1SMYF 4D4XA 3ATPA 1C17M 5B1AC 4MVQA 3ZQVA 4J7TA 3BRJA 2D5RB 3JCUQ
chains in the Genus database with same CATH topology
2OOCA 2A0BA 3U3BA 1Y6DA 1A0BA 1FR0A 1WN0A 3IQTA 2LD6A 4PACA 1OXKA 2Q4FA 1TQGA 3MYFA 1C03A 2LCHA 2LP4A 2R25A 1QSPA 4G78A 1BDJB 3KYJA 1YVIA 1I5NA 3US6A 1SR2A 3KYIA 1C02A 1OXBA 4EUKB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OOC A;  2A0B A;  3U3B A;  1Y6D A;  1A0B A;  1FR0 A;  1WN0 A;  3IQT A;  2LD6 A;  4PAC A;  1OXK A;  2Q4F A;  1TQG A;  3MYF A;  1C03 A;  2LCH A;  2LP4 A;  2R25 A;  1QSP A;  4G78 A;  1BDJ B;  3KYJ A;  1YVI A;  1I5N A;  3US6 A;  1SR2 A;  3KYI A;  1C02 A;  1OXB A;  4EUK B; 
#chains in the Genus database with same CATH topology
 2AWY A;  3FMS A;  2R7V A;  1ZHZ A;  3KMI A;  4LLE A;  5JUA A;  2PX3 A;  3VM6 A;  5COG A;  2YWA A;  1V54 C;  2J8W A;  3EGD A;  3IQT A;  2CGE A;  3K6B A;  3MX3 A;  1O87 A;  3NYJ A;  3TK0 A;  2VC9 A;  2Y3G A;  1CGO A;  5JP7 A;  4EKW A;  1YDI A;  2R7Q A;  2H8A A;  1E86 A;  3U8V A;  1YZA A;  2ICW G;  1YLM A;  3KL4 A;  3GWL A;  2YL0 A;  4J7Y A;  2R25 A;  2YVK A;  1KNY A;  4EIY A;  1YYJ A;  2VCB A;  1F1M A;  4MW8 A;  3RF3 A;  5KYW A;  3FDQ A;  2P1A A;  2JPU A;  1Z5Z A;  3IHU A;  1YA9 A;  3US6 A;  3Q6M A;  4CDA A;  4E7S A;  2R7T A;  2G3K A;  3K66 A;  3W2V A;  2QUP A;  3HNL A;  4J32 B;  5A6K A;  2KGO A;  2W4M A;  3JSE O;  4KNV A;  1OXB A;  4JZA A;  2IXO A;  1QVX A;  4ULV A;  3U0C A;  2I8B A;  3B9Q A;  4EBB A;  1HE1 A;  5AC4 A;  2IBF A;  3EGD B;  3RFY A;  2HMQ A;  1D0Y A;  1QLE C;  1NLX A;  2HZ8 A;  2GFH A;  4PFP A;  1OKK D;  2NUT B;  1Q0F A;  2DYR C;  4XQ1 A;  2R7U A;  2YZS A;  2M4E A;  2YQY A;  2ZXW C;  2J0X A;  4JUR I;  4O6Y A;  4JEA A;  1YJG A;  2Q9C A;  3ZQY A;  5KYW B;  1ZHY A;  2J0W A;  1WAS A;  3LLI A;  3RIP A;  3DXJ F;  3ASN C;  5E2Q A;  4LLC A;  3L1M A;  2XLV A;  1A7D A;  3GWN A;  3JRT A;  4OD4 A;  3JT1 A;  1VK5 A;  1VOM A;  3GOR A;  1KTM A;  4QDL A;  2IM8 A;  2VB6 A;  4C3B A;  4CIH A;  2LSE A;  4N6C A;  5DQZ A;  3NMI A;  2O9X A;  5BQG A;  1Y4C A;  4EUK B;  1EA8 A;  1Q0D A;  3M15 A;  4B6I A;  3O55 A;  2A0B A;  2XRH A;  3UMH A;  1ZYR F;  2E87 A;  1EI7 A;  1SYQ A;  3EH1 A;  3FVY A;  3PCV A;  3PHF 2;  3AQB A;  3FAP B;  3E9V A;  3JSZ A;  3N0T A;  2TMV P;  4KI2 A;  4C7O B;  3PMR A;  4AL0 A;  1LE2 A;  2OJE D;  5L0F A;  3LUT B;  2XS1 A;  3G50 A;  5L0H A;  3ECS A;  1RCP A;  3M4C A;  2VCA A;  4K1O A;  4IJJ A;  2XL4 A;  2VH3 A;  3C7J A;  4OIR F;  4RDA A;  1JR8 A;  1U6H A;  4Q7C A;  2X0C A;  3U5S A;  3TUL A;  2Y3B A;  2WL8 A;  4NY3 A;  4E17 A;  3U2M A;  4MVZ A;  3DMD A;  4BJ6 A;  4E0H A;  3ZSU A;  2KSF A;  4G7H F;  3K1I A;  1TFK B;  2CW0 F;  3EH2 A;  3ABK C;  3R2P A;  2FFH A;  2MHR A;  2YEV A;  4XWJ A;  1BZ4 A;  3TOL A;  1NU9 C;  3S29 A;  5BQI A;  1L7C A;  4JTD B;  1FFH A;  1GM5 A;  5F28 E;  1ZU5 A;  3QVZ A;  2XS8 A;  2HV7 A;  2PX0 A;  3C63 A;  4XEV A;  1GS9 A;  3NKD A;  1FMW A;  3H65 A;  3G4Z A;  4MVO A;  2YL3 A;  2RD9 A;  3R7C A;  3W4Y A;  4XLP F;  2QTV A;  1G5Z A;  2VCC A;  2NSF A;  2J9U A;  3ZIB A;  1J8Y F;  2A68 F;  2WZL A;  1VB5 A;  3B71 A;  5TJ5 E;  1KU2 A;  2L6G A;  2A6E F;  3DAF A;  1OCC C;  3L8J A;  4I44 A;  4U5C E;  4G7Z F;  4ANJ A;  2FGY A;  2F22 A;  2LCH A;  1ZZP A;  1CPQ A;  1DOV A;  1LM3 B;  2P6V A;  2QY9 A;  2XSE A;  3DM5 A;  2R7W A;  2OKU A;  2IXM A;  3ZDL A;  4DBQ A;  3EPV A;  4N4W A;  2LK4 A;  4XPW A;  1FAP B;  5HV9 A;  2J45 A;  3DM9 B;  5E3C A;  1IW7 F;  3GEI A;  1XZP A;  4IB4 A;  3T9O A;  1WAT A;  4JC7 A;  1W2W A;  3SZR A;  1AUE A;  3IQ6 A;  4KC9 A;  2ZD9 A;  3FXH A;  5DVW A;  1D1A A;  3DAG A;  3BEH A;  2R7X A;  1HMO A;  2KC3 A;  4QI2 A;  3MBG A;  2DYS C;  4EHP A;  1Y6D A;  4QI0 A;  4IRU A;  3RVY A;  3EQL F;  3T6G B;  1FR0 A;  4CX9 A;  1Z6A A;  2Q00 A;  4LER A;  2LD6 A;  4U5G A;  3I5Q A;  4YL1 A;  1D1B A;  4YT5 A;  3LS1 A;  3AG2 C;  4O6M A;  3FHD A;  3QW0 A;  3EHN A;  4XLN F;  4EBJ A;  5JLI A;  2Y39 A;  2DGJ A;  1RJ9 A;  3CSK A;  1TWA A;  4JCZ A;  4PFO A;  3S27 A;  2NUP A;  4IAO A;  3SXM A;  1QSP A;  2L81 A;  1NBB A;  4G78 A;  4RBN A;  4CDV A;  1EQ1 A;  3V5X A;  1LS1 A;  3VAY A;  1ORS C;  2OG2 A;  3DJU B;  3T6J A;  1Z7Q c;  1O3U A;  4LDR A;  1MMN A;  3NYL A;  4CSA C;  3HNK A;  3ASO C;  1BR4 A;  4DVY P;  2XXA A;  4DBR A;  3IEE A;  3RQG A;  2L6F A;  1OW7 A;  1JPN A;  1PD1 A;  3FAJ A;  3W8I A;  4IAR A;  4OD5 A;  1LVK A;  2IXP A;  3X2Q C;  1S05 A;  1VMA A;  2WB7 A;  2Y69 C;  3H2V A;  2ASR A;  3U3B A;  4C3E A;  4FAP B;  5KYX B;  2XLH A;  3NKE A;  4OIQ F;  3QMK A;  3LJB A;  3DJN B;  2CYD A;  1PV3 A;  4M63 A;  3RH3 A;  2NUP B;  2PF4 E;  3C8G B;  3KH2 A;  1YA7 O;  4Z9J A;  1EKY A;  2A6H F;  4HFF B;  4Z9I A;  5EHH A;  5JRA A;  2B0J A;  3CEX A;  3ZTM A;  3ZVR A;  2EPN A;  2JD3 A;  2UUH A;  3UMK A;  2H7O A;  5L0C A;  3FOO A;  3L34 A;  1T6I A;  2J46 A;  1WTY A;  3ABM C;  4YN0 B;  3U2L A;  3OWT A;  2J9W A;  4X0R A;  1YYX A;  4N06 A;  5D92 A;  4NTB A;  3CAX A;  3AQC A;  4CDY A;  2HSB A;  2R05 A;  1HW2 A;  2NSG A;  3AJM A;  4U5H A;  1Q0G A;  5CIV A;  3J06 A;  2DI3 A;  1VYK A;  4G7O F;  1GGQ A;  3AG4 C;  1A0B A;  1M2O A;  2EIK C;  4O7G A;  4DXW A;  3S9O A;  2KNH A;  1MMG A;  1MMA A;  5A6A A;  4WGZ A;  1D1C A;  4E7Z A;  4K0D A;  1AVO B;  5A6B D;  4XTK A;  1VLT A;  2M64 A;  1T9K A;  2UUI A;  3GM1 A;  1OW6 A;  2Q7R A;  4EWC A;  4YT8 A;  5L0D A;  3NDB B;  3W8H A;  4MTO A;  3S28 A;  3U8P A;  2OQM A;  3T4R A;  5L3V A;  1LPE A;  2H7B A;  5EK0 A;  1QPU A;  256B A;  4IWB A;  3LEV A;  4YL3 A;  5CI9 A;  1OKK A;  2WZF A;  2OU6 A;  4U5B E;  4CS8 C;  1UG7 A;  3UNG C;  4HE8 D;  1SF8 A;  1RKC A;  3EHM A;  1H9T A;  1OCO C;  5GPG B;  2CDQ A;  2HSQ A;  1T6Q A;  2EPK X;  3Q7L A;  1AEP A;  2PNO A;  1G4U S;  4JRZ A;  1WGW A;  2LIG A;  4CS8 A;  1OQC A;  1TWC A;  1A7E A;  2AU5 A;  4OIN F;  4YT2 A;  1OW8 A;  3EJN A;  1E2X A;  3SXK A;  1M57 C;  1Z3I X;  4PJN A;  3A9C A;  4MND A;  3B29 A;  2H7V C;  1DOW A;  1MQV A;  4EBK A;  3DKA A;  2YLG A;  3DD7 A;  3EGX A;  3B0U X;  5K0I A;  1M2V A;  1ZW2 A;  4KNW A;  1CGN A;  3DI5 A;  3V7O A;  1N1C A;  1S7Z A;  1GQA A;  5E3A A;  3U3F A;  3GEE A;  3T6B A;  2YLD A;  4K7B A;  5L3Q A;  3EFO A;  2L7A A;  3GEH A;  2V3C C;  1B68 A;  3M1C B;  2OOC A;  4NQF A;  5CI8 A;  4YWQ A;  2I15 A;  2Q9A A;  3HKK A;  1CPR A;  3GM2 A;  3HNJ A;  4U9E A;  3ZG1 A;  5JVE A;  1IZM A;  2OEX A;  1FNT c;  2W9Y A;  5L0J A;  1OR3 A;  1BR1 A;  1G4W R;  4DVZ A;  3F46 A;  1OCR C;  4GQH A;  3MYF A;  3O6X A;  4JKV A;  3X1O A;  5KYN A;  3G4X A;  3LNR A;  4ER9 A;  4FX5 A;  1BR2 A;  2XM0 A;  4PK4 A;  1O5H A;  2GAQ A;  4R32 A;  5E33 A;  2LFF A;  1FMV A;  3LES A;  4HEA J;  3RVZ A;  1ORJ A;  2EPL X;  1ZU4 A;  4LAC B;  3TD7 A;  1MNE A;  2EIN C;  2J9B A;  2Q9B A;  3EZI A;  3QVY A;  1RKE A;  4MW3 A;  2IOQ A;  2R9R B;  3UMI A;  4U5F E;  2PBE A;  2XLD A;  3UR3 C;  1XWJ A;  2A1D D;  1E84 A;  2C03 A;  5L0G A;  3ZWI A;  1MND A;  4BG0 A;  3IQC A;  3WAQ A;  4Q4Z F;  3AGT A;  1D0Z A;  2EIJ C;  1H7I A;  3W2W A;  4JTC B;  4I1M A;  5DLJ A;  4CIP A;  2EIL C;  1UFB A;  2Y3H A;  3KPH A;  5KYY A;  2XL6 A;  4P9T A;  3HLZ A;  3TOM A;  2G62 A;  3TJ6 A;  2GWW A;  1M6T A;  1K40 A;  2RSE B;  3NG1 A;  3Q7G A;  4J30 B;  2HV6 A;  1C03 A;  1NG1 A;  1FTS A;  4JIO A;  5T3T A;  3WHN A;  1LKX A;  4XPY A;  3JZ0 A;  5A6J A;  2P61 A;  3IPM O;  3AG1 C;  4E0I A;  2KK1 A;  2W4B A;  3KYJ A;  1NSG B;  3JTL O;  4MQ9 F;  4MVS A;  5KYU A;  1RKE B;  2WVN A;  4P9F A;  4JE9 A;  2MYS A;  4MTF A;  1SR2 A;  3GAN A;  4DRH B;  4MS2 A;  3TQO A;  3EG9 A;  3HTK C;  1NFN A;  2CNW D;  5DQT A;  4BEJ A;  2LFD A;  1TWG A;  3DWW A;  3RQF A;  3JRM O;  1G8X A;  1ORY A;  1TFO B;  3QZC A;  4E18 A;  4CJG A;  4WGY A;  5F5H A;  4CSA A;  2DB4 A;  3CQZ A;  4JEB A;  2NG1 A;  3C8Z A;  1M56 C;  1MMD A;  1NFO A;  1QZX A;  1RJ9 B;  4Q5S F;  2C04 A;  3ZC4 A;  4YK5 A;  1E83 A;  1D0X A;  5BUO A;  2CNW A;  4L6R A;  3SP1 A;  3POV A;  1ZVZ A;  2G3V A;  5KYU B;  3L0I A;  3U9J A;  3MFN A;  2ZXP A;  3SXY A;  1LI7 A;  5F5F A;  4A4A A;  1ZW3 A;  3E70 C;  2R7R A;  3SXZ A;  1BBH A;  2XXA B;  3EG9 B;  1YAU O;  2ZPA A;  5EGY A;  2HUJ A;  1K04 A;  4CBE A;  2FAP B;  5DS6 A;  1U0B B;  2XLO A;  4ULW A;  2Q3T A;  3PDM P;  1V74 B;  4WJ0 A;  4OIP F;  2OEV A;  4U5E E;  3RYL A;  3UGO A;  3ABL C;  1XZQ A;  3RKO F;  1CGM E;  3SEO A;  1JMW A;  1T5O A;  1WN0 A;  2AVK A;  4PAC A;  1E85 A;  3VRC A;  2J9V A;  2Q4F A;  4IGG A;  2NUT A;  4GYT A;  2BC5 A;  4WAB A;  2PFD A;  2V26 A;  3LS0 A;  2R7S A;  2Y3D A;  3MLG A;  3M4B A;  3WOD F;  4BPM A;  5IY5 C;  4AK9 A;  2QNL A;  1NU7 D;  5JT4 A;  2Z15 A;  4YT4 A;  3OA1 A;  1YVI A;  3DE8 A;  2WVQ A;  4JVS A;  5L0I A;  5DS4 A;  2WVO A;  1YAR O;  4IAQ A;  3O10 A;  2KW3 C;  4XEK A;  2HFI A;  3K33 A;  4DOZ A;  5AC5 A;  1SZI A;  3JYH A;  3VF0 A;  2JX0 A;  4N6H A;  4NC3 A;  3SNH A;  3KKB A;  1ZHW A;  1VYI A;  1T6U A;  4CS9 C;  1JOG A;  2OJQ A;  5A6B A;  1JRA A;  2D4U A;  1H9G A;  1LS4 A;  1K05 A;  1HMD A;  3H2U A;  2YRF A;  4KBL A;  4U9D A;  2EIM C;  1V4A A;  2KJG A;  4DRI B;  2J7P D;  5COM A;  4C3D A;  3RW0 A;  3N24 A;  3VYW A;  2KQ9 A;  4I1O B;  3OEO A;  4CS9 A;  1TR2 A;  1T01 A;  4C7O A;  3C62 A;  4W8K A;  4MVU A;  5JS5 A;  3AOU A;  1QQ3 A;  4JCH A;  2NPU A;  2XL8 A;  4H4K C;  4DRJ B;  4ZLC A;  1PCX A;  4F4B A;  1Q0K A;  1VTM P;  3SYN A;  5B1B C;  1U89 A;  3LEO A;  4MVR A;  1I4Z A;  4O6N A;  1NZE A;  3IQ5 A;  3AGU A;  2QE9 A;  3ITF A;  4BJ1 A;  2ZXO A;  2YL1 A;  5HSW A;  2J7P A;  2EPO A;  2HJ3 A;  5COF A;  5DS5 A;  4ZLD A;  2L9J A;  3U9M A;  1Q0M A;  3L8I A;  3RQE A;  1VLS A;  3C18 A;  3LLK A;  1V55 C;  3WG7 C;  3LNM B;  4ONS A;  2A0U A;  3Q6N A;  3AG3 C;  4AE4 A;  5AGF A;  1LE4 A;  3NMK A;  4OIO F;  2X51 A;  2VAS A;  3MYI A;  4D4N A;  2L6H A;  2AP3 A;  3B0P A;  4AL1 A;  5D91 A;  1HW1 A;  4BJ5 C;  4BJ6 C;  1HE9 A;  3K1I C;  3N2Z B;  1OXK A;  2R03 A;  4BEM J;  1TQG A;  4PJJ A;  3TJ5 A;  5B3S C;  4JTA B;  4NTF A;  1QKR A;  1ST6 A;  1J8M F;  2IYL D;  2LP4 A;  2XLW A;  2QLA A;  3S90 A;  4BJ5 A;  3EGX B;  1LIH A;  1M2V B;  4JW1 A;  2WZG A;  2YLI A;  3F47 A;  4W8P A;  1H6G A;  3JYY A;  4LDK A;  2XLE A;  2HJM A;  3A11 A;  4GEH A;  1TWH A;  3KYI A;  3EZH A;  4LDQ A;  4H54 A;  4A2N B;  1C02 A;  2XM4 A;  3EFO B;  4AE4 B;  2HMZ A;  2OCC C;  3V5Y A;  4DJ9 A;  5T3W A;  2IXN A;  2KYH A;  4FES A;  3B0V C;  3DE9 A;  4JJG A;  4O79 A;  4BJT A;  2A69 F;  4NCQ A;  2HS5 A;  1WWP A;  1Z23 A;  3HNI A;  3DZA A;  4PJM A;  3I5P A;  4PR9 A;  2AWC A;  4JJF A;  3S84 A;  3UGP A;  4PJL A;  2ZXR A;  1JAF A;  2BL2 A;  4I3M A;  2GA0 A;  1A7V A;  2XLM A;  3M79 A;  3O39 A;  4Z9H A;  3K1H A;  3NMJ A;  1BDJ B;  3CZ6 A;  1APC A;  3ZTZ A;  1I5N A;  2R7O A;  2EPM X;  3LAY A;  1PD0 A;  1RXQ A;  2PP4 A;  1OCZ C;  4YJW A;  4MVM A;  4NTA A;  3FOP A;  5T1D B;  4FWV A;  1R5I D;  1FFT C;  2MWQ A;  1ZHT A;  3C8G D;  2HKV A;  4YL0 A;  4UDV A;  3I4U A;  1RMV A;  1A41 A;  3GOD A;  3QW1 A;  5KYY B;  1TKN A;  3S0X A;  1Z63 A;  5KYX A;  3QTH A;  4U5D E;  2CCY A;  2LQG A;  4XPX A;  1HY5 A;  2BE5 F;  5BQH A;  5A69 A;  1JPJ A;  1LI5 A;  1OR2 A;  4RD9 A;  2YL7 A;  4XEF A;  3V5Z A;  2GDC A;  4G0H A;  5FCL A;  5B3I A;  3K7D A;  1I4Y A;  4HFK B;  1R4T A;  5FZT A;  3C8G A;  1WOL A;  1L3P A;  3NYM A;  4MTG A;  2P0N A;  2B0H A;  2W45 A;  2R02 A;  2YHS A;  2YKZ A;  3NRH A;  4CS7 A;  5JSL A;  1YZC A;  1ZHX A;  2P7V A;  3GM3 A;  3HJC A;  4AX2 A;  4CJO A;  4P6I C;  2ETS A;  1SMY F;  4D4X A;  3ATP A;  1C17 M;  5B1A C;  4MVQ A;  3ZQV A;  4J7T A;  3BRJ A;  2D5R B;  3JCU Q; 
#chains in the Genus database with same CATH homology
 2OOC A;  2A0B A;  3U3B A;  1Y6D A;  1A0B A;  1FR0 A;  1WN0 A;  3IQT A;  2LD6 A;  4PAC A;  1OXK A;  2Q4F A;  1TQG A;  3MYF A;  1C03 A;  2LCH A;  2LP4 A;  2R25 A;  1QSP A;  4G78 A;  1BDJ B;  3KYJ A;  1YVI A;  1I5N A;  3US6 A;  1SR2 A;  3KYI A;  1C02 A;  1OXB A;  4EUK B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...