4G78A

Subatomic resolution crystal structure of histidine-containing phosphotransfer protein mthpt2 from medicago truncatula
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
147
structure length
137
Chain Sequence
SNAMDHLHRKLRDHEAAMFQQGYLDDQFSQLQKLQDDTSPDFVIEVMLNNMSRALEQVPVNFKQIDAHAHQQKGSSASVGAARVKNVCGTFRNFCEAQNLEGCVRCLQQLQQEYSLLKNNLKYLFKLQQEIKTAGRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Subatomic Resolution Crystal Structure of Histidine-containing Phosphotransfer Protein MtHPt2 from Medicago truncatula
rcsb
source organism Medicago truncatula
molecule tags Transferase
molecule keywords Histidine phosphotransfer protein
total genus 67
structure length 137
sequence length 147
ec nomenclature ec 2.7.3.-:
pdb deposition date 2012-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01627 Hpt Hpt domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.160 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) HPT domain 4g78A00
2A0BA 3U3BA 3MYFA 3KYIA 1SR2A 4EUKB 1Y6DA 3KYJA 1OXBA 2LD6A 1BDJB 1FR0A 1WN0A 1YVIA 1I5NA 4PACA 3US6A 3IQTA 1QSPA 4G78A 1C02A 2OOCA 1A0BA 1TQGA 2LCHA 2LP4A 2R25A 2Q4FA 1OXKA 1C03A
chains in the Genus database with same CATH superfamily
4XQ1A 1YZAA 2CCYA 1R4TA 2BL2A 2KW3C 4RD9A 1MMGA 1O5HA 3ABLC 3G50A 4YN0B 5FZTA 2XM4A 1JR8A 3WHNA 4LLEA 1H7IA 1Z5ZA 2EIKC 3AOUA 2FFHA 2AP3A 3JCUQ 2IOQA 3ZIBA 5HV9A 3V5XA 3EG9B 5D92A 3MFNA 1TKNA 3O39A 4RBNA 3VRCA 2P0NA 2YL1A 1YA7O 4XTKA 3K1HA 5DLJA 1Q0GA 3MYIA 4JRZA 1KTMA 2Q7RA 4E7SA 1EQ1A 2PBEA 4YL3A 1TWGA 2LFDA 1T6UA 2Y3DA 2OOCA 2YKZA 5A6JA 3IHUA 5BQHA 3X2QC 2Y39A 1MMNA 1YDIA 1PV3A 2YLGA 2XXAA 4MS2A 1KNYA 3JSEO 5JUAA 5BUOA 1C03A 4AK9A 1H9TA 2QE9A 4WABA 3IEEA 4DBQA 5CIVA 3SYNA 4KBLA 2PNOA 2YL7A 1WASA 2XS1A 1JRAA 3AQBA 3FAPB 4NC3A 3POVA 3W2VA 1MNDA 1OW8A 1TFOB 2HKVA 2Q9CA 2Z15A 3BEHA 3I5QA 3NMKA 2R03A 4HFKB 4BJ6C 1U89A 4CDVA 4CX9A 1LS1A 3Q7LA 3S0XA 2A69F 1AVOB 3EPVA 4ULVA 5AGFA 2OEXA 1N1CA 1ST6A 2O9XA 2DI3A 2CNWA 2GDCA 1ZHZA 2OKUA 4BPMA 1A41A 2E87A 1OCCC 2CW0F 3C8GD 3E9VA 3SP1A 1PCXA 4G7HF 4EBKA 4D4NA 2J0WA 1TWHA 4LDQA 2H7VC 1SMYF 1OKKA 1V55C 2KNHA 2ZXOA 1Z7Qc 5L0FA 2HFIA 2PFDA 2OEVA 2W4BA 3ITFA 4YT5A 4LLCA 3RH3A 2OJQA 3DJUB 3X1OA 2NSGA 5A6KA 5EGYA 4DRJB 1FR0A 1MQVA 3LS0A 3NYLA 4H4KC 1HE9A 3B0PA 2HZ8A 3NYMA 4U5FE 2L6GA 1L7CA 3ZVRA 3L1MA 3EH1A 4JCZA 3WG7C 3SZRA 2ZXRA 3EGXB 3EH2A 4MVUA 4OIOF 3ATPA 4KI2A 3HNKA 3C8GB 3PCVA 2AVKA 4YL0A 4E7ZA 2YLIA 3KYJA 3QVZA 5E2QA 4NTFA 3C8ZA 3EFOA 1XZQA 3CSKA 1R5ID 4PACA 3ASOC 1SYQA 1MMAA 1RKEB 2NUPA 5K0IA 3GEEA 4JEBA 1OW7A 3U9JA 4CJOA 1Q0KA 3T6JA 3HJCA 4Z9JA 4YK5A 3ABMC 4EWCA 1CPQA 3AGTA 1B68A 4U5HA 5JVEA 3UGPA 2ICWG 1GQAA 1RJ9A 1TQGA 2BE5F 2P6VA 1V74B 1OKKD 1YARO 2A1DD 1D0XA 3DM5A 3W4YA 2AWYA 3NMJA 5T3WA 5COFA 2I15A 1YLMA 1E86A 2EPKX 2IBFA 2L81A 2R9RB 3GWNA 2V3CC 4EKWA 4ONSA 2Q3TA 4N4WA 4EIYA 4W8PA 3Q6NA 3Q6MA 3T6GB 2G3VA 3B71A 3IQ6A 4N6HA 3G4ZA 2EILC 2HMQA 5JP7A 3U2LA 2IXOA 2V26A 2VCCA 4JTDB 4Q7CA 1HW1A 3DWWA 1TWCA 1H6GA 4DRIB 3JRTA 4H54A 1ORYA 1HW2A 2NSFA 3MLGA 4JKVA 1LPEA 5T1DB 5B3SC 1O87A 2XLDA 2R7OA 1T6IA 1EI7A 4YT8A 5EK0A 1YJGA 2Q00A 3LLKA 1HY5A 4JJFA 2ZXWC 3L34A 1A7VA 3OA1A 1FNTc 3UR3C 1Z23A 3MBGA 3U3BA 3H2VA 5DS6A 2VC9A 4DBRA 2YQYA 5DQZA 4OIQF 2UUHA 4WGYA 1ORJA 3IQCA 5L3QA 3JRMO 1APCA 4MTOA 3B0VC 3EGDA 1ZYRF 4EUKB 3U0CA 1TWAA 4PK4A 1M2OA 2D4UA 1VMAA 2I8BA 1QZXA 3K7DA 1A7DA 1WGWA 3H2UA 2XLMA 2PX0A 3EZHA 4MVQA 4W8KA 1LIHA 1PD1A 1LI5A 2R7TA 1M2VA 3QW1A 5A6AA 1GS9A 4PJJA 2PP4A 3K66A 2WZLA 4J30B 5KYNA 1OCRC 2GA0A 3EGDB 3RF3A 3EZIA 1U0BB 2JX0A 5B1BC 1ORSC 2P7VA 5KYWB 2NUPB 1BR2A 5BQGA 3HNJA 1LVKA 1OXKA 4WJ0A 1HE1A 3NMIA 4P9FA 3NG1A 4U9EA 3V5YA 4A2NB 4Z9HA 3KL4A 2R7RA 3FAJA 2XLOA 1FFTC 3CEXA 3AGUA 4CBEA 3RFYA 2R7XA 1Y6DA 1JAFA 3C63A 1K04A 4KNVA 3U3FA 5KYUA 2GWWA 1IW7F 2WB7A 2XLEA 2AU5A 1BR1A 1D0YA 4I3MA 4XEFA 1PD0A 1C02A 1FMWA 5KYXA 2CNWD 256BA 5T3TA 3SXMA 4CS9A 2BC5A 2Q9BA 4MW3A 1YAUO 3HLZA 4MVOA 2LSEA 3V5ZA 5JRAA 4U5GA 3UMKA 3L8IA 1I5NA 3R7CA 3LUTB 5COGA 5D91A 2VASA 5TJ5E 4GYTA 1J8MF 2XLHA 5F5FA 4NTAA 4DRHB 3HNLA 2ZD9A 2IXNA 3ASNC 1WATA 2PF4E 4D4XA 1VK5A 2VH3A 4LACB 4YJWA 2ASRA 3AQCA 1Q0FA 1LS4A 4HFFB 3OEOA 5KYYA 3TQOA 3F47A 2QY9A 1Z63A 2M4EA 1OXBA 4EBBA 5E3AA 2LD6A 3DD7A 1BDJB 3AJMA 4K7BA 1NFNA 4BJ1A 1ZU4A 4MW8A 2LQGA 4ULWA 4PFOA 1C17M 3N2ZB 3B29A 1YZCA 4O6MA 2RD9A 5L0GA 5JSLA 3UMIA 2L6HA 3VYWA 4C7OB 2Y3BA 4NY3A 2NPUA 5CI9A 1QQ3A 4JC7A 3FHDA 5E33A 3AG1C 3W8HA 5KYXB 3DM9B 3O6XA 2XLWA 1NLXA 3WAQA 3QMKA 3RYLA 3N24A 4IWBA 2DB4A 3U5SA 1RKEA 1S05A 1RXQA 2CGEA 4PFPA 3NDBB 3UNGC 4DVZA 4EBJA 4CS9C 1V4AA 2KQ9A 4IAQA 3SXZA 4OD4A 1OCZC 2VCBA 3EHMA 4RDAA 3DJNB 1XZPA 2EPNA 4IGGA 5B1AC 2J45A 2B0HA 2OU6A 3FMSA 5F5HA 4AE4A 3LEVA 4DVYP 1G4US 3ZWIA 5L0DA 2FAPB 4J7YA 4JIOA 1E84A 2OJED 3KPHA 3LS1A 2CDQA 3C62A 2J8WA 3T6BA 4Q5SF 1V54C 2LFFA 3LESA 1ZW2A 1MNEA 2YEVA 2X51A 3JTLO 3EFOB 4U9DA 5JT4A 5COMA 1AUEA 2C04A 3SXYA 4A4AA 1H9GA 4X0RA 3M15A 3N0TA 4XPXA 3VAYA 2Q4FA 2G3KA 2A0BA 3EGXA 2WVOA 2AWCA 4I1OB 4MTFA 1M57C 2J7PA 4EHPA 1HMDA 1DOWA 1D0ZA 5EHHA 1NZEA 2NUTA 5FCLA 2DYRC 4JCHA 3HTKC 1NBBA 3R2PA 2J9VA 3EHNA 1GGQA 5KYYB 4DJ9A 3ZTZA 2H7OA 3C18A 2VB6A 2EINC 4PJMA 2Y69C 3SEOA 1WN0A 3I4UA 3M79A 1ZZPA 2HMZA 1QPUA 1JMWA 4HE8D 2XS8A 1GM5A 1O3UA 1QSPA 4MNDA 4QI0A 5A6BD 4P6IC 1S7ZA 4MVMA 1K05A 3AG3C 2EIMC 4LDKA 1OW6A 3TOMA 1W2WA 3U2MA 3S9OA 2KYHA 4KC9A 1AEPA 2L7AA 1QKRA 1VLSA 1L3PA 3MYFA 3RQGA 3ZC4A 3K1IA 4FWVA 4XPYA 5DQTA 4G7ZF 5L0JA 2NG1A 1SF8A 2XM0A 2XL4A 1VB5A 3DI5A 3W2WA 4DXWA 4O6NA 5KYUB 5GPGB 1SR2A 1F1MA 4IJJA 4C3EA 3H65A 2W4MA 2ZXPA 3GORA 3NKEA 5DS5A 1SZIA 1I4YA 2YRFA 3O55A 4KNWA 4N06A 1CPRA 1Y4CA 2EIJC 4LERA 1FFHA 4PJLA 4E18A 3LEOA 2Q9AA 1RJ9B 1T01A 2OCCC 3RQFA 3RVYA 3QW0A 4BEJA 1CGOA 3GANA 1E85A 1RKCA 3DE9A 2J9BA 4MVZA 3TJ6A 5DVWA 1I4ZA 1RMVA 1NU9C 2HSBA 3EJNA 3F46A 3JSZA 4G0HA 1BZ4A 1K40A 1Z3IX 2LK4A 4J7TA 4JE9A 4DOZA 3GEHA 1A7EA 2EPMX 2WVQA 5KYWA 3DAFA 3KH2A 3S90A 3K33A 3TK0A 1BBHA 3KYIA 3UMHA 3GM2A 3FVYA 5L0CA 1LM3B 4IB4A 2DYSC 1NSGB 2RSEB 4AL1A 4ZLDA 1E83A 1CGME 1M2VB 2MHRA 4QI2A 2R7SA 3DXJF 3GODA 4IARA 4E17A 1MMDA 2NUTB 2UUIA 2YL0A 3EQLF 2R7VA 4MQ9F 3VF0A 1OR2A 2IYLD 3QTHA 3S28A 2KSFA 3JZ0A 3K1IC 4GQHA 4CDYA 1LE2A 3E70C 2R7UA 1ZHYA 2R7WA 4FESA 5B3IA 5JLIA 1WOLA 4HEAJ 5DS4A 2WZFA 3B9QA 4NQFA 4PJNA 4ZLCA 3SNHA 4JJGA 2HUJA 2D5RB 1NU7D 1U6HA 3DZAA 3QVYA 2YLDA 1HMOA 2J9UA 4YWQA 2L9JA 2YVKA 3ZTMA 4CS8C 3M1CB 4U5BE 1D1AA 3LNMB 1VLTA 1ZHWA 2XSEA 4AE4B 4BEMJ 4JW1A 3M4BA 2YZSA 3A11A 1WWPA 4O7GA 3MX3A 4CSAC 2YWAA 2EPLX 1YYXA 3OWTA 3KKBA 4G7OF 2WZGA 2JPUA 2OG2A 1ZHXA 2YHSA 2R02A 2Y3GA 3IQ5A 4OD5A 3VM6A 1YA9A 2MWQA 2XLVA 4BJ5C 1VYKA 2VCAA 1Q0DA 4JURI 2TMVP 1QLEC 2ETSA 4U5DE 2J46A 4G78A 5CI8A 4FAPB 1IZMA 4YL1A 2MYSA 1DOVA 3GM3A 1OR3A 1NG1A 1LI7A 2XL6A 3SXKA 1JPNA 4JVSA 1G8XA 2R05A 3CZ6A 3CQZA 2KC3A 1ZHTA 3FXHA 3QZCA 1TR2A 1FTSA 3CAXA 3B0UX 1VOMA 3EG9A 4JZAA 3J06A 1D1BA 3TOLA 1JPJA 2HV6A 2QUPA 3LJBA 4CIPA 1E2XA 4QDLA 2A6HF 3LLIA 4XWJA 4CSAA 4NCQA 1OQCA 3BRJA 3RIPA 3ZSUA 2W45A 2KK1A 2J7PD 4K1OA 3ECSA 3RQEA 3RKOF 3I5PA 1Q0MA 2XL8A 3ZG1A 4C3DA 1ZU5A 3T9OA 4F4BA 2W9YA 4OIPF 1G5ZA 3HKKA 2OQMA 3ZQVA 3U8VA 2CYDA 3T4RA 3AG2C 3L0IA 5F28E 2R25A 4FX5A 4P9TA 3TD7A 2KJGA 5A6BA 4CJGA 4Z9IA 2H8AA 4MVRA 2IXMA 2HS5A 4K0DA 4GEHA 4CS8A 1WTYA 4O6YA 2J9WA 2A0UA 3M4CA 2H7BA 2Y3HA 4M63A 2P1AA 4B6IA 4OINF 1OCOC 2GFHA 4CS7A 3O10A 1QVXA 2X0CA 3IPMO 4PR9A 3RW0A 2HV7A 2GAQA 2QTVA 3A9CA 1YVIA 3NRHA 1EKYA 4WGZA 3US6A 1T5OA 3PDMP 1RCPA 1T9KA 4NTBA 1LKXA 2FGYA 4OIRF 4BJ5A 5L0IA 3RVZA 1FMVA 4IRUA 2R7QA 4JTAB 5HSWA 3C8GA 2XXAB 3TJ5A 4Q4ZF 4MTGA 5BQIA 1UG7A 2HJ3A 5AC5A 3GWLA 2JD3A 2ZPAA 4XEVA 3U9MA 1UFBA 2IXPA 3AG4C 4L6RA 2KGOA 1ZW3A 2PX3A 4XLPF 1FAPB 3DMDA 3DKAA 2M64A 5AC4A 3FOPA 3V7OA 2LIGA 4C7OA 1YYJA 4E0HA 3S29A 1J8YF 4YT2A 4R32A 3FDQA 1NFOA 1TFKB 4CDAA 4YT4A 1Z6AA 2C03A 4O79A 2L6FA 4XPWA 1KU2A 1M6TA 2YL3A 3DAGA 3PMRA 4I1MA 4J32B 3UGOA 4ANJA 4N6CA 5L0HA 1M56C 5JS5A 2LCHA 4BG0A 5L3VA 2LP4A 2XRHA 4U5EE 5E3CA 4ER9A 3W8IA 2G62A 3HNIA 3ZDLA 2DGJA 2EPOA 3FOOA 4LDRA 1VYIA 3GM1A 4MVSA 3G4XA 4C3BA 2WVNA 3S84A 4XLNF 1CGNA 3JT1A 2F22A 3Q7GA 4UDVA 2P61A 1LE4A 1BR4A 1XWJA 3S27A 4BJTA 3GEIA 3NYJA 3ZQYA 3PHF2 2J0XA 1T6QA 4I44A 4AX2A 4E0IA 3JYYA 1EA8A 2QNLA 3C7JA 2A6EF 2QLAA 3L8JA 4IAOA 1JOGA 4JEAA 3ABKC 4XEKA 4JTCB 4U5CE 3JYHA 5IY5C 3IQTA 3WODF 3K6BA 3U8PA 2WL8A 3NKDA 2A68F 3TULA 1A0BA 3KMIA 3LNRA 4AL0A 2IM8A 3DE8A 1VTMP 1G4WR 2B0JA 4BJ6A 1ZVZA 4CIHA 3LAYA 5A69A 1D1CA 2HJMA 2HSQA
chains in the Genus database with same CATH topology
2A0BA 3U3BA 3MYFA 3KYIA 1SR2A 4EUKB 1Y6DA 3KYJA 1OXBA 2LD6A 1BDJB 1FR0A 1WN0A 1YVIA 1I5NA 4PACA 3US6A 3IQTA 1QSPA 4G78A 1C02A 2OOCA 1A0BA 1TQGA 2LCHA 2LP4A 2R25A 2Q4FA 1OXKA 1C03A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A0B A;  3U3B A;  3MYF A;  3KYI A;  1SR2 A;  4EUK B;  1Y6D A;  3KYJ A;  1OXB A;  2LD6 A;  1BDJ B;  1FR0 A;  1WN0 A;  1YVI A;  1I5N A;  4PAC A;  3US6 A;  3IQT A;  1QSP A;  4G78 A;  1C02 A;  2OOC A;  1A0B A;  1TQG A;  2LCH A;  2LP4 A;  2R25 A;  2Q4F A;  1OXK A;  1C03 A; 
#chains in the Genus database with same CATH topology
 4XQ1 A;  1YZA A;  2CCY A;  1R4T A;  2BL2 A;  2KW3 C;  4RD9 A;  1MMG A;  1O5H A;  3ABL C;  3G50 A;  4YN0 B;  5FZT A;  2XM4 A;  1JR8 A;  3WHN A;  4LLE A;  1H7I A;  1Z5Z A;  2EIK C;  3AOU A;  2FFH A;  2AP3 A;  3JCU Q;  2IOQ A;  3ZIB A;  5HV9 A;  3V5X A;  3EG9 B;  5D92 A;  3MFN A;  1TKN A;  3O39 A;  4RBN A;  3VRC A;  2P0N A;  2YL1 A;  1YA7 O;  4XTK A;  3K1H A;  5DLJ A;  1Q0G A;  3MYI A;  4JRZ A;  1KTM A;  2Q7R A;  4E7S A;  1EQ1 A;  2PBE A;  4YL3 A;  1TWG A;  2LFD A;  1T6U A;  2Y3D A;  2OOC A;  2YKZ A;  5A6J A;  3IHU A;  5BQH A;  3X2Q C;  2Y39 A;  1MMN A;  1YDI A;  1PV3 A;  2YLG A;  2XXA A;  4MS2 A;  1KNY A;  3JSE O;  5JUA A;  5BUO A;  1C03 A;  4AK9 A;  1H9T A;  2QE9 A;  4WAB A;  3IEE A;  4DBQ A;  5CIV A;  3SYN A;  4KBL A;  2PNO A;  2YL7 A;  1WAS A;  2XS1 A;  1JRA A;  3AQB A;  3FAP B;  4NC3 A;  3POV A;  3W2V A;  1MND A;  1OW8 A;  1TFO B;  2HKV A;  2Q9C A;  2Z15 A;  3BEH A;  3I5Q A;  3NMK A;  2R03 A;  4HFK B;  4BJ6 C;  1U89 A;  4CDV A;  4CX9 A;  1LS1 A;  3Q7L A;  3S0X A;  2A69 F;  1AVO B;  3EPV A;  4ULV A;  5AGF A;  2OEX A;  1N1C A;  1ST6 A;  2O9X A;  2DI3 A;  2CNW A;  2GDC A;  1ZHZ A;  2OKU A;  4BPM A;  1A41 A;  2E87 A;  1OCC C;  2CW0 F;  3C8G D;  3E9V A;  3SP1 A;  1PCX A;  4G7H F;  4EBK A;  4D4N A;  2J0W A;  1TWH A;  4LDQ A;  2H7V C;  1SMY F;  1OKK A;  1V55 C;  2KNH A;  2ZXO A;  1Z7Q c;  5L0F A;  2HFI A;  2PFD A;  2OEV A;  2W4B A;  3ITF A;  4YT5 A;  4LLC A;  3RH3 A;  2OJQ A;  3DJU B;  3X1O A;  2NSG A;  5A6K A;  5EGY A;  4DRJ B;  1FR0 A;  1MQV A;  3LS0 A;  3NYL A;  4H4K C;  1HE9 A;  3B0P A;  2HZ8 A;  3NYM A;  4U5F E;  2L6G A;  1L7C A;  3ZVR A;  3L1M A;  3EH1 A;  4JCZ A;  3WG7 C;  3SZR A;  2ZXR A;  3EGX B;  3EH2 A;  4MVU A;  4OIO F;  3ATP A;  4KI2 A;  3HNK A;  3C8G B;  3PCV A;  2AVK A;  4YL0 A;  4E7Z A;  2YLI A;  3KYJ A;  3QVZ A;  5E2Q A;  4NTF A;  3C8Z A;  3EFO A;  1XZQ A;  3CSK A;  1R5I D;  4PAC A;  3ASO C;  1SYQ A;  1MMA A;  1RKE B;  2NUP A;  5K0I A;  3GEE A;  4JEB A;  1OW7 A;  3U9J A;  4CJO A;  1Q0K A;  3T6J A;  3HJC A;  4Z9J A;  4YK5 A;  3ABM C;  4EWC A;  1CPQ A;  3AGT A;  1B68 A;  4U5H A;  5JVE A;  3UGP A;  2ICW G;  1GQA A;  1RJ9 A;  1TQG A;  2BE5 F;  2P6V A;  1V74 B;  1OKK D;  1YAR O;  2A1D D;  1D0X A;  3DM5 A;  3W4Y A;  2AWY A;  3NMJ A;  5T3W A;  5COF A;  2I15 A;  1YLM A;  1E86 A;  2EPK X;  2IBF A;  2L81 A;  2R9R B;  3GWN A;  2V3C C;  4EKW A;  4ONS A;  2Q3T A;  4N4W A;  4EIY A;  4W8P A;  3Q6N A;  3Q6M A;  3T6G B;  2G3V A;  3B71 A;  3IQ6 A;  4N6H A;  3G4Z A;  2EIL C;  2HMQ A;  5JP7 A;  3U2L A;  2IXO A;  2V26 A;  2VCC A;  4JTD B;  4Q7C A;  1HW1 A;  3DWW A;  1TWC A;  1H6G A;  4DRI B;  3JRT A;  4H54 A;  1ORY A;  1HW2 A;  2NSF A;  3MLG A;  4JKV A;  1LPE A;  5T1D B;  5B3S C;  1O87 A;  2XLD A;  2R7O A;  1T6I A;  1EI7 A;  4YT8 A;  5EK0 A;  1YJG A;  2Q00 A;  3LLK A;  1HY5 A;  4JJF A;  2ZXW C;  3L34 A;  1A7V A;  3OA1 A;  1FNT c;  3UR3 C;  1Z23 A;  3MBG A;  3U3B A;  3H2V A;  5DS6 A;  2VC9 A;  4DBR A;  2YQY A;  5DQZ A;  4OIQ F;  2UUH A;  4WGY A;  1ORJ A;  3IQC A;  5L3Q A;  3JRM O;  1APC A;  4MTO A;  3B0V C;  3EGD A;  1ZYR F;  4EUK B;  3U0C A;  1TWA A;  4PK4 A;  1M2O A;  2D4U A;  1VMA A;  2I8B A;  1QZX A;  3K7D A;  1A7D A;  1WGW A;  3H2U A;  2XLM A;  2PX0 A;  3EZH A;  4MVQ A;  4W8K A;  1LIH A;  1PD1 A;  1LI5 A;  2R7T A;  1M2V A;  3QW1 A;  5A6A A;  1GS9 A;  4PJJ A;  2PP4 A;  3K66 A;  2WZL A;  4J30 B;  5KYN A;  1OCR C;  2GA0 A;  3EGD B;  3RF3 A;  3EZI A;  1U0B B;  2JX0 A;  5B1B C;  1ORS C;  2P7V A;  5KYW B;  2NUP B;  1BR2 A;  5BQG A;  3HNJ A;  1LVK A;  1OXK A;  4WJ0 A;  1HE1 A;  3NMI A;  4P9F A;  3NG1 A;  4U9E A;  3V5Y A;  4A2N B;  4Z9H A;  3KL4 A;  2R7R A;  3FAJ A;  2XLO A;  1FFT C;  3CEX A;  3AGU A;  4CBE A;  3RFY A;  2R7X A;  1Y6D A;  1JAF A;  3C63 A;  1K04 A;  4KNV A;  3U3F A;  5KYU A;  2GWW A;  1IW7 F;  2WB7 A;  2XLE A;  2AU5 A;  1BR1 A;  1D0Y A;  4I3M A;  4XEF A;  1PD0 A;  1C02 A;  1FMW A;  5KYX A;  2CNW D;  256B A;  5T3T A;  3SXM A;  4CS9 A;  2BC5 A;  2Q9B A;  4MW3 A;  1YAU O;  3HLZ A;  4MVO A;  2LSE A;  3V5Z A;  5JRA A;  4U5G A;  3UMK A;  3L8I A;  1I5N A;  3R7C A;  3LUT B;  5COG A;  5D91 A;  2VAS A;  5TJ5 E;  4GYT A;  1J8M F;  2XLH A;  5F5F A;  4NTA A;  4DRH B;  3HNL A;  2ZD9 A;  2IXN A;  3ASN C;  1WAT A;  2PF4 E;  4D4X A;  1VK5 A;  2VH3 A;  4LAC B;  4YJW A;  2ASR A;  3AQC A;  1Q0F A;  1LS4 A;  4HFF B;  3OEO A;  5KYY A;  3TQO A;  3F47 A;  2QY9 A;  1Z63 A;  2M4E A;  1OXB A;  4EBB A;  5E3A A;  2LD6 A;  3DD7 A;  1BDJ B;  3AJM A;  4K7B A;  1NFN A;  4BJ1 A;  1ZU4 A;  4MW8 A;  2LQG A;  4ULW A;  4PFO A;  1C17 M;  3N2Z B;  3B29 A;  1YZC A;  4O6M A;  2RD9 A;  5L0G A;  5JSL A;  3UMI A;  2L6H A;  3VYW A;  4C7O B;  2Y3B A;  4NY3 A;  2NPU A;  5CI9 A;  1QQ3 A;  4JC7 A;  3FHD A;  5E33 A;  3AG1 C;  3W8H A;  5KYX B;  3DM9 B;  3O6X A;  2XLW A;  1NLX A;  3WAQ A;  3QMK A;  3RYL A;  3N24 A;  4IWB A;  2DB4 A;  3U5S A;  1RKE A;  1S05 A;  1RXQ A;  2CGE A;  4PFP A;  3NDB B;  3UNG C;  4DVZ A;  4EBJ A;  4CS9 C;  1V4A A;  2KQ9 A;  4IAQ A;  3SXZ A;  4OD4 A;  1OCZ C;  2VCB A;  3EHM A;  4RDA A;  3DJN B;  1XZP A;  2EPN A;  4IGG A;  5B1A C;  2J45 A;  2B0H A;  2OU6 A;  3FMS A;  5F5H A;  4AE4 A;  3LEV A;  4DVY P;  1G4U S;  3ZWI A;  5L0D A;  2FAP B;  4J7Y A;  4JIO A;  1E84 A;  2OJE D;  3KPH A;  3LS1 A;  2CDQ A;  3C62 A;  2J8W A;  3T6B A;  4Q5S F;  1V54 C;  2LFF A;  3LES A;  1ZW2 A;  1MNE A;  2YEV A;  2X51 A;  3JTL O;  3EFO B;  4U9D A;  5JT4 A;  5COM A;  1AUE A;  2C04 A;  3SXY A;  4A4A A;  1H9G A;  4X0R A;  3M15 A;  3N0T A;  4XPX A;  3VAY A;  2Q4F A;  2G3K A;  2A0B A;  3EGX A;  2WVO A;  2AWC A;  4I1O B;  4MTF A;  1M57 C;  2J7P A;  4EHP A;  1HMD A;  1DOW A;  1D0Z A;  5EHH A;  1NZE A;  2NUT A;  5FCL A;  2DYR C;  4JCH A;  3HTK C;  1NBB A;  3R2P A;  2J9V A;  3EHN A;  1GGQ A;  5KYY B;  4DJ9 A;  3ZTZ A;  2H7O A;  3C18 A;  2VB6 A;  2EIN C;  4PJM A;  2Y69 C;  3SEO A;  1WN0 A;  3I4U A;  3M79 A;  1ZZP A;  2HMZ A;  1QPU A;  1JMW A;  4HE8 D;  2XS8 A;  1GM5 A;  1O3U A;  1QSP A;  4MND A;  4QI0 A;  5A6B D;  4P6I C;  1S7Z A;  4MVM A;  1K05 A;  3AG3 C;  2EIM C;  4LDK A;  1OW6 A;  3TOM A;  1W2W A;  3U2M A;  3S9O A;  2KYH A;  4KC9 A;  1AEP A;  2L7A A;  1QKR A;  1VLS A;  1L3P A;  3MYF A;  3RQG A;  3ZC4 A;  3K1I A;  4FWV A;  4XPY A;  5DQT A;  4G7Z F;  5L0J A;  2NG1 A;  1SF8 A;  2XM0 A;  2XL4 A;  1VB5 A;  3DI5 A;  3W2W A;  4DXW A;  4O6N A;  5KYU B;  5GPG B;  1SR2 A;  1F1M A;  4IJJ A;  4C3E A;  3H65 A;  2W4M A;  2ZXP A;  3GOR A;  3NKE A;  5DS5 A;  1SZI A;  1I4Y A;  2YRF A;  3O55 A;  4KNW A;  4N06 A;  1CPR A;  1Y4C A;  2EIJ C;  4LER A;  1FFH A;  4PJL A;  4E18 A;  3LEO A;  2Q9A A;  1RJ9 B;  1T01 A;  2OCC C;  3RQF A;  3RVY A;  3QW0 A;  4BEJ A;  1CGO A;  3GAN A;  1E85 A;  1RKC A;  3DE9 A;  2J9B A;  4MVZ A;  3TJ6 A;  5DVW A;  1I4Z A;  1RMV A;  1NU9 C;  2HSB A;  3EJN A;  3F46 A;  3JSZ A;  4G0H A;  1BZ4 A;  1K40 A;  1Z3I X;  2LK4 A;  4J7T A;  4JE9 A;  4DOZ A;  3GEH A;  1A7E A;  2EPM X;  2WVQ A;  5KYW A;  3DAF A;  3KH2 A;  3S90 A;  3K33 A;  3TK0 A;  1BBH A;  3KYI A;  3UMH A;  3GM2 A;  3FVY A;  5L0C A;  1LM3 B;  4IB4 A;  2DYS C;  1NSG B;  2RSE B;  4AL1 A;  4ZLD A;  1E83 A;  1CGM E;  1M2V B;  2MHR A;  4QI2 A;  2R7S A;  3DXJ F;  3GOD A;  4IAR A;  4E17 A;  1MMD A;  2NUT B;  2UUI A;  2YL0 A;  3EQL F;  2R7V A;  4MQ9 F;  3VF0 A;  1OR2 A;  2IYL D;  3QTH A;  3S28 A;  2KSF A;  3JZ0 A;  3K1I C;  4GQH A;  4CDY A;  1LE2 A;  3E70 C;  2R7U A;  1ZHY A;  2R7W A;  4FES A;  5B3I A;  5JLI A;  1WOL A;  4HEA J;  5DS4 A;  2WZF A;  3B9Q A;  4NQF A;  4PJN A;  4ZLC A;  3SNH A;  4JJG A;  2HUJ A;  2D5R B;  1NU7 D;  1U6H A;  3DZA A;  3QVY A;  2YLD A;  1HMO A;  2J9U A;  4YWQ A;  2L9J A;  2YVK A;  3ZTM A;  4CS8 C;  3M1C B;  4U5B E;  1D1A A;  3LNM B;  1VLT A;  1ZHW A;  2XSE A;  4AE4 B;  4BEM J;  4JW1 A;  3M4B A;  2YZS A;  3A11 A;  1WWP A;  4O7G A;  3MX3 A;  4CSA C;  2YWA A;  2EPL X;  1YYX A;  3OWT A;  3KKB A;  4G7O F;  2WZG A;  2JPU A;  2OG2 A;  1ZHX A;  2YHS A;  2R02 A;  2Y3G A;  3IQ5 A;  4OD5 A;  3VM6 A;  1YA9 A;  2MWQ A;  2XLV A;  4BJ5 C;  1VYK A;  2VCA A;  1Q0D A;  4JUR I;  2TMV P;  1QLE C;  2ETS A;  4U5D E;  2J46 A;  4G78 A;  5CI8 A;  4FAP B;  1IZM A;  4YL1 A;  2MYS A;  1DOV A;  3GM3 A;  1OR3 A;  1NG1 A;  1LI7 A;  2XL6 A;  3SXK A;  1JPN A;  4JVS A;  1G8X A;  2R05 A;  3CZ6 A;  3CQZ A;  2KC3 A;  1ZHT A;  3FXH A;  3QZC A;  1TR2 A;  1FTS A;  3CAX A;  3B0U X;  1VOM A;  3EG9 A;  4JZA A;  3J06 A;  1D1B A;  3TOL A;  1JPJ A;  2HV6 A;  2QUP A;  3LJB A;  4CIP A;  1E2X A;  4QDL A;  2A6H F;  3LLI A;  4XWJ A;  4CSA A;  4NCQ A;  1OQC A;  3BRJ A;  3RIP A;  3ZSU A;  2W45 A;  2KK1 A;  2J7P D;  4K1O A;  3ECS A;  3RQE A;  3RKO F;  3I5P A;  1Q0M A;  2XL8 A;  3ZG1 A;  4C3D A;  1ZU5 A;  3T9O A;  4F4B A;  2W9Y A;  4OIP F;  1G5Z A;  3HKK A;  2OQM A;  3ZQV A;  3U8V A;  2CYD A;  3T4R A;  3AG2 C;  3L0I A;  5F28 E;  2R25 A;  4FX5 A;  4P9T A;  3TD7 A;  2KJG A;  5A6B A;  4CJG A;  4Z9I A;  2H8A A;  4MVR A;  2IXM A;  2HS5 A;  4K0D A;  4GEH A;  4CS8 A;  1WTY A;  4O6Y A;  2J9W A;  2A0U A;  3M4C A;  2H7B A;  2Y3H A;  4M63 A;  2P1A A;  4B6I A;  4OIN F;  1OCO C;  2GFH A;  4CS7 A;  3O10 A;  1QVX A;  2X0C A;  3IPM O;  4PR9 A;  3RW0 A;  2HV7 A;  2GAQ A;  2QTV A;  3A9C A;  1YVI A;  3NRH A;  1EKY A;  4WGZ A;  3US6 A;  1T5O A;  3PDM P;  1RCP A;  1T9K A;  4NTB A;  1LKX A;  2FGY A;  4OIR F;  4BJ5 A;  5L0I A;  3RVZ A;  1FMV A;  4IRU A;  2R7Q A;  4JTA B;  5HSW A;  3C8G A;  2XXA B;  3TJ5 A;  4Q4Z F;  4MTG A;  5BQI A;  1UG7 A;  2HJ3 A;  5AC5 A;  3GWL A;  2JD3 A;  2ZPA A;  4XEV A;  3U9M A;  1UFB A;  2IXP A;  3AG4 C;  4L6R A;  2KGO A;  1ZW3 A;  2PX3 A;  4XLP F;  1FAP B;  3DMD A;  3DKA A;  2M64 A;  5AC4 A;  3FOP A;  3V7O A;  2LIG A;  4C7O A;  1YYJ A;  4E0H A;  3S29 A;  1J8Y F;  4YT2 A;  4R32 A;  3FDQ A;  1NFO A;  1TFK B;  4CDA A;  4YT4 A;  1Z6A A;  2C03 A;  4O79 A;  2L6F A;  4XPW A;  1KU2 A;  1M6T A;  2YL3 A;  3DAG A;  3PMR A;  4I1M A;  4J32 B;  3UGO A;  4ANJ A;  4N6C A;  5L0H A;  1M56 C;  5JS5 A;  2LCH A;  4BG0 A;  5L3V A;  2LP4 A;  2XRH A;  4U5E E;  5E3C A;  4ER9 A;  3W8I A;  2G62 A;  3HNI A;  3ZDL A;  2DGJ A;  2EPO A;  3FOO A;  4LDR A;  1VYI A;  3GM1 A;  4MVS A;  3G4X A;  4C3B A;  2WVN A;  3S84 A;  4XLN F;  1CGN A;  3JT1 A;  2F22 A;  3Q7G A;  4UDV A;  2P61 A;  1LE4 A;  1BR4 A;  1XWJ A;  3S27 A;  4BJT A;  3GEI A;  3NYJ A;  3ZQY A;  3PHF 2;  2J0X A;  1T6Q A;  4I44 A;  4AX2 A;  4E0I A;  3JYY A;  1EA8 A;  2QNL A;  3C7J A;  2A6E F;  2QLA A;  3L8J A;  4IAO A;  1JOG A;  4JEA A;  3ABK C;  4XEK A;  4JTC B;  4U5C E;  3JYH A;  5IY5 C;  3IQT A;  3WOD F;  3K6B A;  3U8P A;  2WL8 A;  3NKD A;  2A68 F;  3TUL A;  1A0B A;  3KMI A;  3LNR A;  4AL0 A;  2IM8 A;  3DE8 A;  1VTM P;  1G4W R;  2B0J A;  4BJ6 A;  1ZVZ A;  4CIH A;  3LAY A;  5A69 A;  1D1C A;  2HJM A;  2HSQ A; 
#chains in the Genus database with same CATH homology
 2A0B A;  3U3B A;  3MYF A;  3KYI A;  1SR2 A;  4EUK B;  1Y6D A;  3KYJ A;  1OXB A;  2LD6 A;  1BDJ B;  1FR0 A;  1WN0 A;  1YVI A;  1I5N A;  4PAC A;  3US6 A;  3IQT A;  1QSP A;  4G78 A;  1C02 A;  2OOC A;  1A0B A;  1TQG A;  2LCH A;  2LP4 A;  2R25 A;  2Q4F A;  1OXK A;  1C03 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...