4G78A

Subatomic resolution crystal structure of histidine-containing phosphotransfer protein mthpt2 from medicago truncatula
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
147
structure length
137
Chain Sequence
SNAMDHLHRKLRDHEAAMFQQGYLDDQFSQLQKLQDDTSPDFVIEVMLNNMSRALEQVPVNFKQIDAHAHQQKGSSASVGAARVKNVCGTFRNFCEAQNLEGCVRCLQQLQQEYSLLKNNLKYLFKLQQEIKTAGRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histidine phosphotransfer protein
publication title Subatomic Resolution Crystal Structure of Histidine-containing Phosphotransfer Protein MtHPt2 from Medicago truncatula
rcsb
source organism Medicago truncatula
molecule tags Transferase
total genus 67
structure length 137
sequence length 147
ec nomenclature ec 2.7.3.-:
pdb deposition date 2012-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01627 Hpt Hpt domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.160 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) HPT domain 4g78A00
1OXKA 3KYJA 1A0BA 2LD6A 1I5NA 2LCHA 2OOCA 1Y6DA 2LP4A 2Q4FA 3IQTA 4PACA 1YVIA 1TQGA 1WN0A 1C02A 3U3BA 2R25A 4EUKB 1FR0A 2A0BA 3KYIA 3US6A 1C03A 1SR2A 1OXBA 3MYFA 4G78A 1QSPA 1BDJB
chains in the Genus database with same CATH superfamily
256BA 3ABLC 3HNLA 2DGJA 1V4AA 2XL4A 3CQZA 3JRTA 3SXZA 4EHPA 4OIRF 1ZU5A 3ZG1A 5A69A 4Z9JA 3LS0A 3VRCA 1YZAA 1T9KA 4C3BA 3GWLA 2MWQA 1OW6A 2R02A 1OKKD 4E18A 1ST6A 3N2ZB 5KYWA 3G4XA 1TFOB 1Z7Qc 2YEVA 4JIOA 4N4WA 1LE4A 4CSAC 3DMDA 1J8MF 4XEFA 5B3IA 3HJCA 2EIJC 1ZZPA 4NY3A 4J7YA 1Q0DA 2CGEA 5T3TA 4KNVA 4XLNF 5F5HA 3ABKC 1CGNA 3O6XA 4MW8A 1GQAA 1XZPA 2KW3C 4J32B 3T4RA 4HFFB 2LSEA 4LACB 2KQ9A 4G78A 3T9OA 2IXMA 2CCYA 2IXOA 3JZ0A 1OW7A 5HV9A 3FAJA 4DBQA 3R7CA 1WOLA 2Y3BA 3K1IC 3RW0A 4PJLA 1E83A 2XXAA 5AGFA 3NYJA 3UMKA 4C3DA 4P9FA 2WVQA 5BUOA 3SXMA 4JRZA 3PHF2 1PV3A 1RJ9B 3GODA 1A7DA 1R4TA 1TWHA 3DJUB 1M56C 2XS8A 4FESA 3AG1C 3SZRA 5KYNA 1RKCA 1DOWA 2LP4A 3LJBA 1MNEA 4NTBA 2GAQA 2OQMA 2Q4FA 1QPUA 2YZSA 4JTAB 1BR2A 2RD9A 5K0IA 2BE5F 3TQOA 4A2NB 3O39A 4FWVA 4ANJA 4K0DA 1FR0A 4JC7A 4F4BA 2J7PA 3RF3A 4U5DE 2HKVA 2PX0A 4MTGA 3AQBA 2ICWG 5CIVA 1OR2A 2HJMA 4PFOA 1EA8A 2WVNA 5L0JA 2YKZA 5HSWA 3CEXA 2J9BA 2MYSA 2ZXRA 2XL8A 4K7BA 1M2OA 4JCZA 2R03A 5B1AC 3GEHA 5KYXB 3LS1A 3C8GD 2IYLD 4YL0A 1RCPA 3UR3C 4AE4B 1I4YA 3RVYA 1CPRA 4N06A 3GM1A 3NKDA 2HV6A 4KC9A 2ZXOA 5JP7A 3CAXA 2J0WA 3AGUA 5A6BA 3KH2A 4U5BE 1U0BB 2W9YA 1M6TA 3LNMB 5AC4A 4JE9A 4E7SA 4PJMA 2HZ8A 2XLEA 3O10A 3TD7A 4DRIB 4LLEA 4O6YA 1E86A 4NTFA 2HS5A 2YHSA 3GM2A 3M4BA 4BJ1A 4EUKB 1H9GA 1NFOA 3B71A 3BEHA 3N24A 1W2WA 3CZ6A 2Z15A 1NZEA 1OQCA 3B29A 2DI3A 4LLCA 4CDYA 3MFNA 2W4MA 3LUTB 1GGQA 1LI5A 1XWJA 1JAFA 1JMWA 4DRJB 3S84A 2TMVP 1BR4A 2NUPA 1KTMA 2M4EA 1YA9A 2VCBA 4YN0B 4BEJA 5KYWB 3MYIA 3FAPB 4MVOA 2R7RA 3EGXB 3L1MA 4MVQA 3LLIA 2VC9A 2OOCA 3M4CA 1JOGA 1L3PA 2CNWD 4O6MA 3IEEA 4U5GA 1S7ZA 1RJ9A 3K66A 3IQTA 1MMNA 4XPWA 1H9TA 1QLEC 1Q0KA 1QQ3A 2IOQA 3PCVA 3L8JA 2YRFA 4U5FE 3RIPA 1ZVZA 3B9QA 2CDQA 3FMSA 1B68A 4D4XA 4KI2A 2OU6A 2KNHA 3FVYA 1EQ1A 2DYRC 2MHRA 3NMJA 4D4NA 4YL1A 1OCCC 1OXBA 2Y3GA 3U2MA 3ZDLA 2R9RB 1CPQA 1RKEB 3EHNA 3ITFA 3U0CA 3JYYA 4JEBA 4IGGA 3EG9B 5E2QA 2WL8A 1S05A 3G50A 3ZIBA 3JTLO 4I1OB 1I5NA 1BZ4A 4PFPA 5D92A 3SYNA 4AL0A 1HMDA 4MVZA 4CDVA 4EKWA 3AOUA 2VCAA 3NYMA 3EHMA 3TULA 1LS1A 3R2PA 1D1AA 2QNLA 1SMYF 3EJNA 1ORJA 4OD5A 4XEVA 2L7AA 2Q9BA 3ASOC 1QZXA 1MMGA 1T5OA 1Z5ZA 3OA1A 4MVMA 4ZLDA 3EGDB 3LEOA 5DQZA 4C3EA 5DLJA 5BQGA 1C03A 2QUPA 4E7ZA 3UGPA 4UDVA 2EINC 2Y69C 1H7IA 1ORSC 2L9JA 2Q9CA 3DM5A 3K1HA 3KL4A 2IXNA 3HTKC 4R32A 3JSZA 3L8IA 4CS8A 5EHHA 2GFHA 5L0FA 1AUEA 4YK5A 4MVUA 2PF4E 1FTSA 2J8WA 2L81A 3MLGA 3QVZA 2QTVA 2YL0A 3EGXA 1D0ZA 1OR3A 4IAOA 2Y39A 3FOPA 3DAFA 3LESA 2HMQA 3DWWA 3S28A 3VF0A 4BJ6C 4J7TA 1YYJA 3CSKA 2J7PD 2C03A 1NLXA 1G8XA 1HY5A 4L6RA 3Q7LA 1VYKA 1OCRC 1OCZC 2G62A 2AWCA 4HE8D 4PK4A 3IQ5A 1TFKB 3DD7A 1VTMP 3EZIA 1E84A 3QW0A 3RVZA 1YYXA 4MS2A 1V74B 3AJMA 3HLZA 1TWAA 4CIHA 1YZCA 3VAYA 2I15A 1C17M 1LIHA 1O3UA 5CI9A 3H65A 5GPGB 1ZHTA 2XLOA 3LNRA 4Q5SF 1NBBA 4GQHA 3EPVA 4KBLA 3EG9A 1ZW2A 5B1BC 3U8VA 4C7OB 1T6UA 1NSGB 4XQ1A 1V55C 3Q6MA 1MMAA 5F28E 2ZXWC 3ZSUA 5COMA 2WZFA 2BC5A 2O9XA 1KU2A 1MQVA 3IPMO 3X1OA 4BJ5C 3GWNA 1F1MA 3W2VA 4H54A 3GORA 1LE2A 4MTOA 5D91A 1HW2A 3US6A 4AX2A 2Q00A 1LVKA 3SXKA 2YL3A 4J30B 2ZXPA 4ER9A 2YLGA 4LDRA 1SZIA 2AP3A 3T6BA 3EGDA 2QY9A 1QSPA 3FHDA 3DE9A 4IWBA 4N6HA 2A69F 2GA0A 2XM0A 2M64A 4XWJA 1EI7A 3QVYA 1K40A 1LM3B 4I44A 1TKNA 4IB4A 4NQFA 1U89A 2EILC 4AK9A 5JUAA 3I4UA 3UGOA 1V54C 2LCHA 1D0XA 4QI2A 2NUTB 3TK0A 2A6EF 2AWYA 5A6AA 4JURI 2X51A 2ZD9A 4JTDB 4U5CE 1FNTc 2EPLX 4CIPA 5KYUB 2J46A 4K1OA 4OIQF 4OIOF 5DVWA 1Z23A 3KKBA 4GEHA 3NMKA 3TOLA 3KYIA 3E70C 4WGZA 3NDBB 1WGWA 1G5ZA 2NSFA 3NRHA 2JX0A 1VLTA 1VYIA 1ORYA 4LDKA 2H8AA 2YQYA 1NFNA 3S9OA 2XS1A 1A7VA 4OD4A 2H7BA 2HMZA 4WGYA 1ZHWA 3HNIA 4QDLA 4MQ9F 1FAPB 2R7WA 3U8PA 3Q7GA 5JVEA 5E3AA 3JSEO 4U9DA 4BJ5A 5DS6A 4BJTA 2R7QA 1Z63A 4YT4A 1Y6DA 1GM5A 2IXPA 4ULWA 4U5EE 2FFHA 4XTKA 4CS9A 4N6CA 2OCCC 2HSBA 4CBEA 3TJ6A 1M2VB 2WB7A 3ATPA 1Q0GA 2NPUA 3ABMC 4KNWA 2B0JA 4CS8C 5BQIA 3DJNB 1APCA 4JCHA 3WG7C 5KYYB 4CX9A 5DS5A 1K04A 2IM8A 5COGA 4MVRA 2A0UA 3DM9B 4JEAA 3Q6NA 1NU7D 4DXWA 2V3CC 4YJWA 1PD1A 1J8YF 2H7OA 2HFIA 2G3KA 2YLDA 1T6QA 3GEIA 3W4YA 4XLPF 3WAQA 3WHNA 5FZTA 2D4UA 2J0XA 3FOOA 1GS9A 1AVOB 4RBNA 3I5PA 5EGYA 5B3SC 3LEVA 3LAYA 3WODF 5L0DA 5T3WA 3M15A 1VLSA 4X0RA 1NG1A 5L3VA 5KYXA 1U6HA 4AE4A 1YVIA 3UMIA 1TQGA 3EFOB 2NUTA 4BEMJ 2L6FA 1A41A 2J45A 4JKVA 5TJ5E 4O7GA 1WWPA 2Y3DA 3K6BA 2Y3HA 4JVSA 3KMIA 5KYUA 4B6IA 2D5RB 4I3MA 5L0CA 2XL6A 3HNKA 2P7VA 4JTCB 4LDQA 4M63A 2XXAB 1T01A 4DVZA 1JR8A 3J06A 3C63A 2WVOA 3RQEA 3ZWIA 5JT4A 5COFA 5CI8A 2W45A 1DOVA 3PMRA 3DXJF 4G0HA 1WATA 1FFTC 3M79A 3EZHA 3DE8A 1E85A 2LQGA 3S29A 2CNWA 3QMKA 5L0GA 2JPUA 2C04A 3O55A 1YDIA 3H2UA 2A6HF 3ZTMA 4JW1A 1Q0MA 2OKUA 1WN0A 3W8HA 4CDAA 1TWCA 2J9WA 2QE9A 2RSEB 3NG1A 5EK0A 2XM4A 4EWCA 2CYDA 3IHUA 2EIMC 2A0BA 2VH3A 2XLWA 3F46A 4BPMA 1HE9A 4FAPB 1M2VA 3JYHA 1Z6AA 3QZCA 3T6GB 3SEOA 2PNOA 3V5YA 5KYYA 3NYLA 1LI7A 1KNYA 1ZHYA 4O6NA 1IZMA 1I4ZA 3KYJA 1MNDA 1R5ID 2ASRA 2XLMA 2QLAA 3IQCA 4XPYA 3ZC4A 1A0BA 4ZLCA 3S27A 5F5FA 2R7TA 1LS4A 1RKEA 2H7VC 2Q3TA 2ETSA 3DZAA 3N0TA 2A68F 4QI0A 5DS4A 1HW1A 2EPNA 5A6BD 1ZHXA 4E0IA 1E2XA 3RYLA 5E3CA 3T6JA 5L0IA 4EBBA 4PACA 2X0CA 5JLIA 2GDCA 2XRHA 2F22A 4HFKB 2CW0F 2P1AA 1BR1A 3BRJA 3AQCA 2IBFA 4E0HA 1XZQA 3K7DA 3EFOA 2NUPB 3S0XA 3C8ZA 3L34A 3AG2C 4DVYP 2R7UA 4CS9C 3ZQYA 1TR2A 1JRAA 3W8IA 1N1CA 3UMHA 2XLVA 4MVSA 3RH3A 1BDJB 3C8GB 4U5HA 4IRUA 3TJ5A 2I8BA 3V7OA 4RD9A 4EBJA 2LFFA 3F47A 2LD6A 4JJGA 2PBEA 1RXQA 1Z3IX 4Z9HA 1OCOC 3TOMA 3ECSA 4AL1A 1UG7A 3OEOA 3IQ6A 4FX5A 1QKRA 3V5ZA 1VOMA 3MX3A 3SXYA 1H6GA 1AEPA 2LK4A 1MMDA 1OKKA 2NG1A 2Q9AA 4LERA 3NKEA 5JS5A 2WZLA 3U3FA 4I1MA 4PJNA 4BG0A 4G7ZF 1NU9C 1VB5A 1CGOA 1QVXA 1UFBA 3OWTA 1RMVA 2GWWA 1FFHA 3JRMO 4IJJA 4PJJA 2KC3A 1ZU4A 1O5HA 1YJGA 1HE1A 4P9TA 2KJGA 5L0HA 4E17A 3S90A 1VK5A 4Z9IA 2EPKX 3U5SA 3U9JA 5A6KA 2V26A 3PDMP 2R05A 3AG3C 1Y4CA 3POVA 4EIYA 2ZPAA 3GEEA 4P6IC 4DOZA 2R7OA 4CSAA 1PCXA 2P0NA 5BQHA 1CGME 2FGYA 2OJED 2P61A 2LIGA 4YL3A 1ZW3A 3RKOF 3V5XA 2Q7RA 2YL7A 2B0HA 5DQTA 2OEVA 2PP4A 2JD3A 4BJ6A 4YT8A 2VB6A 3QW1A 2EPOA 3A11A 3M1CB 3EH2A 2EPMX 4A4AA 4O79A 4ONSA 2FAPB 3KPHA 3B0VC 1C02A 4W8PA 4OINF 3E9VA 1O87A 4C7OA 3VYWA 1EKYA 2BL2A 2WZGA 3K1IA 4WABA 2G3VA 5FCLA 3DKAA 3G4ZA 4WJ0A 3RQGA 3X2QC 1PD0A 1Q0FA 1LKXA 4XEKA 5A6JA 3HNJA 2NSGA 2LFDA 3HKKA 4NTAA 2VASA 1M57C 1L7CA 3GANA 3JCUQ 2HJ3A 3QTHA 4CJGA 3MYFA 5IY5C 4DBRA 4DJ9A 4IAQA 2A1DD 4U9EA 2PFDA 4W8KA 2XLDA 1ZYRF 2DYSC 3I5QA 2HSQA 3NMIA 2KGOA 1LPEA 2OG2A 3MBGA 3C8GA 4CS7A 1IW7F 3U2LA 3DI5A 3LLKA 1TWGA 5L3QA 2OEXA 2KYHA 4NCQA 4YT5A 3ZVRA 4Q4ZF 2XSEA 4XPXA 4YT2A 1JPNA 1SYQA 1YARO 4MW3A 1YAUO 5JRAA 2KSFA 4MNDA 2YWAA 2YL1A 3DAGA 3H2VA 2L6GA 3A9CA 3ZTZA 3RQFA 4H4KC 1SF8A 1YLMA 3SNHA 4RDAA 4EBKA 4DRHB 3AG4C 4Q7CA 2YVKA 1D1CA 1FMWA 2P6VA 2HV7A 4HEAJ 2UUIA 1YA7O 3U9MA 3ZQVA 1BBHA 1SR2A 2HUJA 3FXHA 1WASA 1ZHZA 4OIPF 2UUHA 2YLIA 2AVKA 2XLHA 3ASNC 3GM3A 2J9UA 4JZAA 3FDQA 1OW8A 4IARA 1JPJA 1A7EA 1OXKA 2DB4A 3EH1A 5JSLA 5E33A 2R7VA 3C7JA 5T1DB 4CJOA 2R7XA 3VM6A 3EQLF 3C18A 1D1BA 4YWQA 2E87A 4G7HF 2KK1A 3K33A 1FMVA 4MTFA 4G7OF 1G4US 2W4BA 1HMOA 3SP1A 2OJQA 5AC5A 2J9VA 1VMAA 1WTYA 3B0UX 3U3BA 2R25A 1G4WR 3JT1A 1D0YA 3AGTA 1T6IA 3B0PA 4JJFA 4PR9A 4ULVA 2R7SA 4NC3A 3UNGC 3RFYA 2PX3A 4GYTA 2EIKC 3L0IA 3W2WA 1K05A 2L6HA 2AU5A 3C62A 2VCCA
chains in the Genus database with same CATH topology
1OXKA 3KYJA 1A0BA 2LD6A 1I5NA 2LCHA 2OOCA 1Y6DA 2LP4A 2Q4FA 3IQTA 4PACA 1YVIA 1TQGA 1WN0A 1C02A 3U3BA 2R25A 4EUKB 1FR0A 2A0BA 3KYIA 3US6A 1C03A 1SR2A 1OXBA 3MYFA 4G78A 1QSPA 1BDJB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OXK A;  3KYJ A;  1A0B A;  2LD6 A;  1I5N A;  2LCH A;  2OOC A;  1Y6D A;  2LP4 A;  2Q4F A;  3IQT A;  4PAC A;  1YVI A;  1TQG A;  1WN0 A;  1C02 A;  3U3B A;  2R25 A;  4EUK B;  1FR0 A;  2A0B A;  3KYI A;  3US6 A;  1C03 A;  1SR2 A;  1OXB A;  3MYF A;  4G78 A;  1QSP A;  1BDJ B; 
#chains in the Genus database with same CATH topology
 256B A;  3ABL C;  3HNL A;  2DGJ A;  1V4A A;  2XL4 A;  3CQZ A;  3JRT A;  3SXZ A;  4EHP A;  4OIR F;  1ZU5 A;  3ZG1 A;  5A69 A;  4Z9J A;  3LS0 A;  3VRC A;  1YZA A;  1T9K A;  4C3B A;  3GWL A;  2MWQ A;  1OW6 A;  2R02 A;  1OKK D;  4E18 A;  1ST6 A;  3N2Z B;  5KYW A;  3G4X A;  1TFO B;  1Z7Q c;  2YEV A;  4JIO A;  4N4W A;  1LE4 A;  4CSA C;  3DMD A;  1J8M F;  4XEF A;  5B3I A;  3HJC A;  2EIJ C;  1ZZP A;  4NY3 A;  4J7Y A;  1Q0D A;  2CGE A;  5T3T A;  4KNV A;  4XLN F;  5F5H A;  3ABK C;  1CGN A;  3O6X A;  4MW8 A;  1GQA A;  1XZP A;  2KW3 C;  4J32 B;  3T4R A;  4HFF B;  2LSE A;  4LAC B;  2KQ9 A;  4G78 A;  3T9O A;  2IXM A;  2CCY A;  2IXO A;  3JZ0 A;  1OW7 A;  5HV9 A;  3FAJ A;  4DBQ A;  3R7C A;  1WOL A;  2Y3B A;  3K1I C;  3RW0 A;  4PJL A;  1E83 A;  2XXA A;  5AGF A;  3NYJ A;  3UMK A;  4C3D A;  4P9F A;  2WVQ A;  5BUO A;  3SXM A;  4JRZ A;  3PHF 2;  1PV3 A;  1RJ9 B;  3GOD A;  1A7D A;  1R4T A;  1TWH A;  3DJU B;  1M56 C;  2XS8 A;  4FES A;  3AG1 C;  3SZR A;  5KYN A;  1RKC A;  1DOW A;  2LP4 A;  3LJB A;  1MNE A;  4NTB A;  2GAQ A;  2OQM A;  2Q4F A;  1QPU A;  2YZS A;  4JTA B;  1BR2 A;  2RD9 A;  5K0I A;  2BE5 F;  3TQO A;  4A2N B;  3O39 A;  4FWV A;  4ANJ A;  4K0D A;  1FR0 A;  4JC7 A;  4F4B A;  2J7P A;  3RF3 A;  4U5D E;  2HKV A;  2PX0 A;  4MTG A;  3AQB A;  2ICW G;  5CIV A;  1OR2 A;  2HJM A;  4PFO A;  1EA8 A;  2WVN A;  5L0J A;  2YKZ A;  5HSW A;  3CEX A;  2J9B A;  2MYS A;  2ZXR A;  2XL8 A;  4K7B A;  1M2O A;  4JCZ A;  2R03 A;  5B1A C;  3GEH A;  5KYX B;  3LS1 A;  3C8G D;  2IYL D;  4YL0 A;  1RCP A;  3UR3 C;  4AE4 B;  1I4Y A;  3RVY A;  1CPR A;  4N06 A;  3GM1 A;  3NKD A;  2HV6 A;  4KC9 A;  2ZXO A;  5JP7 A;  3CAX A;  2J0W A;  3AGU A;  5A6B A;  3KH2 A;  4U5B E;  1U0B B;  2W9Y A;  1M6T A;  3LNM B;  5AC4 A;  4JE9 A;  4E7S A;  4PJM A;  2HZ8 A;  2XLE A;  3O10 A;  3TD7 A;  4DRI B;  4LLE A;  4O6Y A;  1E86 A;  4NTF A;  2HS5 A;  2YHS A;  3GM2 A;  3M4B A;  4BJ1 A;  4EUK B;  1H9G A;  1NFO A;  3B71 A;  3BEH A;  3N24 A;  1W2W A;  3CZ6 A;  2Z15 A;  1NZE A;  1OQC A;  3B29 A;  2DI3 A;  4LLC A;  4CDY A;  3MFN A;  2W4M A;  3LUT B;  1GGQ A;  1LI5 A;  1XWJ A;  1JAF A;  1JMW A;  4DRJ B;  3S84 A;  2TMV P;  1BR4 A;  2NUP A;  1KTM A;  2M4E A;  1YA9 A;  2VCB A;  4YN0 B;  4BEJ A;  5KYW B;  3MYI A;  3FAP B;  4MVO A;  2R7R A;  3EGX B;  3L1M A;  4MVQ A;  3LLI A;  2VC9 A;  2OOC A;  3M4C A;  1JOG A;  1L3P A;  2CNW D;  4O6M A;  3IEE A;  4U5G A;  1S7Z A;  1RJ9 A;  3K66 A;  3IQT A;  1MMN A;  4XPW A;  1H9T A;  1QLE C;  1Q0K A;  1QQ3 A;  2IOQ A;  3PCV A;  3L8J A;  2YRF A;  4U5F E;  3RIP A;  1ZVZ A;  3B9Q A;  2CDQ A;  3FMS A;  1B68 A;  4D4X A;  4KI2 A;  2OU6 A;  2KNH A;  3FVY A;  1EQ1 A;  2DYR C;  2MHR A;  3NMJ A;  4D4N A;  4YL1 A;  1OCC C;  1OXB A;  2Y3G A;  3U2M A;  3ZDL A;  2R9R B;  1CPQ A;  1RKE B;  3EHN A;  3ITF A;  3U0C A;  3JYY A;  4JEB A;  4IGG A;  3EG9 B;  5E2Q A;  2WL8 A;  1S05 A;  3G50 A;  3ZIB A;  3JTL O;  4I1O B;  1I5N A;  1BZ4 A;  4PFP A;  5D92 A;  3SYN A;  4AL0 A;  1HMD A;  4MVZ A;  4CDV A;  4EKW A;  3AOU A;  2VCA A;  3NYM A;  3EHM A;  3TUL A;  1LS1 A;  3R2P A;  1D1A A;  2QNL A;  1SMY F;  3EJN A;  1ORJ A;  4OD5 A;  4XEV A;  2L7A A;  2Q9B A;  3ASO C;  1QZX A;  1MMG A;  1T5O A;  1Z5Z A;  3OA1 A;  4MVM A;  4ZLD A;  3EGD B;  3LEO A;  5DQZ A;  4C3E A;  5DLJ A;  5BQG A;  1C03 A;  2QUP A;  4E7Z A;  3UGP A;  4UDV A;  2EIN C;  2Y69 C;  1H7I A;  1ORS C;  2L9J A;  2Q9C A;  3DM5 A;  3K1H A;  3KL4 A;  2IXN A;  3HTK C;  4R32 A;  3JSZ A;  3L8I A;  4CS8 A;  5EHH A;  2GFH A;  5L0F A;  1AUE A;  4YK5 A;  4MVU A;  2PF4 E;  1FTS A;  2J8W A;  2L81 A;  3MLG A;  3QVZ A;  2QTV A;  2YL0 A;  3EGX A;  1D0Z A;  1OR3 A;  4IAO A;  2Y39 A;  3FOP A;  3DAF A;  3LES A;  2HMQ A;  3DWW A;  3S28 A;  3VF0 A;  4BJ6 C;  4J7T A;  1YYJ A;  3CSK A;  2J7P D;  2C03 A;  1NLX A;  1G8X A;  1HY5 A;  4L6R A;  3Q7L A;  1VYK A;  1OCR C;  1OCZ C;  2G62 A;  2AWC A;  4HE8 D;  4PK4 A;  3IQ5 A;  1TFK B;  3DD7 A;  1VTM P;  3EZI A;  1E84 A;  3QW0 A;  3RVZ A;  1YYX A;  4MS2 A;  1V74 B;  3AJM A;  3HLZ A;  1TWA A;  4CIH A;  1YZC A;  3VAY A;  2I15 A;  1C17 M;  1LIH A;  1O3U A;  5CI9 A;  3H65 A;  5GPG B;  1ZHT A;  2XLO A;  3LNR A;  4Q5S F;  1NBB A;  4GQH A;  3EPV A;  4KBL A;  3EG9 A;  1ZW2 A;  5B1B C;  3U8V A;  4C7O B;  1T6U A;  1NSG B;  4XQ1 A;  1V55 C;  3Q6M A;  1MMA A;  5F28 E;  2ZXW C;  3ZSU A;  5COM A;  2WZF A;  2BC5 A;  2O9X A;  1KU2 A;  1MQV A;  3IPM O;  3X1O A;  4BJ5 C;  3GWN A;  1F1M A;  3W2V A;  4H54 A;  3GOR A;  1LE2 A;  4MTO A;  5D91 A;  1HW2 A;  3US6 A;  4AX2 A;  2Q00 A;  1LVK A;  3SXK A;  2YL3 A;  4J30 B;  2ZXP A;  4ER9 A;  2YLG A;  4LDR A;  1SZI A;  2AP3 A;  3T6B A;  3EGD A;  2QY9 A;  1QSP A;  3FHD A;  3DE9 A;  4IWB A;  4N6H A;  2A69 F;  2GA0 A;  2XM0 A;  2M64 A;  4XWJ A;  1EI7 A;  3QVY A;  1K40 A;  1LM3 B;  4I44 A;  1TKN A;  4IB4 A;  4NQF A;  1U89 A;  2EIL C;  4AK9 A;  5JUA A;  3I4U A;  3UGO A;  1V54 C;  2LCH A;  1D0X A;  4QI2 A;  2NUT B;  3TK0 A;  2A6E F;  2AWY A;  5A6A A;  4JUR I;  2X51 A;  2ZD9 A;  4JTD B;  4U5C E;  1FNT c;  2EPL X;  4CIP A;  5KYU B;  2J46 A;  4K1O A;  4OIQ F;  4OIO F;  5DVW A;  1Z23 A;  3KKB A;  4GEH A;  3NMK A;  3TOL A;  3KYI A;  3E70 C;  4WGZ A;  3NDB B;  1WGW A;  1G5Z A;  2NSF A;  3NRH A;  2JX0 A;  1VLT A;  1VYI A;  1ORY A;  4LDK A;  2H8A A;  2YQY A;  1NFN A;  3S9O A;  2XS1 A;  1A7V A;  4OD4 A;  2H7B A;  2HMZ A;  4WGY A;  1ZHW A;  3HNI A;  4QDL A;  4MQ9 F;  1FAP B;  2R7W A;  3U8P A;  3Q7G A;  5JVE A;  5E3A A;  3JSE O;  4U9D A;  4BJ5 A;  5DS6 A;  4BJT A;  2R7Q A;  1Z63 A;  4YT4 A;  1Y6D A;  1GM5 A;  2IXP A;  4ULW A;  4U5E E;  2FFH A;  4XTK A;  4CS9 A;  4N6C A;  2OCC C;  2HSB A;  4CBE A;  3TJ6 A;  1M2V B;  2WB7 A;  3ATP A;  1Q0G A;  2NPU A;  3ABM C;  4KNW A;  2B0J A;  4CS8 C;  5BQI A;  3DJN B;  1APC A;  4JCH A;  3WG7 C;  5KYY B;  4CX9 A;  5DS5 A;  1K04 A;  2IM8 A;  5COG A;  4MVR A;  2A0U A;  3DM9 B;  4JEA A;  3Q6N A;  1NU7 D;  4DXW A;  2V3C C;  4YJW A;  1PD1 A;  1J8Y F;  2H7O A;  2HFI A;  2G3K A;  2YLD A;  1T6Q A;  3GEI A;  3W4Y A;  4XLP F;  3WAQ A;  3WHN A;  5FZT A;  2D4U A;  2J0X A;  3FOO A;  1GS9 A;  1AVO B;  4RBN A;  3I5P A;  5EGY A;  5B3S C;  3LEV A;  3LAY A;  3WOD F;  5L0D A;  5T3W A;  3M15 A;  1VLS A;  4X0R A;  1NG1 A;  5L3V A;  5KYX A;  1U6H A;  4AE4 A;  1YVI A;  3UMI A;  1TQG A;  3EFO B;  2NUT A;  4BEM J;  2L6F A;  1A41 A;  2J45 A;  4JKV A;  5TJ5 E;  4O7G A;  1WWP A;  2Y3D A;  3K6B A;  2Y3H A;  4JVS A;  3KMI A;  5KYU A;  4B6I A;  2D5R B;  4I3M A;  5L0C A;  2XL6 A;  3HNK A;  2P7V A;  4JTC B;  4LDQ A;  4M63 A;  2XXA B;  1T01 A;  4DVZ A;  1JR8 A;  3J06 A;  3C63 A;  2WVO A;  3RQE A;  3ZWI A;  5JT4 A;  5COF A;  5CI8 A;  2W45 A;  1DOV A;  3PMR A;  3DXJ F;  4G0H A;  1WAT A;  1FFT C;  3M79 A;  3EZH A;  3DE8 A;  1E85 A;  2LQG A;  3S29 A;  2CNW A;  3QMK A;  5L0G A;  2JPU A;  2C04 A;  3O55 A;  1YDI A;  3H2U A;  2A6H F;  3ZTM A;  4JW1 A;  1Q0M A;  2OKU A;  1WN0 A;  3W8H A;  4CDA A;  1TWC A;  2J9W A;  2QE9 A;  2RSE B;  3NG1 A;  5EK0 A;  2XM4 A;  4EWC A;  2CYD A;  3IHU A;  2EIM C;  2A0B A;  2VH3 A;  2XLW A;  3F46 A;  4BPM A;  1HE9 A;  4FAP B;  1M2V A;  3JYH A;  1Z6A A;  3QZC A;  3T6G B;  3SEO A;  2PNO A;  3V5Y A;  5KYY A;  3NYL A;  1LI7 A;  1KNY A;  1ZHY A;  4O6N A;  1IZM A;  1I4Z A;  3KYJ A;  1MND A;  1R5I D;  2ASR A;  2XLM A;  2QLA A;  3IQC A;  4XPY A;  3ZC4 A;  1A0B A;  4ZLC A;  3S27 A;  5F5F A;  2R7T A;  1LS4 A;  1RKE A;  2H7V C;  2Q3T A;  2ETS A;  3DZA A;  3N0T A;  2A68 F;  4QI0 A;  5DS4 A;  1HW1 A;  2EPN A;  5A6B D;  1ZHX A;  4E0I A;  1E2X A;  3RYL A;  5E3C A;  3T6J A;  5L0I A;  4EBB A;  4PAC A;  2X0C A;  5JLI A;  2GDC A;  2XRH A;  2F22 A;  4HFK B;  2CW0 F;  2P1A A;  1BR1 A;  3BRJ A;  3AQC A;  2IBF A;  4E0H A;  1XZQ A;  3K7D A;  3EFO A;  2NUP B;  3S0X A;  3C8Z A;  3L34 A;  3AG2 C;  4DVY P;  2R7U A;  4CS9 C;  3ZQY A;  1TR2 A;  1JRA A;  3W8I A;  1N1C A;  3UMH A;  2XLV A;  4MVS A;  3RH3 A;  1BDJ B;  3C8G B;  4U5H A;  4IRU A;  3TJ5 A;  2I8B A;  3V7O A;  4RD9 A;  4EBJ A;  2LFF A;  3F47 A;  2LD6 A;  4JJG A;  2PBE A;  1RXQ A;  1Z3I X;  4Z9H A;  1OCO C;  3TOM A;  3ECS A;  4AL1 A;  1UG7 A;  3OEO A;  3IQ6 A;  4FX5 A;  1QKR A;  3V5Z A;  1VOM A;  3MX3 A;  3SXY A;  1H6G A;  1AEP A;  2LK4 A;  1MMD A;  1OKK A;  2NG1 A;  2Q9A A;  4LER A;  3NKE A;  5JS5 A;  2WZL A;  3U3F A;  4I1M A;  4PJN A;  4BG0 A;  4G7Z F;  1NU9 C;  1VB5 A;  1CGO A;  1QVX A;  1UFB A;  3OWT A;  1RMV A;  2GWW A;  1FFH A;  3JRM O;  4IJJ A;  4PJJ A;  2KC3 A;  1ZU4 A;  1O5H A;  1YJG A;  1HE1 A;  4P9T A;  2KJG A;  5L0H A;  4E17 A;  3S90 A;  1VK5 A;  4Z9I A;  2EPK X;  3U5S A;  3U9J A;  5A6K A;  2V26 A;  3PDM P;  2R05 A;  3AG3 C;  1Y4C A;  3POV A;  4EIY A;  2ZPA A;  3GEE A;  4P6I C;  4DOZ A;  2R7O A;  4CSA A;  1PCX A;  2P0N A;  5BQH A;  1CGM E;  2FGY A;  2OJE D;  2P61 A;  2LIG A;  4YL3 A;  1ZW3 A;  3RKO F;  3V5X A;  2Q7R A;  2YL7 A;  2B0H A;  5DQT A;  2OEV A;  2PP4 A;  2JD3 A;  4BJ6 A;  4YT8 A;  2VB6 A;  3QW1 A;  2EPO A;  3A11 A;  3M1C B;  3EH2 A;  2EPM X;  4A4A A;  4O79 A;  4ONS A;  2FAP B;  3KPH A;  3B0V C;  1C02 A;  4W8P A;  4OIN F;  3E9V A;  1O87 A;  4C7O A;  3VYW A;  1EKY A;  2BL2 A;  2WZG A;  3K1I A;  4WAB A;  2G3V A;  5FCL A;  3DKA A;  3G4Z A;  4WJ0 A;  3RQG A;  3X2Q C;  1PD0 A;  1Q0F A;  1LKX A;  4XEK A;  5A6J A;  3HNJ A;  2NSG A;  2LFD A;  3HKK A;  4NTA A;  2VAS A;  1M57 C;  1L7C A;  3GAN A;  3JCU Q;  2HJ3 A;  3QTH A;  4CJG A;  3MYF A;  5IY5 C;  4DBR A;  4DJ9 A;  4IAQ A;  2A1D D;  4U9E A;  2PFD A;  4W8K A;  2XLD A;  1ZYR F;  2DYS C;  3I5Q A;  2HSQ A;  3NMI A;  2KGO A;  1LPE A;  2OG2 A;  3MBG A;  3C8G A;  4CS7 A;  1IW7 F;  3U2L A;  3DI5 A;  3LLK A;  1TWG A;  5L3Q A;  2OEX A;  2KYH A;  4NCQ A;  4YT5 A;  3ZVR A;  4Q4Z F;  2XSE A;  4XPX A;  4YT2 A;  1JPN A;  1SYQ A;  1YAR O;  4MW3 A;  1YAU O;  5JRA A;  2KSF A;  4MND A;  2YWA A;  2YL1 A;  3DAG A;  3H2V A;  2L6G A;  3A9C A;  3ZTZ A;  3RQF A;  4H4K C;  1SF8 A;  1YLM A;  3SNH A;  4RDA A;  4EBK A;  4DRH B;  3AG4 C;  4Q7C A;  2YVK A;  1D1C A;  1FMW A;  2P6V A;  2HV7 A;  4HEA J;  2UUI A;  1YA7 O;  3U9M A;  3ZQV A;  1BBH A;  1SR2 A;  2HUJ A;  3FXH A;  1WAS A;  1ZHZ A;  4OIP F;  2UUH A;  2YLI A;  2AVK A;  2XLH A;  3ASN C;  3GM3 A;  2J9U A;  4JZA A;  3FDQ A;  1OW8 A;  4IAR A;  1JPJ A;  1A7E A;  1OXK A;  2DB4 A;  3EH1 A;  5JSL A;  5E33 A;  2R7V A;  3C7J A;  5T1D B;  4CJO A;  2R7X A;  3VM6 A;  3EQL F;  3C18 A;  1D1B A;  4YWQ A;  2E87 A;  4G7H F;  2KK1 A;  3K33 A;  1FMV A;  4MTF A;  4G7O F;  1G4U S;  2W4B A;  1HMO A;  3SP1 A;  2OJQ A;  5AC5 A;  2J9V A;  1VMA A;  1WTY A;  3B0U X;  3U3B A;  2R25 A;  1G4W R;  3JT1 A;  1D0Y A;  3AGT A;  1T6I A;  3B0P A;  4JJF A;  4PR9 A;  4ULV A;  2R7S A;  4NC3 A;  3UNG C;  3RFY A;  2PX3 A;  4GYT A;  2EIK C;  3L0I A;  3W2W A;  1K05 A;  2L6H A;  2AU5 A;  3C62 A;  2VCC A; 
#chains in the Genus database with same CATH homology
 1OXK A;  3KYJ A;  1A0B A;  2LD6 A;  1I5N A;  2LCH A;  2OOC A;  1Y6D A;  2LP4 A;  2Q4F A;  3IQT A;  4PAC A;  1YVI A;  1TQG A;  1WN0 A;  1C02 A;  3U3B A;  2R25 A;  4EUK B;  1FR0 A;  2A0B A;  3KYI A;  3US6 A;  1C03 A;  1SR2 A;  1OXB A;  3MYF A;  4G78 A;  1QSP A;  1BDJ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...