4G78A

Subatomic resolution crystal structure of histidine-containing phosphotransfer protein mthpt2 from medicago truncatula
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
147
structure length
137
Chain Sequence
SNAMDHLHRKLRDHEAAMFQQGYLDDQFSQLQKLQDDTSPDFVIEVMLNNMSRALEQVPVNFKQIDAHAHQQKGSSASVGAARVKNVCGTFRNFCEAQNLEGCVRCLQQLQQEYSLLKNNLKYLFKLQQEIKTAGRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Histidine phosphotransfer protein
publication title Subatomic Resolution Crystal Structure of Histidine-containing Phosphotransfer Protein MtHPt2 from Medicago truncatula
rcsb
source organism Medicago truncatula
total genus 67
structure length 137
sequence length 147
ec nomenclature ec 2.7.3.-:
pdb deposition date 2012-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01627 Hpt Hpt domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.160 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) HPT domain 4g78A00
2LP4A 2A0BA 4G78A 1TQGA 1BDJB 2R25A 1YVIA 3US6A 3IQTA 1QSPA 2Q4FA 1SR2A 1I5NA 1OXBA 1C03A 1FR0A 2LCHA 1C02A 3KYIA 4EUKB 1OXKA 2OOCA 2LD6A 3KYJA 3MYFA 1A0BA 3U3BA 4PACA 1WN0A 1Y6DA
chains in the Genus database with same CATH superfamily
2LP4A 3FOOA 3JTLO 5DLJA 3DD7A 2H8AA 4K1OA 2A68F 3Q6NA 5COGA 5F28E 3US6A 3WHNA 2KC3A 4HE8D 1LKXA 2L81A 4OIRF 3V7OA 3ZWIA 3C62A 2HSQA 2LCHA 5L0IA 2R7UA 1F1MA 3FOPA 1D1AA 3EZIA 4Z9IA 5L0CA 3U3FA 3Q7GA 1G5ZA 5HSWA 3B0UX 3QW0A 4CJGA 5KYNA 3L34A 2HJ3A 4YT8A 1EQ1A 2EIJC 1LM3B 4QDLA 2W4MA 1Z3IX 2JPUA 1IZMA 4G7ZF 2I15A 1AEPA 2YLGA 1H7IA 2VH3A 2R7QA 3EHMA 3T6BA 3ZDLA 2QTVA 4ZLCA 2JX0A 5JRAA 4IGGA 3EJNA 4DOZA 4WGZA 1CGNA 5L0FA 1MMDA 1VYIA 1OR3A 2H7VC 2WZFA 3FMSA 3CQZA 3IQTA 4U5CE 4U9DA 3JSEO 4D4XA 4EBKA 2IXOA 2LSEA 3DJUB 4XWJA 4AE4B 4WGYA 5FCLA 3E9VA 3F46A 1Q0FA 4U5DE 3GM1A 1FNTc 1FMWA 1J8MF 2J9WA 3I5QA 4JJFA 1LE2A 3S84A 2EINC 2Y3DA 1QVXA 4O79A 3A11A 2PF4E 2VASA 1QQ3A 4MVUA 4Z9HA 2NUTA 5A6KA 5BUOA 5BQGA 1FFTC 3RW0A 1BZ4A 2C03A 2H7BA 3PHF2 3JT1A 2WVNA 3B9QA 1B68A 1WGWA 3L8IA 4Q7CA 2LQGA 4DVYP 4MVQA 1Y6DA 2P1AA 1NSGB 3ZTMA 1JPNA 5JS5A 4UDVA 4YL3A 1ORSC 2YL1A 2DB4A 4WJ0A 1OCCC 3T4RA 2P6VA 2NUTB 1U0BB 1MMGA 3ZVRA 2AVKA 3J06A 1QKRA 3ASNC 3IQ6A 4OIQF 2OCCC 2XLOA 3KH2A 4JKVA 2KQ9A 4Z9JA 3RQGA 5DQZA 1K40A 1QLEC 3W4YA 2XL8A 4I1MA 1XWJA 3K1HA 1HE1A 4O6NA 2P7VA 3NMKA 3DE8A 3DM9B 5K0IA 1OXKA 2YL0A 4O7GA 2NSGA 2XXAB 5A69A 3VF0A 3HNIA 4YN0B 2V26A 3UNGC 4LACB 1H9TA 4OIOF 4BJ6A 2HMZA 4EBBA 5T3TA 1Q0KA 5JVEA 4KNVA 1UFBA 4BJ6C 1CPRA 1MMAA 2PNOA 3GANA 4XQ1A 5L3VA 3IQ5A 1VLTA 1XZPA 4MVRA 1LS1A 1YA9A 5A6JA 2ZXRA 3Q6MA 1MNDA 4NTAA 4CJOA 2NUPA 3JSZA 2MYSA 4U5EE 4CIPA 3POVA 4J32B 1QPUA 3M79A 4K7BA 4XEVA 1DOVA 3AJMA 3C8GD 3U8PA 2YLIA 3C7JA 4CS8C 3BRJA 4ZLDA 2CNWD 4EBJA 4MW8A 3VAYA 2Y39A 2EPMX 3R2PA 3GWNA 2VC9A 1L3PA 3TULA 4P6IC 3FXHA 3GODA 4MVMA 2Q9AA 3QMKA 5EHHA 4IAQA 2ZPAA 5CI9A 1T6QA 2NUPB 3PMRA 3MFNA 4GYTA 2XRHA 1MNEA 4BEMJ 2GAQA 4CS9C 2IXMA 4JTAB 4MTGA 4PFOA 2D5RB 3GM2A 1PV3A 3MBGA 4W8PA 4XTKA 4CDVA 4E7ZA 4G7HF 4XEFA 3SXZA 5L0HA 1CGME 3SXMA 2XL4A 3H2VA 1YZCA 5AC4A 5JUAA 4N06A 3L8JA 1YVIA 2J46A 2WVQA 1QSPA 256BA 3AG2C 4DJ9A 1D0YA 4CX9A 4F4BA 4MVSA 1OCRC 1SZIA 1TFKB 2D4UA 2R02A 3ASOC 3DM5A 3AGTA 4RDAA 2XM0A 3U2MA 4X0RA 2EIMC 2J7PA 5A6AA 2B0JA 1PCXA 4AL1A 2OOCA 5EGYA 3O10A 5L0DA 1I4ZA 2CYDA 1PD1A 4JRZA 5KYXA 3RH3A 1WTYA 4LDKA 4JJGA 3TOLA 3KL4A 5E33A 4XLNF 2CGEA 4HFFB 4MVOA 1WN0A 5JP7A 3TOMA 1T9KA 3CAXA 1GS9A 3FAJA 1OQCA 3EFOB 3G50A 4FX5A 2WZGA 4JCHA 3L0IA 1RKCA 4O6YA 3ZC4A 1NLXA 1VK5A 3AGUA 4YWQA 1FMVA 1S7ZA 4CDAA 2QE9A 3I5PA 3HJCA 3RYLA 5KYXB 2PFDA 3SNHA 3C18A 3UGPA 4YT4A 4IAOA 3DZAA 4EKWA 4H4KC 3TK0A 1D0ZA 3F47A 2IOQA 2OJQA 1XZQA 3NYLA 3B0VC 1VTMP 1HMDA 3FHDA 2L9JA 4PFPA 2ZD9A 4I3MA 2V3CC 2G3VA 2P0NA 2HV6A 3DJNB 1OW6A 5CI8A 4E7SA 1D1BA 1BR2A 3QTHA 4IRUA 3FAPB 3K1IC 5COMA 5F5HA 1JPJA 1WOLA 1KNYA 3ZQVA 1YZAA 1LI5A 4E0HA 4IJJA 2AU5A 4GQHA 4N4WA 3T6GB 5AC5A 1U89A 4JIOA 2EPKX 2EILC 2W4BA 3AG3C 3GEHA 4PJJA 4EHPA 1O87A 3S0XA 3VRCA 1YYXA 5KYYA 1BDJB 2JD3A 2QNLA 3SXKA 2XLVA 4OINF 3NMJA 3NYJA 4D4NA 2Q4FA 3KKBA 4L6RA 1I5NA 1RJ9A 2O9XA 3UMKA 4CSAC 4OIPF 3IHUA 3SXYA 3HNLA 5L3QA 1T6UA 3ABKC 2FGYA 2OG2A 4XPXA 4EWCA 4J7YA 4O6MA 3JYYA 3ABLC 4HFKB 4JURI 4N6HA 3T9OA 2MWQA 4DRIB 1ZW3A 3AG4C 1R5ID 2DGJA 2XL6A 1Z63A 5JSLA 3RFYA 5KYYB 2AWYA 1EA8A 3OWTA 4P9FA 4NTBA 1ST6A 2HZ8A 5AGFA 1GM5A 1RMVA 2YLDA 3K66A 3WG7C 1RJ9B 2HKVA 4I44A 4MTFA 4DRHB 4DBRA 1V4AA 3ITFA 4MQ9F 1ZU5A 1JOGA 3MYIA 3GEEA 4JEBA 2KSFA 4BJTA 1MQVA 3ECSA 2Q9CA 2KNHA 3W2WA 4ULVA 4A4AA 3PDMP 1K04A 1TWGA 3QVZA 2NG1A 2BL2A 3DMDA 1M6TA 4G0HA 3ZG1A 4BG0A 4C3BA 1C03A 2R7VA 5KYUA 2PP4A 2R03A 2AWCA 3RVZA 1T6IA 3HTKC 4OD4A 3DAGA 3MX3A 2XLMA 1WATA 4Q4ZF 1M56C 5B3IA 3JCUQ 3N0TA 3V5ZA 3ZSUA 4AK9A 4EUKB 1H9GA 4FWVA 5D91A 4A2NB 2YKZA 4RBNA 2OU6A 4W8KA 2HS5A 3C8GA 1K05A 2HUJA 2YVKA 2R05A 4GEHA 5KYUB 3NKDA 2DI3A 2J45A 1Q0GA 2A69F 3U9JA 2B0HA 1FAPB 2W9YA 2YRFA 1E84A 1ORYA 1E85A 2J9VA 3LNRA 4PJMA 2G62A 1Q0MA 2J0WA 1ZHZA 3DI5A 3JRTA 2FAPB 2J0XA 3AG1C 1TQGA 4G78A 2P61A 3LAYA 2XLEA 4CS8A 4J30B 1SYQA 1E86A 4MVZA 3LESA 2ZXWC 1TR2A 5DS4A 1LI7A 3C8ZA 4JZAA 1ZW2A 2EPNA 4IB4A 4LLEA 1LIHA 4PJLA 3UMHA 2ETSA 2IM8A 2KK1A 2WZLA 4H54A 4P9TA 3S29A 3U9MA 2R7SA 4LDRA 1M2VA 2HMQA 4C3DA 1LPEA 1MMNA 5D92A 3V5YA 4CS9A 5DS5A 2CW0F 2IYLD 1J8YF 1HE9A 1YJGA 2VB6A 4BJ5C 1VLSA 1VMAA 1BR1A 4HEAJ 1NU9C 3GEIA 1YA7O 3NYMA 5KYWB 3EH1A 2R7TA 3JZ0A 2BC5A 1M2VB 1CGOA 3R7CA 2A0BA 3A9CA 1KU2A 3O6XA 5DVWA 1WASA 2UUIA 4KI2A 2EPOA 1OW7A 2GDCA 1M2OA 1FFHA 2DYSC 2R9RB 5COFA 1Z5ZA 1A7VA 3SEOA 4MTOA 4YT2A 2XLWA 5A6BA 1UG7A 5BQIA 1D0XA 4IWBA 5L0JA 2VCAA 4G7OF 3AQCA 1O5HA 1YAUO 3QW1A 5EK0A 5L0GA 2KGOA 3N2ZB 2KYHA 4C7OA 2R7XA 2A1DD 4JVSA 1AUEA 2GFHA 2VCCA 1OKKD 3NDBB 3ZTZA 1NFOA 3MYFA 4KC9A 4U5GA 4XLPF 2QLAA 3DWWA 1TWCA 3EGXA 4MNDA 2YEVA 1EI7A 3JRMO 3WODF 3U8VA 1Z23A 4ANJA 2HFIA 2YHSA 3H65A 1E83A 3AOUA 2LK4A 2IBFA 3B29A 3E70C 3IQCA 4PR9A 3UR3C 4NCQA 1HMOA 2ZXOA 3W8IA 2GA0A 3CEXA 2HV7A 2YL7A 3VYWA 1TWHA 1M57C 1L7CA 4DXWA 3EGXB 3LEVA 1SR2A 1HW2A 2Q00A 3OEOA 4K0DA 2WB7A 1HY5A 4DRJB 2YQYA 2I8BA 3EH2A 2EPLX 4YT5A 1OW8A 5FZTA 3KYIA 4U5FE 1A7DA 1Z6AA 3KMIA 1PD0A 1V55C 4KNWA 4CDYA 4EIYA 1N1CA 2AP3A 2IXNA 1A7EA 1IW7F 1ORJA 2PX3A 3RVYA 4N6CA 1LVKA 4R32A 2R7OA 3K1IA 4JEAA 4U5BE 3V5XA 3W2VA 4QI2A 4U9EA 1V74B 3M4BA 4JTDB 2J7PD 3EQLF 2J9BA 2Y3HA 4JE9A 5IY5C 5DQTA 3RF3A 1QZXA 1ZZPA 2A0UA 4CSAA 5F5FA 3B0PA 3H2UA 3VM6A 3WAQA 2XLDA 3GWLA 1ZU4A 1HW1A 2BE5F 3LNMB 2TMVP 3U2LA 2E87A 4QI0A 3RIPA 2QUPA 4FAPB 5BQHA 1OCOC 2M4EA 3PCVA 4DVZA 1NFNA 1APCA 2HJMA 2ASRA 2X51A 3M4CA 5GPGB 1OCZC 3NG1A 4Q5SF 3OA1A 3UMIA 4AX2A 1Y4CA 1CPQA 2L7AA 3MLGA 1ZHYA 4AE4A 3SP1A 4PACA 2OQMA 1KTMA 3FVYA 2CDQA 1GGQA 2OKUA 3CZ6A 3SZRA 4RD9A 1Q0DA 2NSFA 3UGOA 1R4TA 3EG9A 2Q7RA 3RQFA 4E17A 3L1MA 1U6HA 3N24A 4CS7A 1NG1A 1YARO 4CIHA 2KW3C 2Y69C 4LLCA 4C3EA 3ABMC 3S90A 3W8HA 2YZSA 1SF8A 5JLIA 1BBHA 4YJWA 1YDIA 2OEXA 4CBEA 3EG9B 2YWAA 3EGDA 2M64A 1G4WR 4I1OB 3DE9A 4XEKA 4ER9A 4OD5A 3EPVA 5TJ5E 3QZCA 1ZYRF 1G8XA 1S05A 5JT4A 3FDQA 1FTSA 1H6GA 1LS4A 2ICWG 2CNWA 4JW1A 3ZIBA 4BJ1A 3I4UA 5E3AA 3DXJF 2CCYA 2XXAA 2L6FA 5E2QA 3DKAA 1OR2A 3EGDB 2LFDA 1W2WA 1I4YA 1LE4A 2L6HA 2R25A 4ONSA 2L6GA 4ULWA 5T3WA 1ZHXA 2QY9A 3IPMO 3X2QC 3C8GB 3S28A 2Q3TA 1FR0A 4YL1A 5HV9A 1JR8A 1TWAA 2PBEA 4NQFA 3TD7A 1TFOB 2XLHA 3IEEA 2G3KA 2RD9A 3SYNA 2LIGA 1WWPA 2R7RA 4BJ5A 4KBLA 2LD6A 3KYJA 5T1DB 4NY3A 3M1CB 2XM4A 1ZVZA 1V54C 1O3UA 4NTFA 5KYWA 3U3BA 1RXQA 3LJBA 4YK5A 2WL8A 5B3SC 3RQEA 1C17M 4JCZA 4M63A 1Z7Qc 3X1OA 4LERA 3HNJA 2HSBA 2Y3GA 4B6IA 2ZXPA 1OKKA 2OEVA 4PK4A 3TQOA 4DBQA 3LEOA 2J8WA 5B1AC 1NZEA 3KPHA 2C04A 3NRHA 1OXBA 2LFFA 2IXPA 2Z15A 3U5SA 1BR4A 4XPYA 3HNKA 1C02A 1A41A 2WVOA 3TJ6A 1NU7D 3AQBA 4BPMA 4WABA 4MW3A 3DAFA 2YL3A 3T6JA 4E18A 1E2XA 2Q9BA 2X0CA 5DS6A 2A6EF 2DYRC 1ZHTA 1G4US 2PX0A 2XS8A 1A0BA 1VOMA 2GWWA 3ATPA 3CSKA 3K6BA 5CIVA 1GQAA 1RKEA 2UUHA 2R7WA 2FFHA 3JYHA 3Q7LA 1T5OA 5E3CA 2H7OA 3GORA 1JMWA 3HLZA 3LUTB 3G4XA 3LLIA 3S9OA 3S27A 3GM3A 3NMIA 2F22A 1DOWA 3B71A 1AVOB 4NC3A 3NKEA 3U0CA 1JAFA 2OJED 3HKKA 3RKOF 4C7OB 1EKYA 2MHRA 2Y3BA 3EHNA 4FESA 3G4ZA 1NBBA 1RKEB 3ZQYA 3BEHA 4JTCB 2W45A 2A6HF 3LS0A 5B1BC 1SMYF 4IARA 4J7TA 2XS1A 3EZHA 1VB5A 4AL0A 2KJGA 1D1CA 4JC7A 2RSEB 3EFOA 1T01A 3QVYA 2XSEA 3O55A 4YL0A 3K7DA 2EIKC 4LDQA 1TKNA 1VYKA 3LLKA 3TJ5A 4E0IA 4PJNA 3M15A 3O39A 5A6BD 1JRAA 3LS1A 2NPUA 3C63A 4XPWA 2J9UA 4MS2A 4U5HA 1YYJA 1ZHWA 2VCBA 1RCPA 3K33A 4BEJA 1YLMA
chains in the Genus database with same CATH topology
2LP4A 2A0BA 4G78A 1TQGA 1BDJB 2R25A 1YVIA 3US6A 3IQTA 1QSPA 2Q4FA 1SR2A 1I5NA 1OXBA 1C03A 1FR0A 2LCHA 1C02A 3KYIA 4EUKB 1OXKA 2OOCA 2LD6A 3KYJA 3MYFA 1A0BA 3U3BA 4PACA 1WN0A 1Y6DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LP4 A;  2A0B A;  4G78 A;  1TQG A;  1BDJ B;  2R25 A;  1YVI A;  3US6 A;  3IQT A;  1QSP A;  2Q4F A;  1SR2 A;  1I5N A;  1OXB A;  1C03 A;  1FR0 A;  2LCH A;  1C02 A;  3KYI A;  4EUK B;  1OXK A;  2OOC A;  2LD6 A;  3KYJ A;  3MYF A;  1A0B A;  3U3B A;  4PAC A;  1WN0 A;  1Y6D A; 
#chains in the Genus database with same CATH topology
 2LP4 A;  3FOO A;  3JTL O;  5DLJ A;  3DD7 A;  2H8A A;  4K1O A;  2A68 F;  3Q6N A;  5COG A;  5F28 E;  3US6 A;  3WHN A;  2KC3 A;  4HE8 D;  1LKX A;  2L81 A;  4OIR F;  3V7O A;  3ZWI A;  3C62 A;  2HSQ A;  2LCH A;  5L0I A;  2R7U A;  1F1M A;  3FOP A;  1D1A A;  3EZI A;  4Z9I A;  5L0C A;  3U3F A;  3Q7G A;  1G5Z A;  5HSW A;  3B0U X;  3QW0 A;  4CJG A;  5KYN A;  3L34 A;  2HJ3 A;  4YT8 A;  1EQ1 A;  2EIJ C;  1LM3 B;  4QDL A;  2W4M A;  1Z3I X;  2JPU A;  1IZM A;  4G7Z F;  2I15 A;  1AEP A;  2YLG A;  1H7I A;  2VH3 A;  2R7Q A;  3EHM A;  3T6B A;  3ZDL A;  2QTV A;  4ZLC A;  2JX0 A;  5JRA A;  4IGG A;  3EJN A;  4DOZ A;  4WGZ A;  1CGN A;  5L0F A;  1MMD A;  1VYI A;  1OR3 A;  2H7V C;  2WZF A;  3FMS A;  3CQZ A;  3IQT A;  4U5C E;  4U9D A;  3JSE O;  4D4X A;  4EBK A;  2IXO A;  2LSE A;  3DJU B;  4XWJ A;  4AE4 B;  4WGY A;  5FCL A;  3E9V A;  3F46 A;  1Q0F A;  4U5D E;  3GM1 A;  1FNT c;  1FMW A;  1J8M F;  2J9W A;  3I5Q A;  4JJF A;  1LE2 A;  3S84 A;  2EIN C;  2Y3D A;  1QVX A;  4O79 A;  3A11 A;  2PF4 E;  2VAS A;  1QQ3 A;  4MVU A;  4Z9H A;  2NUT A;  5A6K A;  5BUO A;  5BQG A;  1FFT C;  3RW0 A;  1BZ4 A;  2C03 A;  2H7B A;  3PHF 2;  3JT1 A;  2WVN A;  3B9Q A;  1B68 A;  1WGW A;  3L8I A;  4Q7C A;  2LQG A;  4DVY P;  4MVQ A;  1Y6D A;  2P1A A;  1NSG B;  3ZTM A;  1JPN A;  5JS5 A;  4UDV A;  4YL3 A;  1ORS C;  2YL1 A;  2DB4 A;  4WJ0 A;  1OCC C;  3T4R A;  2P6V A;  2NUT B;  1U0B B;  1MMG A;  3ZVR A;  2AVK A;  3J06 A;  1QKR A;  3ASN C;  3IQ6 A;  4OIQ F;  2OCC C;  2XLO A;  3KH2 A;  4JKV A;  2KQ9 A;  4Z9J A;  3RQG A;  5DQZ A;  1K40 A;  1QLE C;  3W4Y A;  2XL8 A;  4I1M A;  1XWJ A;  3K1H A;  1HE1 A;  4O6N A;  2P7V A;  3NMK A;  3DE8 A;  3DM9 B;  5K0I A;  1OXK A;  2YL0 A;  4O7G A;  2NSG A;  2XXA B;  5A69 A;  3VF0 A;  3HNI A;  4YN0 B;  2V26 A;  3UNG C;  4LAC B;  1H9T A;  4OIO F;  4BJ6 A;  2HMZ A;  4EBB A;  5T3T A;  1Q0K A;  5JVE A;  4KNV A;  1UFB A;  4BJ6 C;  1CPR A;  1MMA A;  2PNO A;  3GAN A;  4XQ1 A;  5L3V A;  3IQ5 A;  1VLT A;  1XZP A;  4MVR A;  1LS1 A;  1YA9 A;  5A6J A;  2ZXR A;  3Q6M A;  1MND A;  4NTA A;  4CJO A;  2NUP A;  3JSZ A;  2MYS A;  4U5E E;  4CIP A;  3POV A;  4J32 B;  1QPU A;  3M79 A;  4K7B A;  4XEV A;  1DOV A;  3AJM A;  3C8G D;  3U8P A;  2YLI A;  3C7J A;  4CS8 C;  3BRJ A;  4ZLD A;  2CNW D;  4EBJ A;  4MW8 A;  3VAY A;  2Y39 A;  2EPM X;  3R2P A;  3GWN A;  2VC9 A;  1L3P A;  3TUL A;  4P6I C;  3FXH A;  3GOD A;  4MVM A;  2Q9A A;  3QMK A;  5EHH A;  4IAQ A;  2ZPA A;  5CI9 A;  1T6Q A;  2NUP B;  3PMR A;  3MFN A;  4GYT A;  2XRH A;  1MNE A;  4BEM J;  2GAQ A;  4CS9 C;  2IXM A;  4JTA B;  4MTG A;  4PFO A;  2D5R B;  3GM2 A;  1PV3 A;  3MBG A;  4W8P A;  4XTK A;  4CDV A;  4E7Z A;  4G7H F;  4XEF A;  3SXZ A;  5L0H A;  1CGM E;  3SXM A;  2XL4 A;  3H2V A;  1YZC A;  5AC4 A;  5JUA A;  4N06 A;  3L8J A;  1YVI A;  2J46 A;  2WVQ A;  1QSP A;  256B A;  3AG2 C;  4DJ9 A;  1D0Y A;  4CX9 A;  4F4B A;  4MVS A;  1OCR C;  1SZI A;  1TFK B;  2D4U A;  2R02 A;  3ASO C;  3DM5 A;  3AGT A;  4RDA A;  2XM0 A;  3U2M A;  4X0R A;  2EIM C;  2J7P A;  5A6A A;  2B0J A;  1PCX A;  4AL1 A;  2OOC A;  5EGY A;  3O10 A;  5L0D A;  1I4Z A;  2CYD A;  1PD1 A;  4JRZ A;  5KYX A;  3RH3 A;  1WTY A;  4LDK A;  4JJG A;  3TOL A;  3KL4 A;  5E33 A;  4XLN F;  2CGE A;  4HFF B;  4MVO A;  1WN0 A;  5JP7 A;  3TOM A;  1T9K A;  3CAX A;  1GS9 A;  3FAJ A;  1OQC A;  3EFO B;  3G50 A;  4FX5 A;  2WZG A;  4JCH A;  3L0I A;  1RKC A;  4O6Y A;  3ZC4 A;  1NLX A;  1VK5 A;  3AGU A;  4YWQ A;  1FMV A;  1S7Z A;  4CDA A;  2QE9 A;  3I5P A;  3HJC A;  3RYL A;  5KYX B;  2PFD A;  3SNH A;  3C18 A;  3UGP A;  4YT4 A;  4IAO A;  3DZA A;  4EKW A;  4H4K C;  3TK0 A;  1D0Z A;  3F47 A;  2IOQ A;  2OJQ A;  1XZQ A;  3NYL A;  3B0V C;  1VTM P;  1HMD A;  3FHD A;  2L9J A;  4PFP A;  2ZD9 A;  4I3M A;  2V3C C;  2G3V A;  2P0N A;  2HV6 A;  3DJN B;  1OW6 A;  5CI8 A;  4E7S A;  1D1B A;  1BR2 A;  3QTH A;  4IRU A;  3FAP B;  3K1I C;  5COM A;  5F5H A;  1JPJ A;  1WOL A;  1KNY A;  3ZQV A;  1YZA A;  1LI5 A;  4E0H A;  4IJJ A;  2AU5 A;  4GQH A;  4N4W A;  3T6G B;  5AC5 A;  1U89 A;  4JIO A;  2EPK X;  2EIL C;  2W4B A;  3AG3 C;  3GEH A;  4PJJ A;  4EHP A;  1O87 A;  3S0X A;  3VRC A;  1YYX A;  5KYY A;  1BDJ B;  2JD3 A;  2QNL A;  3SXK A;  2XLV A;  4OIN F;  3NMJ A;  3NYJ A;  4D4N A;  2Q4F A;  3KKB A;  4L6R A;  1I5N A;  1RJ9 A;  2O9X A;  3UMK A;  4CSA C;  4OIP F;  3IHU A;  3SXY A;  3HNL A;  5L3Q A;  1T6U A;  3ABK C;  2FGY A;  2OG2 A;  4XPX A;  4EWC A;  4J7Y A;  4O6M A;  3JYY A;  3ABL C;  4HFK B;  4JUR I;  4N6H A;  3T9O A;  2MWQ A;  4DRI B;  1ZW3 A;  3AG4 C;  1R5I D;  2DGJ A;  2XL6 A;  1Z63 A;  5JSL A;  3RFY A;  5KYY B;  2AWY A;  1EA8 A;  3OWT A;  4P9F A;  4NTB A;  1ST6 A;  2HZ8 A;  5AGF A;  1GM5 A;  1RMV A;  2YLD A;  3K66 A;  3WG7 C;  1RJ9 B;  2HKV A;  4I44 A;  4MTF A;  4DRH B;  4DBR A;  1V4A A;  3ITF A;  4MQ9 F;  1ZU5 A;  1JOG A;  3MYI A;  3GEE A;  4JEB A;  2KSF A;  4BJT A;  1MQV A;  3ECS A;  2Q9C A;  2KNH A;  3W2W A;  4ULV A;  4A4A A;  3PDM P;  1K04 A;  1TWG A;  3QVZ A;  2NG1 A;  2BL2 A;  3DMD A;  1M6T A;  4G0H A;  3ZG1 A;  4BG0 A;  4C3B A;  1C03 A;  2R7V A;  5KYU A;  2PP4 A;  2R03 A;  2AWC A;  3RVZ A;  1T6I A;  3HTK C;  4OD4 A;  3DAG A;  3MX3 A;  2XLM A;  1WAT A;  4Q4Z F;  1M56 C;  5B3I A;  3JCU Q;  3N0T A;  3V5Z A;  3ZSU A;  4AK9 A;  4EUK B;  1H9G A;  4FWV A;  5D91 A;  4A2N B;  2YKZ A;  4RBN A;  2OU6 A;  4W8K A;  2HS5 A;  3C8G A;  1K05 A;  2HUJ A;  2YVK A;  2R05 A;  4GEH A;  5KYU B;  3NKD A;  2DI3 A;  2J45 A;  1Q0G A;  2A69 F;  3U9J A;  2B0H A;  1FAP B;  2W9Y A;  2YRF A;  1E84 A;  1ORY A;  1E85 A;  2J9V A;  3LNR A;  4PJM A;  2G62 A;  1Q0M A;  2J0W A;  1ZHZ A;  3DI5 A;  3JRT A;  2FAP B;  2J0X A;  3AG1 C;  1TQG A;  4G78 A;  2P61 A;  3LAY A;  2XLE A;  4CS8 A;  4J30 B;  1SYQ A;  1E86 A;  4MVZ A;  3LES A;  2ZXW C;  1TR2 A;  5DS4 A;  1LI7 A;  3C8Z A;  4JZA A;  1ZW2 A;  2EPN A;  4IB4 A;  4LLE A;  1LIH A;  4PJL A;  3UMH A;  2ETS A;  2IM8 A;  2KK1 A;  2WZL A;  4H54 A;  4P9T A;  3S29 A;  3U9M A;  2R7S A;  4LDR A;  1M2V A;  2HMQ A;  4C3D A;  1LPE A;  1MMN A;  5D92 A;  3V5Y A;  4CS9 A;  5DS5 A;  2CW0 F;  2IYL D;  1J8Y F;  1HE9 A;  1YJG A;  2VB6 A;  4BJ5 C;  1VLS A;  1VMA A;  1BR1 A;  4HEA J;  1NU9 C;  3GEI A;  1YA7 O;  3NYM A;  5KYW B;  3EH1 A;  2R7T A;  3JZ0 A;  2BC5 A;  1M2V B;  1CGO A;  3R7C A;  2A0B A;  3A9C A;  1KU2 A;  3O6X A;  5DVW A;  1WAS A;  2UUI A;  4KI2 A;  2EPO A;  1OW7 A;  2GDC A;  1M2O A;  1FFH A;  2DYS C;  2R9R B;  5COF A;  1Z5Z A;  1A7V A;  3SEO A;  4MTO A;  4YT2 A;  2XLW A;  5A6B A;  1UG7 A;  5BQI A;  1D0X A;  4IWB A;  5L0J A;  2VCA A;  4G7O F;  3AQC A;  1O5H A;  1YAU O;  3QW1 A;  5EK0 A;  5L0G A;  2KGO A;  3N2Z B;  2KYH A;  4C7O A;  2R7X A;  2A1D D;  4JVS A;  1AUE A;  2GFH A;  2VCC A;  1OKK D;  3NDB B;  3ZTZ A;  1NFO A;  3MYF A;  4KC9 A;  4U5G A;  4XLP F;  2QLA A;  3DWW A;  1TWC A;  3EGX A;  4MND A;  2YEV A;  1EI7 A;  3JRM O;  3WOD F;  3U8V A;  1Z23 A;  4ANJ A;  2HFI A;  2YHS A;  3H65 A;  1E83 A;  3AOU A;  2LK4 A;  2IBF A;  3B29 A;  3E70 C;  3IQC A;  4PR9 A;  3UR3 C;  4NCQ A;  1HMO A;  2ZXO A;  3W8I A;  2GA0 A;  3CEX A;  2HV7 A;  2YL7 A;  3VYW A;  1TWH A;  1M57 C;  1L7C A;  4DXW A;  3EGX B;  3LEV A;  1SR2 A;  1HW2 A;  2Q00 A;  3OEO A;  4K0D A;  2WB7 A;  1HY5 A;  4DRJ B;  2YQY A;  2I8B A;  3EH2 A;  2EPL X;  4YT5 A;  1OW8 A;  5FZT A;  3KYI A;  4U5F E;  1A7D A;  1Z6A A;  3KMI A;  1PD0 A;  1V55 C;  4KNW A;  4CDY A;  4EIY A;  1N1C A;  2AP3 A;  2IXN A;  1A7E A;  1IW7 F;  1ORJ A;  2PX3 A;  3RVY A;  4N6C A;  1LVK A;  4R32 A;  2R7O A;  3K1I A;  4JEA A;  4U5B E;  3V5X A;  3W2V A;  4QI2 A;  4U9E A;  1V74 B;  3M4B A;  4JTD B;  2J7P D;  3EQL F;  2J9B A;  2Y3H A;  4JE9 A;  5IY5 C;  5DQT A;  3RF3 A;  1QZX A;  1ZZP A;  2A0U A;  4CSA A;  5F5F A;  3B0P A;  3H2U A;  3VM6 A;  3WAQ A;  2XLD A;  3GWL A;  1ZU4 A;  1HW1 A;  2BE5 F;  3LNM B;  2TMV P;  3U2L A;  2E87 A;  4QI0 A;  3RIP A;  2QUP A;  4FAP B;  5BQH A;  1OCO C;  2M4E A;  3PCV A;  4DVZ A;  1NFN A;  1APC A;  2HJM A;  2ASR A;  2X51 A;  3M4C A;  5GPG B;  1OCZ C;  3NG1 A;  4Q5S F;  3OA1 A;  3UMI A;  4AX2 A;  1Y4C A;  1CPQ A;  2L7A A;  3MLG A;  1ZHY A;  4AE4 A;  3SP1 A;  4PAC A;  2OQM A;  1KTM A;  3FVY A;  2CDQ A;  1GGQ A;  2OKU A;  3CZ6 A;  3SZR A;  4RD9 A;  1Q0D A;  2NSF A;  3UGO A;  1R4T A;  3EG9 A;  2Q7R A;  3RQF A;  4E17 A;  3L1M A;  1U6H A;  3N24 A;  4CS7 A;  1NG1 A;  1YAR O;  4CIH A;  2KW3 C;  2Y69 C;  4LLC A;  4C3E A;  3ABM C;  3S90 A;  3W8H A;  2YZS A;  1SF8 A;  5JLI A;  1BBH A;  4YJW A;  1YDI A;  2OEX A;  4CBE A;  3EG9 B;  2YWA A;  3EGD A;  2M64 A;  1G4W R;  4I1O B;  3DE9 A;  4XEK A;  4ER9 A;  4OD5 A;  3EPV A;  5TJ5 E;  3QZC A;  1ZYR F;  1G8X A;  1S05 A;  5JT4 A;  3FDQ A;  1FTS A;  1H6G A;  1LS4 A;  2ICW G;  2CNW A;  4JW1 A;  3ZIB A;  4BJ1 A;  3I4U A;  5E3A A;  3DXJ F;  2CCY A;  2XXA A;  2L6F A;  5E2Q A;  3DKA A;  1OR2 A;  3EGD B;  2LFD A;  1W2W A;  1I4Y A;  1LE4 A;  2L6H A;  2R25 A;  4ONS A;  2L6G A;  4ULW A;  5T3W A;  1ZHX A;  2QY9 A;  3IPM O;  3X2Q C;  3C8G B;  3S28 A;  2Q3T A;  1FR0 A;  4YL1 A;  5HV9 A;  1JR8 A;  1TWA A;  2PBE A;  4NQF A;  3TD7 A;  1TFO B;  2XLH A;  3IEE A;  2G3K A;  2RD9 A;  3SYN A;  2LIG A;  1WWP A;  2R7R A;  4BJ5 A;  4KBL A;  2LD6 A;  3KYJ A;  5T1D B;  4NY3 A;  3M1C B;  2XM4 A;  1ZVZ A;  1V54 C;  1O3U A;  4NTF A;  5KYW A;  3U3B A;  1RXQ A;  3LJB A;  4YK5 A;  2WL8 A;  5B3S C;  3RQE A;  1C17 M;  4JCZ A;  4M63 A;  1Z7Q c;  3X1O A;  4LER A;  3HNJ A;  2HSB A;  2Y3G A;  4B6I A;  2ZXP A;  1OKK A;  2OEV A;  4PK4 A;  3TQO A;  4DBQ A;  3LEO A;  2J8W A;  5B1A C;  1NZE A;  3KPH A;  2C04 A;  3NRH A;  1OXB A;  2LFF A;  2IXP A;  2Z15 A;  3U5S A;  1BR4 A;  4XPY A;  3HNK A;  1C02 A;  1A41 A;  2WVO A;  3TJ6 A;  1NU7 D;  3AQB A;  4BPM A;  4WAB A;  4MW3 A;  3DAF A;  2YL3 A;  3T6J A;  4E18 A;  1E2X A;  2Q9B A;  2X0C A;  5DS6 A;  2A6E F;  2DYR C;  1ZHT A;  1G4U S;  2PX0 A;  2XS8 A;  1A0B A;  1VOM A;  2GWW A;  3ATP A;  3CSK A;  3K6B A;  5CIV A;  1GQA A;  1RKE A;  2UUH A;  2R7W A;  2FFH A;  3JYH A;  3Q7L A;  1T5O A;  5E3C A;  2H7O A;  3GOR A;  1JMW A;  3HLZ A;  3LUT B;  3G4X A;  3LLI A;  3S9O A;  3S27 A;  3GM3 A;  3NMI A;  2F22 A;  1DOW A;  3B71 A;  1AVO B;  4NC3 A;  3NKE A;  3U0C A;  1JAF A;  2OJE D;  3HKK A;  3RKO F;  4C7O B;  1EKY A;  2MHR A;  2Y3B A;  3EHN A;  4FES A;  3G4Z A;  1NBB A;  1RKE B;  3ZQY A;  3BEH A;  4JTC B;  2W45 A;  2A6H F;  3LS0 A;  5B1B C;  1SMY F;  4IAR A;  4J7T A;  2XS1 A;  3EZH A;  1VB5 A;  4AL0 A;  2KJG A;  1D1C A;  4JC7 A;  2RSE B;  3EFO A;  1T01 A;  3QVY A;  2XSE A;  3O55 A;  4YL0 A;  3K7D A;  2EIK C;  4LDQ A;  1TKN A;  1VYK A;  3LLK A;  3TJ5 A;  4E0I A;  4PJN A;  3M15 A;  3O39 A;  5A6B D;  1JRA A;  3LS1 A;  2NPU A;  3C63 A;  4XPW A;  2J9U A;  4MS2 A;  4U5H A;  1YYJ A;  1ZHW A;  2VCB A;  1RCP A;  3K33 A;  4BEJ A;  1YLM A; 
#chains in the Genus database with same CATH homology
 2LP4 A;  2A0B A;  4G78 A;  1TQG A;  1BDJ B;  2R25 A;  1YVI A;  3US6 A;  3IQT A;  1QSP A;  2Q4F A;  1SR2 A;  1I5N A;  1OXB A;  1C03 A;  1FR0 A;  2LCH A;  1C02 A;  3KYI A;  4EUK B;  1OXK A;  2OOC A;  2LD6 A;  3KYJ A;  3MYF A;  1A0B A;  3U3B A;  4PAC A;  1WN0 A;  1Y6D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...