3U9MA

Structure of reduced human fbxl5 hemerythrin like domain
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
157
structure length
157
Chain Sequence
FPEEVDVFTAPHWRMKQLVGLYCDKLSKTNFSNNNDFRALLQSLYATFKEFKMHEQIENEYIIGLLQQRSQTIYNVHSDNKLSEMLSLFEKGLKNVKNEYEQLNYAKQLKERLEAFTRDFLPHMKEEEEVFQPMLMEYFTYEELKDIKKKVIAQHCS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords F-box/LRR-repeat protein 5
publication title The Structural Basis of Iron Sensing by the Human F-box Protein FBXL5.
pubmed doi rcsb
source organism Homo sapiens
total genus 72
structure length 157
sequence length 157
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2011-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01814 Hemerythrin Hemerythrin HHE cation binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.520 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) nmb1532 protein domain like 3u9mA00
2P0NA 3CAXA 3V5YA 3U9MA 3U9JA 3V5ZA 3V5XA
chains in the Genus database with same CATH superfamily
1YVIA 2OJQA 1NU9C 4LDRA 4F4BA 5KYWA 2ZXOA 3ECSA 1F1MA 3F46A 3EHNA 2A68F 2Z15A 2DB4A 3LNMB 3N0TA 3QMKA 1TWAA 1E84A 1VTMP 4N6HA 3ASNC 3DWWA 1JAFA 1XZPA 4FX5A 3KMIA 3J06A 2Y3HA 4KNVA 1MQVA 4EBJA 1FFTC 2CGEA 2J7PD 3ZQVA 3U9MA 1LPEA 1VYKA 2VCBA 3IPMO 4DVYP 4ZLCA 5HSWA 3CQZA 3QVYA 2YWAA 3HKKA 3RQGA 4C3EA 2HZ8A 2ETSA 2J0WA 1R5ID 2CCYA 2YRFA 1C17M 1C03A 1TR2A 1ZU4A 2FGYA 3U0CA 3SXZA 3W2VA 3LAYA 2KGOA 4X0RA 1MMNA 3RQFA 2DI3A 1YYJA 2IXOA 3TOMA 1G8XA 3EG9A 1HE1A 2EPOA 3GM2A 5BQGA 1ST6A 3OEOA 3ATPA 1QKRA 1ZYRF 1LE2A 2VB6A 3IQ6A 1PCXA 2WVNA 3ZDLA 4ANJA 2L9JA 2J9WA 4YL0A 3S27A 2QE9A 3H2UA 3NYJA 2Q9BA 5KYUB 3PHF2 2A0BA 3HNLA 3B29A 5DLJA 3AQBA 3RH3A 3EZHA 3U9JA 1TWHA 1M2OA 2XLWA 3AG1C 4YL1A 3RKOF 3MYFA 3M4CA 3O55A 4JTDB 4J7YA 2A69F 2X0CA 3T4RA 3POVA 2A0UA 4PJMA 2VCAA 2KK1A 1FAPB 4DVZA 4ULWA 2ZXRA 5F5HA 1MMAA 4NC3A 5KYNA 2J7PA 4YN0B 3RIPA 4YT4A 4YT8A 1S7ZA 3VYWA 3WAQA 2GWWA 1SF8A 1YDIA 1BR2A 1SZIA 3HNJA 2YLDA 3C8GB 2CDQA 3KL4A 4RDAA 3QTHA 3RFYA 2C04A 3C8GD 1MNEA 1RKEB 1HMDA 2A6EF 2PNOA 1WN0A 3LNRA 1IZMA 2ZXPA 4K1OA 1Q0DA 5COMA 2QLAA 4UDVA 3SZRA 3DMDA 4BJTA 2E87A 5B3SC 1CPRA 4G0HA 5CI8A 3RF3A 1V55C 2H8AA 1J8MF 3HTKC 4RBNA 4JCZA 2IXMA 3A11A 3ASOC 3L34A 4XPXA 4CSAC 4C7OB 5KYUA 5L0CA 3TK0A 4BJ6A 4EBKA 1I4ZA 4LLCA 3BEHA 4PFPA 2Q4FA 1AVOB 1HW2A 4PJJA 1OW8A 3W8HA 2P7VA 2YVKA 4U5CE 3EZIA 2R7SA 2I15A 2EPMX 1Q0FA 1QZXA 3E9VA 5BUOA 1D1AA 1G4WR 1M6TA 4JVSA 4NY3A 3ZVRA 4P6IC 2OCCC 3LS0A 2Y3BA 1XZQA 4O79A 4XEFA 4EWCA 3CEXA 4OIRF 3UGPA 1LM3B 3NG1A 4XWJA 1BDJB 1PD0A 3NMIA 3C8GA 4LERA 1WWPA 5D92A 4D4XA 1R4TA 5AGFA 1OCZC 1RCPA 4G7OF 2XL6A 4XQ1A 4ZLDA 4E18A 2IBFA 3IQ5A 1FMWA 3MBGA 3F47A 4W8PA 3ZWIA 5K0IA 4XPWA 1Q0GA 1JPNA 3AOUA 3C8ZA 2VASA 3JCUQ 2NUTB 4DOZA 2A1DD 1NLXA 3K66A 4JEBA 4CS9A 2W9YA 5A6JA 1FNTc 2J9BA 2XLMA 3EPVA 2ZXWC 1E83A 4C7OA 1YJGA 3DKAA 3U8PA 4C3BA 3GORA 3HLZA 3SXYA 2XRHA 4CX9A 4OIOF 3CAXA 2YHSA 3C7JA 4PJLA 4HEAJ 1ZHZA 3IEEA 5DS4A 2QNLA 4P9FA 2XLEA 3U2LA 5JUAA 2Y3DA 3NMJA 4Z9IA 1HY5A 1KU2A 3I4UA 2LD6A 4XEVA 2A6HF 3FXHA 3U8VA 3VF0A 2J9UA 3AG2C 4R32A 2YQYA 4D4NA 1Z63A 4WJ0A 1I5NA 4JURI 1K04A 1UFBA 3LS1A 2ICWG 5A6BD 1Z3IX 2B0JA 2XLDA 1OXKA 5FZTA 4BPMA 4JTCB 2L81A 3MLGA 3TULA 3SXMA 2R05A 1S05A 2D4UA 5F5FA 2XM0A 2J46A 3L8JA 4JTAB 1QQ3A 2Y69C 1G4US 4KBLA 5FCLA 2YEVA 3EFOB 1TKNA 2Q3TA 4J7TA 2J45A 4YL3A 4JKVA 3UGOA 2NPUA 4HFFB 2NUTA 3SXKA 5CIVA 2EPNA 1O5HA 1OR2A 1NFNA 3AG4C 3SEOA 1Q0KA 3UMIA 3ITFA 1SYQA 4GEHA 2ASRA 1ORYA 4N6CA 1T01A 4Q5SF 3JRTA 2B0HA 4ER9A 4Z9JA 2GFHA 3FDQA 5L3QA 3M1CB 3K1IC 1EQ1A 3M79A 3OA1A 4O6MA 1K05A 1RMVA 4YWQA 2R7QA 1Z7Qc 2EIMC 1A0BA 3KPHA 4B6IA 2W4BA 3LEVA 2UUIA 3T6JA 1YZCA 3SP1A 4E7SA 2H7OA 2JPUA 4OINF 1CGME 2AWYA 1Z6AA 5A6BA 1JPJA 2HJMA 1H6GA 2Y3GA 2P1AA 3QVZA 3TOLA 3IHUA 3MX3A 1D0YA 2AP3A 4CIHA 4K0DA 1CGOA 2NSGA 3LJBA 2KNHA 2CW0F 2IXNA 4MVMA 4HE8D 1QSPA 2HFIA 1VLSA 1WATA 1ZVZA 2XLVA 4LDQA 2F22A 3DXJF 2YL1A 3G4ZA 3G50A 2EPKX 2G62A 1LI7A 2IYLD 1V4AA 3EFOA 3KKBA 3LUTB 4JRZA 3ZQYA 5L0GA 1BZ4A 2LIGA 3Q7GA 1AUEA 3DI5A 2WL8A 1FR0A 2PF4E 3NKEA 4LACB 3ZTMA 5A69A 1TFKB 1ZZPA 5COFA 4EKWA 3ABKC 2WB7A 2PFDA 3CZ6A 1L3PA 3DM5A 3GEIA 3N2ZB 2YZSA 2I8BA 3S28A 3GM1A 4IAOA 2VCCA 4JW1A 4ULVA 1BBHA 3EGDB 4LLEA 4Z9HA 5L0HA 1DOVA 2LSEA 1M57C 3NMKA 3UR3C 3L8IA 4Q7CA 4IJJA 5BQHA 2CYDA 3UMKA 4CDAA 1YA9A 3N24A 1T5OA 2GDCA 2R02A 3MFNA 1D0ZA 4BJ6C 1RXQA 2W4MA 1N1CA 3AGTA 1ORJA 3W4YA 2Q9CA 2AU5A 3TJ5A 2MHRA 1W2WA 2KW3C 4W8KA 4E7ZA 2ZD9A 3L0IA 1LS1A 4CS8A 5D91A 1YARO 4BJ5A 5JLIA 1FTSA 1HW1A 2RD9A 3JT1A 4U9DA 3I5PA 1GS9A 3Q6MA 4MQ9F 5L0DA 1LS4A 3U3FA 4AL1A 2R7TA 3DE9A 2XSEA 1V54C 4WGYA 1OXBA 1OCOC 1WOLA 4MVZA 5TJ5E 2NUPB 2MYSA 3M15A 4U5GA 3RVYA 3GWNA 3SNHA 4CJOA 4IWBA 2R03A 5EK0A 2QUPA 2KJGA 3PCVA 1B68A 2HUJA 4M63A 4BJ1A 1GM5A 3IQCA 4L6RA 3B71A 4NQFA 1A7DA 5L0JA 1ZHYA 3GM3A 1JOGA 2XLHA 3I5QA 4I1MA 4BG0A 1ZHWA 3EGDA 3O10A 3RYLA 4MS2A 4P9TA 1U6HA 3JTLO 1BR4A 2JX0A 1GGQA 3IQTA 1A41A 3S90A 2R7RA 3X1OA 4J32B 3MYIA 4H4KC 1YLMA 2NG1A 2FFHA 3GEEA 1GQAA 4QI0A 3GEHA 2HS5A 3KYJA 4MTGA 2IXPA 3NDBB 4MVRA 3DM9B 2XS1A 3FVYA 256BA 1QVXA 1SR2A 5CI9A 4QDLA 2R7VA 3U5SA 4OIQF 3AJMA 3US6A 3WG7C 4KI2A 2V3CC 3EH1A 2VC9A 5JS5A 1PV3A 4PR9A 4PK4A 4XLNF 2JD3A 3JZ0A 3QW0A 3ZSUA 1MNDA 1LIHA 3DZAA 4A4AA 2OQMA 4XEKA 1Z23A 2EIKC 2EILC 1EKYA 1RKCA 2NUPA 2XL8A 2FAPB 2YLGA 3JSZA 1G5ZA 4PFOA 4CJGA 2TMVP 3FMSA 2LFDA 1H7IA 2WVOA 2OKUA 3LLKA 3V7OA 2R7XA 5F28E 2HV7A 4RD9A 4IARA 1OW7A 4MW8A 3TQOA 3V5YA 3W8IA 4CS9C 4K7BA 2PBEA 3KYIA 2HJ3A 1NG1A 2M64A 5E2QA 2BC5A 4O6NA 2P6VA 1U89A 2XS8A 1XWJA 4CBEA 1M2VB 2OU6A 1TWGA 4LDKA 2OOCA 5GPGB 3VM6A 1KTMA 3DJUB 1D1BA 4DRJB 1D1CA 2HMQA 4MVUA 2XXAB 3H65A 1TWCA 5B3IA 1BR1A 5DS6A 2L7AA 4H54A 3K7DA 3R2PA 2ZPAA 4MVQA 5E33A 4KNWA 1H9TA 2OEXA 4IAQA 1A7EA 5EGYA 3RQEA 3S9OA 1A7VA 2YKZA 5HV9A 3HNIA 3K1IA 4NTBA 2J8WA 5KYYB 4KC9A 3T9OA 3PMRA 5T1DB 3L1MA 5B1AC 1ZU5A 3LEOA 4YT5A 4EIYA 1NSGB 3WHNA 3DAFA 3DAGA 2AWCA 4BEJA 3K6BA 1EI7A 3C18A 4U9EA 4JZAA 4XTKA 3U2MA 3WODF 1ORSC 1JRAA 3DE8A 3EGXB 3B0UX 3NYMA 3ZG1A 5DS5A 4EHPA 4E17A 4DBRA 1E85A 2WZLA 5T3WA 1E86A 5L3VA 3FHDA 1FFHA 1MMGA 1O87A 2AVKA 1LI5A 3HJCA 2IOQA 2P0NA 1M2VA 3JSEO 4MTOA 4EUKB 5B1BC 4DRHB 2EINC 1D0XA 4FWVA 4WABA 2X51A 4MVOA 1AEPA 2GA0A 5DQTA 4CDYA 3AGUA 5IY5C 4AE4B 2HSBA 4CDVA 4XLPF 2XXAA 3FOOA 1YAUO 2WZGA 1V74B 3EJNA 1KNYA 3GANA 4JE9A 5JSLA 1T6IA 4YJWA 1JMWA 3ZIBA 2OJED 3LESA 4XPYA 1ZW3A 3EH2A 1PD1A 1RJ9B 3SYNA 4G7ZF 1OR3A 3M4BA 1Q0MA 1WGWA 4G78A 2HSQA 4GQHA 3Q7LA 1LVKA 3B0PA 2NSFA 4N4WA 2J0XA 4U5BE 3RVZA 5KYXB 2BE5F 1ZHTA 4JIOA 3V5ZA 1DOWA 1ZW2A 2KYHA 1Y6DA 2EIJC 2XL4A 3B9QA 3DJNB 1T6QA 1I4YA 5DVWA 3Q6NA 3KH2A 5T3TA 3U3BA 3R7CA 2LFFA 3BRJA 2DYRC 2KSFA 1APCA 2QY9A 3EGXA 3QZCA 3UMHA 3OWTA 4I1OB 1H9GA 1VK5A 4DRIB 1L7CA 2YL0A 4CSAA 3H2VA 4ONSA 1YA7O 4NTAA 4YT2A 2LP4A 2R9RB 5JP7A 2J9VA 2V26A 3E70C 2DYSC 4MTFA 4IGGA 2QTVA 4EBBA 2GAQA 1J8YF 1C02A 3TJ6A 3T6BA 3EHMA 3K33A 1OKKD 1Y4CA 3G4XA 2CNWD 2PX3A 4AE4A 3LLIA 2L6GA 2OG2A 4JJGA 1NFOA 1SMYF 2UUHA 4JJFA 3T6GB 4G7HF 1CGNA 2BL2A 1HMOA 5BQIA 1EA8A 1VB5A 4I3MA 2H7BA 1OQCA 3GODA 1RJ9A 2O9XA 4NTFA 2WVQA 3TD7A 4MW3A 3NKDA 5DQZA 4CS8C 2YL7A 4AX2A 4BJ5C 1NU7D 3JYYA 4HFKB 5E3AA 4PJNA 2HMZA 3V5XA 2R7UA 4J30B 4I44A 3S29A 2R7OA 3O6XA 4DXWA 3ABMC 2MWQA 3NYLA 4CS7A 5KYXA 3C62A 2LK4A 2Q00A 3VAYA 5KYYA 1WASA 3A9CA 2XM4A 1HE9A 3DD7A 2Q9AA 4GYTA 3ABLC 3X2QC 5A6KA 2KC3A 2VH3A 5AC4A 3RW0A 2P61A 3O39A 1K40A 4O7GA 3FOPA 3K1HA 1QPUA 4N06A 2Q7RA 1T9KA 2H7VC 2HV6A 3C63A 4MVSA 3AQCA 2DGJA 2HKVA 2PP4A 4AK9A 1JR8A 3FAPB 2G3KA 1UG7A 2WZFA 2XLOA 2R7WA 1OKKA 2CNWA 3JRMO 4FESA 5L0FA 5L0IA 1VMAA 1Z5ZA 4A2NB 2L6FA 1RKEA 2PX0A 4IRUA 4JEAA 5A6AA 1T6UA 2M4EA 1YZAA 2KQ9A 2YLIA 4PACA 2D5RB 3W2WA 3ZC4A 4OIPF 1QLEC 5JT4A 5KYWB 4U5DE 5JRAA 3PDMP 1O3UA 4IB4A 2Y39A 4U5EE 2LCHA 1E2XA 3QW1A 4DBQA 4QI2A 3ZTZA 2LQGA 4OD5A 3EQLF 3NRHA 1FMVA 1VOMA 4FAPB 3FAJA 4C3DA 3S84A 4OD4A 3HNKA 2OEVA 1TQGA 4WGZA 2R25A 4Q4ZF 2IM8A 3UNGC 4JC7A 1WTYA 4O6YA 2L6HA 5E3CA 3AG3C 1NBBA 4U5HA 3B0VC 4NCQA 5JVEA 4AL0A 3GWLA 4E0HA 1MMDA 1U0BB 1IW7F 2YL3A 1LKXA 4JCHA 2C03A 2RSEB 5EHHA 4CIPA 3S0XA 1TFOB 3VRCA 1LE4A 2EPLX 3CSKA 3JYHA 4BEMJ 1OW6A 3EG9B 4MNDA 5COGA 4E0IA 1ZHXA 2W45A 1NZEA 4DJ9A 4U5FE 1CPQA 1VLTA 4YK5A 2G3VA 1OCCC 5AC5A 1VYIA 1M56C 1OCRC 1YYXA
chains in the Genus database with same CATH topology
2P0NA 3CAXA 3V5YA 3U9MA 3U9JA 3V5ZA 3V5XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P0N A;  3CAX A;  3V5Y A;  3U9M A;  3U9J A;  3V5Z A;  3V5X A; 
#chains in the Genus database with same CATH topology
 1YVI A;  2OJQ A;  1NU9 C;  4LDR A;  4F4B A;  5KYW A;  2ZXO A;  3ECS A;  1F1M A;  3F46 A;  3EHN A;  2A68 F;  2Z15 A;  2DB4 A;  3LNM B;  3N0T A;  3QMK A;  1TWA A;  1E84 A;  1VTM P;  4N6H A;  3ASN C;  3DWW A;  1JAF A;  1XZP A;  4FX5 A;  3KMI A;  3J06 A;  2Y3H A;  4KNV A;  1MQV A;  4EBJ A;  1FFT C;  2CGE A;  2J7P D;  3ZQV A;  3U9M A;  1LPE A;  1VYK A;  2VCB A;  3IPM O;  4DVY P;  4ZLC A;  5HSW A;  3CQZ A;  3QVY A;  2YWA A;  3HKK A;  3RQG A;  4C3E A;  2HZ8 A;  2ETS A;  2J0W A;  1R5I D;  2CCY A;  2YRF A;  1C17 M;  1C03 A;  1TR2 A;  1ZU4 A;  2FGY A;  3U0C A;  3SXZ A;  3W2V A;  3LAY A;  2KGO A;  4X0R A;  1MMN A;  3RQF A;  2DI3 A;  1YYJ A;  2IXO A;  3TOM A;  1G8X A;  3EG9 A;  1HE1 A;  2EPO A;  3GM2 A;  5BQG A;  1ST6 A;  3OEO A;  3ATP A;  1QKR A;  1ZYR F;  1LE2 A;  2VB6 A;  3IQ6 A;  1PCX A;  2WVN A;  3ZDL A;  4ANJ A;  2L9J A;  2J9W A;  4YL0 A;  3S27 A;  2QE9 A;  3H2U A;  3NYJ A;  2Q9B A;  5KYU B;  3PHF 2;  2A0B A;  3HNL A;  3B29 A;  5DLJ A;  3AQB A;  3RH3 A;  3EZH A;  3U9J A;  1TWH A;  1M2O A;  2XLW A;  3AG1 C;  4YL1 A;  3RKO F;  3MYF A;  3M4C A;  3O55 A;  4JTD B;  4J7Y A;  2A69 F;  2X0C A;  3T4R A;  3POV A;  2A0U A;  4PJM A;  2VCA A;  2KK1 A;  1FAP B;  4DVZ A;  4ULW A;  2ZXR A;  5F5H A;  1MMA A;  4NC3 A;  5KYN A;  2J7P A;  4YN0 B;  3RIP A;  4YT4 A;  4YT8 A;  1S7Z A;  3VYW A;  3WAQ A;  2GWW A;  1SF8 A;  1YDI A;  1BR2 A;  1SZI A;  3HNJ A;  2YLD A;  3C8G B;  2CDQ A;  3KL4 A;  4RDA A;  3QTH A;  3RFY A;  2C04 A;  3C8G D;  1MNE A;  1RKE B;  1HMD A;  2A6E F;  2PNO A;  1WN0 A;  3LNR A;  1IZM A;  2ZXP A;  4K1O A;  1Q0D A;  5COM A;  2QLA A;  4UDV A;  3SZR A;  3DMD A;  4BJT A;  2E87 A;  5B3S C;  1CPR A;  4G0H A;  5CI8 A;  3RF3 A;  1V55 C;  2H8A A;  1J8M F;  3HTK C;  4RBN A;  4JCZ A;  2IXM A;  3A11 A;  3ASO C;  3L34 A;  4XPX A;  4CSA C;  4C7O B;  5KYU A;  5L0C A;  3TK0 A;  4BJ6 A;  4EBK A;  1I4Z A;  4LLC A;  3BEH A;  4PFP A;  2Q4F A;  1AVO B;  1HW2 A;  4PJJ A;  1OW8 A;  3W8H A;  2P7V A;  2YVK A;  4U5C E;  3EZI A;  2R7S A;  2I15 A;  2EPM X;  1Q0F A;  1QZX A;  3E9V A;  5BUO A;  1D1A A;  1G4W R;  1M6T A;  4JVS A;  4NY3 A;  3ZVR A;  4P6I C;  2OCC C;  3LS0 A;  2Y3B A;  1XZQ A;  4O79 A;  4XEF A;  4EWC A;  3CEX A;  4OIR F;  3UGP A;  1LM3 B;  3NG1 A;  4XWJ A;  1BDJ B;  1PD0 A;  3NMI A;  3C8G A;  4LER A;  1WWP A;  5D92 A;  4D4X A;  1R4T A;  5AGF A;  1OCZ C;  1RCP A;  4G7O F;  2XL6 A;  4XQ1 A;  4ZLD A;  4E18 A;  2IBF A;  3IQ5 A;  1FMW A;  3MBG A;  3F47 A;  4W8P A;  3ZWI A;  5K0I A;  4XPW A;  1Q0G A;  1JPN A;  3AOU A;  3C8Z A;  2VAS A;  3JCU Q;  2NUT B;  4DOZ A;  2A1D D;  1NLX A;  3K66 A;  4JEB A;  4CS9 A;  2W9Y A;  5A6J A;  1FNT c;  2J9B A;  2XLM A;  3EPV A;  2ZXW C;  1E83 A;  4C7O A;  1YJG A;  3DKA A;  3U8P A;  4C3B A;  3GOR A;  3HLZ A;  3SXY A;  2XRH A;  4CX9 A;  4OIO F;  3CAX A;  2YHS A;  3C7J A;  4PJL A;  4HEA J;  1ZHZ A;  3IEE A;  5DS4 A;  2QNL A;  4P9F A;  2XLE A;  3U2L A;  5JUA A;  2Y3D A;  3NMJ A;  4Z9I A;  1HY5 A;  1KU2 A;  3I4U A;  2LD6 A;  4XEV A;  2A6H F;  3FXH A;  3U8V A;  3VF0 A;  2J9U A;  3AG2 C;  4R32 A;  2YQY A;  4D4N A;  1Z63 A;  4WJ0 A;  1I5N A;  4JUR I;  1K04 A;  1UFB A;  3LS1 A;  2ICW G;  5A6B D;  1Z3I X;  2B0J A;  2XLD A;  1OXK A;  5FZT A;  4BPM A;  4JTC B;  2L81 A;  3MLG A;  3TUL A;  3SXM A;  2R05 A;  1S05 A;  2D4U A;  5F5F A;  2XM0 A;  2J46 A;  3L8J A;  4JTA B;  1QQ3 A;  2Y69 C;  1G4U S;  4KBL A;  5FCL A;  2YEV A;  3EFO B;  1TKN A;  2Q3T A;  4J7T A;  2J45 A;  4YL3 A;  4JKV A;  3UGO A;  2NPU A;  4HFF B;  2NUT A;  3SXK A;  5CIV A;  2EPN A;  1O5H A;  1OR2 A;  1NFN A;  3AG4 C;  3SEO A;  1Q0K A;  3UMI A;  3ITF A;  1SYQ A;  4GEH A;  2ASR A;  1ORY A;  4N6C A;  1T01 A;  4Q5S F;  3JRT A;  2B0H A;  4ER9 A;  4Z9J A;  2GFH A;  3FDQ A;  5L3Q A;  3M1C B;  3K1I C;  1EQ1 A;  3M79 A;  3OA1 A;  4O6M A;  1K05 A;  1RMV A;  4YWQ A;  2R7Q A;  1Z7Q c;  2EIM C;  1A0B A;  3KPH A;  4B6I A;  2W4B A;  3LEV A;  2UUI A;  3T6J A;  1YZC A;  3SP1 A;  4E7S A;  2H7O A;  2JPU A;  4OIN F;  1CGM E;  2AWY A;  1Z6A A;  5A6B A;  1JPJ A;  2HJM A;  1H6G A;  2Y3G A;  2P1A A;  3QVZ A;  3TOL A;  3IHU A;  3MX3 A;  1D0Y A;  2AP3 A;  4CIH A;  4K0D A;  1CGO A;  2NSG A;  3LJB A;  2KNH A;  2CW0 F;  2IXN A;  4MVM A;  4HE8 D;  1QSP A;  2HFI A;  1VLS A;  1WAT A;  1ZVZ A;  2XLV A;  4LDQ A;  2F22 A;  3DXJ F;  2YL1 A;  3G4Z A;  3G50 A;  2EPK X;  2G62 A;  1LI7 A;  2IYL D;  1V4A A;  3EFO A;  3KKB A;  3LUT B;  4JRZ A;  3ZQY A;  5L0G A;  1BZ4 A;  2LIG A;  3Q7G A;  1AUE A;  3DI5 A;  2WL8 A;  1FR0 A;  2PF4 E;  3NKE A;  4LAC B;  3ZTM A;  5A69 A;  1TFK B;  1ZZP A;  5COF A;  4EKW A;  3ABK C;  2WB7 A;  2PFD A;  3CZ6 A;  1L3P A;  3DM5 A;  3GEI A;  3N2Z B;  2YZS A;  2I8B A;  3S28 A;  3GM1 A;  4IAO A;  2VCC A;  4JW1 A;  4ULV A;  1BBH A;  3EGD B;  4LLE A;  4Z9H A;  5L0H A;  1DOV A;  2LSE A;  1M57 C;  3NMK A;  3UR3 C;  3L8I A;  4Q7C A;  4IJJ A;  5BQH A;  2CYD A;  3UMK A;  4CDA A;  1YA9 A;  3N24 A;  1T5O A;  2GDC A;  2R02 A;  3MFN A;  1D0Z A;  4BJ6 C;  1RXQ A;  2W4M A;  1N1C A;  3AGT A;  1ORJ A;  3W4Y A;  2Q9C A;  2AU5 A;  3TJ5 A;  2MHR A;  1W2W A;  2KW3 C;  4W8K A;  4E7Z A;  2ZD9 A;  3L0I A;  1LS1 A;  4CS8 A;  5D91 A;  1YAR O;  4BJ5 A;  5JLI A;  1FTS A;  1HW1 A;  2RD9 A;  3JT1 A;  4U9D A;  3I5P A;  1GS9 A;  3Q6M A;  4MQ9 F;  5L0D A;  1LS4 A;  3U3F A;  4AL1 A;  2R7T A;  3DE9 A;  2XSE A;  1V54 C;  4WGY A;  1OXB A;  1OCO C;  1WOL A;  4MVZ A;  5TJ5 E;  2NUP B;  2MYS A;  3M15 A;  4U5G A;  3RVY A;  3GWN A;  3SNH A;  4CJO A;  4IWB A;  2R03 A;  5EK0 A;  2QUP A;  2KJG A;  3PCV A;  1B68 A;  2HUJ A;  4M63 A;  4BJ1 A;  1GM5 A;  3IQC A;  4L6R A;  3B71 A;  4NQF A;  1A7D A;  5L0J A;  1ZHY A;  3GM3 A;  1JOG A;  2XLH A;  3I5Q A;  4I1M A;  4BG0 A;  1ZHW A;  3EGD A;  3O10 A;  3RYL A;  4MS2 A;  4P9T A;  1U6H A;  3JTL O;  1BR4 A;  2JX0 A;  1GGQ A;  3IQT A;  1A41 A;  3S90 A;  2R7R A;  3X1O A;  4J32 B;  3MYI A;  4H4K C;  1YLM A;  2NG1 A;  2FFH A;  3GEE A;  1GQA A;  4QI0 A;  3GEH A;  2HS5 A;  3KYJ A;  4MTG A;  2IXP A;  3NDB B;  4MVR A;  3DM9 B;  2XS1 A;  3FVY A;  256B A;  1QVX A;  1SR2 A;  5CI9 A;  4QDL A;  2R7V A;  3U5S A;  4OIQ F;  3AJM A;  3US6 A;  3WG7 C;  4KI2 A;  2V3C C;  3EH1 A;  2VC9 A;  5JS5 A;  1PV3 A;  4PR9 A;  4PK4 A;  4XLN F;  2JD3 A;  3JZ0 A;  3QW0 A;  3ZSU A;  1MND A;  1LIH A;  3DZA A;  4A4A A;  2OQM A;  4XEK A;  1Z23 A;  2EIK C;  2EIL C;  1EKY A;  1RKC A;  2NUP A;  2XL8 A;  2FAP B;  2YLG A;  3JSZ A;  1G5Z A;  4PFO A;  4CJG A;  2TMV P;  3FMS A;  2LFD A;  1H7I A;  2WVO A;  2OKU A;  3LLK A;  3V7O A;  2R7X A;  5F28 E;  2HV7 A;  4RD9 A;  4IAR A;  1OW7 A;  4MW8 A;  3TQO A;  3V5Y A;  3W8I A;  4CS9 C;  4K7B A;  2PBE A;  3KYI A;  2HJ3 A;  1NG1 A;  2M64 A;  5E2Q A;  2BC5 A;  4O6N A;  2P6V A;  1U89 A;  2XS8 A;  1XWJ A;  4CBE A;  1M2V B;  2OU6 A;  1TWG A;  4LDK A;  2OOC A;  5GPG B;  3VM6 A;  1KTM A;  3DJU B;  1D1B A;  4DRJ B;  1D1C A;  2HMQ A;  4MVU A;  2XXA B;  3H65 A;  1TWC A;  5B3I A;  1BR1 A;  5DS6 A;  2L7A A;  4H54 A;  3K7D A;  3R2P A;  2ZPA A;  4MVQ A;  5E33 A;  4KNW A;  1H9T A;  2OEX A;  4IAQ A;  1A7E A;  5EGY A;  3RQE A;  3S9O A;  1A7V A;  2YKZ A;  5HV9 A;  3HNI A;  3K1I A;  4NTB A;  2J8W A;  5KYY B;  4KC9 A;  3T9O A;  3PMR A;  5T1D B;  3L1M A;  5B1A C;  1ZU5 A;  3LEO A;  4YT5 A;  4EIY A;  1NSG B;  3WHN A;  3DAF A;  3DAG A;  2AWC A;  4BEJ A;  3K6B A;  1EI7 A;  3C18 A;  4U9E A;  4JZA A;  4XTK A;  3U2M A;  3WOD F;  1ORS C;  1JRA A;  3DE8 A;  3EGX B;  3B0U X;  3NYM A;  3ZG1 A;  5DS5 A;  4EHP A;  4E17 A;  4DBR A;  1E85 A;  2WZL A;  5T3W A;  1E86 A;  5L3V A;  3FHD A;  1FFH A;  1MMG A;  1O87 A;  2AVK A;  1LI5 A;  3HJC A;  2IOQ A;  2P0N A;  1M2V A;  3JSE O;  4MTO A;  4EUK B;  5B1B C;  4DRH B;  2EIN C;  1D0X A;  4FWV A;  4WAB A;  2X51 A;  4MVO A;  1AEP A;  2GA0 A;  5DQT A;  4CDY A;  3AGU A;  5IY5 C;  4AE4 B;  2HSB A;  4CDV A;  4XLP F;  2XXA A;  3FOO A;  1YAU O;  2WZG A;  1V74 B;  3EJN A;  1KNY A;  3GAN A;  4JE9 A;  5JSL A;  1T6I A;  4YJW A;  1JMW A;  3ZIB A;  2OJE D;  3LES A;  4XPY A;  1ZW3 A;  3EH2 A;  1PD1 A;  1RJ9 B;  3SYN A;  4G7Z F;  1OR3 A;  3M4B A;  1Q0M A;  1WGW A;  4G78 A;  2HSQ A;  4GQH A;  3Q7L A;  1LVK A;  3B0P A;  2NSF A;  4N4W A;  2J0X A;  4U5B E;  3RVZ A;  5KYX B;  2BE5 F;  1ZHT A;  4JIO A;  3V5Z A;  1DOW A;  1ZW2 A;  2KYH A;  1Y6D A;  2EIJ C;  2XL4 A;  3B9Q A;  3DJN B;  1T6Q A;  1I4Y A;  5DVW A;  3Q6N A;  3KH2 A;  5T3T A;  3U3B A;  3R7C A;  2LFF A;  3BRJ A;  2DYR C;  2KSF A;  1APC A;  2QY9 A;  3EGX A;  3QZC A;  3UMH A;  3OWT A;  4I1O B;  1H9G A;  1VK5 A;  4DRI B;  1L7C A;  2YL0 A;  4CSA A;  3H2V A;  4ONS A;  1YA7 O;  4NTA A;  4YT2 A;  2LP4 A;  2R9R B;  5JP7 A;  2J9V A;  2V26 A;  3E70 C;  2DYS C;  4MTF A;  4IGG A;  2QTV A;  4EBB A;  2GAQ A;  1J8Y F;  1C02 A;  3TJ6 A;  3T6B A;  3EHM A;  3K33 A;  1OKK D;  1Y4C A;  3G4X A;  2CNW D;  2PX3 A;  4AE4 A;  3LLI A;  2L6G A;  2OG2 A;  4JJG A;  1NFO A;  1SMY F;  2UUH A;  4JJF A;  3T6G B;  4G7H F;  1CGN A;  2BL2 A;  1HMO A;  5BQI A;  1EA8 A;  1VB5 A;  4I3M A;  2H7B A;  1OQC A;  3GOD A;  1RJ9 A;  2O9X A;  4NTF A;  2WVQ A;  3TD7 A;  4MW3 A;  3NKD A;  5DQZ A;  4CS8 C;  2YL7 A;  4AX2 A;  4BJ5 C;  1NU7 D;  3JYY A;  4HFK B;  5E3A A;  4PJN A;  2HMZ A;  3V5X A;  2R7U A;  4J30 B;  4I44 A;  3S29 A;  2R7O A;  3O6X A;  4DXW A;  3ABM C;  2MWQ A;  3NYL A;  4CS7 A;  5KYX A;  3C62 A;  2LK4 A;  2Q00 A;  3VAY A;  5KYY A;  1WAS A;  3A9C A;  2XM4 A;  1HE9 A;  3DD7 A;  2Q9A A;  4GYT A;  3ABL C;  3X2Q C;  5A6K A;  2KC3 A;  2VH3 A;  5AC4 A;  3RW0 A;  2P61 A;  3O39 A;  1K40 A;  4O7G A;  3FOP A;  3K1H A;  1QPU A;  4N06 A;  2Q7R A;  1T9K A;  2H7V C;  2HV6 A;  3C63 A;  4MVS A;  3AQC A;  2DGJ A;  2HKV A;  2PP4 A;  4AK9 A;  1JR8 A;  3FAP B;  2G3K A;  1UG7 A;  2WZF A;  2XLO A;  2R7W A;  1OKK A;  2CNW A;  3JRM O;  4FES A;  5L0F A;  5L0I A;  1VMA A;  1Z5Z A;  4A2N B;  2L6F A;  1RKE A;  2PX0 A;  4IRU A;  4JEA A;  5A6A A;  1T6U A;  2M4E A;  1YZA A;  2KQ9 A;  2YLI A;  4PAC A;  2D5R B;  3W2W A;  3ZC4 A;  4OIP F;  1QLE C;  5JT4 A;  5KYW B;  4U5D E;  5JRA A;  3PDM P;  1O3U A;  4IB4 A;  2Y39 A;  4U5E E;  2LCH A;  1E2X A;  3QW1 A;  4DBQ A;  4QI2 A;  3ZTZ A;  2LQG A;  4OD5 A;  3EQL F;  3NRH A;  1FMV A;  1VOM A;  4FAP B;  3FAJ A;  4C3D A;  3S84 A;  4OD4 A;  3HNK A;  2OEV A;  1TQG A;  4WGZ A;  2R25 A;  4Q4Z F;  2IM8 A;  3UNG C;  4JC7 A;  1WTY A;  4O6Y A;  2L6H A;  5E3C A;  3AG3 C;  1NBB A;  4U5H A;  3B0V C;  4NCQ A;  5JVE A;  4AL0 A;  3GWL A;  4E0H A;  1MMD A;  1U0B B;  1IW7 F;  2YL3 A;  1LKX A;  4JCH A;  2C03 A;  2RSE B;  5EHH A;  4CIP A;  3S0X A;  1TFO B;  3VRC A;  1LE4 A;  2EPL X;  3CSK A;  3JYH A;  4BEM J;  1OW6 A;  3EG9 B;  4MND A;  5COG A;  4E0I A;  1ZHX A;  2W45 A;  1NZE A;  4DJ9 A;  4U5F E;  1CPQ A;  1VLT A;  4YK5 A;  2G3V A;  1OCC C;  5AC5 A;  1VYI A;  1M56 C;  1OCR C;  1YYX A; 
#chains in the Genus database with same CATH homology
 2P0N A;  3CAX A;  3V5Y A;  3U9M A;  3U9J A;  3V5Z A;  3V5X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...