3U9MA

Structure of reduced human fbxl5 hemerythrin like domain
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
157
structure length
157
Chain Sequence
FPEEVDVFTAPHWRMKQLVGLYCDKLSKTNFSNNNDFRALLQSLYATFKEFKMHEQIENEYIIGLLQQRSQTIYNVHSDNKLSEMLSLFEKGLKNVKNEYEQLNYAKQLKERLEAFTRDFLPHMKEEEEVFQPMLMEYFTYEELKDIKKKVIAQHCS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords F-box/LRR-repeat protein 5
publication title The Structural Basis of Iron Sensing by the Human F-box Protein FBXL5.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 72
structure length 157
sequence length 157
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2011-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01814 Hemerythrin Hemerythrin HHE cation binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.520 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) nmb1532 protein domain like 3u9mA00
3CAXA 3U9JA 3V5XA 3U9MA 3V5ZA 3V5YA 2P0NA
chains in the Genus database with same CATH superfamily
1Z7Qc 2NSFA 4JTCB 2WVQA 3DJNB 2R7SA 4W8KA 1Z5ZA 2XLOA 4EIYA 5BUOA 2J8WA 4MW8A 1SZIA 4WGZA 2G3KA 1G5ZA 1ZVZA 2XLWA 3EG9B 3HNIA 3NKDA 4Q5SF 1Z6AA 2NUPB 2BL2A 3J06A 3IQCA 1WASA 1TKNA 2P6VA 3NMIA 4X0RA 1PD0A 1LE2A 5HSWA 1APCA 3LNMB 4NC3A 2PP4A 2RSEB 1WATA 2HJMA 1L3PA 2Q00A 3AGTA 4JVSA 4CS9C 4D4XA 5A6KA 3T6JA 5CIVA 1J8MF 5L0DA 3POVA 3C18A 3RYLA 2NG1A 2ICWG 1QVXA 2IXMA 1BR2A 1OCRC 4Z9HA 1MQVA 2EPOA 2PX0A 2Q9AA 5L0IA 4O6NA 1VLSA 4U5EE 1PD1A 2YVKA 1W2WA 4U5BE 1KNYA 3PHF2 3TQOA 2FGYA 3E9VA 3Q6NA 1YYXA 3RKOF 4MTGA 2Y3BA 1A7VA 3KYIA 4CX9A 2I15A 2VCCA 3I5QA 3O6XA 1SF8A 3E70C 3LESA 4YJWA 3CEXA 2J9UA 4BJ6A 3EGXB 4XLPF 4QI2A 3U8VA 2ZXPA 2YLIA 1Y4CA 5B1AC 3ZTMA 4BG0A 2AP3A 2KYHA 4KI2A 2EILC 1ZHTA 1G4US 1ZU5A 3AG2C 1D1CA 4YWQA 4FESA 4ER9A 2OQMA 1TWAA 2PFDA 4LDQA 4YT8A 3B0VC 4CIPA 4BJ6C 2L7AA 4KBLA 2A6HF 1TQGA 3EHNA 1F1MA 3K66A 5B1BC 3R7CA 2JD3A 2YLGA 3DE8A 3ITFA 2KNHA 1Q0KA 2HMQA 2DB4A 4NTBA 1Q0MA 3QTHA 1AUEA 4J30B 3PMRA 1Q0GA 4YL3A 3JTLO 4Z9IA 1H7IA 1Y6DA 2FFHA 4JC7A 1TR2A 4U9DA 4PFOA 2AWCA 3CSKA 3ZQVA 1S05A 3S28A 3L8IA 3VRCA 5T1DB 4C3EA 2Y3HA 3B0UX 3ABLC 1VYIA 4J7YA 2LSEA 2GA0A 3LNRA 1JR8A 3T6BA 1RKEA 3GWNA 2D4UA 4MVSA 4XPYA 5DLJA 4DOZA 4NCQA 2P61A 4JURI 4UDVA 1OR3A 2OJED 2WZFA 4OIOF 3QMKA 1I4YA 1PV3A 1QPUA 2YL1A 1NU7D 3MYFA 4EBKA 4L6RA 1OR2A 1UG7A 2XL4A 3I5PA 3PDMP 1YZCA 2IXPA 4KNWA 3IPMO 1NG1A 1OCOC 2P1AA 2Q9BA 3JRMO 4PFPA 1YJGA 2YLDA 3KKBA 3IQ5A 3TD7A 3W8IA 3RW0A 1N1CA 1OXKA 1V55C 3FMSA 2YHSA 4MVQA 4N6CA 3FOPA 3FVYA 2NPUA 4JIOA 2C03A 4O79A 3N2ZB 3EZHA 1H9TA 1LE4A 4H4KC 4DVZA 4AK9A 2OCCC 4JCHA 4RDAA 4OIPF 1IW7F 2YWAA 3K7DA 3S0XA 3DZAA 1RMVA 5D91A 2ZD9A 3IEEA 3CAXA 4JRZA 2KK1A 3U9MA 4MQ9F 1YDIA 5HV9A 1ZU4A 5KYYA 4CSAA 4MVZA 3QW0A 2R05A 5DS5A 1YVIA 3KL4A 3AJMA 4LACB 2Y69C 4CIHA 2Q9CA 2X51A 4NTAA 2JX0A 5A69A 1I5NA 3JYYA 4YN0B 1VTMP 1LS4A 1NZEA 2EPMX 3DWWA 2IYLD 1C02A 4KC9A 5L0HA 3EPVA 1CGNA 1ZHXA 4AL1A 3WG7C 5E2QA 1U0BB 1T6IA 4MNDA 2QTVA 3QW1A 2ZXOA 3X2QC 3NYMA 4CSAC 4GQHA 4JKVA 4M63A 1GQAA 3GODA 1LI5A 3HJCA 4G78A 2AU5A 2KC3A 2R7OA 1ORSC 3AG1C 1CGOA 4G0HA 1T01A 1V4AA 5AC5A 4AX2A 2UUIA 2YL7A 3FXHA 3SXZA 2L81A 4YT5A 2CNWD 1A41A 1VOMA 1CPQA 2Q3TA 1XZQA 4AL0A 5KYNA 3W8HA 4YT2A 2R7QA 5KYXB 5CI9A 3K1HA 1YYJA 3IQ6A 3NRHA 1Z23A 4XEFA 2QY9A 5F5HA 2A68F 3ZQYA 3MX3A 5COGA 1OW6A 4CS9A 4DVYP 1HY5A 3W2WA 2J9BA 2OU6A 2HKVA 2XLHA 3DMDA 3GM3A 5K0IA 4XPWA 5BQGA 3G4ZA 2MWQA 3T6GB 3SNHA 5BQIA 2B0JA 2KGOA 3TJ6A 1ORJA 2R7TA 2LFFA 1J8YF 1M2OA 1D0ZA 2L6HA 2HJ3A 3A11A 5JUAA 2XXAB 2QE9A 3U8PA 4E18A 3RH3A 1BR1A 3U3FA 1XZPA 2MYSA 1LS1A 4MW3A 1UFBA 4IAOA 2IOQA 4U5GA 3V5YA 4BJ1A 4DRIB 1K05A 4U5HA 1JRAA 1ZHYA 5DVWA 1EI7A 1ORYA 2GWWA 2YRFA 2Z15A 3UMIA 2OJQA 1VMAA 3DAFA 1GS9A 2J45A 1TFKB 3EGXA 3RF3A 1RXQA 4ULWA 5F5FA 2R7XA 4BJ5C 1B68A 2L9JA 3DI5A 4OIRF 3KH2A 4A2NB 1U89A 2KQ9A 2ZXRA 5IY5C 1KU2A 2ASRA 3EFOA 3HNLA 1WN0A 3K6BA 4MVRA 3T9OA 3FDQA 2J9WA 3DD7A 1DOWA 3AOUA 4NY3A 3PCVA 1O87A 2BC5A 2R02A 4K0DA 4JZAA 1WOLA 1ZW2A 5BQHA 1JAFA 1NSGB 2CNWA 2HV6A 3C8GA 3EFOB 4DXWA 3ZWIA 4DBQA 2R7WA 2VCBA 1M56C 3NKEA 5CI8A 2PX3A 3N0TA 3V5XA 2H8AA 2A0BA 1E83A 2LIGA 2YL3A 3C8GB 3U3BA 2R7VA 2A6EF 4JEAA 3DE9A 3A9CA 4J7TA 3SYNA 3RVZA 4FWVA 2W4BA 3EHMA 2QLAA 4E0IA 2EINC 4CS8C 3DKAA 2D5RB 3RIPA 2WVOA 1M2VA 5JSLA 2IXNA 5DQTA 3EQLF 3SP1A 3TJ5A 3ZG1A 1D0YA 2XLEA 3JSZA 2ETSA 2DGJA 3GM1A 2KJGA 4OD5A 3S84A 3AGUA 4B6IA 3SZRA 1R5ID 1OKKA 2H7BA 3C8ZA 2EPKX 3F47A 4MVMA 1D1BA 4K1OA 1M2VB 3UMKA 1O5HA 1FR0A 2XM4A 2XRHA 2GDCA 2IXOA 3DAGA 3FOOA 3HNJA 4WJ0A 5FCLA 1SYQA 1H6GA 1Z3IX 2LK4A 3B29A 3QVYA 4PJNA 5KYUA 3VM6A 3ZSUA 4U9EA 2F22A 3F46A 4BEJA 3TULA 4EWCA 3GEIA 4BEMJ 2AWYA 1AVOB 3EGDB 2H7VC 1H9GA 2IM8A 5A6BA 2JPUA 3B0PA 3VYWA 4HE8D 2R03A 5DQZA 1FMVA 256BA 5KYUB 4I1MA 4CJOA 5E3AA 1V54C 4G7OF 2YZSA 2HMZA 1OQCA 2HS5A 2E87A 3MYIA 2A69F 3LUTB 2WL8A 4XEVA 5T3WA 2OG2A 3JT1A 1EKYA 3MLGA 3B9QA 3U2LA 3LEOA 4IRUA 2LFDA 4YL0A 3FHDA 4P9FA 1WTYA 3BRJA 1YARO 3AQBA 2Y3GA 3IQTA 1NLXA 3OWTA 4HFKB 4MS2A 4MTFA 1D1AA 2P7VA 2Q7RA 1FMWA 2HSQA 1ZHZA 4CJGA 4G7ZF 2VB6A 2CDQA 2XL8A 5GPGB 3U2MA 2UUHA 3AQCA 1R4TA 1HW1A 3W2VA 3G4XA 4Q4ZF 4XLNF 3DXJF 3RVYA 2ZPAA 3RQFA 4Q7CA 5F28E 1NFNA 4JEBA 4K7BA 4CDVA 4PJLA 3L8JA 2J46A 4OINF 1XWJA 1M57C 4E0HA 4JW1A 1BBHA 5KYWB 2YL0A 3VAYA 3LAYA 2DYSC 5KYXA 3M4BA 1OW8A 3S9OA 3Q7LA 5A6JA 5L3QA 4HEAJ 1ZZPA 3T4RA 4ZLCA 1MNEA 1CGME 1HMDA 3C8GD 1OCZC 4GYTA 1G8XA 2HZ8A 4IB4A 2VCAA 2XLDA 1FFTC 1NBBA 2W45A 3ZIBA 3LS1A 4CDAA 1GM5A 2A0UA 2M64A 5D92A 5COMA 3N24A 1MMDA 4MTOA 3RFYA 1FNTc 5A6AA 4LLEA 2Y39A 4RBNA 1O3UA 5TJ5E 1V74B 2XLVA 4PACA 2R7UA 1QSPA 3WHNA 3M4CA 4E17A 2EPNA 2XXAA 3V5ZA 4DBRA 1QQ3A 2OKUA 4P6IC 2CCYA 1OXBA 2EIKC 2NSGA 3B71A 1A0BA 3RQEA 1HE1A 1Q0DA 1E2XA 3H2UA 3I4UA 3ASNC 2X0CA 3UNGC 2OEXA 4BJTA 4E7ZA 4C7OA 3NYLA 3H65A 3LLIA 4XTKA 5B3IA 3C7JA 4MVUA 4WABA 4ONSA 1E84A 1YA9A 1NFOA 1OKKD 4IAQA 4XPXA 1NU9C 4BJ5A 2PNOA 1LVKA 3O39A 2GFHA 1FAPB 2HFIA 3G50A 4O6YA 2DI3A 2KW3C 4MVOA 2EIJC 3KMIA 3NMJA 1Z63A 4C7OB 2ZXWC 1U6HA 1LKXA 2PBEA 2QNLA 5T3TA 4E7SA 4U5FE 1E85A 3O55A 4OIQF 4C3BA 2L6FA 4DRHB 5A6BD 2R7RA 1G4WR 4EHPA 2P0NA 2MHRA 4J32B 1L7CA 4EKWA 3OEOA 2J0WA 4WGYA 4EUKB 3U9JA 1HE9A 2G62A 2H7OA 2VH3A 3OA1A 4FX5A 4JTAB 4U5DE 3SXKA 3US6A 5L0JA 1BDJB 4JJGA 4ULVA 1TWGA 5L0FA 4IJJA 3DJUB 1E86A 5EHHA 5E3CA 3ABKC 4H54A 1PCXA 2M4EA 3UGOA 1I4ZA 1WWPA 1LIHA 1EQ1A 3JCUQ 1Q0FA 4XWJA 3GANA 2HUJA 3H2VA 3NYJA 4IARA 4CS8A 2XL6A 3LS0A 5L0CA 3FAPB 3CQZA 3SXYA 1YA7O 4CS7A 5COFA 1T5OA 3GM2A 3M79A 3S29A 1RJ9A 2Q4FA 1T6QA 1LI7A 2CW0F 2J7PA 3WODF 5DS6A 1BR4A 2LD6A 1MMAA 4PK4A 3GORA 4DRJB 4IGGA 1GGQA 2HV7A 1RJ9B 1ST6A 3HKKA 3DM5A 1DOVA 3GWLA 3QVZA 1K04A 1SMYF 2GAQA 2XS1A 4O6MA 4N06A 1VK5A 4RD9A 5EK0A 4GEHA 1YLMA 2FAPB 1T6UA 2YQYA 3QZCA 2V26A 5JP7A 3TK0A 5L3VA 3M1CB 5JS5A 3EGDA 2LCHA 4ANJA 1CPRA 1IZMA 4PJJA 5FZTA 1RKCA 1HW2A 3LJBA 3HTKC 2XLMA 2XS8A 1TFOB 4JTDB 3ATPA 4LERA 3K33A 4OD4A 2LP4A 3KYJA 2XM0A 3R2PA 1S7ZA 5E33A 3EH1A 4N4WA 1K40A 1C03A 2NUTA 2OOCA 3BEHA 3IHUA 4W8PA 2L6GA 2TMVP 3JYHA 2AVKA 4LDKA 2DYRC 1MNDA 5JRAA 3EJNA 1QLEC 1SR2A 1ZHWA 2NUTB 4XEKA 2R25A 3JRTA 5L0GA 4EBBA 5EGYA 2I8BA 1C17M 1MMGA 3RQGA 1OCCC 3NG1A 3UR3C 4QI0A 4JJFA 4YT4A 3U5SA 5JVEA 4I1OB 3NMKA 1ZYRF 2EIMC 2HSBA 4NTFA 1RKEB 3NDBB 2G3VA 1VYKA 3JZ0A 2O9XA 4KNVA 3WAQA 2WZGA 3DM9B 3ZC4A 1FFHA 4BPMA 1BZ4A 4C3DA 4XQ1A 4R32A 4O7GA 3TOLA 5JT4A 4G7HF 3SXMA 2CGEA 4Z9JA 3AG4C 4FAPB 1T9KA 1A7EA 2PF4E 3L34A 3FAJA 3GEEA 4A4AA 3MBGA 2R9RB 1TWCA 3KPHA 3EZIA 3X1OA 2VASA 3L1MA 5KYWA 4D4NA 2XSEA 2J9VA 2W9YA 3CZ6A 1QZXA 4JCZA 4YK5A 4I3MA 1D0XA 4HFFB 4JE9A 3SEOA 3ZDLA 4QDLA 4U5CE 3U0CA 4F4BA 5AGFA 3S27A 4LDRA 1ZW3A 5AC4A 4ZLDA 1RCPA 2EPLX 2BE5F 4PJMA 1JMWA 1LM3B 5DS4A 3S90A 2W4MA 4AE4A 2C04A 2CYDA 1WGWA 3ECSA 4YL1A 1MMNA 2A1DD 2RD9A 1FTSA 1EA8A 3VF0A 4CDYA 5KYYB 4I44A 2V3CC 4AE4B 1JOGA 3AG3C 3V7OA 1JPJA 3TOMA 4IWBA 2WZLA 1LPEA 1YAUO 3JSEO 3K1IA 3UGPA 2J7PD 2KSFA 4PR9A 5JLIA 3HLZA 3C63A 2B0HA 1M6TA 1A7DA 1YZAA 3HNKA 1AEPA 1TWHA 2VC9A 3GEHA 3Q6MA 2WB7A 4P9TA 3EH2A 3UMHA 2J0XA 1OW7A 2Y3DA 1KTMA 3Q7GA 4DJ9A 3M15A 3O10A 2WVNA 1JPNA 3L0IA 2OEVA 1VLTA 2IBFA 2LQGA 3K1IC 3LEVA 3ABMC 3LLKA 1QKRA 1VB5A 3MFNA 4CBEA 2YKZA 3ASOC 4N6HA 4NQFA 5B3SC 3W4YA 1HMOA 2YEVA 4LLCA 4EBJA 3ZVRA 3ZTZA 3EG9A 3C62A 2NUPA 2QUPA
chains in the Genus database with same CATH topology
3CAXA 3U9JA 3V5XA 3U9MA 3V5ZA 3V5YA 2P0NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CAX A;  3U9J A;  3V5X A;  3U9M A;  3V5Z A;  3V5Y A;  2P0N A; 
#chains in the Genus database with same CATH topology
 1Z7Q c;  2NSF A;  4JTC B;  2WVQ A;  3DJN B;  2R7S A;  4W8K A;  1Z5Z A;  2XLO A;  4EIY A;  5BUO A;  2J8W A;  4MW8 A;  1SZI A;  4WGZ A;  2G3K A;  1G5Z A;  1ZVZ A;  2XLW A;  3EG9 B;  3HNI A;  3NKD A;  4Q5S F;  1Z6A A;  2NUP B;  2BL2 A;  3J06 A;  3IQC A;  1WAS A;  1TKN A;  2P6V A;  3NMI A;  4X0R A;  1PD0 A;  1LE2 A;  5HSW A;  1APC A;  3LNM B;  4NC3 A;  2PP4 A;  2RSE B;  1WAT A;  2HJM A;  1L3P A;  2Q00 A;  3AGT A;  4JVS A;  4CS9 C;  4D4X A;  5A6K A;  3T6J A;  5CIV A;  1J8M F;  5L0D A;  3POV A;  3C18 A;  3RYL A;  2NG1 A;  2ICW G;  1QVX A;  2IXM A;  1BR2 A;  1OCR C;  4Z9H A;  1MQV A;  2EPO A;  2PX0 A;  2Q9A A;  5L0I A;  4O6N A;  1VLS A;  4U5E E;  1PD1 A;  2YVK A;  1W2W A;  4U5B E;  1KNY A;  3PHF 2;  3TQO A;  2FGY A;  3E9V A;  3Q6N A;  1YYX A;  3RKO F;  4MTG A;  2Y3B A;  1A7V A;  3KYI A;  4CX9 A;  2I15 A;  2VCC A;  3I5Q A;  3O6X A;  1SF8 A;  3E70 C;  3LES A;  4YJW A;  3CEX A;  2J9U A;  4BJ6 A;  3EGX B;  4XLP F;  4QI2 A;  3U8V A;  2ZXP A;  2YLI A;  1Y4C A;  5B1A C;  3ZTM A;  4BG0 A;  2AP3 A;  2KYH A;  4KI2 A;  2EIL C;  1ZHT A;  1G4U S;  1ZU5 A;  3AG2 C;  1D1C A;  4YWQ A;  4FES A;  4ER9 A;  2OQM A;  1TWA A;  2PFD A;  4LDQ A;  4YT8 A;  3B0V C;  4CIP A;  4BJ6 C;  2L7A A;  4KBL A;  2A6H F;  1TQG A;  3EHN A;  1F1M A;  3K66 A;  5B1B C;  3R7C A;  2JD3 A;  2YLG A;  3DE8 A;  3ITF A;  2KNH A;  1Q0K A;  2HMQ A;  2DB4 A;  4NTB A;  1Q0M A;  3QTH A;  1AUE A;  4J30 B;  3PMR A;  1Q0G A;  4YL3 A;  3JTL O;  4Z9I A;  1H7I A;  1Y6D A;  2FFH A;  4JC7 A;  1TR2 A;  4U9D A;  4PFO A;  2AWC A;  3CSK A;  3ZQV A;  1S05 A;  3S28 A;  3L8I A;  3VRC A;  5T1D B;  4C3E A;  2Y3H A;  3B0U X;  3ABL C;  1VYI A;  4J7Y A;  2LSE A;  2GA0 A;  3LNR A;  1JR8 A;  3T6B A;  1RKE A;  3GWN A;  2D4U A;  4MVS A;  4XPY A;  5DLJ A;  4DOZ A;  4NCQ A;  2P61 A;  4JUR I;  4UDV A;  1OR3 A;  2OJE D;  2WZF A;  4OIO F;  3QMK A;  1I4Y A;  1PV3 A;  1QPU A;  2YL1 A;  1NU7 D;  3MYF A;  4EBK A;  4L6R A;  1OR2 A;  1UG7 A;  2XL4 A;  3I5P A;  3PDM P;  1YZC A;  2IXP A;  4KNW A;  3IPM O;  1NG1 A;  1OCO C;  2P1A A;  2Q9B A;  3JRM O;  4PFP A;  1YJG A;  2YLD A;  3KKB A;  3IQ5 A;  3TD7 A;  3W8I A;  3RW0 A;  1N1C A;  1OXK A;  1V55 C;  3FMS A;  2YHS A;  4MVQ A;  4N6C A;  3FOP A;  3FVY A;  2NPU A;  4JIO A;  2C03 A;  4O79 A;  3N2Z B;  3EZH A;  1H9T A;  1LE4 A;  4H4K C;  4DVZ A;  4AK9 A;  2OCC C;  4JCH A;  4RDA A;  4OIP F;  1IW7 F;  2YWA A;  3K7D A;  3S0X A;  3DZA A;  1RMV A;  5D91 A;  2ZD9 A;  3IEE A;  3CAX A;  4JRZ A;  2KK1 A;  3U9M A;  4MQ9 F;  1YDI A;  5HV9 A;  1ZU4 A;  5KYY A;  4CSA A;  4MVZ A;  3QW0 A;  2R05 A;  5DS5 A;  1YVI A;  3KL4 A;  3AJM A;  4LAC B;  2Y69 C;  4CIH A;  2Q9C A;  2X51 A;  4NTA A;  2JX0 A;  5A69 A;  1I5N A;  3JYY A;  4YN0 B;  1VTM P;  1LS4 A;  1NZE A;  2EPM X;  3DWW A;  2IYL D;  1C02 A;  4KC9 A;  5L0H A;  3EPV A;  1CGN A;  1ZHX A;  4AL1 A;  3WG7 C;  5E2Q A;  1U0B B;  1T6I A;  4MND A;  2QTV A;  3QW1 A;  2ZXO A;  3X2Q C;  3NYM A;  4CSA C;  4GQH A;  4JKV A;  4M63 A;  1GQA A;  3GOD A;  1LI5 A;  3HJC A;  4G78 A;  2AU5 A;  2KC3 A;  2R7O A;  1ORS C;  3AG1 C;  1CGO A;  4G0H A;  1T01 A;  1V4A A;  5AC5 A;  4AX2 A;  2UUI A;  2YL7 A;  3FXH A;  3SXZ A;  2L81 A;  4YT5 A;  2CNW D;  1A41 A;  1VOM A;  1CPQ A;  2Q3T A;  1XZQ A;  4AL0 A;  5KYN A;  3W8H A;  4YT2 A;  2R7Q A;  5KYX B;  5CI9 A;  3K1H A;  1YYJ A;  3IQ6 A;  3NRH A;  1Z23 A;  4XEF A;  2QY9 A;  5F5H A;  2A68 F;  3ZQY A;  3MX3 A;  5COG A;  1OW6 A;  4CS9 A;  4DVY P;  1HY5 A;  3W2W A;  2J9B A;  2OU6 A;  2HKV A;  2XLH A;  3DMD A;  3GM3 A;  5K0I A;  4XPW A;  5BQG A;  3G4Z A;  2MWQ A;  3T6G B;  3SNH A;  5BQI A;  2B0J A;  2KGO A;  3TJ6 A;  1ORJ A;  2R7T A;  2LFF A;  1J8Y F;  1M2O A;  1D0Z A;  2L6H A;  2HJ3 A;  3A11 A;  5JUA A;  2XXA B;  2QE9 A;  3U8P A;  4E18 A;  3RH3 A;  1BR1 A;  3U3F A;  1XZP A;  2MYS A;  1LS1 A;  4MW3 A;  1UFB A;  4IAO A;  2IOQ A;  4U5G A;  3V5Y A;  4BJ1 A;  4DRI B;  1K05 A;  4U5H A;  1JRA A;  1ZHY A;  5DVW A;  1EI7 A;  1ORY A;  2GWW A;  2YRF A;  2Z15 A;  3UMI A;  2OJQ A;  1VMA A;  3DAF A;  1GS9 A;  2J45 A;  1TFK B;  3EGX A;  3RF3 A;  1RXQ A;  4ULW A;  5F5F A;  2R7X A;  4BJ5 C;  1B68 A;  2L9J A;  3DI5 A;  4OIR F;  3KH2 A;  4A2N B;  1U89 A;  2KQ9 A;  2ZXR A;  5IY5 C;  1KU2 A;  2ASR A;  3EFO A;  3HNL A;  1WN0 A;  3K6B A;  4MVR A;  3T9O A;  3FDQ A;  2J9W A;  3DD7 A;  1DOW A;  3AOU A;  4NY3 A;  3PCV A;  1O87 A;  2BC5 A;  2R02 A;  4K0D A;  4JZA A;  1WOL A;  1ZW2 A;  5BQH A;  1JAF A;  1NSG B;  2CNW A;  2HV6 A;  3C8G A;  3EFO B;  4DXW A;  3ZWI A;  4DBQ A;  2R7W A;  2VCB A;  1M56 C;  3NKE A;  5CI8 A;  2PX3 A;  3N0T A;  3V5X A;  2H8A A;  2A0B A;  1E83 A;  2LIG A;  2YL3 A;  3C8G B;  3U3B A;  2R7V A;  2A6E F;  4JEA A;  3DE9 A;  3A9C A;  4J7T A;  3SYN A;  3RVZ A;  4FWV A;  2W4B A;  3EHM A;  2QLA A;  4E0I A;  2EIN C;  4CS8 C;  3DKA A;  2D5R B;  3RIP A;  2WVO A;  1M2V A;  5JSL A;  2IXN A;  5DQT A;  3EQL F;  3SP1 A;  3TJ5 A;  3ZG1 A;  1D0Y A;  2XLE A;  3JSZ A;  2ETS A;  2DGJ A;  3GM1 A;  2KJG A;  4OD5 A;  3S84 A;  3AGU A;  4B6I A;  3SZR A;  1R5I D;  1OKK A;  2H7B A;  3C8Z A;  2EPK X;  3F47 A;  4MVM A;  1D1B A;  4K1O A;  1M2V B;  3UMK A;  1O5H A;  1FR0 A;  2XM4 A;  2XRH A;  2GDC A;  2IXO A;  3DAG A;  3FOO A;  3HNJ A;  4WJ0 A;  5FCL A;  1SYQ A;  1H6G A;  1Z3I X;  2LK4 A;  3B29 A;  3QVY A;  4PJN A;  5KYU A;  3VM6 A;  3ZSU A;  4U9E A;  2F22 A;  3F46 A;  4BEJ A;  3TUL A;  4EWC A;  3GEI A;  4BEM J;  2AWY A;  1AVO B;  3EGD B;  2H7V C;  1H9G A;  2IM8 A;  5A6B A;  2JPU A;  3B0P A;  3VYW A;  4HE8 D;  2R03 A;  5DQZ A;  1FMV A;  256B A;  5KYU B;  4I1M A;  4CJO A;  5E3A A;  1V54 C;  4G7O F;  2YZS A;  2HMZ A;  1OQC A;  2HS5 A;  2E87 A;  3MYI A;  2A69 F;  3LUT B;  2WL8 A;  4XEV A;  5T3W A;  2OG2 A;  3JT1 A;  1EKY A;  3MLG A;  3B9Q A;  3U2L A;  3LEO A;  4IRU A;  2LFD A;  4YL0 A;  3FHD A;  4P9F A;  1WTY A;  3BRJ A;  1YAR O;  3AQB A;  2Y3G A;  3IQT A;  1NLX A;  3OWT A;  4HFK B;  4MS2 A;  4MTF A;  1D1A A;  2P7V A;  2Q7R A;  1FMW A;  2HSQ A;  1ZHZ A;  4CJG A;  4G7Z F;  2VB6 A;  2CDQ A;  2XL8 A;  5GPG B;  3U2M A;  2UUH A;  3AQC A;  1R4T A;  1HW1 A;  3W2V A;  3G4X A;  4Q4Z F;  4XLN F;  3DXJ F;  3RVY A;  2ZPA A;  3RQF A;  4Q7C A;  5F28 E;  1NFN A;  4JEB A;  4K7B A;  4CDV A;  4PJL A;  3L8J A;  2J46 A;  4OIN F;  1XWJ A;  1M57 C;  4E0H A;  4JW1 A;  1BBH A;  5KYW B;  2YL0 A;  3VAY A;  3LAY A;  2DYS C;  5KYX A;  3M4B A;  1OW8 A;  3S9O A;  3Q7L A;  5A6J A;  5L3Q A;  4HEA J;  1ZZP A;  3T4R A;  4ZLC A;  1MNE A;  1CGM E;  1HMD A;  3C8G D;  1OCZ C;  4GYT A;  1G8X A;  2HZ8 A;  4IB4 A;  2VCA A;  2XLD A;  1FFT C;  1NBB A;  2W45 A;  3ZIB A;  3LS1 A;  4CDA A;  1GM5 A;  2A0U A;  2M64 A;  5D92 A;  5COM A;  3N24 A;  1MMD A;  4MTO A;  3RFY A;  1FNT c;  5A6A A;  4LLE A;  2Y39 A;  4RBN A;  1O3U A;  5TJ5 E;  1V74 B;  2XLV A;  4PAC A;  2R7U A;  1QSP A;  3WHN A;  3M4C A;  4E17 A;  2EPN A;  2XXA A;  3V5Z A;  4DBR A;  1QQ3 A;  2OKU A;  4P6I C;  2CCY A;  1OXB A;  2EIK C;  2NSG A;  3B71 A;  1A0B A;  3RQE A;  1HE1 A;  1Q0D A;  1E2X A;  3H2U A;  3I4U A;  3ASN C;  2X0C A;  3UNG C;  2OEX A;  4BJT A;  4E7Z A;  4C7O A;  3NYL A;  3H65 A;  3LLI A;  4XTK A;  5B3I A;  3C7J A;  4MVU A;  4WAB A;  4ONS A;  1E84 A;  1YA9 A;  1NFO A;  1OKK D;  4IAQ A;  4XPX A;  1NU9 C;  4BJ5 A;  2PNO A;  1LVK A;  3O39 A;  2GFH A;  1FAP B;  2HFI A;  3G50 A;  4O6Y A;  2DI3 A;  2KW3 C;  4MVO A;  2EIJ C;  3KMI A;  3NMJ A;  1Z63 A;  4C7O B;  2ZXW C;  1U6H A;  1LKX A;  2PBE A;  2QNL A;  5T3T A;  4E7S A;  4U5F E;  1E85 A;  3O55 A;  4OIQ F;  4C3B A;  2L6F A;  4DRH B;  5A6B D;  2R7R A;  1G4W R;  4EHP A;  2P0N A;  2MHR A;  4J32 B;  1L7C A;  4EKW A;  3OEO A;  2J0W A;  4WGY A;  4EUK B;  3U9J A;  1HE9 A;  2G62 A;  2H7O A;  2VH3 A;  3OA1 A;  4FX5 A;  4JTA B;  4U5D E;  3SXK A;  3US6 A;  5L0J A;  1BDJ B;  4JJG A;  4ULV A;  1TWG A;  5L0F A;  4IJJ A;  3DJU B;  1E86 A;  5EHH A;  5E3C A;  3ABK C;  4H54 A;  1PCX A;  2M4E A;  3UGO A;  1I4Z A;  1WWP A;  1LIH A;  1EQ1 A;  3JCU Q;  1Q0F A;  4XWJ A;  3GAN A;  2HUJ A;  3H2V A;  3NYJ A;  4IAR A;  4CS8 A;  2XL6 A;  3LS0 A;  5L0C A;  3FAP B;  3CQZ A;  3SXY A;  1YA7 O;  4CS7 A;  5COF A;  1T5O A;  3GM2 A;  3M79 A;  3S29 A;  1RJ9 A;  2Q4F A;  1T6Q A;  1LI7 A;  2CW0 F;  2J7P A;  3WOD F;  5DS6 A;  1BR4 A;  2LD6 A;  1MMA A;  4PK4 A;  3GOR A;  4DRJ B;  4IGG A;  1GGQ A;  2HV7 A;  1RJ9 B;  1ST6 A;  3HKK A;  3DM5 A;  1DOV A;  3GWL A;  3QVZ A;  1K04 A;  1SMY F;  2GAQ A;  2XS1 A;  4O6M A;  4N06 A;  1VK5 A;  4RD9 A;  5EK0 A;  4GEH A;  1YLM A;  2FAP B;  1T6U A;  2YQY A;  3QZC A;  2V26 A;  5JP7 A;  3TK0 A;  5L3V A;  3M1C B;  5JS5 A;  3EGD A;  2LCH A;  4ANJ A;  1CPR A;  1IZM A;  4PJJ A;  5FZT A;  1RKC A;  1HW2 A;  3LJB A;  3HTK C;  2XLM A;  2XS8 A;  1TFO B;  4JTD B;  3ATP A;  4LER A;  3K33 A;  4OD4 A;  2LP4 A;  3KYJ A;  2XM0 A;  3R2P A;  1S7Z A;  5E33 A;  3EH1 A;  4N4W A;  1K40 A;  1C03 A;  2NUT A;  2OOC A;  3BEH A;  3IHU A;  4W8P A;  2L6G A;  2TMV P;  3JYH A;  2AVK A;  4LDK A;  2DYR C;  1MND A;  5JRA A;  3EJN A;  1QLE C;  1SR2 A;  1ZHW A;  2NUT B;  4XEK A;  2R25 A;  3JRT A;  5L0G A;  4EBB A;  5EGY A;  2I8B A;  1C17 M;  1MMG A;  3RQG A;  1OCC C;  3NG1 A;  3UR3 C;  4QI0 A;  4JJF A;  4YT4 A;  3U5S A;  5JVE A;  4I1O B;  3NMK A;  1ZYR F;  2EIM C;  2HSB A;  4NTF A;  1RKE B;  3NDB B;  2G3V A;  1VYK A;  3JZ0 A;  2O9X A;  4KNV A;  3WAQ A;  2WZG A;  3DM9 B;  3ZC4 A;  1FFH A;  4BPM A;  1BZ4 A;  4C3D A;  4XQ1 A;  4R32 A;  4O7G A;  3TOL A;  5JT4 A;  4G7H F;  3SXM A;  2CGE A;  4Z9J A;  3AG4 C;  4FAP B;  1T9K A;  1A7E A;  2PF4 E;  3L34 A;  3FAJ A;  3GEE A;  4A4A A;  3MBG A;  2R9R B;  1TWC A;  3KPH A;  3EZI A;  3X1O A;  2VAS A;  3L1M A;  5KYW A;  4D4N A;  2XSE A;  2J9V A;  2W9Y A;  3CZ6 A;  1QZX A;  4JCZ A;  4YK5 A;  4I3M A;  1D0X A;  4HFF B;  4JE9 A;  3SEO A;  3ZDL A;  4QDL A;  4U5C E;  3U0C A;  4F4B A;  5AGF A;  3S27 A;  4LDR A;  1ZW3 A;  5AC4 A;  4ZLD A;  1RCP A;  2EPL X;  2BE5 F;  4PJM A;  1JMW A;  1LM3 B;  5DS4 A;  3S90 A;  2W4M A;  4AE4 A;  2C04 A;  2CYD A;  1WGW A;  3ECS A;  4YL1 A;  1MMN A;  2A1D D;  2RD9 A;  1FTS A;  1EA8 A;  3VF0 A;  4CDY A;  5KYY B;  4I44 A;  2V3C C;  4AE4 B;  1JOG A;  3AG3 C;  3V7O A;  1JPJ A;  3TOM A;  4IWB A;  2WZL A;  1LPE A;  1YAU O;  3JSE O;  3K1I A;  3UGP A;  2J7P D;  2KSF A;  4PR9 A;  5JLI A;  3HLZ A;  3C63 A;  2B0H A;  1M6T A;  1A7D A;  1YZA A;  3HNK A;  1AEP A;  1TWH A;  2VC9 A;  3GEH A;  3Q6M A;  2WB7 A;  4P9T A;  3EH2 A;  3UMH A;  2J0X A;  1OW7 A;  2Y3D A;  1KTM A;  3Q7G A;  4DJ9 A;  3M15 A;  3O10 A;  2WVN A;  1JPN A;  3L0I A;  2OEV A;  1VLT A;  2IBF A;  2LQG A;  3K1I C;  3LEV A;  3ABM C;  3LLK A;  1QKR A;  1VB5 A;  3MFN A;  4CBE A;  2YKZ A;  3ASO C;  4N6H A;  4NQF A;  5B3S C;  3W4Y A;  1HMO A;  2YEV A;  4LLC A;  4EBJ A;  3ZVR A;  3ZTZ A;  3EG9 A;  3C62 A;  2NUP A;  2QUP A; 
#chains in the Genus database with same CATH homology
 3CAX A;  3U9J A;  3V5X A;  3U9M A;  3V5Z A;  3V5Y A;  2P0N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...