4WABA

Crystal structure of mpges1 solved by native-sad phasing
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
161
structure length
161
Chain Sequence
SPALPAFLLCSTLLVIKMYVVAIITGQVRLRKKAFANPEDALRHGGPQYCRSDPDVERCLRAHRNDMETIYPFLFLGFVYSFLGPNPFVAWMHFLVFLVGRVAHTVAYLGKLRAPIRSVTYTLAQLPCASMALQILWEAARHFLPAALRAALLGRLRTLRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Prostaglandin E synthase,Leukotriene C4 synthase
publication title Fast native-SAD phasing for routine macromolecular structure determination.
pubmed doi rcsb
source organism Homo sapiens
total genus 67
structure length 161
sequence length 161
ec nomenclature ec 4.4.1.20: Leukotriene-C(4) synthase.
pdb deposition date 2014-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01124 MAPEG MAPEG family
A PF01124 MAPEG MAPEG family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.550 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Membrane associated eicosanoid/glutathione metabolism-like domain 4wabA00
4JCZA 3B29A 3HKKA 2UUHA 5HV9A 4AL0A 2H8AA 4NTAA 4J7TA 4JRZA 4NTBA 3DWWA 5BQGA 4JC7A 4YL0A 4NTFA 5BQIA 4J7YA 4YL3A 4AL1A 4BPMA 2UUIA 5K0IA 3PCVA 2PNOA 3LEOA 4WABA 2Q7RA 4YK5A 4YL1A 5BQHA
chains in the Genus database with same CATH superfamily
2H7VC 4CDYA 2J9WA 2VH3A 3U8VA 3ASOC 4U5FE 2R7WA 1TWCA 2PX0A 1PD1A 4Z9HA 4CIPA 1E84A 3TJ6A 2J9VA 1Q0GA 3ZC4A 2AWYA 1TFOB 4OIOF 3GWLA 2WVOA 5B3SC 2G3KA 2FGYA 2M64A 3O55A 5COMA 1TFKB 2A68F 1WOLA 2DYRC 3HNIA 4CX9A 2NSFA 4D4XA 2YEVA 1E86A 3NRHA 3S90A 2IXOA 1RXQA 5T1DB 3MLGA 5AC4A 5FCLA 3H2VA 4CJGA 1NU7D 3US6A 2R03A 3AG3C 4YL3A 1JOGA 3EPVA 3K6BA 4O7GA 4U5CE 1J8YF 1ZU4A 3FVYA 3DKAA 3CZ6A 3NKEA 3EG9B 4HFKB 1D1BA 3CQZA 5D92A 4DVZA 2ZXPA 2A0UA 2XLDA 3KL4A 2W4MA 4MNDA 3SXMA 2LQGA 3E70C 4JW1A 2ZD9A 2HMZA 3RYLA 1SR2A 1H6GA 2UUHA 1U0BB 4H4KC 1A0BA 3VF0A 4JVSA 2F22A 3EG9A 2X0CA 4PK4A 2R25A 4J7TA 2J7PD 3TULA 2H7BA 4PJLA 5IY5C 1FMVA 4NC3A 3SYNA 5CI8A 5EHHA 3Q6MA 3FHDA 2J45A 2HS5A 3WG7C 2CW0F 2YL1A 5DS6A 3LLKA 4JEAA 1YVIA 1IW7F 1H7IA 1B68A 2PF4E 3LLIA 4EBKA 1VK5A 4MVRA 5A6BA 1LVKA 1AUEA 2IM8A 2AP3A 5L0IA 3LNMB 4PJNA 3IHUA 1BDJB 1ZHWA 1SYQA 2JPUA 2CYDA 1GQAA 2NG1A 4N4WA 3QMKA 4M63A 2GDCA 4BJTA 5A6JA 2DI3A 2IOQA 2Q3TA 4QI0A 3H2UA 3DM5A 2YKZA 4HEAJ 2XL8A 3HNKA 2B0HA 2L9JA 2LFDA 3VM6A 4C3EA 1OCCC 2L7AA 4WGYA 2EIMC 5DVWA 1J8MF 1M2VB 2MWQA 3NMIA 4JC7A 4ULWA 1YZAA 1ZHTA 4EKWA 1APCA 1W2WA 2PBEA 2EPOA 3B9QA 3GEIA 3NMKA 1V55C 2J46A 2LK4A 2R05A 3HJCA 1U89A 4NQFA 3W2VA 5L3QA 2R7RA 1VYIA 1BR1A 1Q0FA 4PJMA 4X0RA 4W8PA 1WTYA 2ETSA 1M2VA 1ZU5A 2DGJA 2ZPAA 5T3TA 4BG0A 3C8ZA 4C3BA 3U2LA 4DXWA 1HMDA 2CDQA 3IEEA 3IQ5A 2LIGA 4U9EA 3NYJA 3EZHA 2J0WA 4J30B 4U5BE 2WVQA 3Q7GA 1IZMA 1TWGA 2QE9A 3M79A 4O79A 1LE2A 1ZHYA 2J9UA 4CIHA 3S27A 4UDVA 256BA 3LESA 2KW3C 5L0JA 4OINF 3LUTB 3B0VC 4O6MA 3U9JA 3ZTMA 1JR8A 4JZAA 4CS8C 4U9DA 3DE9A 3TJ5A 1QPUA 2AU5A 2OCCC 3UNGC 2NSGA 1F1MA 2XLWA 1VB5A 5KYWB 3QW0A 3U8PA 4BJ5A 1A7DA 4A4AA 3ZG1A 2PP4A 3PMRA 4JURI 3TQOA 4IARA 3ZVRA 2XLEA 3UMHA 4JKVA 4H54A 3RVYA 3Q6NA 4QDLA 4YK5A 2Q7RA 2OOCA 2I15A 4GYTA 3TD7A 1G8XA 1TR2A 3I4UA 3GWNA 4IB4A 4G0HA 4MTFA 1T6IA 2Y3HA 4YJWA 3V5ZA 4BEJA 1VYKA 1NBBA 5KYWA 1H9TA 1T01A 4F4BA 2YLGA 1OKKA 1V74B 2HFIA 3VYWA 4CSAA 3V7OA 3KYJA 3RVZA 3BRJA 5COGA 4IRUA 5E3CA 2RSEB 3I5QA 1S05A 3OWTA 4JIOA 4EBJA 5B3IA 3OEOA 2EPLX 2YL0A 2OKUA 3MX3A 3N2ZB 3VRCA 2P6VA 2M4EA 2VB6A 5E3AA 3VAYA 4IAQA 5BUOA 2HSBA 2W9YA 3F47A 3LAYA 5EGYA 3S84A 4CBEA 4MTOA 2XRHA 4LDKA 3KPHA 1K05A 1MNEA 4CJOA 4W8KA 1NZEA 1C03A 3EGXB 4IWBA 2HJ3A 4NCQA 2I8BA 1CGNA 2CGEA 2XLMA 4YL1A 3V5YA 1JRAA 2DYSC 2Z15A 3K1HA 1M6TA 1LI7A 1OXBA 1PCXA 1VMAA 1Q0DA 4N6CA 3WHNA 5KYXA 1H9GA 3M1CB 2YRFA 3EGXA 1ORYA 4P9FA 4K0DA 3LS0A 4ULVA 2BE5F 3EFOB 3A11A 3ITFA 3AG4C 4I1OB 1RKCA 4U5EE 4ANJA 1LPEA 1VOMA 4CDAA 1BR4A 2WZLA 3ECSA 3ATPA 4Q5SF 1LIHA 2L81A 2ZXRA 4I1MA 1MMDA 3K33A 2XM0A 1OCOC 4OIRF 5A6AA 2HKVA 1M57C 2X51A 1I4ZA 1K40A 2J7PA 2IXNA 2FAPB 2KJGA 3GM1A 3ZWIA 1OR3A 3JSEO 5BQIA 3EFOA 3SEOA 1QQ3A 2R7SA 4Z9JA 2A6EF 3RQEA 3FDQA 1YAUO 4P6IC 5KYYB 3POVA 1EA8A 1Q0KA 1K04A 4OD4A 1MMAA 1NFNA 2V26A 2EIJC 2E87A 3MFNA 4BJ6C 4YWQA 2A6HF 3JYHA 4IGGA 4DOZA 1WATA 4JTDB 4K7BA 3F46A 1AEPA 2R7OA 4LDRA 3DXJF 4RBNA 3SNHA 1QLEC 1D0YA 3C7JA 5D91A 4KNVA 1D0ZA 4MW8A 1G4US 2H7OA 3RIPA 2YL3A 2OQMA 2XL4A 1BBHA 1S7ZA 1BR2A 2Y69C 4DVYP 1KU2A 4C3DA 5JUAA 4LLCA 4MVZA 1HW2A 1R5ID 4AL1A 4KNWA 5K0IA 4P9TA 2PNOA 1OW7A 1KTMA 2Q9AA 2XXAB 2WVNA 4I44A 4YT8A 3RQFA 1Y6DA 1FAPB 1MMNA 3IQ6A 2QTVA 1ORSC 3S0XA 3T9OA 3KMIA 4O6YA 2DB4A 3HLZA 3NG1A 4CS9C 1TWAA 5L0GA 3SZRA 1UG7A 4L6RA 2Q00A 5E2QA 4EIYA 3EH2A 2G3VA 1I4YA 2GFHA 2IBFA 1G4WR 3U2MA 2XXAA 3KKBA 3U5SA 3NYMA 2XL6A 1Z7Qc 1OW8A 4PJJA 4E0HA 2AWCA 4Q7CA 4CS9A 1ORJA 2WZFA 3MYFA 1NU9C 3JTLO 2YL7A 1MQVA 3X2QC 4BEMJ 5L0HA 1CGME 3L8IA 1GM5A 3PDMP 2R7TA 3QVYA 4WJ0A 3FAJA 1RMVA 1D1CA 3DD7A 2OG2A 3PCVA 4ER9A 3A9CA 3CEXA 3LEOA 1YLMA 3O39A 1NFOA 2KGOA 3NMJA 1L3PA 1T9KA 1LS4A 4XEVA 2D4UA 2HUJA 1QVXA 3UGPA 1T6UA 2G62A 3NKDA 1ZYRF 3AGUA 1EQ1A 2VC9A 1CPQA 3U0CA 2H8AA 4DJ9A 3L34A 4MVSA 3ZQYA 2EPNA 4XLNF 1C17M 4YT2A 3W4YA 5HSWA 2PX3A 3UMIA 2V3CC 2R7UA 1OQCA 5L0DA 1NSGB 2BC5A 4DBQA 3EHNA 3GM3A 3T6GB 4BJ1A 3JT1A 3JZ0A 2Y3GA 2HV7A 3BEHA 2IXMA 3IPMO 4JCHA 2VCCA 5CI9A 3TK0A 5JT4A 4BPMA 2GAQA 3AQBA 5KYNA 4CS8A 3AG1C 1HMOA 4RDAA 1T6QA 1ZW2A 1OXKA 2Q9BA 1SF8A 2C04A 2XM4A 2Y3DA 2R02A 1UFBA 3RFYA 1HE1A 1Z6AA 3CAXA 3FXHA 3SXYA 2MYSA 3WAQA 1YYJA 1FMWA 1WASA 4YN0B 2BL2A 3DE8A 3Q7LA 1CPRA 3B0UX 2YLIA 3JCUQ 4ZLDA 3L0IA 3C8GD 5T3WA 4RD9A 4G7OF 4E18A 4JE9A 1QSPA 1A41A 2EIKC 2QY9A 2O9XA 3B71A 4XQ1A 4E0IA 4EWCA 4AX2A 1YZCA 3AQCA 3WODF 3K1IC 1ZHXA 1VTMP 1SMYF 2C03A 3GEHA 1JPJA 3EHMA 2QNLA 2YLDA 1AVOB 3ABMC 4Q4ZF 1YDIA 2XLOA 3AOUA 4WABA 3EH1A 1A7VA 3KH2A 3M4CA 2XLHA 1D1AA 3GEEA 3JRTA 4AE4B 1OR2A 4DBRA 5JRAA 1ZZPA 4D4NA 3HTKC 1YA9A 2KC3A 2YQYA 1M2OA 3DM9B 1LE4A 2Q4FA 3QVZA 5TJ5E 1NG1A 4AL0A 3DJUB 3SXKA 3W2WA 4AE4A 5JSLA 3C62A 4Z9IA 2OEXA 3GM2A 3RF3A 3R7CA 3RW0A 5CIVA 4JRZA 4LLEA 4JJGA 4O6NA 2D5RB 4MVUA 5KYUB 5DS4A 4OD5A 3ZDLA 4JTCB 4NY3A 4FAPB 5L0FA 1LS1A 2A0BA 2J0XA 4K1OA 2TMVP 2L6GA 1PV3A 3T6BA 2B0JA 4PFPA 4MTGA 3TOLA 2RD9A 2MHRA 5F28E 5AC5A 4FESA 4MW3A 2CCYA 2IYLD 1O5HA 1RJ9B 4LACB 1YJGA 4MVQA 5KYUA 3GORA 4CS7A 4EHPA 1HW1A 1DOVA 1R4TA 3IQTA 3TOMA 3NDBB 3ZTZA 3ABKC 2L6HA 5JVEA 3LNRA 1MNDA 5E33A 2KK1A 4B6IA 3QTHA 1YARO 2QLAA 2HZ8A 3JSZA 3U9MA 4QI2A 1RJ9A 2CNWD 4XTKA 5FZTA 2P0NA 3AG2C 4KBLA 5B1BC 5KYYA 1ST6A 3NYLA 4XPYA 3JRMO 1FR0A 1T5OA 2EINC 1Z23A 2FFHA 4LDQA 5B1AC 4BJ6A 4MS2A 3KYIA 5JS5A 2EPMX 1JAFA 2A1DD 4J32B 3E9VA 4XEFA 2LCHA 3M4BA 4G78A 2LSEA 4U5GA 2YHSA 4FX5A 3JYYA 3C63A 3RKOF 2LD6A 3EGDB 1V4AA 2ZXWC 2W45A 2Q9CA 5AGFA 3UGOA 1Z3IX 5BQHA 2NUPB 2OEVA 3N0TA 3H65A 3UMKA 2XSEA 3DJNB 3T4RA 5JP7A 3B0PA 4DRJB 4JTAB 1TQGA 2EPKX 3R2PA 3G50A 2KSFA 3FMSA 5JLIA 3EGDA 4R32A 3T6JA 2QUPA 5HV9A 2YVKA 4WGZA 1N1CA 4NTAA 2XLVA 2NUPA 2NUTB 3FOPA 1QKRA 4MVOA 1Z5ZA 2ZXOA 1HE9A 2GWWA 2P7VA 3C18A 4XEKA 5L0CA 2ICWG 2IXPA 3V5XA 1SZIA 1QZXA 3AGTA 3DMDA 4YT5A 3DI5A 2KYHA 3AJMA 3QW1A 4EUKB 1L7CA 1M56C 1WGWA 1I5NA 2W4BA 4PR9A 3O6XA 2NUTA 3ABLC 1V54C 4N06A 5EK0A 2LP4A 1LKXA 3DZAA 1A7EA 2VCAA 4IAOA 1XZQA 4A2NB 5DLJA 1Q0MA 3EZIA 3LS1A 2YWAA 1C02A 3RQGA 5L3VA 4OIPF 2LFFA 5DQTA 4C7OB 4ONSA 1KNYA 2HMQA 4XPXA 3S29A 3B29A 3LEVA 4KC9A 1YYXA 1YA7O 3HKKA 4XWJA 3M15A 5DQZA 2Y39A 3C8GB 2VCBA 2KQ9A 4PFOA 1Y4CA 3RH3A 3MBGA 4DRHB 3GODA 1U6HA 4XLPF 4C7OA 4JEBA 5BQGA 1O87A 5A6BD 2HV6A 2P61A 1BZ4A 4GEHA 1ZW3A 1FTSA 1TKNA 3C8GA 3HNJA 2UUIA 4GQHA 4PACA 4YT4A 4OIQF 1WWPA 3DAGA 2XS1A 1DOWA 3FAPB 4U5DE 4IJJA 4FWVA 3ZSUA 1D0XA 2Y3BA 1G5ZA 1LM3B 2OU6A 2P1AA 4U5HA 5COFA 2HSQA 1E83A 1Z63A 2L6FA 2KNHA 3N24A 3S9OA 3G4ZA 1OCRC 3PHF2 4LERA 4E17A 1RCPA 1EI7A 2J9BA 3S28A 3U3BA 4I3MA 2R9RB 3U3FA 1VLSA 3QZCA 5GPGB 1ZHZA 4ZLCA 3IQCA 3UR3C 4BJ5C 5DS5A 4DRIB 2WZGA 3SXZA 3L8JA 2R7QA 2JX0A 2OJQA 3DWWA 3SP1A 3EJNA 1E85A 4G7ZF 2EILC 2GA0A 3K66A 2JD3A 2AVKA 3EQLF 4J7YA 5A6KA 4CDVA 2YZSA 4HFFB 2R7XA 2PFDA 4HE8D 5F5HA 4CSAC 3OA1A 3LJBA 1OCZC 2A69F 1JPNA 2XS8A 1GS9A 1O3UA 3O10A 1MMGA 4JCZA 3K1IA 2NPUA 4KI2A 2HJMA 3L1MA 2WB7A 3CSKA 4E7ZA 1PD0A 1XWJA 4AK9A 3J06A 1CGOA 1ZVZA 3DAFA 1WN0A 4XPWA 1RKEB 1FFTC 3ASNC 1GGQA 4G7HF 2J8WA 2WL8A 2ASRA 4MVMA 3K7DA 4N6HA 4NTBA 1FFHA 5A69A 3G4XA 4JJFA 4MQ9F 3FOOA 1VLTA 2VASA 1OW6A 1XZPA 2CNWA 1LI5A 4YL0A 4NTFA 1FNTc 1E2XA 1TWHA 2R7VA 1EKYA 1RKEA 3W8IA 1HY5A 4E7SA 5KYXB 3ZIBA 3X1OA 3W8HA 4EBBA 5F5FA 1NLXA 1OKKD 2OJED 3HNLA 3MYIA 3ZQVA 3I5PA 3GANA 1JMWA
chains in the Genus database with same CATH topology
4JCZA 3B29A 3HKKA 2UUHA 5HV9A 4AL0A 2H8AA 4NTAA 4J7TA 4JRZA 4NTBA 3DWWA 5BQGA 4JC7A 4YL0A 4NTFA 5BQIA 4J7YA 4YL3A 4AL1A 4BPMA 2UUIA 5K0IA 3PCVA 2PNOA 3LEOA 4WABA 2Q7RA 4YK5A 4YL1A 5BQHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JCZ A;  3B29 A;  3HKK A;  2UUH A;  5HV9 A;  4AL0 A;  2H8A A;  4NTA A;  4J7T A;  4JRZ A;  4NTB A;  3DWW A;  5BQG A;  4JC7 A;  4YL0 A;  4NTF A;  5BQI A;  4J7Y A;  4YL3 A;  4AL1 A;  4BPM A;  2UUI A;  5K0I A;  3PCV A;  2PNO A;  3LEO A;  4WAB A;  2Q7R A;  4YK5 A;  4YL1 A;  5BQH A; 
#chains in the Genus database with same CATH topology
 2H7V C;  4CDY A;  2J9W A;  2VH3 A;  3U8V A;  3ASO C;  4U5F E;  2R7W A;  1TWC A;  2PX0 A;  1PD1 A;  4Z9H A;  4CIP A;  1E84 A;  3TJ6 A;  2J9V A;  1Q0G A;  3ZC4 A;  2AWY A;  1TFO B;  4OIO F;  3GWL A;  2WVO A;  5B3S C;  2G3K A;  2FGY A;  2M64 A;  3O55 A;  5COM A;  1TFK B;  2A68 F;  1WOL A;  2DYR C;  3HNI A;  4CX9 A;  2NSF A;  4D4X A;  2YEV A;  1E86 A;  3NRH A;  3S90 A;  2IXO A;  1RXQ A;  5T1D B;  3MLG A;  5AC4 A;  5FCL A;  3H2V A;  4CJG A;  1NU7 D;  3US6 A;  2R03 A;  3AG3 C;  4YL3 A;  1JOG A;  3EPV A;  3K6B A;  4O7G A;  4U5C E;  1J8Y F;  1ZU4 A;  3FVY A;  3DKA A;  3CZ6 A;  3NKE A;  3EG9 B;  4HFK B;  1D1B A;  3CQZ A;  5D92 A;  4DVZ A;  2ZXP A;  2A0U A;  2XLD A;  3KL4 A;  2W4M A;  4MND A;  3SXM A;  2LQG A;  3E70 C;  4JW1 A;  2ZD9 A;  2HMZ A;  3RYL A;  1SR2 A;  1H6G A;  2UUH A;  1U0B B;  4H4K C;  1A0B A;  3VF0 A;  4JVS A;  2F22 A;  3EG9 A;  2X0C A;  4PK4 A;  2R25 A;  4J7T A;  2J7P D;  3TUL A;  2H7B A;  4PJL A;  5IY5 C;  1FMV A;  4NC3 A;  3SYN A;  5CI8 A;  5EHH A;  3Q6M A;  3FHD A;  2J45 A;  2HS5 A;  3WG7 C;  2CW0 F;  2YL1 A;  5DS6 A;  3LLK A;  4JEA A;  1YVI A;  1IW7 F;  1H7I A;  1B68 A;  2PF4 E;  3LLI A;  4EBK A;  1VK5 A;  4MVR A;  5A6B A;  1LVK A;  1AUE A;  2IM8 A;  2AP3 A;  5L0I A;  3LNM B;  4PJN A;  3IHU A;  1BDJ B;  1ZHW A;  1SYQ A;  2JPU A;  2CYD A;  1GQA A;  2NG1 A;  4N4W A;  3QMK A;  4M63 A;  2GDC A;  4BJT A;  5A6J A;  2DI3 A;  2IOQ A;  2Q3T A;  4QI0 A;  3H2U A;  3DM5 A;  2YKZ A;  4HEA J;  2XL8 A;  3HNK A;  2B0H A;  2L9J A;  2LFD A;  3VM6 A;  4C3E A;  1OCC C;  2L7A A;  4WGY A;  2EIM C;  5DVW A;  1J8M F;  1M2V B;  2MWQ A;  3NMI A;  4JC7 A;  4ULW A;  1YZA A;  1ZHT A;  4EKW A;  1APC A;  1W2W A;  2PBE A;  2EPO A;  3B9Q A;  3GEI A;  3NMK A;  1V55 C;  2J46 A;  2LK4 A;  2R05 A;  3HJC A;  1U89 A;  4NQF A;  3W2V A;  5L3Q A;  2R7R A;  1VYI A;  1BR1 A;  1Q0F A;  4PJM A;  4X0R A;  4W8P A;  1WTY A;  2ETS A;  1M2V A;  1ZU5 A;  2DGJ A;  2ZPA A;  5T3T A;  4BG0 A;  3C8Z A;  4C3B A;  3U2L A;  4DXW A;  1HMD A;  2CDQ A;  3IEE A;  3IQ5 A;  2LIG A;  4U9E A;  3NYJ A;  3EZH A;  2J0W A;  4J30 B;  4U5B E;  2WVQ A;  3Q7G A;  1IZM A;  1TWG A;  2QE9 A;  3M79 A;  4O79 A;  1LE2 A;  1ZHY A;  2J9U A;  4CIH A;  3S27 A;  4UDV A;  256B A;  3LES A;  2KW3 C;  5L0J A;  4OIN F;  3LUT B;  3B0V C;  4O6M A;  3U9J A;  3ZTM A;  1JR8 A;  4JZA A;  4CS8 C;  4U9D A;  3DE9 A;  3TJ5 A;  1QPU A;  2AU5 A;  2OCC C;  3UNG C;  2NSG A;  1F1M A;  2XLW A;  1VB5 A;  5KYW B;  3QW0 A;  3U8P A;  4BJ5 A;  1A7D A;  4A4A A;  3ZG1 A;  2PP4 A;  3PMR A;  4JUR I;  3TQO A;  4IAR A;  3ZVR A;  2XLE A;  3UMH A;  4JKV A;  4H54 A;  3RVY A;  3Q6N A;  4QDL A;  4YK5 A;  2Q7R A;  2OOC A;  2I15 A;  4GYT A;  3TD7 A;  1G8X A;  1TR2 A;  3I4U A;  3GWN A;  4IB4 A;  4G0H A;  4MTF A;  1T6I A;  2Y3H A;  4YJW A;  3V5Z A;  4BEJ A;  1VYK A;  1NBB A;  5KYW A;  1H9T A;  1T01 A;  4F4B A;  2YLG A;  1OKK A;  1V74 B;  2HFI A;  3VYW A;  4CSA A;  3V7O A;  3KYJ A;  3RVZ A;  3BRJ A;  5COG A;  4IRU A;  5E3C A;  2RSE B;  3I5Q A;  1S05 A;  3OWT A;  4JIO A;  4EBJ A;  5B3I A;  3OEO A;  2EPL X;  2YL0 A;  2OKU A;  3MX3 A;  3N2Z B;  3VRC A;  2P6V A;  2M4E A;  2VB6 A;  5E3A A;  3VAY A;  4IAQ A;  5BUO A;  2HSB A;  2W9Y A;  3F47 A;  3LAY A;  5EGY A;  3S84 A;  4CBE A;  4MTO A;  2XRH A;  4LDK A;  3KPH A;  1K05 A;  1MNE A;  4CJO A;  4W8K A;  1NZE A;  1C03 A;  3EGX B;  4IWB A;  2HJ3 A;  4NCQ A;  2I8B A;  1CGN A;  2CGE A;  2XLM A;  4YL1 A;  3V5Y A;  1JRA A;  2DYS C;  2Z15 A;  3K1H A;  1M6T A;  1LI7 A;  1OXB A;  1PCX A;  1VMA A;  1Q0D A;  4N6C A;  3WHN A;  5KYX A;  1H9G A;  3M1C B;  2YRF A;  3EGX A;  1ORY A;  4P9F A;  4K0D A;  3LS0 A;  4ULV A;  2BE5 F;  3EFO B;  3A11 A;  3ITF A;  3AG4 C;  4I1O B;  1RKC A;  4U5E E;  4ANJ A;  1LPE A;  1VOM A;  4CDA A;  1BR4 A;  2WZL A;  3ECS A;  3ATP A;  4Q5S F;  1LIH A;  2L81 A;  2ZXR A;  4I1M A;  1MMD A;  3K33 A;  2XM0 A;  1OCO C;  4OIR F;  5A6A A;  2HKV A;  1M57 C;  2X51 A;  1I4Z A;  1K40 A;  2J7P A;  2IXN A;  2FAP B;  2KJG A;  3GM1 A;  3ZWI A;  1OR3 A;  3JSE O;  5BQI A;  3EFO A;  3SEO A;  1QQ3 A;  2R7S A;  4Z9J A;  2A6E F;  3RQE A;  3FDQ A;  1YAU O;  4P6I C;  5KYY B;  3POV A;  1EA8 A;  1Q0K A;  1K04 A;  4OD4 A;  1MMA A;  1NFN A;  2V26 A;  2EIJ C;  2E87 A;  3MFN A;  4BJ6 C;  4YWQ A;  2A6H F;  3JYH A;  4IGG A;  4DOZ A;  1WAT A;  4JTD B;  4K7B A;  3F46 A;  1AEP A;  2R7O A;  4LDR A;  3DXJ F;  4RBN A;  3SNH A;  1QLE C;  1D0Y A;  3C7J A;  5D91 A;  4KNV A;  1D0Z A;  4MW8 A;  1G4U S;  2H7O A;  3RIP A;  2YL3 A;  2OQM A;  2XL4 A;  1BBH A;  1S7Z A;  1BR2 A;  2Y69 C;  4DVY P;  1KU2 A;  4C3D A;  5JUA A;  4LLC A;  4MVZ A;  1HW2 A;  1R5I D;  4AL1 A;  4KNW A;  5K0I A;  4P9T A;  2PNO A;  1OW7 A;  1KTM A;  2Q9A A;  2XXA B;  2WVN A;  4I44 A;  4YT8 A;  3RQF A;  1Y6D A;  1FAP B;  1MMN A;  3IQ6 A;  2QTV A;  1ORS C;  3S0X A;  3T9O A;  3KMI A;  4O6Y A;  2DB4 A;  3HLZ A;  3NG1 A;  4CS9 C;  1TWA A;  5L0G A;  3SZR A;  1UG7 A;  4L6R A;  2Q00 A;  5E2Q A;  4EIY A;  3EH2 A;  2G3V A;  1I4Y A;  2GFH A;  2IBF A;  1G4W R;  3U2M A;  2XXA A;  3KKB A;  3U5S A;  3NYM A;  2XL6 A;  1Z7Q c;  1OW8 A;  4PJJ A;  4E0H A;  2AWC A;  4Q7C A;  4CS9 A;  1ORJ A;  2WZF A;  3MYF A;  1NU9 C;  3JTL O;  2YL7 A;  1MQV A;  3X2Q C;  4BEM J;  5L0H A;  1CGM E;  3L8I A;  1GM5 A;  3PDM P;  2R7T A;  3QVY A;  4WJ0 A;  3FAJ A;  1RMV A;  1D1C A;  3DD7 A;  2OG2 A;  3PCV A;  4ER9 A;  3A9C A;  3CEX A;  3LEO A;  1YLM A;  3O39 A;  1NFO A;  2KGO A;  3NMJ A;  1L3P A;  1T9K A;  1LS4 A;  4XEV A;  2D4U A;  2HUJ A;  1QVX A;  3UGP A;  1T6U A;  2G62 A;  3NKD A;  1ZYR F;  3AGU A;  1EQ1 A;  2VC9 A;  1CPQ A;  3U0C A;  2H8A A;  4DJ9 A;  3L34 A;  4MVS A;  3ZQY A;  2EPN A;  4XLN F;  1C17 M;  4YT2 A;  3W4Y A;  5HSW A;  2PX3 A;  3UMI A;  2V3C C;  2R7U A;  1OQC A;  5L0D A;  1NSG B;  2BC5 A;  4DBQ A;  3EHN A;  3GM3 A;  3T6G B;  4BJ1 A;  3JT1 A;  3JZ0 A;  2Y3G A;  2HV7 A;  3BEH A;  2IXM A;  3IPM O;  4JCH A;  2VCC A;  5CI9 A;  3TK0 A;  5JT4 A;  4BPM A;  2GAQ A;  3AQB A;  5KYN A;  4CS8 A;  3AG1 C;  1HMO A;  4RDA A;  1T6Q A;  1ZW2 A;  1OXK A;  2Q9B A;  1SF8 A;  2C04 A;  2XM4 A;  2Y3D A;  2R02 A;  1UFB A;  3RFY A;  1HE1 A;  1Z6A A;  3CAX A;  3FXH A;  3SXY A;  2MYS A;  3WAQ A;  1YYJ A;  1FMW A;  1WAS A;  4YN0 B;  2BL2 A;  3DE8 A;  3Q7L A;  1CPR A;  3B0U X;  2YLI A;  3JCU Q;  4ZLD A;  3L0I A;  3C8G D;  5T3W A;  4RD9 A;  4G7O F;  4E18 A;  4JE9 A;  1QSP A;  1A41 A;  2EIK C;  2QY9 A;  2O9X A;  3B71 A;  4XQ1 A;  4E0I A;  4EWC A;  4AX2 A;  1YZC A;  3AQC A;  3WOD F;  3K1I C;  1ZHX A;  1VTM P;  1SMY F;  2C03 A;  3GEH A;  1JPJ A;  3EHM A;  2QNL A;  2YLD A;  1AVO B;  3ABM C;  4Q4Z F;  1YDI A;  2XLO A;  3AOU A;  4WAB A;  3EH1 A;  1A7V A;  3KH2 A;  3M4C A;  2XLH A;  1D1A A;  3GEE A;  3JRT A;  4AE4 B;  1OR2 A;  4DBR A;  5JRA A;  1ZZP A;  4D4N A;  3HTK C;  1YA9 A;  2KC3 A;  2YQY A;  1M2O A;  3DM9 B;  1LE4 A;  2Q4F A;  3QVZ A;  5TJ5 E;  1NG1 A;  4AL0 A;  3DJU B;  3SXK A;  3W2W A;  4AE4 A;  5JSL A;  3C62 A;  4Z9I A;  2OEX A;  3GM2 A;  3RF3 A;  3R7C A;  3RW0 A;  5CIV A;  4JRZ A;  4LLE A;  4JJG A;  4O6N A;  2D5R B;  4MVU A;  5KYU B;  5DS4 A;  4OD5 A;  3ZDL A;  4JTC B;  4NY3 A;  4FAP B;  5L0F A;  1LS1 A;  2A0B A;  2J0X A;  4K1O A;  2TMV P;  2L6G A;  1PV3 A;  3T6B A;  2B0J A;  4PFP A;  4MTG A;  3TOL A;  2RD9 A;  2MHR A;  5F28 E;  5AC5 A;  4FES A;  4MW3 A;  2CCY A;  2IYL D;  1O5H A;  1RJ9 B;  4LAC B;  1YJG A;  4MVQ A;  5KYU A;  3GOR A;  4CS7 A;  4EHP A;  1HW1 A;  1DOV A;  1R4T A;  3IQT A;  3TOM A;  3NDB B;  3ZTZ A;  3ABK C;  2L6H A;  5JVE A;  3LNR A;  1MND A;  5E33 A;  2KK1 A;  4B6I A;  3QTH A;  1YAR O;  2QLA A;  2HZ8 A;  3JSZ A;  3U9M A;  4QI2 A;  1RJ9 A;  2CNW D;  4XTK A;  5FZT A;  2P0N A;  3AG2 C;  4KBL A;  5B1B C;  5KYY A;  1ST6 A;  3NYL A;  4XPY A;  3JRM O;  1FR0 A;  1T5O A;  2EIN C;  1Z23 A;  2FFH A;  4LDQ A;  5B1A C;  4BJ6 A;  4MS2 A;  3KYI A;  5JS5 A;  2EPM X;  1JAF A;  2A1D D;  4J32 B;  3E9V A;  4XEF A;  2LCH A;  3M4B A;  4G78 A;  2LSE A;  4U5G A;  2YHS A;  4FX5 A;  3JYY A;  3C63 A;  3RKO F;  2LD6 A;  3EGD B;  1V4A A;  2ZXW C;  2W45 A;  2Q9C A;  5AGF A;  3UGO A;  1Z3I X;  5BQH A;  2NUP B;  2OEV A;  3N0T A;  3H65 A;  3UMK A;  2XSE A;  3DJN B;  3T4R A;  5JP7 A;  3B0P A;  4DRJ B;  4JTA B;  1TQG A;  2EPK X;  3R2P A;  3G50 A;  2KSF A;  3FMS A;  5JLI A;  3EGD A;  4R32 A;  3T6J A;  2QUP A;  5HV9 A;  2YVK A;  4WGZ A;  1N1C A;  4NTA A;  2XLV A;  2NUP A;  2NUT B;  3FOP A;  1QKR A;  4MVO A;  1Z5Z A;  2ZXO A;  1HE9 A;  2GWW A;  2P7V A;  3C18 A;  4XEK A;  5L0C A;  2ICW G;  2IXP A;  3V5X A;  1SZI A;  1QZX A;  3AGT A;  3DMD A;  4YT5 A;  3DI5 A;  2KYH A;  3AJM A;  3QW1 A;  4EUK B;  1L7C A;  1M56 C;  1WGW A;  1I5N A;  2W4B A;  4PR9 A;  3O6X A;  2NUT A;  3ABL C;  1V54 C;  4N06 A;  5EK0 A;  2LP4 A;  1LKX A;  3DZA A;  1A7E A;  2VCA A;  4IAO A;  1XZQ A;  4A2N B;  5DLJ A;  1Q0M A;  3EZI A;  3LS1 A;  2YWA A;  1C02 A;  3RQG A;  5L3V A;  4OIP F;  2LFF A;  5DQT A;  4C7O B;  4ONS A;  1KNY A;  2HMQ A;  4XPX A;  3S29 A;  3B29 A;  3LEV A;  4KC9 A;  1YYX A;  1YA7 O;  3HKK A;  4XWJ A;  3M15 A;  5DQZ A;  2Y39 A;  3C8G B;  2VCB A;  2KQ9 A;  4PFO A;  1Y4C A;  3RH3 A;  3MBG A;  4DRH B;  3GOD A;  1U6H A;  4XLP F;  4C7O A;  4JEB A;  5BQG A;  1O87 A;  5A6B D;  2HV6 A;  2P61 A;  1BZ4 A;  4GEH A;  1ZW3 A;  1FTS A;  1TKN A;  3C8G A;  3HNJ A;  2UUI A;  4GQH A;  4PAC A;  4YT4 A;  4OIQ F;  1WWP A;  3DAG A;  2XS1 A;  1DOW A;  3FAP B;  4U5D E;  4IJJ A;  4FWV A;  3ZSU A;  1D0X A;  2Y3B A;  1G5Z A;  1LM3 B;  2OU6 A;  2P1A A;  4U5H A;  5COF A;  2HSQ A;  1E83 A;  1Z63 A;  2L6F A;  2KNH A;  3N24 A;  3S9O A;  3G4Z A;  1OCR C;  3PHF 2;  4LER A;  4E17 A;  1RCP A;  1EI7 A;  2J9B A;  3S28 A;  3U3B A;  4I3M A;  2R9R B;  3U3F A;  1VLS A;  3QZC A;  5GPG B;  1ZHZ A;  4ZLC A;  3IQC A;  3UR3 C;  4BJ5 C;  5DS5 A;  4DRI B;  2WZG A;  3SXZ A;  3L8J A;  2R7Q A;  2JX0 A;  2OJQ A;  3DWW A;  3SP1 A;  3EJN A;  1E85 A;  4G7Z F;  2EIL C;  2GA0 A;  3K66 A;  2JD3 A;  2AVK A;  3EQL F;  4J7Y A;  5A6K A;  4CDV A;  2YZS A;  4HFF B;  2R7X A;  2PFD A;  4HE8 D;  5F5H A;  4CSA C;  3OA1 A;  3LJB A;  1OCZ C;  2A69 F;  1JPN A;  2XS8 A;  1GS9 A;  1O3U A;  3O10 A;  1MMG A;  4JCZ A;  3K1I A;  2NPU A;  4KI2 A;  2HJM A;  3L1M A;  2WB7 A;  3CSK A;  4E7Z A;  1PD0 A;  1XWJ A;  4AK9 A;  3J06 A;  1CGO A;  1ZVZ A;  3DAF A;  1WN0 A;  4XPW A;  1RKE B;  1FFT C;  3ASN C;  1GGQ A;  4G7H F;  2J8W A;  2WL8 A;  2ASR A;  4MVM A;  3K7D A;  4N6H A;  4NTB A;  1FFH A;  5A69 A;  3G4X A;  4JJF A;  4MQ9 F;  3FOO A;  1VLT A;  2VAS A;  1OW6 A;  1XZP A;  2CNW A;  1LI5 A;  4YL0 A;  4NTF A;  1FNT c;  1E2X A;  1TWH A;  2R7V A;  1EKY A;  1RKE A;  3W8I A;  1HY5 A;  4E7S A;  5KYX B;  3ZIB A;  3X1O A;  3W8H A;  4EBB A;  5F5F A;  1NLX A;  1OKK D;  2OJE D;  3HNL A;  3MYI A;  3ZQV A;  3I5P A;  3GAN A;  1JMW A; 
#chains in the Genus database with same CATH homology
 4JCZ A;  3B29 A;  3HKK A;  2UUH A;  5HV9 A;  4AL0 A;  2H8A A;  4NTA A;  4J7T A;  4JRZ A;  4NTB A;  3DWW A;  5BQG A;  4JC7 A;  4YL0 A;  4NTF A;  5BQI A;  4J7Y A;  4YL3 A;  4AL1 A;  4BPM A;  2UUI A;  5K0I A;  3PCV A;  2PNO A;  3LEO A;  4WAB A;  2Q7R A;  4YK5 A;  4YL1 A;  5BQH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...