4WABA

Crystal structure of mpges1 solved by native-sad phasing
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
161
structure length
161
Chain Sequence
SPALPAFLLCSTLLVIKMYVVAIITGQVRLRKKAFANPEDALRHGGPQYCRSDPDVERCLRAHRNDMETIYPFLFLGFVYSFLGPNPFVAWMHFLVFLVGRVAHTVAYLGKLRAPIRSVTYTLAQLPCASMALQILWEAARHFLPAALRAALLGRLRTLRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Fast native-SAD phasing for routine macromolecular structure determination.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords Prostaglandin E synthase,Leukotriene C4 synthase
total genus 67
structure length 161
sequence length 161
ec nomenclature ec 4.4.1.20: Leukotriene-C(4) synthase.
pdb deposition date 2014-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01124 MAPEG MAPEG family
A PF01124 MAPEG MAPEG family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.550 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Membrane associated eicosanoid/glutathione metabolism-like domain 4wabA00
4JRZA 4BPMA 2Q7RA 3B29A 4AL1A 3HKKA 4YL0A 3PCVA 2PNOA 4YL3A 5BQHA 2UUIA 4NTAA 5BQIA 2UUHA 4WABA 4NTFA 5BQGA 5HV9A 2H8AA 4NTBA 4YL1A 4YK5A 3DWWA 4J7YA 4J7TA 3LEOA 5K0IA 4JC7A 4AL0A 4JCZA
chains in the Genus database with same CATH superfamily
2OQMA 3ITFA 2J7PA 1N1CA 1O3UA 3FAJA 1MQVA 1SR2A 3ASNC 1OCOC 2XLHA 3L1MA 4JZAA 5COMA 5EGYA 4CSAA 4O6MA 3WAQA 3SXMA 2A0BA 5E3AA 2XL4A 3JYYA 2X0CA 2EILC 3RW0A 4CS8A 4JJFA 1PV3A 4JCHA 3MX3A 5CI8A 2P1AA 3ZWIA 1LPEA 3RKOF 2W4BA 3NMIA 3KH2A 3NMKA 3AQBA 3NYLA 4RBNA 4R32A 2I8BA 2W9YA 4WGYA 5JLIA 5L0GA 4ER9A 1JPJA 1QVXA 4A4AA 4EBJA 5EHHA 1M2OA 1O5HA 1QPUA 3DE8A 4P9FA 4JE9A 4YT5A 3WHNA 2C03A 2J9BA 5JVEA 3ATPA 2LCHA 2NSGA 1ZHXA 2ZXRA 3RQEA 3SP1A 3KL4A 4J7YA 2GFHA 3V5YA 5DLJA 2XS1A 3EZHA 3ZTZA 2P6VA 5L0FA 1T6IA 1Z23A 2R7XA 2LP4A 4JIOA 4E0IA 4KI2A 1OR2A 1NU9C 4DBQA 4D4NA 5KYWA 1BR4A 3UMKA 2VB6A 4E17A 4CS8C 4DRJB 5L3VA 3HKKA 1M57C 4N6CA 3N0TA 3NKDA 4U5BE 4YL0A 2HV6A 3S9OA 4O6NA 1EQ1A 1E85A 3G50A 4JEBA 2XRHA 1ZHYA 4LDKA 1TQGA 2NUPB 3CAXA 4W8KA 4EBKA 3O55A 3SXKA 1A0BA 1E84A 2C04A 3IQCA 5L0JA 1J8YF 1ZHTA 2VASA 3IQ6A 1MMDA 1VB5A 2IXOA 3RVYA 4IARA 4CIHA 5A6KA 1HY5A 4EBBA 2RD9A 1ORYA 1LI7A 5JUAA 1VMAA 3JZ0A 3FAPB 4WJ0A 2HZ8A 2A6HF 2IOQA 4JEAA 3RQFA 1I4YA 1VOMA 2PX0A 4WGZA 1TWHA 3X2QC 5JS5A 2WZGA 1K05A 2B0JA 2G62A 2AWCA 4U5EE 3VYWA 3S0XA 1LS1A 2R7WA 2IYLD 1GS9A 2CCYA 4DOZA 1UG7A 3Q6MA 3DM5A 1GQAA 2NG1A 2YQYA 3U8VA 3R2PA 3A9CA 4MVOA 5CI9A 3PDMP 2Y3BA 4CDYA 1Y4CA 2OKUA 2NUTB 2ZXWC 4JURI 1LKXA 4N4WA 3DI5A 3MFNA 4G7ZF 1U0BB 3IQTA 3OWTA 3T6JA 5DS4A 2KW3C 2A1DD 2GAQA 2NUPA 2XLVA 2M4EA 2JX0A 3EG9A 3K1IA 5FCLA 3AG2C 1E83A 3NDBB 4OIOF 1H6GA 2A6EF 3CZ6A 3C63A 2OG2A 3DE9A 4H54A 1EA8A 1V54C 4ONSA 2QLAA 5EK0A 5F5HA 4B6IA 4DBRA 1E2XA 3TULA 2CYDA 3U3FA 3TQOA 3NYMA 3QVZA 3UR3C 3EFOA 4N6HA 1JMWA 2D5RB 3LUTB 1NFNA 2KK1A 3B71A 3V5XA 3W2VA 1TWAA 2ZPAA 2LFFA 2ZD9A 3RIPA 4BEJA 1H9TA 4C3EA 1Z5ZA 1A7EA 4BJTA 2XM4A 3UNGC 3QW0A 5A6BD 1G4WR 5B1AC 2A0UA 1ZYRF 4ULVA 4NTFA 5T3TA 3SNHA 4MNDA 3C8GD 4JVSA 1J8MF 3L34A 1MNDA 1YDIA 2NPUA 4U5HA 5AC5A 3B0UX 1V74B 4MVMA 1YA7O 2YL3A 3DJNB 3R7CA 2A69F 4K0DA 4CS7A 3EHMA 2Q4FA 4K7BA 1OQCA 2IXMA 3OA1A 4PJJA 4ANJA 1ZU4A 4E0HA 4EUKB 1WGWA 2R9RB 3AG3C 2Y3HA 3S27A 2V3CC 3C62A 2R02A 3AQCA 3GM1A 3Q7GA 1LM3B 3IPMO 4C3DA 3B29A 3QVYA 4CS9A 5E3CA 2DYSC 5E33A 3I5PA 1JR8A 3VF0A 5KYYA 3POVA 4P6IC 3UMIA 4EWCA 4XPXA 1YZCA 1MMNA 2EPMX 3GODA 4BEMJ 5KYNA 2H7BA 4CDAA 2LFDA 4IWBA 4FESA 1KU2A 2Q3TA 1ORJA 3LESA 1C17M 1BDJB 1HW1A 3HJCA 4G78A 3ZG1A 3JCUQ 2Q00A 3LLIA 1FAPB 1Q0MA 2CNWA 4W8PA 4CJGA 5KYXB 2IXPA 1R4TA 1I5NA 3EG9B 1HE1A 2A68F 4QDLA 4PFPA 4AX2A 5GPGB 2ETSA 1Q0KA 2YLGA 2YVKA 3WODF 2QTVA 2J9UA 3T6BA 3E70C 1M2VA 1D1AA 2Y69C 3RVZA 1OW8A 3EPVA 2EIJC 4XEKA 2NUTA 2BL2A 1C02A 2OJED 2OOCA 3KYIA 4LDRA 5BQHA 2H7OA 3AG1C 1RKEB 3BRJA 2XS8A 3QMKA 1H9GA 4MTGA 4N06A 4U5DE 2BC5A 1XZQA 3DMDA 1TWGA 3GEHA 3HNJA 2JPUA 1Z63A 2OU6A 4YN0B 1MNEA 1PCXA 4GEHA 4MS2A 3V5ZA 5HV9A 1OKKD 3HLZA 4PJMA 1T6QA 3TOMA 3S90A 4LDQA 4YK5A 1CPRA 1T9KA 3W8IA 4CDVA 1RKCA 5L0CA 3MYFA 1T6UA 1UFBA 2PX3A 2QUPA 4LERA 4CIPA 1T5OA 2VCBA 2HMQA 4GQHA 4JC7A 5AGFA 2W4MA 2R7QA 3DAGA 3EGXB 4CS9C 1TKNA 1LS4A 5COGA 3U2LA 4U9EA 3HNLA 1AEPA 3GWLA 3UGOA 4U5FE 1YJGA 1NZEA 1SZIA 3EQLF 1WATA 2Z15A 3LJBA 2PNOA 3U3BA 1LVKA 3JSEO 2XLWA 3T9OA 2EPNA 3S29A 4MTFA 2B0HA 3PHF2 4PJLA 2KJGA 5KYUB 3JRTA 4LLEA 2MYSA 1TFOB 2EPLX 3VAYA 2ASRA 1OCRC 3HNKA 1L7CA 1V4AA 3KYJA 3Q6NA 4XLNF 1NU7D 3T6GB 4J32B 2AU5A 4OIQF 4PK4A 2AWYA 1K04A 4LACB 2VH3A 4HFKB 2L9JA 1FMWA 4DVZA 3EGDA 1D0XA 3MBGA 4BJ5C 4OIRF 1JRAA 4C7OB 2W45A 1VYIA 4OIPF 4EKWA 2QY9A 3G4XA 4RD9A 4CBEA 4CSAC 3SYNA 2WL8A 2P0NA 1XZPA 1QQ3A 1QSPA 3AOUA 1QLEC 3C8ZA 2LK4A 3H2VA 4CJOA 4E7ZA 5BUOA 3DM9B 3K7DA 3GEIA 2P7VA 5KYUA 3LNMB 3ZTMA 1VYKA 1OCCC 2R7OA 1YYXA 1BBHA 1U6HA 3DAFA 3S28A 4KBLA 4YT8A 3AG4C 3W2WA 2YWAA 5L3QA 1OKKA 1AUEA 3ABKC 3W8HA 1FFTC 3WG7C 1WWPA 4U5CE 3JRMO 4PACA 3DZAA 5L0DA 2LD6A 2G3VA 1QKRA 2YZSA 3RH3A 1OW6A 4YWQA 2J0WA 3H65A 4AK9A 2D4UA 1HMOA 2EPKX 3L0IA 3M1CB 5B1BC 2VCAA 4F4BA 2XL6A 3DXJF 3EH1A 1ST6A 2R7RA 2R05A 3EJNA 4EHPA 4DRIB 1W2WA 2J8WA 2Y3GA 4JKVA 4XWJA 4XPWA 4OINF 3SZRA 3I4UA 4MW3A 1A41A 1VLSA 1QZXA 1RXQA 1MMGA 2DI3A 2FAPB 3U0CA 5JSLA 1RMVA 2Q9CA 2MHRA 2X51A 3DKAA 5JP7A 2YRFA 4AE4A 1F1MA 1LE4A 2YL1A 3FXHA 1G8XA 2EPOA 1CPQA 2UUHA 3RF3A 2YLDA 4WABA 3LLKA 1EI7A 2VCCA 3ZVRA 1B68A 1BZ4A 1RKEA 3SXZA 3TD7A 1OXBA 3KMIA 1Q0GA 3FOOA 1FFHA 2XLOA 2HJ3A 4O6YA 5L0HA 3ASOC 3C8GA 4O79A 1ZW3A 2WZLA 1GGQA 4P9TA 1APCA 4LLCA 2IBFA 4HEAJ 2XL8A 4E18A 3U2MA 4BPMA 1S05A 3QZCA 1KNYA 3V7OA 4FWVA 1FMVA 3ABLC 4IJJA 5A6AA 3K66A 3T4RA 3B0PA 1MMAA 3UMHA 2AVKA 1K40A 1YLMA 2J7PD 3M4BA 4PR9A 4BJ6A 1VLTA 4XPYA 2J46A 2GA0A 1WN0A 3PMRA 1KTMA 1V55C 4J30B 4MVSA 2ZXOA 2F22A 3B0VC 2QE9A 4KNWA 3S84A 3GANA 4NTBA 3FOPA 1YAUO 1TWCA 1FNTc 2OCCC 2R7TA 3DWWA 2YLIA 3FDQA 3LAYA 3N2ZB 1SF8A 2L6GA 3F46A 2P61A 1D0YA 4XTKA 1AVOB 2DGJA 2EIMC 4M63A 2TMVP 3ECSA 1ZZPA 2L6HA 2HJMA 2Q9BA 2CDQA 1GM5A 4MVZA 1VK5A 1WTYA 4Z9JA 3ZC4A 2J9WA 3N24A 4BJ5A 4C7OA 4ULWA 3AJMA 2J45A 4GYTA 1G4US 4OD4A 4MQ9F 1SYQA 2JD3A 3RQGA 2R03A 4HE8D 4MVUA 5F5FA 2MWQA 3K1HA 5E2QA 3UGPA 4MVQA 3ZIBA 1FR0A 3LS0A 4G0HA 1ZU5A 3FMSA 1LI5A 256BA 1RJ9B 3JTLO 3JYHA 3KKBA 4IRUA 3RFYA 4BJ6C 3GORA 3TK0A 1CGNA 3O10A 4YL1A 3QW1A 4DRHB 2H7VC 5DVWA 5B3SC 2LQGA 1PD0A 1YZAA 1NFOA 3IHUA 4KC9A 5L0IA 1DOWA 5IY5C 2XSEA 1VTMP 3EHNA 1Z7Qc 2WB7A 3NRHA 2IM8A 3I5QA 4JRZA 2XM0A 4PFOA 3U9JA 2DB4A 4YT2A 3CEXA 5JT4A 3GM2A 5KYWB 4L6RA 3OEOA 4JTCB 4A2NB 3PCVA 4UDVA 4JW1A 1CGME 2KC3A 4MVRA 4ZLCA 5DQTA 4G7HF 1YA9A 3EGDB 1EKYA 1OXKA 5D92A 3AGUA 5BQIA 2KNHA 3CSKA 4RDAA 3U5SA 1WOLA 2R25A 2Y3DA 4C3BA 1LIHA 4AE4B 3E9VA 3ZSUA 4DJ9A 3ZQVA 2PFDA 1RJ9A 2XLDA 5DS5A 2FGYA 2G3KA 1S7ZA 2PBEA 4D4XA 1O87A 5AC4A 4NQFA 1ZHWA 2YL7A 1HW2A 1CGOA 4MW8A 3G4ZA 1TR2A 1NSGB 3NYJA 4Z9IA 1D1BA 2OEXA 4AL1A 4YJWA 1DOVA 1HMDA 3L8IA 3C7JA 4HFFB 2BE5F 4EIYA 1LE2A 2GWWA 3L8JA 3QTHA 2YL0A 2XXAB 1NLXA 1E86A 1OW7A 1D1CA 1Q0FA 1L3PA 3VRCA 5CIVA 2WVQA 4YL3A 2HSQA 3Q7LA 4X0RA 2KQ9A 3LS1A 1H7IA 2L81A 4NTAA 5JRAA 1RCPA 3EGXA 3HNIA 4JTDB 2VC9A 1IW7F 1M6TA 1SMYF 3MYIA 1Q0DA 3JSZA 2L6FA 2H8AA 2LSEA 2XXAA 2OEVA 5KYXA 3GWNA 1NG1A 3TOLA 2HFIA 1T01A 1XWJA 4U5GA 3BEHA 5HSWA 3LEOA 4MTOA 1ZVZA 5K0IA 3GM3A 5A69A 4I3MA 4K1OA 4NC3A 3MLGA 3B9QA 2Y39A 5FZTA 3M79A 4FX5A 3RYLA 3U8PA 3TJ5A 1M56C 4ZLDA 3CQZA 4I1OB 2PF4E 2YEVA 1YVIA 1R5ID 2GDCA 2WZFA 2I15A 3ABMC 3X1OA 5KYYB 3EZIA 3FVYA 3O39A 1Z6AA 1BR1A 1ZW2A 2LIGA 3M15A 4IAQA 3US6A 3W4YA 4KNVA 1M2VB 2KSFA 2KYHA 4NCQA 2R7SA 4XQ1A 4PJNA 4IB4A 5T3WA 1FTSA 4XEFA 4DXWA 3J06A 5D91A 1JOGA 2WVOA 5BQGA 5A6BA 2IXNA 2XLEA 1OCZC 2DYRC 4H4KC 4O7GA 3JT1A 1D0ZA 3NKEA 2KGOA 4J7TA 4U9DA 4NY3A 4XLPF 4XEVA 2AP3A 3H2UA 4FAPB 4JTAB 1C03A 3U9MA 4BG0A 1ZHZA 2J0XA 2YHSA 2L7AA 1JPNA 2CNWD 2PP4A 1PD1A 2WVNA 3EFOB 1Z3IX 3EH2A 2NSFA 2ZXPA 3SEOA 3NG1A 2R7VA 5TJ5E 2UUIA 2HMZA 4Z9HA 1ORSC 4OD5A 1A7VA 1YARO 1Y6DA 2HKVA 2M64A 3AGTA 2J9VA 3IEEA 4QI2A 1A7DA 2FFHA 5A6JA 3GEEA 2ICWG 2HV7A 2OJQA 3LNRA 2O9XA 1WASA 3C8GB 3DJUB 4BJ1A 2EINC 3K1IC 2CW0F 3ZQYA 5F28E 1HE9A 3NMJA 4AL0A 1U89A 3DD7A 4CX9A 1G5ZA 4DVYP 2Q9AA 2Q7RA 3ZDLA 3K6BA 4JJGA 3K33A 1JAFA 3F47A 1TFKB 4Q4ZF 5T1DB 5B3IA 1YYJA 3O6XA 4IAOA 4Q5SF 3VM6A 2CGEA 2EIKC 4Q7CA 3FHDA 1NBBA 4IGGA 3KPHA 3SXYA 4YT4A 4E7SA 2HS5A 2V26A 3A11A 3HTKC 2E87A 3C18A 1IZMA 2QNLA 2HSBA 3IQ5A 5COFA 4G7OF 4I1MA 5DS6A 3TJ6A 2HUJA 4QI0A 1BR2A 1OR3A 3M4CA 2R7UA 1I4ZA 2YKZA 3LEVA 2RSEB 2XLMA 4I44A 5DQZA 4JCZA
chains in the Genus database with same CATH topology
4JRZA 4BPMA 2Q7RA 3B29A 4AL1A 3HKKA 4YL0A 3PCVA 2PNOA 4YL3A 5BQHA 2UUIA 4NTAA 5BQIA 2UUHA 4WABA 4NTFA 5BQGA 5HV9A 2H8AA 4NTBA 4YL1A 4YK5A 3DWWA 4J7YA 4J7TA 3LEOA 5K0IA 4JC7A 4AL0A 4JCZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JRZ A;  4BPM A;  2Q7R A;  3B29 A;  4AL1 A;  3HKK A;  4YL0 A;  3PCV A;  2PNO A;  4YL3 A;  5BQH A;  2UUI A;  4NTA A;  5BQI A;  2UUH A;  4WAB A;  4NTF A;  5BQG A;  5HV9 A;  2H8A A;  4NTB A;  4YL1 A;  4YK5 A;  3DWW A;  4J7Y A;  4J7T A;  3LEO A;  5K0I A;  4JC7 A;  4AL0 A;  4JCZ A; 
#chains in the Genus database with same CATH topology
 2OQM A;  3ITF A;  2J7P A;  1N1C A;  1O3U A;  3FAJ A;  1MQV A;  1SR2 A;  3ASN C;  1OCO C;  2XLH A;  3L1M A;  4JZA A;  5COM A;  5EGY A;  4CSA A;  4O6M A;  3WAQ A;  3SXM A;  2A0B A;  5E3A A;  2XL4 A;  3JYY A;  2X0C A;  2EIL C;  3RW0 A;  4CS8 A;  4JJF A;  1PV3 A;  4JCH A;  3MX3 A;  5CI8 A;  2P1A A;  3ZWI A;  1LPE A;  3RKO F;  2W4B A;  3NMI A;  3KH2 A;  3NMK A;  3AQB A;  3NYL A;  4RBN A;  4R32 A;  2I8B A;  2W9Y A;  4WGY A;  5JLI A;  5L0G A;  4ER9 A;  1JPJ A;  1QVX A;  4A4A A;  4EBJ A;  5EHH A;  1M2O A;  1O5H A;  1QPU A;  3DE8 A;  4P9F A;  4JE9 A;  4YT5 A;  3WHN A;  2C03 A;  2J9B A;  5JVE A;  3ATP A;  2LCH A;  2NSG A;  1ZHX A;  2ZXR A;  3RQE A;  3SP1 A;  3KL4 A;  4J7Y A;  2GFH A;  3V5Y A;  5DLJ A;  2XS1 A;  3EZH A;  3ZTZ A;  2P6V A;  5L0F A;  1T6I A;  1Z23 A;  2R7X A;  2LP4 A;  4JIO A;  4E0I A;  4KI2 A;  1OR2 A;  1NU9 C;  4DBQ A;  4D4N A;  5KYW A;  1BR4 A;  3UMK A;  2VB6 A;  4E17 A;  4CS8 C;  4DRJ B;  5L3V A;  3HKK A;  1M57 C;  4N6C A;  3N0T A;  3NKD A;  4U5B E;  4YL0 A;  2HV6 A;  3S9O A;  4O6N A;  1EQ1 A;  1E85 A;  3G50 A;  4JEB A;  2XRH A;  1ZHY A;  4LDK A;  1TQG A;  2NUP B;  3CAX A;  4W8K A;  4EBK A;  3O55 A;  3SXK A;  1A0B A;  1E84 A;  2C04 A;  3IQC A;  5L0J A;  1J8Y F;  1ZHT A;  2VAS A;  3IQ6 A;  1MMD A;  1VB5 A;  2IXO A;  3RVY A;  4IAR A;  4CIH A;  5A6K A;  1HY5 A;  4EBB A;  2RD9 A;  1ORY A;  1LI7 A;  5JUA A;  1VMA A;  3JZ0 A;  3FAP B;  4WJ0 A;  2HZ8 A;  2A6H F;  2IOQ A;  4JEA A;  3RQF A;  1I4Y A;  1VOM A;  2PX0 A;  4WGZ A;  1TWH A;  3X2Q C;  5JS5 A;  2WZG A;  1K05 A;  2B0J A;  2G62 A;  2AWC A;  4U5E E;  3VYW A;  3S0X A;  1LS1 A;  2R7W A;  2IYL D;  1GS9 A;  2CCY A;  4DOZ A;  1UG7 A;  3Q6M A;  3DM5 A;  1GQA A;  2NG1 A;  2YQY A;  3U8V A;  3R2P A;  3A9C A;  4MVO A;  5CI9 A;  3PDM P;  2Y3B A;  4CDY A;  1Y4C A;  2OKU A;  2NUT B;  2ZXW C;  4JUR I;  1LKX A;  4N4W A;  3DI5 A;  3MFN A;  4G7Z F;  1U0B B;  3IQT A;  3OWT A;  3T6J A;  5DS4 A;  2KW3 C;  2A1D D;  2GAQ A;  2NUP A;  2XLV A;  2M4E A;  2JX0 A;  3EG9 A;  3K1I A;  5FCL A;  3AG2 C;  1E83 A;  3NDB B;  4OIO F;  1H6G A;  2A6E F;  3CZ6 A;  3C63 A;  2OG2 A;  3DE9 A;  4H54 A;  1EA8 A;  1V54 C;  4ONS A;  2QLA A;  5EK0 A;  5F5H A;  4B6I A;  4DBR A;  1E2X A;  3TUL A;  2CYD A;  3U3F A;  3TQO A;  3NYM A;  3QVZ A;  3UR3 C;  3EFO A;  4N6H A;  1JMW A;  2D5R B;  3LUT B;  1NFN A;  2KK1 A;  3B71 A;  3V5X A;  3W2V A;  1TWA A;  2ZPA A;  2LFF A;  2ZD9 A;  3RIP A;  4BEJ A;  1H9T A;  4C3E A;  1Z5Z A;  1A7E A;  4BJT A;  2XM4 A;  3UNG C;  3QW0 A;  5A6B D;  1G4W R;  5B1A C;  2A0U A;  1ZYR F;  4ULV A;  4NTF A;  5T3T A;  3SNH A;  4MND A;  3C8G D;  4JVS A;  1J8M F;  3L34 A;  1MND A;  1YDI A;  2NPU A;  4U5H A;  5AC5 A;  3B0U X;  1V74 B;  4MVM A;  1YA7 O;  2YL3 A;  3DJN B;  3R7C A;  2A69 F;  4K0D A;  4CS7 A;  3EHM A;  2Q4F A;  4K7B A;  1OQC A;  2IXM A;  3OA1 A;  4PJJ A;  4ANJ A;  1ZU4 A;  4E0H A;  4EUK B;  1WGW A;  2R9R B;  3AG3 C;  2Y3H A;  3S27 A;  2V3C C;  3C62 A;  2R02 A;  3AQC A;  3GM1 A;  3Q7G A;  1LM3 B;  3IPM O;  4C3D A;  3B29 A;  3QVY A;  4CS9 A;  5E3C A;  2DYS C;  5E33 A;  3I5P A;  1JR8 A;  3VF0 A;  5KYY A;  3POV A;  4P6I C;  3UMI A;  4EWC A;  4XPX A;  1YZC A;  1MMN A;  2EPM X;  3GOD A;  4BEM J;  5KYN A;  2H7B A;  4CDA A;  2LFD A;  4IWB A;  4FES A;  1KU2 A;  2Q3T A;  1ORJ A;  3LES A;  1C17 M;  1BDJ B;  1HW1 A;  3HJC A;  4G78 A;  3ZG1 A;  3JCU Q;  2Q00 A;  3LLI A;  1FAP B;  1Q0M A;  2CNW A;  4W8P A;  4CJG A;  5KYX B;  2IXP A;  1R4T A;  1I5N A;  3EG9 B;  1HE1 A;  2A68 F;  4QDL A;  4PFP A;  4AX2 A;  5GPG B;  2ETS A;  1Q0K A;  2YLG A;  2YVK A;  3WOD F;  2QTV A;  2J9U A;  3T6B A;  3E70 C;  1M2V A;  1D1A A;  2Y69 C;  3RVZ A;  1OW8 A;  3EPV A;  2EIJ C;  4XEK A;  2NUT A;  2BL2 A;  1C02 A;  2OJE D;  2OOC A;  3KYI A;  4LDR A;  5BQH A;  2H7O A;  3AG1 C;  1RKE B;  3BRJ A;  2XS8 A;  3QMK A;  1H9G A;  4MTG A;  4N06 A;  4U5D E;  2BC5 A;  1XZQ A;  3DMD A;  1TWG A;  3GEH A;  3HNJ A;  2JPU A;  1Z63 A;  2OU6 A;  4YN0 B;  1MNE A;  1PCX A;  4GEH A;  4MS2 A;  3V5Z A;  5HV9 A;  1OKK D;  3HLZ A;  4PJM A;  1T6Q A;  3TOM A;  3S90 A;  4LDQ A;  4YK5 A;  1CPR A;  1T9K A;  3W8I A;  4CDV A;  1RKC A;  5L0C A;  3MYF A;  1T6U A;  1UFB A;  2PX3 A;  2QUP A;  4LER A;  4CIP A;  1T5O A;  2VCB A;  2HMQ A;  4GQH A;  4JC7 A;  5AGF A;  2W4M A;  2R7Q A;  3DAG A;  3EGX B;  4CS9 C;  1TKN A;  1LS4 A;  5COG A;  3U2L A;  4U9E A;  3HNL A;  1AEP A;  3GWL A;  3UGO A;  4U5F E;  1YJG A;  1NZE A;  1SZI A;  3EQL F;  1WAT A;  2Z15 A;  3LJB A;  2PNO A;  3U3B A;  1LVK A;  3JSE O;  2XLW A;  3T9O A;  2EPN A;  3S29 A;  4MTF A;  2B0H A;  3PHF 2;  4PJL A;  2KJG A;  5KYU B;  3JRT A;  4LLE A;  2MYS A;  1TFO B;  2EPL X;  3VAY A;  2ASR A;  1OCR C;  3HNK A;  1L7C A;  1V4A A;  3KYJ A;  3Q6N A;  4XLN F;  1NU7 D;  3T6G B;  4J32 B;  2AU5 A;  4OIQ F;  4PK4 A;  2AWY A;  1K04 A;  4LAC B;  2VH3 A;  4HFK B;  2L9J A;  1FMW A;  4DVZ A;  3EGD A;  1D0X A;  3MBG A;  4BJ5 C;  4OIR F;  1JRA A;  4C7O B;  2W45 A;  1VYI A;  4OIP F;  4EKW A;  2QY9 A;  3G4X A;  4RD9 A;  4CBE A;  4CSA C;  3SYN A;  2WL8 A;  2P0N A;  1XZP A;  1QQ3 A;  1QSP A;  3AOU A;  1QLE C;  3C8Z A;  2LK4 A;  3H2V A;  4CJO A;  4E7Z A;  5BUO A;  3DM9 B;  3K7D A;  3GEI A;  2P7V A;  5KYU A;  3LNM B;  3ZTM A;  1VYK A;  1OCC C;  2R7O A;  1YYX A;  1BBH A;  1U6H A;  3DAF A;  3S28 A;  4KBL A;  4YT8 A;  3AG4 C;  3W2W A;  2YWA A;  5L3Q A;  1OKK A;  1AUE A;  3ABK C;  3W8H A;  1FFT C;  3WG7 C;  1WWP A;  4U5C E;  3JRM O;  4PAC A;  3DZA A;  5L0D A;  2LD6 A;  2G3V A;  1QKR A;  2YZS A;  3RH3 A;  1OW6 A;  4YWQ A;  2J0W A;  3H65 A;  4AK9 A;  2D4U A;  1HMO A;  2EPK X;  3L0I A;  3M1C B;  5B1B C;  2VCA A;  4F4B A;  2XL6 A;  3DXJ F;  3EH1 A;  1ST6 A;  2R7R A;  2R05 A;  3EJN A;  4EHP A;  4DRI B;  1W2W A;  2J8W A;  2Y3G A;  4JKV A;  4XWJ A;  4XPW A;  4OIN F;  3SZR A;  3I4U A;  4MW3 A;  1A41 A;  1VLS A;  1QZX A;  1RXQ A;  1MMG A;  2DI3 A;  2FAP B;  3U0C A;  5JSL A;  1RMV A;  2Q9C A;  2MHR A;  2X51 A;  3DKA A;  5JP7 A;  2YRF A;  4AE4 A;  1F1M A;  1LE4 A;  2YL1 A;  3FXH A;  1G8X A;  2EPO A;  1CPQ A;  2UUH A;  3RF3 A;  2YLD A;  4WAB A;  3LLK A;  1EI7 A;  2VCC A;  3ZVR A;  1B68 A;  1BZ4 A;  1RKE A;  3SXZ A;  3TD7 A;  1OXB A;  3KMI A;  1Q0G A;  3FOO A;  1FFH A;  2XLO A;  2HJ3 A;  4O6Y A;  5L0H A;  3ASO C;  3C8G A;  4O79 A;  1ZW3 A;  2WZL A;  1GGQ A;  4P9T A;  1APC A;  4LLC A;  2IBF A;  4HEA J;  2XL8 A;  4E18 A;  3U2M A;  4BPM A;  1S05 A;  3QZC A;  1KNY A;  3V7O A;  4FWV A;  1FMV A;  3ABL C;  4IJJ A;  5A6A A;  3K66 A;  3T4R A;  3B0P A;  1MMA A;  3UMH A;  2AVK A;  1K40 A;  1YLM A;  2J7P D;  3M4B A;  4PR9 A;  4BJ6 A;  1VLT A;  4XPY A;  2J46 A;  2GA0 A;  1WN0 A;  3PMR A;  1KTM A;  1V55 C;  4J30 B;  4MVS A;  2ZXO A;  2F22 A;  3B0V C;  2QE9 A;  4KNW A;  3S84 A;  3GAN A;  4NTB A;  3FOP A;  1YAU O;  1TWC A;  1FNT c;  2OCC C;  2R7T A;  3DWW A;  2YLI A;  3FDQ A;  3LAY A;  3N2Z B;  1SF8 A;  2L6G A;  3F46 A;  2P61 A;  1D0Y A;  4XTK A;  1AVO B;  2DGJ A;  2EIM C;  4M63 A;  2TMV P;  3ECS A;  1ZZP A;  2L6H A;  2HJM A;  2Q9B A;  2CDQ A;  1GM5 A;  4MVZ A;  1VK5 A;  1WTY A;  4Z9J A;  3ZC4 A;  2J9W A;  3N24 A;  4BJ5 A;  4C7O A;  4ULW A;  3AJM A;  2J45 A;  4GYT A;  1G4U S;  4OD4 A;  4MQ9 F;  1SYQ A;  2JD3 A;  3RQG A;  2R03 A;  4HE8 D;  4MVU A;  5F5F A;  2MWQ A;  3K1H A;  5E2Q A;  3UGP A;  4MVQ A;  3ZIB A;  1FR0 A;  3LS0 A;  4G0H A;  1ZU5 A;  3FMS A;  1LI5 A;  256B A;  1RJ9 B;  3JTL O;  3JYH A;  3KKB A;  4IRU A;  3RFY A;  4BJ6 C;  3GOR A;  3TK0 A;  1CGN A;  3O10 A;  4YL1 A;  3QW1 A;  4DRH B;  2H7V C;  5DVW A;  5B3S C;  2LQG A;  1PD0 A;  1YZA A;  1NFO A;  3IHU A;  4KC9 A;  5L0I A;  1DOW A;  5IY5 C;  2XSE A;  1VTM P;  3EHN A;  1Z7Q c;  2WB7 A;  3NRH A;  2IM8 A;  3I5Q A;  4JRZ A;  2XM0 A;  4PFO A;  3U9J A;  2DB4 A;  4YT2 A;  3CEX A;  5JT4 A;  3GM2 A;  5KYW B;  4L6R A;  3OEO A;  4JTC B;  4A2N B;  3PCV A;  4UDV A;  4JW1 A;  1CGM E;  2KC3 A;  4MVR A;  4ZLC A;  5DQT A;  4G7H F;  1YA9 A;  3EGD B;  1EKY A;  1OXK A;  5D92 A;  3AGU A;  5BQI A;  2KNH A;  3CSK A;  4RDA A;  3U5S A;  1WOL A;  2R25 A;  2Y3D A;  4C3B A;  1LIH A;  4AE4 B;  3E9V A;  3ZSU A;  4DJ9 A;  3ZQV A;  2PFD A;  1RJ9 A;  2XLD A;  5DS5 A;  2FGY A;  2G3K A;  1S7Z A;  2PBE A;  4D4X A;  1O87 A;  5AC4 A;  4NQF A;  1ZHW A;  2YL7 A;  1HW2 A;  1CGO A;  4MW8 A;  3G4Z A;  1TR2 A;  1NSG B;  3NYJ A;  4Z9I A;  1D1B A;  2OEX A;  4AL1 A;  4YJW A;  1DOV A;  1HMD A;  3L8I A;  3C7J A;  4HFF B;  2BE5 F;  4EIY A;  1LE2 A;  2GWW A;  3L8J A;  3QTH A;  2YL0 A;  2XXA B;  1NLX A;  1E86 A;  1OW7 A;  1D1C A;  1Q0F A;  1L3P A;  3VRC A;  5CIV A;  2WVQ A;  4YL3 A;  2HSQ A;  3Q7L A;  4X0R A;  2KQ9 A;  3LS1 A;  1H7I A;  2L81 A;  4NTA A;  5JRA A;  1RCP A;  3EGX A;  3HNI A;  4JTD B;  2VC9 A;  1IW7 F;  1M6T A;  1SMY F;  3MYI A;  1Q0D A;  3JSZ A;  2L6F A;  2H8A A;  2LSE A;  2XXA A;  2OEV A;  5KYX A;  3GWN A;  1NG1 A;  3TOL A;  2HFI A;  1T01 A;  1XWJ A;  4U5G A;  3BEH A;  5HSW A;  3LEO A;  4MTO A;  1ZVZ A;  5K0I A;  3GM3 A;  5A69 A;  4I3M A;  4K1O A;  4NC3 A;  3MLG A;  3B9Q A;  2Y39 A;  5FZT A;  3M79 A;  4FX5 A;  3RYL A;  3U8P A;  3TJ5 A;  1M56 C;  4ZLD A;  3CQZ A;  4I1O B;  2PF4 E;  2YEV A;  1YVI A;  1R5I D;  2GDC A;  2WZF A;  2I15 A;  3ABM C;  3X1O A;  5KYY B;  3EZI A;  3FVY A;  3O39 A;  1Z6A A;  1BR1 A;  1ZW2 A;  2LIG A;  3M15 A;  4IAQ A;  3US6 A;  3W4Y A;  4KNV A;  1M2V B;  2KSF A;  2KYH A;  4NCQ A;  2R7S A;  4XQ1 A;  4PJN A;  4IB4 A;  5T3W A;  1FTS A;  4XEF A;  4DXW A;  3J06 A;  5D91 A;  1JOG A;  2WVO A;  5BQG A;  5A6B A;  2IXN A;  2XLE A;  1OCZ C;  2DYR C;  4H4K C;  4O7G A;  3JT1 A;  1D0Z A;  3NKE A;  2KGO A;  4J7T A;  4U9D A;  4NY3 A;  4XLP F;  4XEV A;  2AP3 A;  3H2U A;  4FAP B;  4JTA B;  1C03 A;  3U9M A;  4BG0 A;  1ZHZ A;  2J0X A;  2YHS A;  2L7A A;  1JPN A;  2CNW D;  2PP4 A;  1PD1 A;  2WVN A;  3EFO B;  1Z3I X;  3EH2 A;  2NSF A;  2ZXP A;  3SEO A;  3NG1 A;  2R7V A;  5TJ5 E;  2UUI A;  2HMZ A;  4Z9H A;  1ORS C;  4OD5 A;  1A7V A;  1YAR O;  1Y6D A;  2HKV A;  2M64 A;  3AGT A;  2J9V A;  3IEE A;  4QI2 A;  1A7D A;  2FFH A;  5A6J A;  3GEE A;  2ICW G;  2HV7 A;  2OJQ A;  3LNR A;  2O9X A;  1WAS A;  3C8G B;  3DJU B;  4BJ1 A;  2EIN C;  3K1I C;  2CW0 F;  3ZQY A;  5F28 E;  1HE9 A;  3NMJ A;  4AL0 A;  1U89 A;  3DD7 A;  4CX9 A;  1G5Z A;  4DVY P;  2Q9A A;  2Q7R A;  3ZDL A;  3K6B A;  4JJG A;  3K33 A;  1JAF A;  3F47 A;  1TFK B;  4Q4Z F;  5T1D B;  5B3I A;  1YYJ A;  3O6X A;  4IAO A;  4Q5S F;  3VM6 A;  2CGE A;  2EIK C;  4Q7C A;  3FHD A;  1NBB A;  4IGG A;  3KPH A;  3SXY A;  4YT4 A;  4E7S A;  2HS5 A;  2V26 A;  3A11 A;  3HTK C;  2E87 A;  3C18 A;  1IZM A;  2QNL A;  2HSB A;  3IQ5 A;  5COF A;  4G7O F;  4I1M A;  5DS6 A;  3TJ6 A;  2HUJ A;  4QI0 A;  1BR2 A;  1OR3 A;  3M4C A;  2R7U A;  1I4Z A;  2YKZ A;  3LEV A;  2RSE B;  2XLM A;  4I44 A;  5DQZ A;  4JCZ A; 
#chains in the Genus database with same CATH homology
 4JRZ A;  4BPM A;  2Q7R A;  3B29 A;  4AL1 A;  3HKK A;  4YL0 A;  3PCV A;  2PNO A;  4YL3 A;  5BQH A;  2UUI A;  4NTA A;  5BQI A;  2UUH A;  4WAB A;  4NTF A;  5BQG A;  5HV9 A;  2H8A A;  4NTB A;  4YL1 A;  4YK5 A;  3DWW A;  4J7Y A;  4J7T A;  3LEO A;  5K0I A;  4JC7 A;  4AL0 A;  4JCZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...