4WABA

Crystal structure of mpges1 solved by native-sad phasing
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
161
structure length
161
Chain Sequence
b'SPALPAFLLCSTLLVIKMYVVAIITGQVRLRKKAFANPEDALRHGGPQYCRSDPDVERCLRAHRNDMETIYPFLFLGFVYSFLGPNPFVAWMHFLVFLVGRVAHTVAYLGKLRAPIRSVTYTLAQLPCASMALQILWEAARHFLPAALRAALLGRLRTLRP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Prostaglandin E synthase,Leukotriene C4 synthase
molecule tags Isomerase
source organism Homo sapiens
publication title Fast native-SAD phasing for routine macromolecular structure determination.
pubmed doi rcsb
total genus 67
structure length 161
sequence length 161
ec nomenclature ec 4.4.1.20: Leukotriene-C(4) synthase.
pdb deposition date 2014-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01124 MAPEG MAPEG family
A PF01124 MAPEG MAPEG family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.550 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Membrane associated eicosanoid/glutathione metabolism-like domain 4wabA00
4JRZA 4NTFA 4AL0A 4NTAA 3LEOA 4YL0A 4JC7A 4YL1A 4JCZA 4BPMA 4J7YA 2H8AA 5BQHA 2Q7RA 3PCVA 2PNOA 4YK5A 4YL3A 3DWWA 4AL1A 2UUIA 4WABA 5K0IA 4J7TA 3HKKA 5BQIA 5HV9A 2UUHA 4NTBA 3B29A 5BQGA
chains in the Genus database with same CATH superfamily
2R03A 2BL2A 4O6MA 1A7DA 4FAPB 2Q9CA 2WZGA 1D0YA 2LIGA 4CDVA 2YKZA 1H9GA 4JJGA 3AOUA 2OJED 3H2VA 4MW8A 3QVZA 4PK4A 3W2WA 1EKYA 3AG4C 2FAPB 2H7BA 4XQ1A 3SXZA 1M6TA 3JYHA 1FMWA 4J7YA 3SP1A 2JD3A 3B0PA 1ZYRF 2C03A 2EPOA 3ASOC 3HTKC 3QVYA 4MVOA 2QNLA 4KNWA 4WGYA 4BEJA 2ETSA 4IRUA 4G7HF 1H6GA 1JR8A 3DE8A 3X1OA 1TR2A 2CW0F 1QPUA 3NYJA 4PJMA 4QI2A 1NBBA 2EPNA 2R05A 1GGQA 5DVWA 5KYYB 1Q0KA 3EGXA 1LI5A 1VK5A 1RCPA 3ZIBA 1HE9A 4OIOF 3VAYA 1YA9A 5JLIA 4CJOA 2HV7A 3M4BA 2Y39A 1R5ID 3TJ5A 3M4CA 5JVEA 3IQ6A 3BRJA 4DVYP 3PHF2 2YL7A 4JW1A 2OU6A 1M2OA 1SF8A 4GQHA 1WTYA 1LS1A 5FCLA 2XL4A 3LNRA 3N2ZB 3UNGC 4E0HA 2HKVA 2XS1A 3AQCA 4QDLA 5D92A 5T1DB 2GFHA 2HMZA 1ZW2A 3IPMO 5BUOA 1T5OA 4U5EE 2XSEA 2Q7RA 1AVOB 4R32A 1FMVA 2J0WA 3ASNC 4JE9A 3DWWA 1PCXA 3GWNA 2W4MA 3HNLA 4ZLCA 3TULA 2XLVA 4ULWA 4G7ZF 4M63A 1G8XA 4O6YA 2Y3DA 3T6GB 3LLIA 2BE5F 3A11A 3DD7A 3W2VA 5JT4A 1Q0FA 2MWQA 4C3EA 2B0JA 4JTDB 1UG7A 5FZTA 3T9OA 4JRZA 3TQOA 4CIPA 1EA8A 1PD1A 2Y3HA 2A6HF 5B1BC 1TWGA 4U9EA 3SYNA 1U89A 3U8PA 3QW1A 4MVUA 2R7UA 1WOLA 3JSEO 1Q0MA 4I44A 2W4BA 1FR0A 1QSPA 4YT2A 4AX2A 4JTAB 1NZEA 1RMVA 1OXBA 2H8AA 1B68A 5BQHA 1LS4A 3GM3A 3Q6MA 1VB5A 2WL8A 5KYUB 3U2MA 3US6A 3JYYA 1DOVA 2PP4A 1KU2A 4OD4A 1IW7F 3C62A 2LCHA 1EQ1A 3UR3C 3DMDA 3KMIA 3G50A 1E84A 2DYRC 2C04A 1BBHA 3I4UA 1AUEA 4EUKB 3I5PA 2VB6A 3L1MA 1PD0A 1YAUO 1OCCC 1VYIA 1YZAA 2J7PA 2L6FA 1O3UA 1TWCA 3GEHA 4HFFB 1L3PA 4Z9IA 5JS5A 5IY5C 3EH1A 5DS5A 4YL0A 3RFYA 1MMNA 4CS8C 1D0ZA 3RIPA 3H2UA 1HE1A 4EBJA 1A0BA 1NU9C 3EH2A 4PFOA 3LUTB 2VCAA 4WGZA 5TJ5E 1WATA 4CS9C 3B9QA 4PJLA 3IQ5A 2TMVP 3FHDA 4HEAJ 2IXPA 4CS7A 2J9VA 4PR9A 2A1DD 2KJGA 1L7CA 3S29A 3EPVA 2R7QA 3K1IC 3HNKA 2Q9AA 1LKXA 2R7VA 5L0CA 1OW6A 2CYDA 3LJBA 5KYWA 1A7VA 2HSBA 4J32B 1Z5ZA 3ITFA 4BJ5A 3TOMA 1FTSA 4JEBA 4ULVA 2QY9A 3SXKA 5DQTA 1HW1A 2XL6A 3DZAA 3KH2A 4G78A 2XLEA 1OR2A 2J8WA 2R25A 1Q0DA 2NSGA 2OEVA 3NRHA 5A69A 5L0FA 4XLPF 1YA7O 4DXWA 1QKRA 1G4WR 4Q7CA 4XPYA 4BJ6C 3K7DA 1LPEA 1NSGB 2XLOA 5JUAA 1E83A 1ORYA 2J45A 3BEHA 1RKEB 2FFHA 2CDQA 2X51A 4CBEA 5EGYA 1CPRA 3U5SA 1K04A 1RKEA 1H7IA 3G4XA 4I1MA 1JRAA 2P6VA 3ZTZA 1TQGA 1E2XA 1Z3IX 3Q6NA 2WB7A 1SMYF 3GORA 2EINC 1OW7A 1ZHYA 4P6IC 1OQCA 2L6GA 1ORJA 3SNHA 2P7VA 3FVYA 1MQVA 2HS5A 5F28E 4C7OB 2ZXPA 2AU5A 5HSWA 1YARO 2L6HA 3Q7GA 4MVMA 5BQIA 5A6JA 3RKOF 1LIHA 3EGXB 4NTBA 3HLZA 3B29A 2QUPA 4BJ6A 4D4XA 1R4TA 1MMAA 2LQGA 1RXQA 2A6EF 3LAYA 3J06A 2NPUA 3V5ZA 3N24A 3S27A 2Q9BA 4JCZA 1VTMP 4KC9A 4BPMA 4XEKA 2J9WA 2YL3A 3CAXA 1TWAA 1M2VA 2IOQA 3KKBA 3R7CA 3RF3A 1LVKA 3AG1C 5A6KA 2Q3TA 1MNDA 1VYKA 1ZVZA 2Z15A 1BR1A 3A9CA 3IHUA 3MFNA 3AG3C 4XPWA 1C03A 3DM9B 1D0XA 3M15A 2W9YA 3F47A 5K0IA 5L3QA 4CSAA 2ZXRA 1ZU5A 4RBNA 4AE4A 4YT8A 3HKKA 1KTMA 5F5FA 1LI7A 3L8JA 4PACA 3QTHA 2EILC 3KYJA 2R9RB 5AC5A 2YRFA 3DM5A 4LDKA 1BDJB 4O6NA 2CGEA 2M4EA 2NSFA 3PMRA 3U9MA 1OCOC 4W8PA 3W8IA 2ZXWC 2IM8A 2KSFA 1YDIA 2NUPA 3SZRA 3WHNA 2EPMX 3FDQA 2XXAB 1XZQA 2PFDA 1ZHWA 1BZ4A 1D1BA 4U5BE 1NFNA 1OKKA 4P9TA 3NYLA 4U5FE 1HMDA 1I4YA 2VCCA 5E3AA 4UDVA 4LLCA 4YJWA 2ZPAA 1Y4CA 4PFPA 4ANJA 1YVIA 5T3TA 2A0UA 1VMAA 4FWVA 2B0HA 4MTFA 3UMIA 4RDAA 4NC3A 3EGDB 1WN0A 2CCYA 5KYNA 1ZU4A 3MX3A 3S0XA 3CEXA 5KYWB 2V3CC 5AGFA 1MMGA 3IQCA 1G5ZA 2IXNA 3LS0A 1Z7Qc 3E70C 5DS4A 3ZTMA 4LLEA 4O79A 2Q00A 2DYSC 3N0TA 1TFKB 3U0CA 4KBLA 2IXOA 1T6UA 1WWPA 2GDCA 2XLMA 2YL0A 4WJ0A 5GPGB 3V7OA 4BG0A 2HV6A 2WVNA 1WGWA 1NG1A 2LFDA 4YWQA 2NUPB 5L0HA 4A2NB 2XXAA 2NUTB 3AG2C 3EFOB 3M79A 4IAQA 5E2QA 5B1AC 1M57C 5B3SC 2EIJC 4EBBA 2HFIA 4DBRA 1E85A 1T9KA 4NCQA 2CNWA 4E17A 1U0BB 1J8MF 2W45A 3RH3A 4H54A 1JPJA 2JPUA 4WABA 2HJ3A 3VM6A 3EZHA 3RW0A 2L7AA 4MVSA 4DRJB 5KYXB 2ZD9A 4FX5A 5E33A 5HV9A 1WASA 1UFBA 1YYXA 3S90A 2V26A 4EBKA 3LS1A 3AQBA 3E9VA 4W8KA 3GANA 2XM4A 3RVYA 3UGPA 4AL0A 3EGDA 2OQMA 3JRTA 1K40A 4NTAA 1CGME 3ABKC 4IJJA 2OJQA 4RD9A 2VC9A 3JTLO 2YZSA 4GYTA 1LE4A 3ZQVA 1VOMA 4MS2A 1A7EA 3S9OA 4LERA 5COGA 2G3KA 3EHMA 1D1CA 3DXJF 3F46A 1OKKD 2BC5A 4MVQA 4D4NA 2KK1A 1V4AA 2OG2A 3GEEA 1OCRC 3OEOA 4LDRA 5DQZA 5KYUA 5JP7A 1KNYA 4MVRA 1C02A 1QZXA 1MMDA 3EFOA 3NG1A 2NUTA 1W2WA 2JX0A 3SEOA 3X2QC 4CDYA 4C7OA 3GEIA 4JTCB 3NMIA 3QZCA 4IWBA 4N6CA 3C18A 1CPQA 3IQTA 4IB4A 2E87A 4L6RA 5E3CA 2XS8A 3UMKA 2AVKA 3JZ0A 2FGYA 1A41A 1QVXA 4U5DE 2EPKX 5L0DA 2PBEA 3DJUB 4BJTA 4MW3A 3M1CB 2HSQA 3S28A 4E0IA 3AJMA 1ZHTA 4CS9A 4EKWA 4MTOA 4U5GA 4YT4A 1HY5A 1V55C 2G3VA 3JSZA 3EZIA 3TJ6A 4XEFA 2EIKC 5CI9A 4YK5A 3ZVRA 2HZ8A 3FOOA 3ZDLA 4I3MA 5L0JA 3GM2A 2LD6A 2XLDA 2L9JA 3RVZA 1XZPA 4C3DA 1S05A 1C17M 1Z23A 4K0DA 3U3BA 1H9TA 2KGOA 3O55A 3TK0A 3W4YA 4AK9A 2XM0A 3C8GD 4JZAA 4CSAC 3DI5A 3EG9A 4LDQA 4DJ9A 1V74B 2LP4A 1JAFA 2R7RA 4MVZA 4NTFA 5COFA 1SZIA 4ER9A 2O9XA 4XTKA 2A69F 2WZLA 1F1MA 4LACB 2Q4FA 4YT5A 1GM5A 3AGUA 3OA1A 2D4UA 4Q4ZF 1ZZPA 4EIYA 3ABLC 1OCZC 2VASA 2YVKA 2IBFA 1I5NA 2H7OA 5L3VA 1MNEA 3Q7LA 4YL3A 4DRIB 4XLNF 3U9JA 1U6HA 2LK4A 3SXYA 1NFOA 2AP3A 1J8YF 3GWLA 4GEHA 2LFFA 4IAOA 1M2VB 2PX3A 2F22A 1FFTC 4N06A 2DI3A 3GM1A 4U9DA 3VRCA 4JIOA 3B0VC 1Y6DA 4Q5SF 1VLSA 1PV3A 2VCBA 4JKVA 2QE9A 1OR3A 2RD9A 1NU7D 4JC7A 4YL1A 5A6BA 1G4US 1S7ZA 1E86A 5CIVA 3T6JA 4CIHA 3FAJA 1OXKA 3HNIA 2H7VC 3C8GA 3DJNB 3UMHA 1QLEC 2Y69C 1FNTc 3UGOA 3AGTA 4YN0B 3I5QA 1V54C 2L81A 3NYMA 2M64A 2XRHA 2R7XA 2UUIA 4E7ZA 4KI2A 4MNDA 1YLMA 2WZFA 3C63A 1GS9A 5COMA 1CGNA 3WAQA 1T01A 2MYSA 3O10A 4A4AA 5KYXA 1K05A 5BQGA 3C7JA 3MYFA 4XPXA 3EHNA 1TFOB 2LSEA 3GODA 3SXMA 2PX0A 1N1CA 4CJGA 2R02A 3W8HA 1IZMA 3S84A 4NQFA 1ZHXA 5JSLA 1Q0GA 3FAPB 2MHRA 2YL1A 4JEAA 1APCA 4E7SA 3K66A 2OOCA 2G62A 2PF4E 3K1HA 4OIPF 5AC4A 4P9FA 3LEVA 1JMWA 2EPLX 1ST6A 3B0UX 3B71A 1NLXA 3PDMP 3IEEA 4Z9JA 2WVQA 2YLIA 1VLTA 3KL4A 2I15A 3MBGA 3C8GB 2CNWD 2ZXOA 4IGGA 4N4WA 3ATPA 1BR2A 2OEXA 4JJFA 4CDAA 4CS8A 5DS6A 2ASRA 4PJJA 1AEPA 1CGOA 2KC3A 2R7OA 3DE9A 2QLAA 2XLWA 1T6QA 3CZ6A 3QW0A 4OD5A 3FXHA 2XL8A 1QQ3A 3HJCA 3MLGA 4ONSA 3RQFA 1GQAA 5A6BD 3KPHA 3NMKA 4OIQF 3O39A 5JRAA 3CSKA 3U3FA 2ICWG 3JCUQ 3RQEA 3NDBB 2QTVA 1OW8A 3KYIA 3V5YA 4OINF 2NG1A 1Z63A 1YZCA 4JVSA 1D1AA 3LLKA 5CI8A 5B3IA 3K6BA 2R7WA 3R2PA 2KQ9A 3QMKA 4KNVA 2PNOA 3MYIA 1ORSC 3K1IA 4K7BA 2AWCA 1SYQA 1YJGA 3U2LA 1T6IA 4JCHA 4MTGA 2P1AA 2IYLD 4CX9A 2OKUA 1RKCA 3VF0A 4BJ5C 3K33A 2R7TA 4Z9HA 4BEMJ 1HW2A 2UUHA 3FMSA 2YLGA 3NMJA 4PJNA 3ZSUA 3L34A 4HE8D 2A0BA 4IARA 3DKAA 4U5CE 5KYYA 3O6XA 4MQ9F 4XWJA 4F4BA 3ZC4A 3LEOA 4FESA 2A68F 1FFHA 3T4RA 4OIRF 3RQGA 2J9UA 1RJ9A 1I4ZA 3ZWIA 3LESA 4DVZA 3L0IA 3JRMO 5A6AA 2HUJA 4QI0A 3LNMB 3FOPA 2J0XA 3DAGA 2GWWA 3ABMC 1ZHZA 2OCCC 3ZG1A 2YLDA 1LM3B 2YHSA 3PCVA 2P0NA 3HNJA 4DOZA 1HMOA 3EG9B 3L8IA 3JT1A 4JURI 2X0CA 2DB4A 4J7TA 4H4KC 4O7GA 1RJ9B 2VH3A 2YWAA 1DOWA 4DRHB 4DBQA 3T6BA 5L0IA 1FAPB 1ZW3A 4HFKB 2Y3BA 1JPNA 3TD7A 5DLJA 3H65A 5T3WA 3VYWA 2YEVA 2D5RB 1EI7A 4B6IA 4AE4B 5F5HA 3ECSA 5EHHA 2HMQA 3WG7C 1YYJA 2IXMA 1TKNA 2RSEB 4C3BA 3RYLA 4EHPA 2AWYA 4XEVA 2KW3C 2KYHA 3G4ZA 3NKEA 2J46A 5EK0A 1O5HA 3EJNA 2R7SA 1O87A 2HJMA 4E18A 1M56C 5L0GA 2Y3GA 2YQYA 1Z6AA 2KNHA 1BR4A 4J30B 4X0RA 3TOLA 3U8VA 3ZQYA 1SR2A 4AL1A 2GA0A 3OWTA 4I1OB 3V5XA 2EIMC 4BJ1A 4N6HA 2WVOA 3POVA 2J7PD 4ZLDA 4NY3A 1LE2A 2J9BA 4G7OF 2DGJA 3EQLF 4EWCA 3DAFA 1JOGA 2GAQA 3CQZA 4U5HA 1TWHA 256BA 2P61A 2XLHA 4G0HA 4K1OA 3WODF 3NKDA 3C8ZA 5D91A 2I8BA 1XWJA
chains in the Genus database with same CATH topology
4JRZA 4NTFA 4AL0A 4NTAA 3LEOA 4YL0A 4JC7A 4YL1A 4JCZA 4BPMA 4J7YA 2H8AA 5BQHA 2Q7RA 3PCVA 2PNOA 4YK5A 4YL3A 3DWWA 4AL1A 2UUIA 4WABA 5K0IA 4J7TA 3HKKA 5BQIA 5HV9A 2UUHA 4NTBA 3B29A 5BQGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JRZ A;  4NTF A;  4AL0 A;  4NTA A;  3LEO A;  4YL0 A;  4JC7 A;  4YL1 A;  4JCZ A;  4BPM A;  4J7Y A;  2H8A A;  5BQH A;  2Q7R A;  3PCV A;  2PNO A;  4YK5 A;  4YL3 A;  3DWW A;  4AL1 A;  2UUI A;  4WAB A;  5K0I A;  4J7T A;  3HKK A;  5BQI A;  5HV9 A;  2UUH A;  4NTB A;  3B29 A;  5BQG A; 
#chains in the Genus database with same CATH topology
 2R03 A;  2BL2 A;  4O6M A;  1A7D A;  4FAP B;  2Q9C A;  2WZG A;  1D0Y A;  2LIG A;  4CDV A;  2YKZ A;  1H9G A;  4JJG A;  3AOU A;  2OJE D;  3H2V A;  4MW8 A;  3QVZ A;  4PK4 A;  3W2W A;  1EKY A;  3AG4 C;  2FAP B;  2H7B A;  4XQ1 A;  3SXZ A;  1M6T A;  3JYH A;  1FMW A;  4J7Y A;  3SP1 A;  2JD3 A;  3B0P A;  1ZYR F;  2C03 A;  2EPO A;  3ASO C;  3HTK C;  3QVY A;  4MVO A;  2QNL A;  4KNW A;  4WGY A;  4BEJ A;  2ETS A;  4IRU A;  4G7H F;  1H6G A;  1JR8 A;  3DE8 A;  3X1O A;  1TR2 A;  2CW0 F;  1QPU A;  3NYJ A;  4PJM A;  4QI2 A;  1NBB A;  2EPN A;  2R05 A;  1GGQ A;  5DVW A;  5KYY B;  1Q0K A;  3EGX A;  1LI5 A;  1VK5 A;  1RCP A;  3ZIB A;  1HE9 A;  4OIO F;  3VAY A;  1YA9 A;  5JLI A;  4CJO A;  2HV7 A;  3M4B A;  2Y39 A;  1R5I D;  3TJ5 A;  3M4C A;  5JVE A;  3IQ6 A;  3BRJ A;  4DVY P;  3PHF 2;  2YL7 A;  4JW1 A;  2OU6 A;  1M2O A;  1SF8 A;  4GQH A;  1WTY A;  1LS1 A;  5FCL A;  2XL4 A;  3LNR A;  3N2Z B;  3UNG C;  4E0H A;  2HKV A;  2XS1 A;  3AQC A;  4QDL A;  5D92 A;  5T1D B;  2GFH A;  2HMZ A;  1ZW2 A;  3IPM O;  5BUO A;  1T5O A;  4U5E E;  2XSE A;  2Q7R A;  1AVO B;  4R32 A;  1FMV A;  2J0W A;  3ASN C;  4JE9 A;  3DWW A;  1PCX A;  3GWN A;  2W4M A;  3HNL A;  4ZLC A;  3TUL A;  2XLV A;  4ULW A;  4G7Z F;  4M63 A;  1G8X A;  4O6Y A;  2Y3D A;  3T6G B;  3LLI A;  2BE5 F;  3A11 A;  3DD7 A;  3W2V A;  5JT4 A;  1Q0F A;  2MWQ A;  4C3E A;  2B0J A;  4JTD B;  1UG7 A;  5FZT A;  3T9O A;  4JRZ A;  3TQO A;  4CIP A;  1EA8 A;  1PD1 A;  2Y3H A;  2A6H F;  5B1B C;  1TWG A;  4U9E A;  3SYN A;  1U89 A;  3U8P A;  3QW1 A;  4MVU A;  2R7U A;  1WOL A;  3JSE O;  1Q0M A;  4I44 A;  2W4B A;  1FR0 A;  1QSP A;  4YT2 A;  4AX2 A;  4JTA B;  1NZE A;  1RMV A;  1OXB A;  2H8A A;  1B68 A;  5BQH A;  1LS4 A;  3GM3 A;  3Q6M A;  1VB5 A;  2WL8 A;  5KYU B;  3U2M A;  3US6 A;  3JYY A;  1DOV A;  2PP4 A;  1KU2 A;  4OD4 A;  1IW7 F;  3C62 A;  2LCH A;  1EQ1 A;  3UR3 C;  3DMD A;  3KMI A;  3G50 A;  1E84 A;  2DYR C;  2C04 A;  1BBH A;  3I4U A;  1AUE A;  4EUK B;  3I5P A;  2VB6 A;  3L1M A;  1PD0 A;  1YAU O;  1OCC C;  1VYI A;  1YZA A;  2J7P A;  2L6F A;  1O3U A;  1TWC A;  3GEH A;  4HFF B;  1L3P A;  4Z9I A;  5JS5 A;  5IY5 C;  3EH1 A;  5DS5 A;  4YL0 A;  3RFY A;  1MMN A;  4CS8 C;  1D0Z A;  3RIP A;  3H2U A;  1HE1 A;  4EBJ A;  1A0B A;  1NU9 C;  3EH2 A;  4PFO A;  3LUT B;  2VCA A;  4WGZ A;  5TJ5 E;  1WAT A;  4CS9 C;  3B9Q A;  4PJL A;  3IQ5 A;  2TMV P;  3FHD A;  4HEA J;  2IXP A;  4CS7 A;  2J9V A;  4PR9 A;  2A1D D;  2KJG A;  1L7C A;  3S29 A;  3EPV A;  2R7Q A;  3K1I C;  3HNK A;  2Q9A A;  1LKX A;  2R7V A;  5L0C A;  1OW6 A;  2CYD A;  3LJB A;  5KYW A;  1A7V A;  2HSB A;  4J32 B;  1Z5Z A;  3ITF A;  4BJ5 A;  3TOM A;  1FTS A;  4JEB A;  4ULV A;  2QY9 A;  3SXK A;  5DQT A;  1HW1 A;  2XL6 A;  3DZA A;  3KH2 A;  4G78 A;  2XLE A;  1OR2 A;  2J8W A;  2R25 A;  1Q0D A;  2NSG A;  2OEV A;  3NRH A;  5A69 A;  5L0F A;  4XLP F;  1YA7 O;  4DXW A;  1QKR A;  1G4W R;  4Q7C A;  4XPY A;  4BJ6 C;  3K7D A;  1LPE A;  1NSG B;  2XLO A;  5JUA A;  1E83 A;  1ORY A;  2J45 A;  3BEH A;  1RKE B;  2FFH A;  2CDQ A;  2X51 A;  4CBE A;  5EGY A;  1CPR A;  3U5S A;  1K04 A;  1RKE A;  1H7I A;  3G4X A;  4I1M A;  1JRA A;  2P6V A;  3ZTZ A;  1TQG A;  1E2X A;  1Z3I X;  3Q6N A;  2WB7 A;  1SMY F;  3GOR A;  2EIN C;  1OW7 A;  1ZHY A;  4P6I C;  1OQC A;  2L6G A;  1ORJ A;  3SNH A;  2P7V A;  3FVY A;  1MQV A;  2HS5 A;  5F28 E;  4C7O B;  2ZXP A;  2AU5 A;  5HSW A;  1YAR O;  2L6H A;  3Q7G A;  4MVM A;  5BQI A;  5A6J A;  3RKO F;  1LIH A;  3EGX B;  4NTB A;  3HLZ A;  3B29 A;  2QUP A;  4BJ6 A;  4D4X A;  1R4T A;  1MMA A;  2LQG A;  1RXQ A;  2A6E F;  3LAY A;  3J06 A;  2NPU A;  3V5Z A;  3N24 A;  3S27 A;  2Q9B A;  4JCZ A;  1VTM P;  4KC9 A;  4BPM A;  4XEK A;  2J9W A;  2YL3 A;  3CAX A;  1TWA A;  1M2V A;  2IOQ A;  3KKB A;  3R7C A;  3RF3 A;  1LVK A;  3AG1 C;  5A6K A;  2Q3T A;  1MND A;  1VYK A;  1ZVZ A;  2Z15 A;  1BR1 A;  3A9C A;  3IHU A;  3MFN A;  3AG3 C;  4XPW A;  1C03 A;  3DM9 B;  1D0X A;  3M15 A;  2W9Y A;  3F47 A;  5K0I A;  5L3Q A;  4CSA A;  2ZXR A;  1ZU5 A;  4RBN A;  4AE4 A;  4YT8 A;  3HKK A;  1KTM A;  5F5F A;  1LI7 A;  3L8J A;  4PAC A;  3QTH A;  2EIL C;  3KYJ A;  2R9R B;  5AC5 A;  2YRF A;  3DM5 A;  4LDK A;  1BDJ B;  4O6N A;  2CGE A;  2M4E A;  2NSF A;  3PMR A;  3U9M A;  1OCO C;  4W8P A;  3W8I A;  2ZXW C;  2IM8 A;  2KSF A;  1YDI A;  2NUP A;  3SZR A;  3WHN A;  2EPM X;  3FDQ A;  2XXA B;  1XZQ A;  2PFD A;  1ZHW A;  1BZ4 A;  1D1B A;  4U5B E;  1NFN A;  1OKK A;  4P9T A;  3NYL A;  4U5F E;  1HMD A;  1I4Y A;  2VCC A;  5E3A A;  4UDV A;  4LLC A;  4YJW A;  2ZPA A;  1Y4C A;  4PFP A;  4ANJ A;  1YVI A;  5T3T A;  2A0U A;  1VMA A;  4FWV A;  2B0H A;  4MTF A;  3UMI A;  4RDA A;  4NC3 A;  3EGD B;  1WN0 A;  2CCY A;  5KYN A;  1ZU4 A;  3MX3 A;  3S0X A;  3CEX A;  5KYW B;  2V3C C;  5AGF A;  1MMG A;  3IQC A;  1G5Z A;  2IXN A;  3LS0 A;  1Z7Q c;  3E70 C;  5DS4 A;  3ZTM A;  4LLE A;  4O79 A;  2Q00 A;  2DYS C;  3N0T A;  1TFK B;  3U0C A;  4KBL A;  2IXO A;  1T6U A;  1WWP A;  2GDC A;  2XLM A;  2YL0 A;  4WJ0 A;  5GPG B;  3V7O A;  4BG0 A;  2HV6 A;  2WVN A;  1WGW A;  1NG1 A;  2LFD A;  4YWQ A;  2NUP B;  5L0H A;  4A2N B;  2XXA A;  2NUT B;  3AG2 C;  3EFO B;  3M79 A;  4IAQ A;  5E2Q A;  5B1A C;  1M57 C;  5B3S C;  2EIJ C;  4EBB A;  2HFI A;  4DBR A;  1E85 A;  1T9K A;  4NCQ A;  2CNW A;  4E17 A;  1U0B B;  1J8M F;  2W45 A;  3RH3 A;  4H54 A;  1JPJ A;  2JPU A;  4WAB A;  2HJ3 A;  3VM6 A;  3EZH A;  3RW0 A;  2L7A A;  4MVS A;  4DRJ B;  5KYX B;  2ZD9 A;  4FX5 A;  5E33 A;  5HV9 A;  1WAS A;  1UFB A;  1YYX A;  3S90 A;  2V26 A;  4EBK A;  3LS1 A;  3AQB A;  3E9V A;  4W8K A;  3GAN A;  2XM4 A;  3RVY A;  3UGP A;  4AL0 A;  3EGD A;  2OQM A;  3JRT A;  1K40 A;  4NTA A;  1CGM E;  3ABK C;  4IJJ A;  2OJQ A;  4RD9 A;  2VC9 A;  3JTL O;  2YZS A;  4GYT A;  1LE4 A;  3ZQV A;  1VOM A;  4MS2 A;  1A7E A;  3S9O A;  4LER A;  5COG A;  2G3K A;  3EHM A;  1D1C A;  3DXJ F;  3F46 A;  1OKK D;  2BC5 A;  4MVQ A;  4D4N A;  2KK1 A;  1V4A A;  2OG2 A;  3GEE A;  1OCR C;  3OEO A;  4LDR A;  5DQZ A;  5KYU A;  5JP7 A;  1KNY A;  4MVR A;  1C02 A;  1QZX A;  1MMD A;  3EFO A;  3NG1 A;  2NUT A;  1W2W A;  2JX0 A;  3SEO A;  3X2Q C;  4CDY A;  4C7O A;  3GEI A;  4JTC B;  3NMI A;  3QZC A;  4IWB A;  4N6C A;  3C18 A;  1CPQ A;  3IQT A;  4IB4 A;  2E87 A;  4L6R A;  5E3C A;  2XS8 A;  3UMK A;  2AVK A;  3JZ0 A;  2FGY A;  1A41 A;  1QVX A;  4U5D E;  2EPK X;  5L0D A;  2PBE A;  3DJU B;  4BJT A;  4MW3 A;  3M1C B;  2HSQ A;  3S28 A;  4E0I A;  3AJM A;  1ZHT A;  4CS9 A;  4EKW A;  4MTO A;  4U5G A;  4YT4 A;  1HY5 A;  1V55 C;  2G3V A;  3JSZ A;  3EZI A;  3TJ6 A;  4XEF A;  2EIK C;  5CI9 A;  4YK5 A;  3ZVR A;  2HZ8 A;  3FOO A;  3ZDL A;  4I3M A;  5L0J A;  3GM2 A;  2LD6 A;  2XLD A;  2L9J A;  3RVZ A;  1XZP A;  4C3D A;  1S05 A;  1C17 M;  1Z23 A;  4K0D A;  3U3B A;  1H9T A;  2KGO A;  3O55 A;  3TK0 A;  3W4Y A;  4AK9 A;  2XM0 A;  3C8G D;  4JZA A;  4CSA C;  3DI5 A;  3EG9 A;  4LDQ A;  4DJ9 A;  1V74 B;  2LP4 A;  1JAF A;  2R7R A;  4MVZ A;  4NTF A;  5COF A;  1SZI A;  4ER9 A;  2O9X A;  4XTK A;  2A69 F;  2WZL A;  1F1M A;  4LAC B;  2Q4F A;  4YT5 A;  1GM5 A;  3AGU A;  3OA1 A;  2D4U A;  4Q4Z F;  1ZZP A;  4EIY A;  3ABL C;  1OCZ C;  2VAS A;  2YVK A;  2IBF A;  1I5N A;  2H7O A;  5L3V A;  1MNE A;  3Q7L A;  4YL3 A;  4DRI B;  4XLN F;  3U9J A;  1U6H A;  2LK4 A;  3SXY A;  1NFO A;  2AP3 A;  1J8Y F;  3GWL A;  4GEH A;  2LFF A;  4IAO A;  1M2V B;  2PX3 A;  2F22 A;  1FFT C;  4N06 A;  2DI3 A;  3GM1 A;  4U9D A;  3VRC A;  4JIO A;  3B0V C;  1Y6D A;  4Q5S F;  1VLS A;  1PV3 A;  2VCB A;  4JKV A;  2QE9 A;  1OR3 A;  2RD9 A;  1NU7 D;  4JC7 A;  4YL1 A;  5A6B A;  1G4U S;  1S7Z A;  1E86 A;  5CIV A;  3T6J A;  4CIH A;  3FAJ A;  1OXK A;  3HNI A;  2H7V C;  3C8G A;  3DJN B;  3UMH A;  1QLE C;  2Y69 C;  1FNT c;  3UGO A;  3AGT A;  4YN0 B;  3I5Q A;  1V54 C;  2L81 A;  3NYM A;  2M64 A;  2XRH A;  2R7X A;  2UUI A;  4E7Z A;  4KI2 A;  4MND A;  1YLM A;  2WZF A;  3C63 A;  1GS9 A;  5COM A;  1CGN A;  3WAQ A;  1T01 A;  2MYS A;  3O10 A;  4A4A A;  5KYX A;  1K05 A;  5BQG A;  3C7J A;  3MYF A;  4XPX A;  3EHN A;  1TFO B;  2LSE A;  3GOD A;  3SXM A;  2PX0 A;  1N1C A;  4CJG A;  2R02 A;  3W8H A;  1IZM A;  3S84 A;  4NQF A;  1ZHX A;  5JSL A;  1Q0G A;  3FAP B;  2MHR A;  2YL1 A;  4JEA A;  1APC A;  4E7S A;  3K66 A;  2OOC A;  2G62 A;  2PF4 E;  3K1H A;  4OIP F;  5AC4 A;  4P9F A;  3LEV A;  1JMW A;  2EPL X;  1ST6 A;  3B0U X;  3B71 A;  1NLX A;  3PDM P;  3IEE A;  4Z9J A;  2WVQ A;  2YLI A;  1VLT A;  3KL4 A;  2I15 A;  3MBG A;  3C8G B;  2CNW D;  2ZXO A;  4IGG A;  4N4W A;  3ATP A;  1BR2 A;  2OEX A;  4JJF A;  4CDA A;  4CS8 A;  5DS6 A;  2ASR A;  4PJJ A;  1AEP A;  1CGO A;  2KC3 A;  2R7O A;  3DE9 A;  2QLA A;  2XLW A;  1T6Q A;  3CZ6 A;  3QW0 A;  4OD5 A;  3FXH A;  2XL8 A;  1QQ3 A;  3HJC A;  3MLG A;  4ONS A;  3RQF A;  1GQA A;  5A6B D;  3KPH A;  3NMK A;  4OIQ F;  3O39 A;  5JRA A;  3CSK A;  3U3F A;  2ICW G;  3JCU Q;  3RQE A;  3NDB B;  2QTV A;  1OW8 A;  3KYI A;  3V5Y A;  4OIN F;  2NG1 A;  1Z63 A;  1YZC A;  4JVS A;  1D1A A;  3LLK A;  5CI8 A;  5B3I A;  3K6B A;  2R7W A;  3R2P A;  2KQ9 A;  3QMK A;  4KNV A;  2PNO A;  3MYI A;  1ORS C;  3K1I A;  4K7B A;  2AWC A;  1SYQ A;  1YJG A;  3U2L A;  1T6I A;  4JCH A;  4MTG A;  2P1A A;  2IYL D;  4CX9 A;  2OKU A;  1RKC A;  3VF0 A;  4BJ5 C;  3K33 A;  2R7T A;  4Z9H A;  4BEM J;  1HW2 A;  2UUH A;  3FMS A;  2YLG A;  3NMJ A;  4PJN A;  3ZSU A;  3L34 A;  4HE8 D;  2A0B A;  4IAR A;  3DKA A;  4U5C E;  5KYY A;  3O6X A;  4MQ9 F;  4XWJ A;  4F4B A;  3ZC4 A;  3LEO A;  4FES A;  2A68 F;  1FFH A;  3T4R A;  4OIR F;  3RQG A;  2J9U A;  1RJ9 A;  1I4Z A;  3ZWI A;  3LES A;  4DVZ A;  3L0I A;  3JRM O;  5A6A A;  2HUJ A;  4QI0 A;  3LNM B;  3FOP A;  2J0X A;  3DAG A;  2GWW A;  3ABM C;  1ZHZ A;  2OCC C;  3ZG1 A;  2YLD A;  1LM3 B;  2YHS A;  3PCV A;  2P0N A;  3HNJ A;  4DOZ A;  1HMO A;  3EG9 B;  3L8I A;  3JT1 A;  4JUR I;  2X0C A;  2DB4 A;  4J7T A;  4H4K C;  4O7G A;  1RJ9 B;  2VH3 A;  2YWA A;  1DOW A;  4DRH B;  4DBQ A;  3T6B A;  5L0I A;  1FAP B;  1ZW3 A;  4HFK B;  2Y3B A;  1JPN A;  3TD7 A;  5DLJ A;  3H65 A;  5T3W A;  3VYW A;  2YEV A;  2D5R B;  1EI7 A;  4B6I A;  4AE4 B;  5F5H A;  3ECS A;  5EHH A;  2HMQ A;  3WG7 C;  1YYJ A;  2IXM A;  1TKN A;  2RSE B;  4C3B A;  3RYL A;  4EHP A;  2AWY A;  4XEV A;  2KW3 C;  2KYH A;  3G4Z A;  3NKE A;  2J46 A;  5EK0 A;  1O5H A;  3EJN A;  2R7S A;  1O87 A;  2HJM A;  4E18 A;  1M56 C;  5L0G A;  2Y3G A;  2YQY A;  1Z6A A;  2KNH A;  1BR4 A;  4J30 B;  4X0R A;  3TOL A;  3U8V A;  3ZQY A;  1SR2 A;  4AL1 A;  2GA0 A;  3OWT A;  4I1O B;  3V5X A;  2EIM C;  4BJ1 A;  4N6H A;  2WVO A;  3POV A;  2J7P D;  4ZLD A;  4NY3 A;  1LE2 A;  2J9B A;  4G7O F;  2DGJ A;  3EQL F;  4EWC A;  3DAF A;  1JOG A;  2GAQ A;  3CQZ A;  4U5H A;  1TWH A;  256B A;  2P61 A;  2XLH A;  4G0H A;  4K1O A;  3WOD F;  3NKD A;  3C8Z A;  5D91 A;  2I8B A;  1XWJ A; 
#chains in the Genus database with same CATH homology
 4JRZ A;  4NTF A;  4AL0 A;  4NTA A;  3LEO A;  4YL0 A;  4JC7 A;  4YL1 A;  4JCZ A;  4BPM A;  4J7Y A;  2H8A A;  5BQH A;  2Q7R A;  3PCV A;  2PNO A;  4YK5 A;  4YL3 A;  3DWW A;  4AL1 A;  2UUI A;  4WAB A;  5K0I A;  4J7T A;  3HKK A;  5BQI A;  5HV9 A;  2UUH A;  4NTB A;  3B29 A;  5BQG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...