3QVZA

Crystal structure of the zn-ridc1 complex stabilized by bmoe crosslinks cocrystallized in the presence of cu(ii)
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
106
structure length
106
Chain Sequence
ADLEDNMETLNDNLKVIEKADNAAQVKDALTKMAAAAADAWSATPPKLEDKSPDSPEMHDFRHGFWILIGQIHDALHLANECKVKEAQAAAEQLKTTCNACHQKYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome cb562
publication title Templated construction of a zn-selective protein dimerization motif.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 46
structure length 106
sequence length 106
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-02-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 3qvzA00
2CCYA 3TOMA 1E86A 3FOPA 3M4CA 3ZQVA 1CGNA 5JP7A 2YL1A 1RCPA 2J8WA 3TOLA 5JUAA 2XLEA 3ZTMA 1EKYA 4U9DA 4D4XA 3M15A 3C63A 3HNJA 2YLDA 1CGOA 1M6TA 4CDYA 5B3IA 2XLMA 5AGFA 3HNKA 4CJOA 4L6RA 2J9BA 1APCA 1NBBA 4D4NA 2BC5A 4CIPA 5JRAA 2XLVA 2YL7A 3M79A 1YYXA 4CDVA 1CPQA 4IARA 4JE9A 1E85A 3L1MA 1QPUA 3U8PA 1JAFA 4JKVA 3VRCA 4JEAA 1CPRA 3HNLA 4ER9A 2YL0A 4WGZA 2XLWA 3M4BA 1A7VA 5JSLA 1E84A 1MQVA 4EIYA 2XLHA 2YL3A 2XLDA 3C62A 3IQ5A 3FOOA 3QVYA 1YYJA 4IAQA 4CDAA 1BBHA 2YLGA 3DE9A 2XM4A 3NMJA 1QQ3A 2XL6A 3NMKA 1S05A 1E83A 2XLOA 5JLIA 2YKZA 1LM3B 5JS5A 3QW0A 2QLAA 5JVEA 4N4WA 2XM0A 2YLIA 3QW1A 3ZWIA 4U9EA 5JT4A 4IB4A 1GQAA 3ZQYA 2XL8A 4ULVA 3ZTZA 4CX9A 1YZCA 3HNIA 3IQ6A 4NC3A 3QVZA 3NMIA 4CJGA 4JEBA 3DE8A 1YZAA 4WGYA 4N6HA 256BA
chains in the Genus database with same CATH superfamily
1XWJA 1A7EA 1R5ID 3EGXA 4U5HA 4U5BE 2UUHA 3TOMA 3W2VA 3ZQVA 4E0HA 4DJ9A 1TWGA 1CGNA 1J8YF 2LIGA 3G4ZA 1Q0DA 1HW1A 2C04A 2J0WA 3TOLA 1XZPA 3EFOA 1EA8A 2WZLA 5DLJA 4OIQF 1ZHZA 2HFIA 3K7DA 4H4KC 1NZEA 2OEXA 4IAOA 4KC9A 3ZTMA 1EQ1A 1Z6AA 2EPNA 2MHRA 3LEOA 4BEMJ 3N2ZB 2R7VA 3B0UX 4D4XA 1LS1A 2QNLA 1ZHYA 2QY9A 5DS6A 1IZMA 1J8MF 5BQGA 2A1DD 4PJLA 1FFTC 4DVYP 4E0IA 2XLMA 1I5NA 1RKEA 1YLMA 3O55A 4JTDB 4O7GA 2GA0A 3C8ZA 4BJ6C 2NUPA 4B6IA 3AG2C 5EGYA 3W2WA 4BJ6A 2E87A 4ZLDA 1APCA 1KNYA 3K6BA 4C3BA 3HKKA 3C8GB 1NLXA 4QI2A 2FFHA 4AE4B 3O6XA 4YWQA 1AVOB 5GPGB 1NG1A 3ASOC 4CIPA 5JRAA 3UGOA 2VB6A 2KYHA 4I44A 3GM2A 2RSEB 3RW0A 1Q0FA 2P61A 3M79A 3Q7GA 2DI3A 1BR4A 4G7HF 1YA7O 3H2UA 3W8IA 4U5GA 4DOZA 3ECSA 2Y3DA 2YQYA 1ZU4A 4A2NB 1E2XA 1JR8A 2ASRA 4U5EE 4LACB 1BDJB 1WATA 2R7WA 3GWNA 1PD1A 2ZPAA 1M2VA 2HUJA 3L1MA 4U5DE 2VH3A 3LLIA 3QZCA 2B0JA 3M1CB 3U8PA 3S0XA 4EBJA 1ZYRF 1K40A 2NSGA 3WG7C 2DYSC 4Z9HA 4OINF 1VYKA 3RF3A 3C18A 3ZVRA 2VASA 5KYUA 1FR0A 4GYTA 3GEIA 2Y3BA 2LK4A 3AGTA 5B1AC 4DXWA 1LVKA 4YT5A 4MVMA 1NFOA 1Y4CA 2KC3A 3JT1A 5JSLA 3EGDB 4C3DA 1NU9C 1MQVA 1WTYA 2M64A 5L0DA 2XLHA 2PP4A 3ABLC 2WVQA 1O3UA 1OW8A 5L0JA 1OCZC 3C62A 4LERA 2V3CC 4HEAJ 4CDAA 2ZXRA 3FXHA 3EQLF 1V55C 2R7QA 3AG4C 4C7OB 1PCXA 3T4RA 1BR1A 1NSGB 2Q9AA 2Y39A 4YT4A 2KW3C 3TJ5A 5DVWA 2VC9A 3DKAA 3T6JA 1D0YA 3K1IA 2MYSA 2XLOA 3C8GA 3SXMA 3U2LA 5JLIA 4QI0A 4IGGA 4J32B 5A6JA 5E3AA 1OKKD 5JVEA 5KYXA 5EHHA 5JT4A 2XRHA 1GQAA 3CQZA 3LAYA 5BQHA 3ZTZA 1T6IA 4MVQA 2EPOA 3Q7LA 4NTFA 4NCQA 4U5FE 1HY5A 2WVNA 3EJNA 3IQ6A 4CS9C 2XXAA 3GEEA 5AC4A 3QVZA 2ZXWC 2F22A 1H7IA 2NSFA 3NMIA 4CJGA 2VCAA 4E18A 3GM1A 5BQIA 3NKEA 3C7JA 2HSBA 2DGJA 5KYWA 1C03A 3GODA 5TJ5E 3HJCA 1ZVZA 2R7TA 2YZSA 4BJTA 1ORYA 3K1HA 2PFDA 3NKDA 2Q9CA 5HV9A 3WAQA 1E86A 3NDBB 1VB5A 1QKRA 2JD3A 4MTFA 5L0CA 2L7AA 1RJ9B 4CBEA 1H9TA 3OA1A 1RCPA 4N6CA 4YN0B 2H7OA 1NU7D 4R32A 3MLGA 4QDLA 1QVXA 3MYFA 5JUAA 4BJ5A 4LDKA 4XLNF 3DZAA 4U9DA 3UNGC 1OCRC 3M15A 4IRUA 3C63A 2X0CA 4CSAC 1D0ZA 4FWVA 1D1AA 1A41A 1QSPA 4CSAA 3L34A 1M6TA 4NTAA 4CDYA 2LP4A 3S90A 1ORJA 3DJNB 2HZ8A 3K66A 3L0IA 5A6BD 3FMSA 4G0HA 4JC7A 4JCHA 3ZC4A 4BJ1A 1FTSA 1BR2A 3K33A 5DQTA 3NYLA 4CJOA 5F5FA 1GS9A 1ZU5A 3AQCA 4MVUA 1UG7A 1N1CA 1UFBA 2IYLD 3QMKA 2A6EF 1K04A 5T3TA 5AC5A 5L3QA 3KYJA 1Z63A 1H6GA 3VF0A 3S27A 2PBEA 1U6HA 4BEJA 4J7YA 4KNWA 4Z9IA 4YK5A 2CDQA 2XLVA 2EIKC 3L8JA 2YRFA 4P6IC 1Z23A 2J9WA 1YARO 1Z7Qc 2IXMA 5CI9A 4O6MA 3O10A 1YYXA 4CDVA 1WN0A 3V5XA 3IHUA 4IARA 4DRHB 1VOMA 1FAPB 3CEXA 2EILC 3DXJF 3GWLA 3LS1A 4LLEA 1M56C 2DB4A 4MTGA 3RIPA 3U3BA 4YJWA 3I5QA 1WGWA 2WZFA 3JYYA 1E83A 4PR9A 2OOCA 2L81A 2QUPA 4MVOA 1RKCA 2HV7A 3FHDA 3RKOF 1TQGA 4JEAA 2YEVA 1CPRA 3Q6MA 3UR3C 4HFFB 2G62A 2W45A 1LI7A 3DM5A 3CZ6A 2GDCA 4ER9A 3EPVA 4E7ZA 2W4MA 2YL0A 4Q4ZF 1FFHA 2ZXOA 3R2PA 5B1BC 3TK0A 3EG9A 5FCLA 4JIOA 3N24A 4RBNA 2XLWA 5E2QA 1I4ZA 3U0CA 5D91A 2FGYA 3F46A 1E84A 5A6AA 4EIYA 2NG1A 1GGQA 5L0IA 4PFPA 3I4UA 4JRZA 1YAUO 4UDVA 4I1OB 4IAQA 3E9VA 2JX0A 5DS5A 1BBHA 3EZHA 3DI5A 1S7ZA 1OW6A 3DE9A 1MNDA 1MMNA 3EHNA 3NMJA 3HLZA 3RYLA 4OIPF 1RMVA 2XL6A 2XL4A 2A0UA 3NMKA 2DYRC 1S05A 1TWHA 2Q9BA 1O87A 3U5SA 1NFNA 2OKUA 4XPXA 2AU5A 4PJJA 2KNHA 5D92A 2OJED 3SXYA 5KYNA 1TFKB 3AGUA 4N4WA 4WJ0A 4X0RA 1GM5A 3BEHA 3ZWIA 4I3MA 1JRAA 4XEVA 1QZXA 1C02A 3G4XA 4LLCA 3VAYA 3ABMC 3B71A 1R4TA 1SMYF 2LFFA 3FVYA 1G4WR 2PX0A 3MBGA 3MYIA 1AEPA 3HNIA 3AOUA 5T1DB 4J7TA 1TWAA 3JRMO 3DD7A 1VLTA 1YA9A 5FZTA 2GWWA 5DQZA 4CS8A 4JJGA 3JSEO 3DMDA 1OQCA 1TKNA 4YT8A 2CW0F 3FAPB 1L3PA 1VYIA 3EZIA 1LIHA 3AJMA 3SXKA 1G8XA 3IQCA 4MW8A 4WGYA 2H8AA 1AUEA 2ZXPA 4EHPA 1K05A 2CCYA 2HS5A 1MMDA 3K1IC 3T9OA 3FOPA 3M4CA 2M4EA 1DOWA 2Y3GA 4MVZA 4XLPF 5JP7A 2R7UA 4RDAA 2PX3A 4AE4A 5A6KA 1LPEA 4ZLCA 2NUTB 2YL1A 3JYHA 1LKXA 3EHMA 1C17M 4KNVA 4MVSA 3SXZA 3RVZA 3ZSUA 4A4AA 4E7SA 2A6HF 3N0TA 5L0HA 4PACA 5KYYB 3UGPA 2R02A 3H2VA 4KBLA 4XTKA 2YVKA 2L9JA 1EKYA 2R7OA 2RD9A 2L6HA 1IW7F 1FMWA 3IEEA 1BZ4A 4WABA 4C3EA 1M57C 3ZG1A 2OG2A 3ITFA 4G7OF 4JZAA 4XEFA 3SYNA 4NTBA 4MNDA 1V4AA 2X51A 3FAJA 2Y3HA 1JPNA 3Q6NA 3RVYA 3L8IA 4L6RA 2R7RA 2J9BA 3IPMO 3JRTA 1Z3IX 1D0XA 2BE5F 4OIOF 3W4YA 1FMVA 2HMQA 3TQOA 3ZIBA 1A0BA 3EFOB 3CSKA 4BG0A 1G4US 1V54C 3F47A 5L3VA 1T9KA 1EI7A 2VCCA 3EGDA 4BJ5C 1JMWA 2C03A 1WWPA 3W8HA 3X1OA 3RQGA 2JPUA 5COMA 2YWAA 5T3WA 1T5OA 2Q4FA 1CPQA 3TJ6A 3NYJA 1HE9A 5A69A 1E85A 3JCUQ 2HJMA 1HW2A 1QPUA 1LE2A 1RKEB 1OCCC 3NG1A 3A11A 1JAFA 2IXOA 4C7OA 1DOVA 4EBKA 3AG3C 4JURI 3ABKC 3X2QC 1OXBA 4MQ9F 1XZQA 2XSEA 4CS7A 1VTMP 4J30B 5K0IA 2LQGA 4JTAB 3U9JA 2IOQA 2A69F 4W8KA 1LI5A 2G3VA 3LNRA 4XEKA 3SNHA 2CYDA 2LSEA 1HE1A 3PDMP 5F28E 2A0BA 2EPLX 4WGZA 3T6BA 1VK5A 1ZHWA 3ASNC 4PJNA 2IXNA 2WL8A 4HE8D 2EIJC 2QTVA 4N06A 4EUKB 2CNWA 2V26A 4YL0A 3ATPA 1OR2A 4JTCB 2XLDA 3GM3A 2FAPB 3S29A 4K0DA 3OEOA 3QVYA 4G78A 1M2VB 4I1MA 1T6QA 4H54A 3S28A 2YLGA 4JJFA 2XM4A 2J7PA 2KSFA 2Q3TA 1F1MA 2R05A 4NQFA 2A68F 3CAXA 1PV3A 3KPHA 4ONSA 2G3KA 3U2MA 4YT2A 5KYUB 2P7VA 1H9GA 2YKZA 1LM3B 2W4BA 3C8GD 3DAFA 3NRHA 3QTHA 1JPJA 1ST6A 1OKKA 2AVKA 3QW0A 1ZZPA 2QLAA 2P6VA 1Q0KA 4ULWA 1RJ9A 3GANA 2ZD9A 3QW1A 2H7BA 1B68A 1RXQA 1Z5ZA 4U9EA 5COFA 1L7CA 3ZQYA 3LEVA 4CX9A 3PMRA 1MMAA 1YZCA 2EPMX 3LS0A 4EWCA 4CIHA 2NPUA 3KMIA 1I4YA 2P0NA 3POVA 2HSQA 1ZHXA 3GEHA 2W9YA 1ZHTA 4Q7CA 2HKVA 5E3CA 2IM8A 4AL0A 1ZW2A 2TMVP 1Y6DA 4O6NA 2R7SA 2MWQA 3IQTA 4HFKB 1KU2A 4JVSA 2AP3A 4MVRA 3NYMA 4O79A 1D1CA 3KYIA 4N6HA 1OCOC 4PFOA 3JSZA 3ZDLA 1VMAA 3RQEA 2OJQA 3DJUB 1T01A 3TULA 3MX3A 2XS1A 4DBQA 1SF8A 1YDIA 2R9RB 4EBBA 5KYXB 4MS2A 2GAQA 5DS4A 1FNTc 2OCCC 2J8WA 2KK1A 2EINC 2WB7A 3LNMB 4JW1A 3RQFA 4IJJA 1YVIA 5HSWA 4GQHA 3US6A 1VLSA 1O5HA 3JZ0A 2XLEA 1D1BA 3AG1C 1SR2A 2D4UA 2L6FA 4GEHA 2XXAB 2HMZA 4P9FA 2Q7RA 4CS8C 3DWWA 4YL1A 4P9TA 4OD5A 4ANJA 5F5HA 4W8PA 5EK0A 3HNJA 3LESA 2YLDA 1CGOA 5B3IA 3KH2A 3EH1A 5KYWB 4DRIB 5A6BA 4EKWA 5AGFA 3HTKC 2PNOA 3LUTB 2Y69C 3HNKA 2VCBA 3PCVA 2I15A 4OIRF 2J46A 4F4BA 3FDQA 1A7DA 1NBBA 4D4NA 4FX5A 2CGEA 2I8BA 2BC5A 2ETSA 2H7VC 3UMIA 5BUOA 1CGME 2Z15A 3R7CA 1T6UA 4XPYA 3BRJA 3AQBA 3B9QA 4FESA 4DRJB 2ICWG 3B0VC 3PHF2 1HMOA 2PF4E 2YL7A 3LJBA 2YHSA 4M63A 4Q5SF 2GFHA 3B0PA 2EPKX 2CNWD 2XS8A 3O39A 3U8VA 3SZRA 3RH3A 4G7ZF 1TWCA 3G50A 4AL1A 5L0FA 4JE9A 5IY5C 4K1OA 4E17A 3S84A 1U0BB 1Q0MA 2OEVA 2P1AA 2LFDA 2HJ3A 5E33A 4AX2A 2J7PD 4O6YA 2J0XA 4JKVA 1SYQA 3V5YA 3VRCA 2R25A 2J9UA 3HNLA 3MFNA 3LLKA 1ORSC 4DVZA 3EGXB 3WODF 2KJGA 4LDRA 5B3SC 1ZW3A 2EIMC 2J45A 3A9CA 1U89A 3DAGA 3V5ZA 1PD0A 3RFYA 2IXPA 4AK9A 3M4BA 3EH2A 4JCZA 4XWJA 1A7VA 4PJMA 1WASA 3OWTA 2KQ9A 4KI2A 4CS9A 2YL3A 2WVOA 1JOGA 4OD4A 3DM9B 3U3FA 3V7OA 3IQ5A 3FOOA 3J06A 3JTLO 2HV6A 3WHNA 5L0GA 1YYJA 1LS4A 4RD9A 2R7XA 1OR3A 1LE4A 3H65A 4XPWA 1W2WA 4NY3A 3S9OA 3UMHA 1V74B 2NUPB 2L6GA 1QQ3A 2BL2A 2IBFA 2R03A 2J9VA 3SEOA 4FAPB 2Q00A 2LD6A 3VYWA 4MW3A 5CI8A 5JS5A 3T6GB 1KTMA 1HMDA 2AWCA 2AWYA 2KGOA 3B29A 3EG9B 2XM0A 2YLIA 1OW7A 1MNEA 2NUTA 2OQMA 4IB4A 4K7BA 2WZGA 4IWBA 3VM6A 4DBRA 4U5CE 2OU6A 1TFOB 2XL8A 4ULVA 1G5ZA 5KYYA 2LCHA 2D5RB 4XQ1A 4Z9JA 3U9MA 2O9XA 1WOLA 4YL3A 1TR2A 5COGA 4NC3A 3UMKA 3E70C 3I5PA 3KKBA 4JEBA 1OXKA 1Q0GA 1SZIA 3TD7A 1QLEC 3KL4A 4PK4A 3DE8A 4BPMA 1M2OA 1YZAA 2UUIA 3GORA 5CIVA 4MTOA 4LDQA 1MMGA 2QE9A 3SP1A 2B0HA 1YJGA 256BA
chains in the Genus database with same CATH topology
2CCYA 3TOMA 1E86A 3FOPA 3M4CA 3ZQVA 1CGNA 5JP7A 2YL1A 1RCPA 2J8WA 3TOLA 5JUAA 2XLEA 3ZTMA 1EKYA 4U9DA 4D4XA 3M15A 3C63A 3HNJA 2YLDA 1CGOA 1M6TA 4CDYA 5B3IA 2XLMA 5AGFA 3HNKA 4CJOA 4L6RA 2J9BA 1APCA 1NBBA 4D4NA 2BC5A 4CIPA 5JRAA 2XLVA 2YL7A 3M79A 1YYXA 4CDVA 1CPQA 4IARA 4JE9A 1E85A 3L1MA 1QPUA 3U8PA 1JAFA 4JKVA 3VRCA 4JEAA 1CPRA 3HNLA 4ER9A 2YL0A 4WGZA 2XLWA 3M4BA 1A7VA 5JSLA 1E84A 1MQVA 4EIYA 2XLHA 2YL3A 2XLDA 3C62A 3IQ5A 3FOOA 3QVYA 1YYJA 4IAQA 4CDAA 1BBHA 2YLGA 3DE9A 2XM4A 3NMJA 1QQ3A 2XL6A 3NMKA 1S05A 1E83A 2XLOA 5JLIA 2YKZA 1LM3B 5JS5A 3QW0A 2QLAA 5JVEA 4N4WA 2XM0A 2YLIA 3QW1A 3ZWIA 4U9EA 5JT4A 4IB4A 1GQAA 3ZQYA 2XL8A 4ULVA 3ZTZA 4CX9A 1YZCA 3HNIA 3IQ6A 4NC3A 3QVZA 3NMIA 4CJGA 4JEBA 3DE8A 1YZAA 4WGYA 4N6HA 256BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CCY A;  3TOM A;  1E86 A;  3FOP A;  3M4C A;  3ZQV A;  1CGN A;  5JP7 A;  2YL1 A;  1RCP A;  2J8W A;  3TOL A;  5JUA A;  2XLE A;  3ZTM A;  1EKY A;  4U9D A;  4D4X A;  3M15 A;  3C63 A;  3HNJ A;  2YLD A;  1CGO A;  1M6T A;  4CDY A;  5B3I A;  2XLM A;  5AGF A;  3HNK A;  4CJO A;  4L6R A;  2J9B A;  1APC A;  1NBB A;  4D4N A;  2BC5 A;  4CIP A;  5JRA A;  2XLV A;  2YL7 A;  3M79 A;  1YYX A;  4CDV A;  1CPQ A;  4IAR A;  4JE9 A;  1E85 A;  3L1M A;  1QPU A;  3U8P A;  1JAF A;  4JKV A;  3VRC A;  4JEA A;  1CPR A;  3HNL A;  4ER9 A;  2YL0 A;  4WGZ A;  2XLW A;  3M4B A;  1A7V A;  5JSL A;  1E84 A;  1MQV A;  4EIY A;  2XLH A;  2YL3 A;  2XLD A;  3C62 A;  3IQ5 A;  3FOO A;  3QVY A;  1YYJ A;  4IAQ A;  4CDA A;  1BBH A;  2YLG A;  3DE9 A;  2XM4 A;  3NMJ A;  1QQ3 A;  2XL6 A;  3NMK A;  1S05 A;  1E83 A;  2XLO A;  5JLI A;  2YKZ A;  1LM3 B;  5JS5 A;  3QW0 A;  2QLA A;  5JVE A;  4N4W A;  2XM0 A;  2YLI A;  3QW1 A;  3ZWI A;  4U9E A;  5JT4 A;  4IB4 A;  1GQA A;  3ZQY A;  2XL8 A;  4ULV A;  3ZTZ A;  4CX9 A;  1YZC A;  3HNI A;  3IQ6 A;  4NC3 A;  3QVZ A;  3NMI A;  4CJG A;  4JEB A;  3DE8 A;  1YZA A;  4WGY A;  4N6H A;  256B A; 
#chains in the Genus database with same CATH topology
 1XWJ A;  1A7E A;  1R5I D;  3EGX A;  4U5H A;  4U5B E;  2UUH A;  3TOM A;  3W2V A;  3ZQV A;  4E0H A;  4DJ9 A;  1TWG A;  1CGN A;  1J8Y F;  2LIG A;  3G4Z A;  1Q0D A;  1HW1 A;  2C04 A;  2J0W A;  3TOL A;  1XZP A;  3EFO A;  1EA8 A;  2WZL A;  5DLJ A;  4OIQ F;  1ZHZ A;  2HFI A;  3K7D A;  4H4K C;  1NZE A;  2OEX A;  4IAO A;  4KC9 A;  3ZTM A;  1EQ1 A;  1Z6A A;  2EPN A;  2MHR A;  3LEO A;  4BEM J;  3N2Z B;  2R7V A;  3B0U X;  4D4X A;  1LS1 A;  2QNL A;  1ZHY A;  2QY9 A;  5DS6 A;  1IZM A;  1J8M F;  5BQG A;  2A1D D;  4PJL A;  1FFT C;  4DVY P;  4E0I A;  2XLM A;  1I5N A;  1RKE A;  1YLM A;  3O55 A;  4JTD B;  4O7G A;  2GA0 A;  3C8Z A;  4BJ6 C;  2NUP A;  4B6I A;  3AG2 C;  5EGY A;  3W2W A;  4BJ6 A;  2E87 A;  4ZLD A;  1APC A;  1KNY A;  3K6B A;  4C3B A;  3HKK A;  3C8G B;  1NLX A;  4QI2 A;  2FFH A;  4AE4 B;  3O6X A;  4YWQ A;  1AVO B;  5GPG B;  1NG1 A;  3ASO C;  4CIP A;  5JRA A;  3UGO A;  2VB6 A;  2KYH A;  4I44 A;  3GM2 A;  2RSE B;  3RW0 A;  1Q0F A;  2P61 A;  3M79 A;  3Q7G A;  2DI3 A;  1BR4 A;  4G7H F;  1YA7 O;  3H2U A;  3W8I A;  4U5G A;  4DOZ A;  3ECS A;  2Y3D A;  2YQY A;  1ZU4 A;  4A2N B;  1E2X A;  1JR8 A;  2ASR A;  4U5E E;  4LAC B;  1BDJ B;  1WAT A;  2R7W A;  3GWN A;  1PD1 A;  2ZPA A;  1M2V A;  2HUJ A;  3L1M A;  4U5D E;  2VH3 A;  3LLI A;  3QZC A;  2B0J A;  3M1C B;  3U8P A;  3S0X A;  4EBJ A;  1ZYR F;  1K40 A;  2NSG A;  3WG7 C;  2DYS C;  4Z9H A;  4OIN F;  1VYK A;  3RF3 A;  3C18 A;  3ZVR A;  2VAS A;  5KYU A;  1FR0 A;  4GYT A;  3GEI A;  2Y3B A;  2LK4 A;  3AGT A;  5B1A C;  4DXW A;  1LVK A;  4YT5 A;  4MVM A;  1NFO A;  1Y4C A;  2KC3 A;  3JT1 A;  5JSL A;  3EGD B;  4C3D A;  1NU9 C;  1MQV A;  1WTY A;  2M64 A;  5L0D A;  2XLH A;  2PP4 A;  3ABL C;  2WVQ A;  1O3U A;  1OW8 A;  5L0J A;  1OCZ C;  3C62 A;  4LER A;  2V3C C;  4HEA J;  4CDA A;  2ZXR A;  3FXH A;  3EQL F;  1V55 C;  2R7Q A;  3AG4 C;  4C7O B;  1PCX A;  3T4R A;  1BR1 A;  1NSG B;  2Q9A A;  2Y39 A;  4YT4 A;  2KW3 C;  3TJ5 A;  5DVW A;  2VC9 A;  3DKA A;  3T6J A;  1D0Y A;  3K1I A;  2MYS A;  2XLO A;  3C8G A;  3SXM A;  3U2L A;  5JLI A;  4QI0 A;  4IGG A;  4J32 B;  5A6J A;  5E3A A;  1OKK D;  5JVE A;  5KYX A;  5EHH A;  5JT4 A;  2XRH A;  1GQA A;  3CQZ A;  3LAY A;  5BQH A;  3ZTZ A;  1T6I A;  4MVQ A;  2EPO A;  3Q7L A;  4NTF A;  4NCQ A;  4U5F E;  1HY5 A;  2WVN A;  3EJN A;  3IQ6 A;  4CS9 C;  2XXA A;  3GEE A;  5AC4 A;  3QVZ A;  2ZXW C;  2F22 A;  1H7I A;  2NSF A;  3NMI A;  4CJG A;  2VCA A;  4E18 A;  3GM1 A;  5BQI A;  3NKE A;  3C7J A;  2HSB A;  2DGJ A;  5KYW A;  1C03 A;  3GOD A;  5TJ5 E;  3HJC A;  1ZVZ A;  2R7T A;  2YZS A;  4BJT A;  1ORY A;  3K1H A;  2PFD A;  3NKD A;  2Q9C A;  5HV9 A;  3WAQ A;  1E86 A;  3NDB B;  1VB5 A;  1QKR A;  2JD3 A;  4MTF A;  5L0C A;  2L7A A;  1RJ9 B;  4CBE A;  1H9T A;  3OA1 A;  1RCP A;  4N6C A;  4YN0 B;  2H7O A;  1NU7 D;  4R32 A;  3MLG A;  4QDL A;  1QVX A;  3MYF A;  5JUA A;  4BJ5 A;  4LDK A;  4XLN F;  3DZA A;  4U9D A;  3UNG C;  1OCR C;  3M15 A;  4IRU A;  3C63 A;  2X0C A;  4CSA C;  1D0Z A;  4FWV A;  1D1A A;  1A41 A;  1QSP A;  4CSA A;  3L34 A;  1M6T A;  4NTA A;  4CDY A;  2LP4 A;  3S90 A;  1ORJ A;  3DJN B;  2HZ8 A;  3K66 A;  3L0I A;  5A6B D;  3FMS A;  4G0H A;  4JC7 A;  4JCH A;  3ZC4 A;  4BJ1 A;  1FTS A;  1BR2 A;  3K33 A;  5DQT A;  3NYL A;  4CJO A;  5F5F A;  1GS9 A;  1ZU5 A;  3AQC A;  4MVU A;  1UG7 A;  1N1C A;  1UFB A;  2IYL D;  3QMK A;  2A6E F;  1K04 A;  5T3T A;  5AC5 A;  5L3Q A;  3KYJ A;  1Z63 A;  1H6G A;  3VF0 A;  3S27 A;  2PBE A;  1U6H A;  4BEJ A;  4J7Y A;  4KNW A;  4Z9I A;  4YK5 A;  2CDQ A;  2XLV A;  2EIK C;  3L8J A;  2YRF A;  4P6I C;  1Z23 A;  2J9W A;  1YAR O;  1Z7Q c;  2IXM A;  5CI9 A;  4O6M A;  3O10 A;  1YYX A;  4CDV A;  1WN0 A;  3V5X A;  3IHU A;  4IAR A;  4DRH B;  1VOM A;  1FAP B;  3CEX A;  2EIL C;  3DXJ F;  3GWL A;  3LS1 A;  4LLE A;  1M56 C;  2DB4 A;  4MTG A;  3RIP A;  3U3B A;  4YJW A;  3I5Q A;  1WGW A;  2WZF A;  3JYY A;  1E83 A;  4PR9 A;  2OOC A;  2L81 A;  2QUP A;  4MVO A;  1RKC A;  2HV7 A;  3FHD A;  3RKO F;  1TQG A;  4JEA A;  2YEV A;  1CPR A;  3Q6M A;  3UR3 C;  4HFF B;  2G62 A;  2W45 A;  1LI7 A;  3DM5 A;  3CZ6 A;  2GDC A;  4ER9 A;  3EPV A;  4E7Z A;  2W4M A;  2YL0 A;  4Q4Z F;  1FFH A;  2ZXO A;  3R2P A;  5B1B C;  3TK0 A;  3EG9 A;  5FCL A;  4JIO A;  3N24 A;  4RBN A;  2XLW A;  5E2Q A;  1I4Z A;  3U0C A;  5D91 A;  2FGY A;  3F46 A;  1E84 A;  5A6A A;  4EIY A;  2NG1 A;  1GGQ A;  5L0I A;  4PFP A;  3I4U A;  4JRZ A;  1YAU O;  4UDV A;  4I1O B;  4IAQ A;  3E9V A;  2JX0 A;  5DS5 A;  1BBH A;  3EZH A;  3DI5 A;  1S7Z A;  1OW6 A;  3DE9 A;  1MND A;  1MMN A;  3EHN A;  3NMJ A;  3HLZ A;  3RYL A;  4OIP F;  1RMV A;  2XL6 A;  2XL4 A;  2A0U A;  3NMK A;  2DYR C;  1S05 A;  1TWH A;  2Q9B A;  1O87 A;  3U5S A;  1NFN A;  2OKU A;  4XPX A;  2AU5 A;  4PJJ A;  2KNH A;  5D92 A;  2OJE D;  3SXY A;  5KYN A;  1TFK B;  3AGU A;  4N4W A;  4WJ0 A;  4X0R A;  1GM5 A;  3BEH A;  3ZWI A;  4I3M A;  1JRA A;  4XEV A;  1QZX A;  1C02 A;  3G4X A;  4LLC A;  3VAY A;  3ABM C;  3B71 A;  1R4T A;  1SMY F;  2LFF A;  3FVY A;  1G4W R;  2PX0 A;  3MBG A;  3MYI A;  1AEP A;  3HNI A;  3AOU A;  5T1D B;  4J7T A;  1TWA A;  3JRM O;  3DD7 A;  1VLT A;  1YA9 A;  5FZT A;  2GWW A;  5DQZ A;  4CS8 A;  4JJG A;  3JSE O;  3DMD A;  1OQC A;  1TKN A;  4YT8 A;  2CW0 F;  3FAP B;  1L3P A;  1VYI A;  3EZI A;  1LIH A;  3AJM A;  3SXK A;  1G8X A;  3IQC A;  4MW8 A;  4WGY A;  2H8A A;  1AUE A;  2ZXP A;  4EHP A;  1K05 A;  2CCY A;  2HS5 A;  1MMD A;  3K1I C;  3T9O A;  3FOP A;  3M4C A;  2M4E A;  1DOW A;  2Y3G A;  4MVZ A;  4XLP F;  5JP7 A;  2R7U A;  4RDA A;  2PX3 A;  4AE4 A;  5A6K A;  1LPE A;  4ZLC A;  2NUT B;  2YL1 A;  3JYH A;  1LKX A;  3EHM A;  1C17 M;  4KNV A;  4MVS A;  3SXZ A;  3RVZ A;  3ZSU A;  4A4A A;  4E7S A;  2A6H F;  3N0T A;  5L0H A;  4PAC A;  5KYY B;  3UGP A;  2R02 A;  3H2V A;  4KBL A;  4XTK A;  2YVK A;  2L9J A;  1EKY A;  2R7O A;  2RD9 A;  2L6H A;  1IW7 F;  1FMW A;  3IEE A;  1BZ4 A;  4WAB A;  4C3E A;  1M57 C;  3ZG1 A;  2OG2 A;  3ITF A;  4G7O F;  4JZA A;  4XEF A;  3SYN A;  4NTB A;  4MND A;  1V4A A;  2X51 A;  3FAJ A;  2Y3H A;  1JPN A;  3Q6N A;  3RVY A;  3L8I A;  4L6R A;  2R7R A;  2J9B A;  3IPM O;  3JRT A;  1Z3I X;  1D0X A;  2BE5 F;  4OIO F;  3W4Y A;  1FMV A;  2HMQ A;  3TQO A;  3ZIB A;  1A0B A;  3EFO B;  3CSK A;  4BG0 A;  1G4U S;  1V54 C;  3F47 A;  5L3V A;  1T9K A;  1EI7 A;  2VCC A;  3EGD A;  4BJ5 C;  1JMW A;  2C03 A;  1WWP A;  3W8H A;  3X1O A;  3RQG A;  2JPU A;  5COM A;  2YWA A;  5T3W A;  1T5O A;  2Q4F A;  1CPQ A;  3TJ6 A;  3NYJ A;  1HE9 A;  5A69 A;  1E85 A;  3JCU Q;  2HJM A;  1HW2 A;  1QPU A;  1LE2 A;  1RKE B;  1OCC C;  3NG1 A;  3A11 A;  1JAF A;  2IXO A;  4C7O A;  1DOV A;  4EBK A;  3AG3 C;  4JUR I;  3ABK C;  3X2Q C;  1OXB A;  4MQ9 F;  1XZQ A;  2XSE A;  4CS7 A;  1VTM P;  4J30 B;  5K0I A;  2LQG A;  4JTA B;  3U9J A;  2IOQ A;  2A69 F;  4W8K A;  1LI5 A;  2G3V A;  3LNR A;  4XEK A;  3SNH A;  2CYD A;  2LSE A;  1HE1 A;  3PDM P;  5F28 E;  2A0B A;  2EPL X;  4WGZ A;  3T6B A;  1VK5 A;  1ZHW A;  3ASN C;  4PJN A;  2IXN A;  2WL8 A;  4HE8 D;  2EIJ C;  2QTV A;  4N06 A;  4EUK B;  2CNW A;  2V26 A;  4YL0 A;  3ATP A;  1OR2 A;  4JTC B;  2XLD A;  3GM3 A;  2FAP B;  3S29 A;  4K0D A;  3OEO A;  3QVY A;  4G78 A;  1M2V B;  4I1M A;  1T6Q A;  4H54 A;  3S28 A;  2YLG A;  4JJF A;  2XM4 A;  2J7P A;  2KSF A;  2Q3T A;  1F1M A;  2R05 A;  4NQF A;  2A68 F;  3CAX A;  1PV3 A;  3KPH A;  4ONS A;  2G3K A;  3U2M A;  4YT2 A;  5KYU B;  2P7V A;  1H9G A;  2YKZ A;  1LM3 B;  2W4B A;  3C8G D;  3DAF A;  3NRH A;  3QTH A;  1JPJ A;  1ST6 A;  1OKK A;  2AVK A;  3QW0 A;  1ZZP A;  2QLA A;  2P6V A;  1Q0K A;  4ULW A;  1RJ9 A;  3GAN A;  2ZD9 A;  3QW1 A;  2H7B A;  1B68 A;  1RXQ A;  1Z5Z A;  4U9E A;  5COF A;  1L7C A;  3ZQY A;  3LEV A;  4CX9 A;  3PMR A;  1MMA A;  1YZC A;  2EPM X;  3LS0 A;  4EWC A;  4CIH A;  2NPU A;  3KMI A;  1I4Y A;  2P0N A;  3POV A;  2HSQ A;  1ZHX A;  3GEH A;  2W9Y A;  1ZHT A;  4Q7C A;  2HKV A;  5E3C A;  2IM8 A;  4AL0 A;  1ZW2 A;  2TMV P;  1Y6D A;  4O6N A;  2R7S A;  2MWQ A;  3IQT A;  4HFK B;  1KU2 A;  4JVS A;  2AP3 A;  4MVR A;  3NYM A;  4O79 A;  1D1C A;  3KYI A;  4N6H A;  1OCO C;  4PFO A;  3JSZ A;  3ZDL A;  1VMA A;  3RQE A;  2OJQ A;  3DJU B;  1T01 A;  3TUL A;  3MX3 A;  2XS1 A;  4DBQ A;  1SF8 A;  1YDI A;  2R9R B;  4EBB A;  5KYX B;  4MS2 A;  2GAQ A;  5DS4 A;  1FNT c;  2OCC C;  2J8W A;  2KK1 A;  2EIN C;  2WB7 A;  3LNM B;  4JW1 A;  3RQF A;  4IJJ A;  1YVI A;  5HSW A;  4GQH A;  3US6 A;  1VLS A;  1O5H A;  3JZ0 A;  2XLE A;  1D1B A;  3AG1 C;  1SR2 A;  2D4U A;  2L6F A;  4GEH A;  2XXA B;  2HMZ A;  4P9F A;  2Q7R A;  4CS8 C;  3DWW A;  4YL1 A;  4P9T A;  4OD5 A;  4ANJ A;  5F5H A;  4W8P A;  5EK0 A;  3HNJ A;  3LES A;  2YLD A;  1CGO A;  5B3I A;  3KH2 A;  3EH1 A;  5KYW B;  4DRI B;  5A6B A;  4EKW A;  5AGF A;  3HTK C;  2PNO A;  3LUT B;  2Y69 C;  3HNK A;  2VCB A;  3PCV A;  2I15 A;  4OIR F;  2J46 A;  4F4B A;  3FDQ A;  1A7D A;  1NBB A;  4D4N A;  4FX5 A;  2CGE A;  2I8B A;  2BC5 A;  2ETS A;  2H7V C;  3UMI A;  5BUO A;  1CGM E;  2Z15 A;  3R7C A;  1T6U A;  4XPY A;  3BRJ A;  3AQB A;  3B9Q A;  4FES A;  4DRJ B;  2ICW G;  3B0V C;  3PHF 2;  1HMO A;  2PF4 E;  2YL7 A;  3LJB A;  2YHS A;  4M63 A;  4Q5S F;  2GFH A;  3B0P A;  2EPK X;  2CNW D;  2XS8 A;  3O39 A;  3U8V A;  3SZR A;  3RH3 A;  4G7Z F;  1TWC A;  3G50 A;  4AL1 A;  5L0F A;  4JE9 A;  5IY5 C;  4K1O A;  4E17 A;  3S84 A;  1U0B B;  1Q0M A;  2OEV A;  2P1A A;  2LFD A;  2HJ3 A;  5E33 A;  4AX2 A;  2J7P D;  4O6Y A;  2J0X A;  4JKV A;  1SYQ A;  3V5Y A;  3VRC A;  2R25 A;  2J9U A;  3HNL A;  3MFN A;  3LLK A;  1ORS C;  4DVZ A;  3EGX B;  3WOD F;  2KJG A;  4LDR A;  5B3S C;  1ZW3 A;  2EIM C;  2J45 A;  3A9C A;  1U89 A;  3DAG A;  3V5Z A;  1PD0 A;  3RFY A;  2IXP A;  4AK9 A;  3M4B A;  3EH2 A;  4JCZ A;  4XWJ A;  1A7V A;  4PJM A;  1WAS A;  3OWT A;  2KQ9 A;  4KI2 A;  4CS9 A;  2YL3 A;  2WVO A;  1JOG A;  4OD4 A;  3DM9 B;  3U3F A;  3V7O A;  3IQ5 A;  3FOO A;  3J06 A;  3JTL O;  2HV6 A;  3WHN A;  5L0G A;  1YYJ A;  1LS4 A;  4RD9 A;  2R7X A;  1OR3 A;  1LE4 A;  3H65 A;  4XPW A;  1W2W A;  4NY3 A;  3S9O A;  3UMH A;  1V74 B;  2NUP B;  2L6G A;  1QQ3 A;  2BL2 A;  2IBF A;  2R03 A;  2J9V A;  3SEO A;  4FAP B;  2Q00 A;  2LD6 A;  3VYW A;  4MW3 A;  5CI8 A;  5JS5 A;  3T6G B;  1KTM A;  1HMD A;  2AWC A;  2AWY A;  2KGO A;  3B29 A;  3EG9 B;  2XM0 A;  2YLI A;  1OW7 A;  1MNE A;  2NUT A;  2OQM A;  4IB4 A;  4K7B A;  2WZG A;  4IWB A;  3VM6 A;  4DBR A;  4U5C E;  2OU6 A;  1TFO B;  2XL8 A;  4ULV A;  1G5Z A;  5KYY A;  2LCH A;  2D5R B;  4XQ1 A;  4Z9J A;  3U9M A;  2O9X A;  1WOL A;  4YL3 A;  1TR2 A;  5COG A;  4NC3 A;  3UMK A;  3E70 C;  3I5P A;  3KKB A;  4JEB A;  1OXK A;  1Q0G A;  1SZI A;  3TD7 A;  1QLE C;  3KL4 A;  4PK4 A;  3DE8 A;  4BPM A;  1M2O A;  1YZA A;  2UUI A;  3GOR A;  5CIV A;  4MTO A;  4LDQ A;  1MMG A;  2QE9 A;  3SP1 A;  2B0H A;  1YJG A;  256B A; 
#chains in the Genus database with same CATH homology
 2CCY A;  3TOM A;  1E86 A;  3FOP A;  3M4C A;  3ZQV A;  1CGN A;  5JP7 A;  2YL1 A;  1RCP A;  2J8W A;  3TOL A;  5JUA A;  2XLE A;  3ZTM A;  1EKY A;  4U9D A;  4D4X A;  3M15 A;  3C63 A;  3HNJ A;  2YLD A;  1CGO A;  1M6T A;  4CDY A;  5B3I A;  2XLM A;  5AGF A;  3HNK A;  4CJO A;  4L6R A;  2J9B A;  1APC A;  1NBB A;  4D4N A;  2BC5 A;  4CIP A;  5JRA A;  2XLV A;  2YL7 A;  3M79 A;  1YYX A;  4CDV A;  1CPQ A;  4IAR A;  4JE9 A;  1E85 A;  3L1M A;  1QPU A;  3U8P A;  1JAF A;  4JKV A;  3VRC A;  4JEA A;  1CPR A;  3HNL A;  4ER9 A;  2YL0 A;  4WGZ A;  2XLW A;  3M4B A;  1A7V A;  5JSL A;  1E84 A;  1MQV A;  4EIY A;  2XLH A;  2YL3 A;  2XLD A;  3C62 A;  3IQ5 A;  3FOO A;  3QVY A;  1YYJ A;  4IAQ A;  4CDA A;  1BBH A;  2YLG A;  3DE9 A;  2XM4 A;  3NMJ A;  1QQ3 A;  2XL6 A;  3NMK A;  1S05 A;  1E83 A;  2XLO A;  5JLI A;  2YKZ A;  1LM3 B;  5JS5 A;  3QW0 A;  2QLA A;  5JVE A;  4N4W A;  2XM0 A;  2YLI A;  3QW1 A;  3ZWI A;  4U9E A;  5JT4 A;  4IB4 A;  1GQA A;  3ZQY A;  2XL8 A;  4ULV A;  3ZTZ A;  4CX9 A;  1YZC A;  3HNI A;  3IQ6 A;  4NC3 A;  3QVZ A;  3NMI A;  4CJG A;  4JEB A;  3DE8 A;  1YZA A;  4WGY A;  4N6H A;  256B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...