3QVZA

Crystal structure of the zn-ridc1 complex stabilized by bmoe crosslinks cocrystallized in the presence of cu(ii)
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
106
structure length
106
Chain Sequence
ADLEDNMETLNDNLKVIEKADNAAQVKDALTKMAAAAADAWSATPPKLEDKSPDSPEMHDFRHGFWILIGQIHDALHLANECKVKEAQAAAEQLKTTCNACHQKYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome cb562
publication title Templated construction of a zn-selective protein dimerization motif.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 46
structure length 106
sequence length 106
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-02-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 3qvzA00
3ZTZA 3HNJA 1CGNA 4U9EA 1YZAA 2XM4A 4N6HA 2YL1A 3L1MA 3NMKA 5JP7A 4U9DA 2YLIA 3TOLA 1YYXA 3HNIA 1CPQA 2QLAA 3M15A 4IARA 3HNKA 5JUAA 3M4CA 3FOOA 256BA 3QVZA 4D4XA 2XLWA 3NMIA 1QPUA 1EKYA 5JT4A 3IQ5A 3QW0A 2XLVA 2J9BA 4CJOA 1M6TA 2XLOA 3ZWIA 4CDAA 2CCYA 3IQ6A 1E85A 1S05A 1NBBA 3TOMA 3M79A 2XLMA 2YL0A 2YL7A 1QQ3A 1YYJA 1BBHA 3DE9A 5AGFA 1E83A 5JSLA 4ER9A 3FOPA 4IAQA 4WGZA 4N4WA 4ULVA 5JVEA 2YKZA 4JEAA 4D4NA 3ZQVA 4CIPA 3HNLA 1APCA 1MQVA 4CJGA 1LM3B 3M4BA 4WGYA 2XL6A 2YLDA 3QW1A 4JKVA 2XLEA 2BC5A 4CDYA 1CGOA 3DE8A 1E84A 5B3IA 3C62A 3C63A 3ZQYA 4CX9A 3ZTMA 1CPRA 2YLGA 4EIYA 4JEBA 3NMJA 2XL8A 2XLHA 2J8WA 5JLIA 1JAFA 4NC3A 1A7VA 3VRCA 2YL3A 5JRAA 3U8PA 4CDVA 2XM0A 1GQAA 4IB4A 3QVYA 2XLDA 4JE9A 5JS5A 1E86A 1RCPA 1YZCA 4L6RA
chains in the Genus database with same CATH superfamily
3S9OA 1WASA 4OIQF 1A7EA 1VYKA 2P0NA 2A6EF 4DRHB 2I15A 2G3VA 3BRJA 2P6VA 4XPYA 3DZAA 4ZLDA 1YZAA 2KSFA 1OR2A 1V74B 2YL1A 1OW6A 2Y3GA 3AG4C 3EGDB 4PJNA 2H7VC 4U9DA 4NTBA 4EBJA 2R7UA 1HE9A 3Q7GA 3AQCA 5A6BD 4P9FA 2DB4A 2G62A 3MYFA 1XWJA 5CI8A 4KBLA 4O6YA 3TOLA 1WATA 2DI3A 2KGOA 3K6BA 1VB5A 2I8BA 2V26A 4DRIB 4LACB 4JIOA 2CDQA 1Y4CA 2QLAA 3ASNC 3FMSA 4YK5A 2HFIA 4E0HA 1KU2A 4IARA 4JTDB 2GDCA 2H7OA 3HNKA 1FR0A 1F1MA 3NYLA 3QTHA 5L0IA 3U2MA 2R9RB 2OJED 3T4RA 4H54A 3SXZA 3LJBA 256BA 2WVNA 2Q7RA 1SMYF 4JTCB 3FAJA 3NKEA 1LI5A 5DS4A 1VLTA 5DS6A 1T6IA 4Q5SF 3WAQA 1SZIA 3G50A 4AE4A 3POVA 2C03A 3S28A 1SR2A 2EPNA 2IM8A 1QPUA 4Q7CA 4DBQA 3ITFA 2XLVA 1DOVA 2V3CC 1YLMA 5KYWA 2HV7A 1JPJA 4W8PA 4YL1A 1Y6DA 5EK0A 1BDJB 1MMAA 2XLOA 2CGEA 4RD9A 3ZWIA 3S90A 1HW2A 5F5FA 5B1BC 4CIHA 1U6HA 3JTLO 1AUEA 4LERA 3T6GB 2CNWD 2YL0A 5F28E 1QQ3A 2ETSA 5B3SC 3DE9A 3DJNB 4G7HF 4RDAA 1TFKB 3HLZA 5D92A 4ER9A 1LVKA 3FOPA 1Q0FA 2CW0F 3GEHA 3A9CA 3MBGA 4WGZA 4ULVA 4XPWA 1OCCC 4YWQA 4U5CE 1TWAA 4YL0A 2A0UA 4JTAB 2X51A 3LLKA 5A6BA 3ZQVA 3MX3A 3FHDA 3TK0A 3RQFA 2L9JA 2XS8A 2EINC 4KNVA 4YT8A 3B9QA 4MVZA 1MNDA 1OQCA 1D0YA 2XL6A 4WGYA 2YLDA 4DRJB 1HMOA 1T9KA 2IYLD 2QY9A 2Q00A 3JRTA 3W2VA 1O5HA 3QW1A 5L0FA 2LSEA 3PMRA 2UUHA 1RJ9B 4C3BA 3J06A 2HSQA 4CBEA 4YT2A 3LS1A 4EBBA 4K1OA 3SEOA 2YQYA 4YT5A 3HTKC 4CS8C 4U5GA 1FAPB 3KYIA 1A41A 5B3IA 3W2WA 3RF3A 2WZFA 1JR8A 4CX9A 3PHF2 1D0XA 4N06A 1YJGA 3EG9B 3ZTMA 2WL8A 3DWWA 2PX3A 4EIYA 4JEBA 4F4BA 3R7CA 4MW8A 3NMJA 1TWCA 4GQHA 4AX2A 5L0JA 2Q3TA 2QTVA 4Z9JA 3KKBA 1T01A 3OWTA 3GM1A 2A69F 4IGGA 1BZ4A 2QNLA 3IEEA 2DGJA 2TMVP 4K7BA 3B71A 3T6BA 2ICWG 1H7IA 3I5QA 3OA1A 3VM6A 3ZSUA 5KYYA 2AU5A 5COMA 3EHNA 2WVQA 3QVYA 4PJLA 3RW0A 3EGXB 2CYDA 1TKNA 2MYSA 1YVIA 3JSEO 2HUJA 2R03A 2X0CA 2JX0A 1NU7D 1OW7A 2EPKX 1C02A 1J8MF 2J0XA 1ZHXA 3JZ0A 4MVMA 4PK4A 2C04A 4A4AA 1M2OA 2LP4A 3E9VA 4ONSA 1QSPA 3DD7A 2HKVA 4AL0A 4G7ZF 2HV6A 1CGNA 4C7OB 4MNDA 5DVWA 3EZHA 4JCZA 2NSFA 1T6UA 3Q7LA 1LE4A 4U9EA 2B0HA 3U2LA 3EFOB 2L81A 4BJ5A 2YHSA 4N6HA 3C7JA 3EHMA 3H2VA 1IW7F 2NSGA 3ECSA 5JP7A 4OIRF 4OD4A 1QKRA 3EPVA 4IWBA 4PFPA 1TQGA 1GGQA 2YLIA 1VOMA 3RKOF 3WODF 2BL2A 2G3KA 3GM2A 3LAYA 4G0HA 2WB7A 3HNIA 4I1OB 4LDKA 1FMVA 3OEOA 1VLSA 2NUPA 3DM5A 2KQ9A 3M15A 1M2VA 3M1CB 4JCHA 4Z9IA 2OU6A 3JCUQ 1Z7Qc 1BR2A 3LLIA 3K1IA 3QVZA 1LKXA 3RVZA 3N2ZB 3V5XA 2WZLA 1Q0DA 1GS9A 3EZIA 1AEPA 2R02A 4EHPA 2RSEB 2EIKC 4FWVA 5BUOA 5BQGA 4YN0B 2MWQA 1SYQA 3ABKC 2HJMA 2IXNA 2LFFA 3FDQA 2R7WA 4XWJA 2LD6A 1I4YA 1MMGA 3DJUB 4MVQA 1G8XA 1JOGA 2NUTA 2JPUA 2R7SA 1JRAA 3UMKA 1R4TA 4U5EE 5KYUA 4CDAA 4R32A 4XEVA 5COGA 4X0RA 1S7ZA 2FAPB 3GANA 4MS2A 1JPNA 1M56C 4JZAA 4BEMJ 3E70C 2HJ3A 3MYIA 3RH3A 4XEFA 1I5NA 3IPMO 3QMKA 3T9OA 1BBHA 5L0CA 5AGFA 2EIJC 3WHNA 3C8ZA 3ZDLA 4N4WA 1ST6A 3DI5A 3C8GD 2AWYA 1YDIA 4XTKA 2L6GA 3NYMA 1EQ1A 3GWLA 4JEAA 3UGOA 5L3VA 5AC4A 1TR2A 3C8GB 4I44A 1H9GA 1MNEA 1OKKD 1D1AA 2XS1A 3S27A 3X2QC 5HSWA 3O39A 3O6XA 1NSGB 1T6QA 3GM3A 3BEHA 2OG2A 3M4BA 3K1HA 2LQGA 1YA9A 4GEHA 3RQGA 2KC3A 2J45A 2VCBA 4PR9A 4KI2A 1HW1A 2XLEA 3EH1A 3VF0A 4CDYA 1V4AA 1ZHWA 4OIPF 2O9XA 1VK5A 5B1AC 2A1DD 2Y3HA 4FESA 3IQCA 3CAXA 3K66A 1E84A 4DXWA 5HV9A 3C63A 3EGDA 5A69A 3US6A 4W8KA 3G4XA 1Q0KA 3TD7A 4MVOA 1FTSA 2Q9AA 5E2QA 1ZHZA 1A7DA 1UG7A 3LNMB 3I5PA 1C17M 5AC5A 2OCCC 2J8WA 3EH2A 1RKEB 2EPMX 2HMQA 3GEEA 1LPEA 3VRCA 4BJTA 4MTOA 2OEXA 4O6NA 1NU9C 3O10A 3LS0A 3U9JA 4LDQA 3L0IA 5L0DA 2EIMC 2PNOA 3IHUA 3U8PA 3UMIA 3ZC4A 3DMDA 3U3BA 1HE1A 1LI7A 1GQAA 2UUIA 3AG1C 4CS7A 2H8AA 2D4UA 4ANJA 4JE9A 4PJJA 4G78A 3UGPA 4JJGA 4CS8A 5BQIA 4G7OF 4XEKA 4CSAC 1Z5ZA 4U5FE 3VAYA 2J0WA 2YWAA 4EKWA 2OOCA 1LE2A 1N1CA 1WTYA 4L6RA 2NPUA 4E7ZA 2XXAB 1OXKA 3AQBA 3ZTZA 2WZGA 3L34A 2F22A 1HY5A 2AVKA 3PCVA 3CZ6A 4C3DA 4J30B 2XM4A 3B0UX 4HFFB 2XSEA 3L1MA 1NFOA 1OCOC 4AK9A 1D1BA 5COFA 2P61A 5FZTA 5L0HA 3MFNA 3SP1A 1ORSC 3NKDA 1G4WR 4MTGA 4AL1A 1Q0MA 4E0IA 2R7RA 1YYXA 2YRFA 3Q6NA 4MVRA 4JC7A 4K0DA 5DS5A 2Y39A 2OJQA 3TULA 4NTAA 1CPQA 2CNWA 1WWPA 3F47A 1T5OA 3TJ6A 2IBFA 1QLEC 3ZVRA 5TJ5E 4EUKB 3KMIA 2GA0A 3LESA 3C18A 3VYWA 2Z15A 2XLWA 4XQ1A 1BR4A 4IJJA 4A2NB 5KYXB 3NDBB 2VH3A 2VASA 2KK1A 1YARO 2P1AA 3V7OA 1A0BA 3AOUA 1EKYA 3CSKA 3IQ5A 2W45A 2AWCA 2J9BA 3ZIBA 3PDMP 1RJ9A 2A6HF 2R7VA 4EWCA 5CIVA 4BG0A 2Y3BA 1I4ZA 5K0IA 3RVYA 4KC9A 3HJCA 4QDLA 2CCYA 2J7PD 3W8IA 4YT4A 3W8HA 5A6AA 1CGME 1J8YF 2R7OA 1QZXA 2XLMA 2IXMA 4HFKB 1EI7A 2R7QA 4Q4ZF 1DOWA 3AGTA 1K40A 2VB6A 4NCQA 3EG9A 1XZQA 2VCCA 5T3WA 1OR3A 1UFBA 1XZPA 3GORA 1ORYA 1E83A 5JSLA 3B0PA 3U5SA 2R7TA 3N24A 1U89A 4IAQA 4OIOF 1ZHTA 5CI9A 2J46A 3CQZA 1HMDA 5JVEA 2YKZA 2D5RB 1ZU5A 2DYRC 2Y3DA 4RBNA 1OXBA 3U3FA 4BEJA 3N0TA 2M64A 4I1MA 3AGUA 4MVUA 4JJFA 4BJ5C 2IXPA 2EPOA 3EGXA 1MQVA 2ZD9A 1PV3A 3SXMA 1LM3B 3V5ZA 4AE4B 2E87A 3UNGC 1TWGA 3G4ZA 5DLJA 4LLCA 1C03A 4CS9C 2FFHA 3S29A 2BE5F 1FNTc 2FGYA 1G5ZA 3TQOA 2BC5A 3AJMA 2XL4A 3I4UA 4BJ6C 2Q9CA 5KYWB 4C7OA 1TFOB 2QUPA 3ASOC 3DKAA 5FCLA 5KYNA 1L7CA 1VTMP 1LIHA 2VCAA 3EFOA 2OKUA 3DXJF 2J9UA 3K1IC 4YJWA 3JYYA 4OINF 3GODA 4IRUA 3H2UA 1YA7O 1V55C 2YLGA 3UMHA 3U0CA 2XL8A 1NFNA 1Z3IX 2AP3A 1JAFA 1A7VA 2HS5A 2OEVA 4MQ9F 2M4EA 2J7PA 5JRAA 4J7YA 3SYNA 5EHHA 3K33A 4J7TA 4DVZA 2RD9A 4IB4A 1O3UA 2J9VA 3K7DA 3F46A 1PD1A 2XRHA 1Z23A 2XLDA 2Q9BA 2ZXRA 2PFDA 3DM9B 4MVSA 3H65A 4E7SA 1WGWA 1OCRC 4JURI 5DQZA 5JS5A 4FAPB 3ZG1A 3SXKA 1L3PA 3JSZA 2W4MA 2W9YA 3LNRA 1RCPA 2H7BA 1RKCA 3Q6MA 2NG1A 4LLEA 4DOZA 5EGYA 3B0VC 4O7GA 2W4BA 1GM5A 2J9WA 3HNJA 3MLGA 1ZZPA 1QVXA 2OQMA 4U5BE 4YL3A 1Q0GA 3LUTB 1H9TA 2R25A 2GAQA 1ZW2A 5E3CA 3ABMC 4U5DE 1Z63A 3NMKA 3O55A 4O79A 5T3TA 2Y69C 4WJ0A 3U9MA 2ZPAA 2PX0A 4LDRA 1ORJA 2IOQA 3ABLC 4H4KC 4M63A 4MTFA 3RFYA 1K05A 2R7XA 1MMNA 2LIGA 2QE9A 1B68A 4EBKA 3S84A 1KTMA 1LS1A 5L0GA 1O87A 2P7VA 3RYLA 4CSAA 3ATPA 1WOLA 5A6KA 4P9TA 1YAUO 4PACA 1U0BB 5JUAA 3M4CA 4XLNF 4JVSA 5KYYB 2L6FA 3FOOA 3FXHA 3L8JA 4D4XA 3LEOA 3C8GA 5E3AA 3NMIA 1VYIA 1ZYRF 4BJ1A 1D0ZA 1NG1A 4J32B 1H6GA 1MMDA 1AVOB 2GWWA 2A68F 3B29A 3TJ5A 5JT4A 1OKKA 3QW0A 3R2PA 5F5HA 3FVYA 2PF4E 3LEVA 4CJOA 1R5ID 2WVOA 1M6TA 4E17A 4OD5A 2YEVA 2EILC 3KPHA 3IQ6A 3U8VA 2L6HA 1E85A 1S05A 1NBBA 5E33A 2HMZA 3TOMA 3M79A 3NYJA 2YL7A 4NY3A 4PFOA 1VMAA 3S0XA 3NG1A 4I3MA 1RXQA 1YYJA 3SNHA 4KNWA 1D1CA 1M57C 2LK4A 3IQTA 2MHRA 2NUPB 1FFTC 3KYJA 1RKEA 5GPGB 1M2VB 2ASRA 3V5YA 1FMWA 3KL4A 1SF8A 3UR3C 1W2WA 2B0JA 4NTFA 1G4US 2LFDA 2LCHA 4MW3A 4D4NA 2PP4A 4GYTA 4CIPA 2R05A 3HNLA 1APCA 1ZW3A 4QI2A 1NZEA 3JT1A 4JRZA 4CJGA 3NRHA 4DBRA 4XLPF 4DJ9A 1OW8A 2ZXWC 4XPXA 3RQEA 5A6JA 2KJGA 1ZHYA 2KYHA 3L8IA 3FAPB 2XXAA 4JKVA 1CGOA 2NUTB 2YZSA 3AG3C 3DE8A 4FX5A 4C3EA 3DAFA 2IXOA 4NQFA 3SZRA 1ZU4A 5KYUB 3T6JA 1ZVZA 1FFHA 3EJNA 3JRMO 3KH2A 3C62A 4QI0A 3ZQYA 1EA8A 4UDVA 3AG2C 2VC9A 5L3QA 1E2XA 4Z9HA 4E18A 2Q4FA 3EQLF 4HE8D 1CPRA 5DQTA 4BPMA 1WN0A 3X1OA 2DYSC 1BR1A 5T1DB 4U5HA 2A0BA 2XLHA 3RIPA 3W4YA 4ZLCA 5JLIA 3GWNA 4NC3A 2HSBA 2L7AA 4ULWA 5BQHA 2ZXPA 5D91A 1JMWA 2EPLX 3CEXA 3WG7C 4DVYP 4JW1A 2YL3A 4CS9A 4WABA 1K04A 1KNYA 2KNHA 4N6CA 4B6IA 4CDVA 1PD0A 2XM0A 4IAOA 4O6MA 4BJ6A 5KYXA 2ZXOA 3SXYA 3GEIA 5IY5C 3DAGA 2JD3A 1IZMA 3HKKA 3JYHA 1E86A 4HEAJ 1LS4A 1Z6AA 1V54C 2KW3C 2HZ8A 2GFHA 2YVKA 3A11A 4P6IC 4PJMA 2PBEA 1TWHA 1PCXA 1NLXA 1OCZC 1YZCA 3QZCA 1RMVA
chains in the Genus database with same CATH topology
3ZTZA 3HNJA 1CGNA 4U9EA 1YZAA 2XM4A 4N6HA 2YL1A 3L1MA 3NMKA 5JP7A 4U9DA 2YLIA 3TOLA 1YYXA 3HNIA 1CPQA 2QLAA 3M15A 4IARA 3HNKA 5JUAA 3M4CA 3FOOA 256BA 3QVZA 4D4XA 2XLWA 3NMIA 1QPUA 1EKYA 5JT4A 3IQ5A 3QW0A 2XLVA 2J9BA 4CJOA 1M6TA 2XLOA 3ZWIA 4CDAA 2CCYA 3IQ6A 1E85A 1S05A 1NBBA 3TOMA 3M79A 2XLMA 2YL0A 2YL7A 1QQ3A 1YYJA 1BBHA 3DE9A 5AGFA 1E83A 5JSLA 4ER9A 3FOPA 4IAQA 4WGZA 4N4WA 4ULVA 5JVEA 2YKZA 4JEAA 4D4NA 3ZQVA 4CIPA 3HNLA 1APCA 1MQVA 4CJGA 1LM3B 3M4BA 4WGYA 2XL6A 2YLDA 3QW1A 4JKVA 2XLEA 2BC5A 4CDYA 1CGOA 3DE8A 1E84A 5B3IA 3C62A 3C63A 3ZQYA 4CX9A 3ZTMA 1CPRA 2YLGA 4EIYA 4JEBA 3NMJA 2XL8A 2XLHA 2J8WA 5JLIA 1JAFA 4NC3A 1A7VA 3VRCA 2YL3A 5JRAA 3U8PA 4CDVA 2XM0A 1GQAA 4IB4A 3QVYA 2XLDA 4JE9A 5JS5A 1E86A 1RCPA 1YZCA 4L6RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZTZ A;  3HNJ A;  1CGN A;  4U9E A;  1YZA A;  2XM4 A;  4N6H A;  2YL1 A;  3L1M A;  3NMK A;  5JP7 A;  4U9D A;  2YLI A;  3TOL A;  1YYX A;  3HNI A;  1CPQ A;  2QLA A;  3M15 A;  4IAR A;  3HNK A;  5JUA A;  3M4C A;  3FOO A;  256B A;  3QVZ A;  4D4X A;  2XLW A;  3NMI A;  1QPU A;  1EKY A;  5JT4 A;  3IQ5 A;  3QW0 A;  2XLV A;  2J9B A;  4CJO A;  1M6T A;  2XLO A;  3ZWI A;  4CDA A;  2CCY A;  3IQ6 A;  1E85 A;  1S05 A;  1NBB A;  3TOM A;  3M79 A;  2XLM A;  2YL0 A;  2YL7 A;  1QQ3 A;  1YYJ A;  1BBH A;  3DE9 A;  5AGF A;  1E83 A;  5JSL A;  4ER9 A;  3FOP A;  4IAQ A;  4WGZ A;  4N4W A;  4ULV A;  5JVE A;  2YKZ A;  4JEA A;  4D4N A;  3ZQV A;  4CIP A;  3HNL A;  1APC A;  1MQV A;  4CJG A;  1LM3 B;  3M4B A;  4WGY A;  2XL6 A;  2YLD A;  3QW1 A;  4JKV A;  2XLE A;  2BC5 A;  4CDY A;  1CGO A;  3DE8 A;  1E84 A;  5B3I A;  3C62 A;  3C63 A;  3ZQY A;  4CX9 A;  3ZTM A;  1CPR A;  2YLG A;  4EIY A;  4JEB A;  3NMJ A;  2XL8 A;  2XLH A;  2J8W A;  5JLI A;  1JAF A;  4NC3 A;  1A7V A;  3VRC A;  2YL3 A;  5JRA A;  3U8P A;  4CDV A;  2XM0 A;  1GQA A;  4IB4 A;  3QVY A;  2XLD A;  4JE9 A;  5JS5 A;  1E86 A;  1RCP A;  1YZC A;  4L6R A; 
#chains in the Genus database with same CATH topology
 3S9O A;  1WAS A;  4OIQ F;  1A7E A;  1VYK A;  2P0N A;  2A6E F;  4DRH B;  2I15 A;  2G3V A;  3BRJ A;  2P6V A;  4XPY A;  3DZA A;  4ZLD A;  1YZA A;  2KSF A;  1OR2 A;  1V74 B;  2YL1 A;  1OW6 A;  2Y3G A;  3AG4 C;  3EGD B;  4PJN A;  2H7V C;  4U9D A;  4NTB A;  4EBJ A;  2R7U A;  1HE9 A;  3Q7G A;  3AQC A;  5A6B D;  4P9F A;  2DB4 A;  2G62 A;  3MYF A;  1XWJ A;  5CI8 A;  4KBL A;  4O6Y A;  3TOL A;  1WAT A;  2DI3 A;  2KGO A;  3K6B A;  1VB5 A;  2I8B A;  2V26 A;  4DRI B;  4LAC B;  4JIO A;  2CDQ A;  1Y4C A;  2QLA A;  3ASN C;  3FMS A;  4YK5 A;  2HFI A;  4E0H A;  1KU2 A;  4IAR A;  4JTD B;  2GDC A;  2H7O A;  3HNK A;  1FR0 A;  1F1M A;  3NYL A;  3QTH A;  5L0I A;  3U2M A;  2R9R B;  2OJE D;  3T4R A;  4H54 A;  3SXZ A;  3LJB A;  256B A;  2WVN A;  2Q7R A;  1SMY F;  4JTC B;  3FAJ A;  3NKE A;  1LI5 A;  5DS4 A;  1VLT A;  5DS6 A;  1T6I A;  4Q5S F;  3WAQ A;  1SZI A;  3G50 A;  4AE4 A;  3POV A;  2C03 A;  3S28 A;  1SR2 A;  2EPN A;  2IM8 A;  1QPU A;  4Q7C A;  4DBQ A;  3ITF A;  2XLV A;  1DOV A;  2V3C C;  1YLM A;  5KYW A;  2HV7 A;  1JPJ A;  4W8P A;  4YL1 A;  1Y6D A;  5EK0 A;  1BDJ B;  1MMA A;  2XLO A;  2CGE A;  4RD9 A;  3ZWI A;  3S90 A;  1HW2 A;  5F5F A;  5B1B C;  4CIH A;  1U6H A;  3JTL O;  1AUE A;  4LER A;  3T6G B;  2CNW D;  2YL0 A;  5F28 E;  1QQ3 A;  2ETS A;  5B3S C;  3DE9 A;  3DJN B;  4G7H F;  4RDA A;  1TFK B;  3HLZ A;  5D92 A;  4ER9 A;  1LVK A;  3FOP A;  1Q0F A;  2CW0 F;  3GEH A;  3A9C A;  3MBG A;  4WGZ A;  4ULV A;  4XPW A;  1OCC C;  4YWQ A;  4U5C E;  1TWA A;  4YL0 A;  2A0U A;  4JTA B;  2X51 A;  3LLK A;  5A6B A;  3ZQV A;  3MX3 A;  3FHD A;  3TK0 A;  3RQF A;  2L9J A;  2XS8 A;  2EIN C;  4KNV A;  4YT8 A;  3B9Q A;  4MVZ A;  1MND A;  1OQC A;  1D0Y A;  2XL6 A;  4WGY A;  2YLD A;  4DRJ B;  1HMO A;  1T9K A;  2IYL D;  2QY9 A;  2Q00 A;  3JRT A;  3W2V A;  1O5H A;  3QW1 A;  5L0F A;  2LSE A;  3PMR A;  2UUH A;  1RJ9 B;  4C3B A;  3J06 A;  2HSQ A;  4CBE A;  4YT2 A;  3LS1 A;  4EBB A;  4K1O A;  3SEO A;  2YQY A;  4YT5 A;  3HTK C;  4CS8 C;  4U5G A;  1FAP B;  3KYI A;  1A41 A;  5B3I A;  3W2W A;  3RF3 A;  2WZF A;  1JR8 A;  4CX9 A;  3PHF 2;  1D0X A;  4N06 A;  1YJG A;  3EG9 B;  3ZTM A;  2WL8 A;  3DWW A;  2PX3 A;  4EIY A;  4JEB A;  4F4B A;  3R7C A;  4MW8 A;  3NMJ A;  1TWC A;  4GQH A;  4AX2 A;  5L0J A;  2Q3T A;  2QTV A;  4Z9J A;  3KKB A;  1T01 A;  3OWT A;  3GM1 A;  2A69 F;  4IGG A;  1BZ4 A;  2QNL A;  3IEE A;  2DGJ A;  2TMV P;  4K7B A;  3B71 A;  3T6B A;  2ICW G;  1H7I A;  3I5Q A;  3OA1 A;  3VM6 A;  3ZSU A;  5KYY A;  2AU5 A;  5COM A;  3EHN A;  2WVQ A;  3QVY A;  4PJL A;  3RW0 A;  3EGX B;  2CYD A;  1TKN A;  2MYS A;  1YVI A;  3JSE O;  2HUJ A;  2R03 A;  2X0C A;  2JX0 A;  1NU7 D;  1OW7 A;  2EPK X;  1C02 A;  1J8M F;  2J0X A;  1ZHX A;  3JZ0 A;  4MVM A;  4PK4 A;  2C04 A;  4A4A A;  1M2O A;  2LP4 A;  3E9V A;  4ONS A;  1QSP A;  3DD7 A;  2HKV A;  4AL0 A;  4G7Z F;  2HV6 A;  1CGN A;  4C7O B;  4MND A;  5DVW A;  3EZH A;  4JCZ A;  2NSF A;  1T6U A;  3Q7L A;  1LE4 A;  4U9E A;  2B0H A;  3U2L A;  3EFO B;  2L81 A;  4BJ5 A;  2YHS A;  4N6H A;  3C7J A;  3EHM A;  3H2V A;  1IW7 F;  2NSG A;  3ECS A;  5JP7 A;  4OIR F;  4OD4 A;  1QKR A;  3EPV A;  4IWB A;  4PFP A;  1TQG A;  1GGQ A;  2YLI A;  1VOM A;  3RKO F;  3WOD F;  2BL2 A;  2G3K A;  3GM2 A;  3LAY A;  4G0H A;  2WB7 A;  3HNI A;  4I1O B;  4LDK A;  1FMV A;  3OEO A;  1VLS A;  2NUP A;  3DM5 A;  2KQ9 A;  3M15 A;  1M2V A;  3M1C B;  4JCH A;  4Z9I A;  2OU6 A;  3JCU Q;  1Z7Q c;  1BR2 A;  3LLI A;  3K1I A;  3QVZ A;  1LKX A;  3RVZ A;  3N2Z B;  3V5X A;  2WZL A;  1Q0D A;  1GS9 A;  3EZI A;  1AEP A;  2R02 A;  4EHP A;  2RSE B;  2EIK C;  4FWV A;  5BUO A;  5BQG A;  4YN0 B;  2MWQ A;  1SYQ A;  3ABK C;  2HJM A;  2IXN A;  2LFF A;  3FDQ A;  2R7W A;  4XWJ A;  2LD6 A;  1I4Y A;  1MMG A;  3DJU B;  4MVQ A;  1G8X A;  1JOG A;  2NUT A;  2JPU A;  2R7S A;  1JRA A;  3UMK A;  1R4T A;  4U5E E;  5KYU A;  4CDA A;  4R32 A;  4XEV A;  5COG A;  4X0R A;  1S7Z A;  2FAP B;  3GAN A;  4MS2 A;  1JPN A;  1M56 C;  4JZA A;  4BEM J;  3E70 C;  2HJ3 A;  3MYI A;  3RH3 A;  4XEF A;  1I5N A;  3IPM O;  3QMK A;  3T9O A;  1BBH A;  5L0C A;  5AGF A;  2EIJ C;  3WHN A;  3C8Z A;  3ZDL A;  4N4W A;  1ST6 A;  3DI5 A;  3C8G D;  2AWY A;  1YDI A;  4XTK A;  2L6G A;  3NYM A;  1EQ1 A;  3GWL A;  4JEA A;  3UGO A;  5L3V A;  5AC4 A;  1TR2 A;  3C8G B;  4I44 A;  1H9G A;  1MNE A;  1OKK D;  1D1A A;  2XS1 A;  3S27 A;  3X2Q C;  5HSW A;  3O39 A;  3O6X A;  1NSG B;  1T6Q A;  3GM3 A;  3BEH A;  2OG2 A;  3M4B A;  3K1H A;  2LQG A;  1YA9 A;  4GEH A;  3RQG A;  2KC3 A;  2J45 A;  2VCB A;  4PR9 A;  4KI2 A;  1HW1 A;  2XLE A;  3EH1 A;  3VF0 A;  4CDY A;  1V4A A;  1ZHW A;  4OIP F;  2O9X A;  1VK5 A;  5B1A C;  2A1D D;  2Y3H A;  4FES A;  3IQC A;  3CAX A;  3K66 A;  1E84 A;  4DXW A;  5HV9 A;  3C63 A;  3EGD A;  5A69 A;  3US6 A;  4W8K A;  3G4X A;  1Q0K A;  3TD7 A;  4MVO A;  1FTS A;  2Q9A A;  5E2Q A;  1ZHZ A;  1A7D A;  1UG7 A;  3LNM B;  3I5P A;  1C17 M;  5AC5 A;  2OCC C;  2J8W A;  3EH2 A;  1RKE B;  2EPM X;  2HMQ A;  3GEE A;  1LPE A;  3VRC A;  4BJT A;  4MTO A;  2OEX A;  4O6N A;  1NU9 C;  3O10 A;  3LS0 A;  3U9J A;  4LDQ A;  3L0I A;  5L0D A;  2EIM C;  2PNO A;  3IHU A;  3U8P A;  3UMI A;  3ZC4 A;  3DMD A;  3U3B A;  1HE1 A;  1LI7 A;  1GQA A;  2UUI A;  3AG1 C;  4CS7 A;  2H8A A;  2D4U A;  4ANJ A;  4JE9 A;  4PJJ A;  4G78 A;  3UGP A;  4JJG A;  4CS8 A;  5BQI A;  4G7O F;  4XEK A;  4CSA C;  1Z5Z A;  4U5F E;  3VAY A;  2J0W A;  2YWA A;  4EKW A;  2OOC A;  1LE2 A;  1N1C A;  1WTY A;  4L6R A;  2NPU A;  4E7Z A;  2XXA B;  1OXK A;  3AQB A;  3ZTZ A;  2WZG A;  3L34 A;  2F22 A;  1HY5 A;  2AVK A;  3PCV A;  3CZ6 A;  4C3D A;  4J30 B;  2XM4 A;  3B0U X;  4HFF B;  2XSE A;  3L1M A;  1NFO A;  1OCO C;  4AK9 A;  1D1B A;  5COF A;  2P61 A;  5FZT A;  5L0H A;  3MFN A;  3SP1 A;  1ORS C;  3NKD A;  1G4W R;  4MTG A;  4AL1 A;  1Q0M A;  4E0I A;  2R7R A;  1YYX A;  2YRF A;  3Q6N A;  4MVR A;  4JC7 A;  4K0D A;  5DS5 A;  2Y39 A;  2OJQ A;  3TUL A;  4NTA A;  1CPQ A;  2CNW A;  1WWP A;  3F47 A;  1T5O A;  3TJ6 A;  2IBF A;  1QLE C;  3ZVR A;  5TJ5 E;  4EUK B;  3KMI A;  2GA0 A;  3LES A;  3C18 A;  3VYW A;  2Z15 A;  2XLW A;  4XQ1 A;  1BR4 A;  4IJJ A;  4A2N B;  5KYX B;  3NDB B;  2VH3 A;  2VAS A;  2KK1 A;  1YAR O;  2P1A A;  3V7O A;  1A0B A;  3AOU A;  1EKY A;  3CSK A;  3IQ5 A;  2W45 A;  2AWC A;  2J9B A;  3ZIB A;  3PDM P;  1RJ9 A;  2A6H F;  2R7V A;  4EWC A;  5CIV A;  4BG0 A;  2Y3B A;  1I4Z A;  5K0I A;  3RVY A;  4KC9 A;  3HJC A;  4QDL A;  2CCY A;  2J7P D;  3W8I A;  4YT4 A;  3W8H A;  5A6A A;  1CGM E;  1J8Y F;  2R7O A;  1QZX A;  2XLM A;  2IXM A;  4HFK B;  1EI7 A;  2R7Q A;  4Q4Z F;  1DOW A;  3AGT A;  1K40 A;  2VB6 A;  4NCQ A;  3EG9 A;  1XZQ A;  2VCC A;  5T3W A;  1OR3 A;  1UFB A;  1XZP A;  3GOR A;  1ORY A;  1E83 A;  5JSL A;  3B0P A;  3U5S A;  2R7T A;  3N24 A;  1U89 A;  4IAQ A;  4OIO F;  1ZHT A;  5CI9 A;  2J46 A;  3CQZ A;  1HMD A;  5JVE A;  2YKZ A;  2D5R B;  1ZU5 A;  2DYR C;  2Y3D A;  4RBN A;  1OXB A;  3U3F A;  4BEJ A;  3N0T A;  2M64 A;  4I1M A;  3AGU A;  4MVU A;  4JJF A;  4BJ5 C;  2IXP A;  2EPO A;  3EGX A;  1MQV A;  2ZD9 A;  1PV3 A;  3SXM A;  1LM3 B;  3V5Z A;  4AE4 B;  2E87 A;  3UNG C;  1TWG A;  3G4Z A;  5DLJ A;  4LLC A;  1C03 A;  4CS9 C;  2FFH A;  3S29 A;  2BE5 F;  1FNT c;  2FGY A;  1G5Z A;  3TQO A;  2BC5 A;  3AJM A;  2XL4 A;  3I4U A;  4BJ6 C;  2Q9C A;  5KYW B;  4C7O A;  1TFO B;  2QUP A;  3ASO C;  3DKA A;  5FCL A;  5KYN A;  1L7C A;  1VTM P;  1LIH A;  2VCA A;  3EFO A;  2OKU A;  3DXJ F;  2J9U A;  3K1I C;  4YJW A;  3JYY A;  4OIN F;  3GOD A;  4IRU A;  3H2U A;  1YA7 O;  1V55 C;  2YLG A;  3UMH A;  3U0C A;  2XL8 A;  1NFN A;  1Z3I X;  2AP3 A;  1JAF A;  1A7V A;  2HS5 A;  2OEV A;  4MQ9 F;  2M4E A;  2J7P A;  5JRA A;  4J7Y A;  3SYN A;  5EHH A;  3K33 A;  4J7T A;  4DVZ A;  2RD9 A;  4IB4 A;  1O3U A;  2J9V A;  3K7D A;  3F46 A;  1PD1 A;  2XRH A;  1Z23 A;  2XLD A;  2Q9B A;  2ZXR A;  2PFD A;  3DM9 B;  4MVS A;  3H65 A;  4E7S A;  1WGW A;  1OCR C;  4JUR I;  5DQZ A;  5JS5 A;  4FAP B;  3ZG1 A;  3SXK A;  1L3P A;  3JSZ A;  2W4M A;  2W9Y A;  3LNR A;  1RCP A;  2H7B A;  1RKC A;  3Q6M A;  2NG1 A;  4LLE A;  4DOZ A;  5EGY A;  3B0V C;  4O7G A;  2W4B A;  1GM5 A;  2J9W A;  3HNJ A;  3MLG A;  1ZZP A;  1QVX A;  2OQM A;  4U5B E;  4YL3 A;  1Q0G A;  3LUT B;  1H9T A;  2R25 A;  2GAQ A;  1ZW2 A;  5E3C A;  3ABM C;  4U5D E;  1Z63 A;  3NMK A;  3O55 A;  4O79 A;  5T3T A;  2Y69 C;  4WJ0 A;  3U9M A;  2ZPA A;  2PX0 A;  4LDR A;  1ORJ A;  2IOQ A;  3ABL C;  4H4K C;  4M63 A;  4MTF A;  3RFY A;  1K05 A;  2R7X A;  1MMN A;  2LIG A;  2QE9 A;  1B68 A;  4EBK A;  3S84 A;  1KTM A;  1LS1 A;  5L0G A;  1O87 A;  2P7V A;  3RYL A;  4CSA A;  3ATP A;  1WOL A;  5A6K A;  4P9T A;  1YAU O;  4PAC A;  1U0B B;  5JUA A;  3M4C A;  4XLN F;  4JVS A;  5KYY B;  2L6F A;  3FOO A;  3FXH A;  3L8J A;  4D4X A;  3LEO A;  3C8G A;  5E3A A;  3NMI A;  1VYI A;  1ZYR F;  4BJ1 A;  1D0Z A;  1NG1 A;  4J32 B;  1H6G A;  1MMD A;  1AVO B;  2GWW A;  2A68 F;  3B29 A;  3TJ5 A;  5JT4 A;  1OKK A;  3QW0 A;  3R2P A;  5F5H A;  3FVY A;  2PF4 E;  3LEV A;  4CJO A;  1R5I D;  2WVO A;  1M6T A;  4E17 A;  4OD5 A;  2YEV A;  2EIL C;  3KPH A;  3IQ6 A;  3U8V A;  2L6H A;  1E85 A;  1S05 A;  1NBB A;  5E33 A;  2HMZ A;  3TOM A;  3M79 A;  3NYJ A;  2YL7 A;  4NY3 A;  4PFO A;  1VMA A;  3S0X A;  3NG1 A;  4I3M A;  1RXQ A;  1YYJ A;  3SNH A;  4KNW A;  1D1C A;  1M57 C;  2LK4 A;  3IQT A;  2MHR A;  2NUP B;  1FFT C;  3KYJ A;  1RKE A;  5GPG B;  1M2V B;  2ASR A;  3V5Y A;  1FMW A;  3KL4 A;  1SF8 A;  3UR3 C;  1W2W A;  2B0J A;  4NTF A;  1G4U S;  2LFD A;  2LCH A;  4MW3 A;  4D4N A;  2PP4 A;  4GYT A;  4CIP A;  2R05 A;  3HNL A;  1APC A;  1ZW3 A;  4QI2 A;  1NZE A;  3JT1 A;  4JRZ A;  4CJG A;  3NRH A;  4DBR A;  4XLP F;  4DJ9 A;  1OW8 A;  2ZXW C;  4XPX A;  3RQE A;  5A6J A;  2KJG A;  1ZHY A;  2KYH A;  3L8I A;  3FAP B;  2XXA A;  4JKV A;  1CGO A;  2NUT B;  2YZS A;  3AG3 C;  3DE8 A;  4FX5 A;  4C3E A;  3DAF A;  2IXO A;  4NQF A;  3SZR A;  1ZU4 A;  5KYU B;  3T6J A;  1ZVZ A;  1FFH A;  3EJN A;  3JRM O;  3KH2 A;  3C62 A;  4QI0 A;  3ZQY A;  1EA8 A;  4UDV A;  3AG2 C;  2VC9 A;  5L3Q A;  1E2X A;  4Z9H A;  4E18 A;  2Q4F A;  3EQL F;  4HE8 D;  1CPR A;  5DQT A;  4BPM A;  1WN0 A;  3X1O A;  2DYS C;  1BR1 A;  5T1D B;  4U5H A;  2A0B A;  2XLH A;  3RIP A;  3W4Y A;  4ZLC A;  5JLI A;  3GWN A;  4NC3 A;  2HSB A;  2L7A A;  4ULW A;  5BQH A;  2ZXP A;  5D91 A;  1JMW A;  2EPL X;  3CEX A;  3WG7 C;  4DVY P;  4JW1 A;  2YL3 A;  4CS9 A;  4WAB A;  1K04 A;  1KNY A;  2KNH A;  4N6C A;  4B6I A;  4CDV A;  1PD0 A;  2XM0 A;  4IAO A;  4O6M A;  4BJ6 A;  5KYX A;  2ZXO A;  3SXY A;  3GEI A;  5IY5 C;  3DAG A;  2JD3 A;  1IZM A;  3HKK A;  3JYH A;  1E86 A;  4HEA J;  1LS4 A;  1Z6A A;  1V54 C;  2KW3 C;  2HZ8 A;  2GFH A;  2YVK A;  3A11 A;  4P6I C;  4PJM A;  2PBE A;  1TWH A;  1PCX A;  1NLX A;  1OCZ C;  1YZC A;  3QZC A;  1RMV A; 
#chains in the Genus database with same CATH homology
 3ZTZ A;  3HNJ A;  1CGN A;  4U9E A;  1YZA A;  2XM4 A;  4N6H A;  2YL1 A;  3L1M A;  3NMK A;  5JP7 A;  4U9D A;  2YLI A;  3TOL A;  1YYX A;  3HNI A;  1CPQ A;  2QLA A;  3M15 A;  4IAR A;  3HNK A;  5JUA A;  3M4C A;  3FOO A;  256B A;  3QVZ A;  4D4X A;  2XLW A;  3NMI A;  1QPU A;  1EKY A;  5JT4 A;  3IQ5 A;  3QW0 A;  2XLV A;  2J9B A;  4CJO A;  1M6T A;  2XLO A;  3ZWI A;  4CDA A;  2CCY A;  3IQ6 A;  1E85 A;  1S05 A;  1NBB A;  3TOM A;  3M79 A;  2XLM A;  2YL0 A;  2YL7 A;  1QQ3 A;  1YYJ A;  1BBH A;  3DE9 A;  5AGF A;  1E83 A;  5JSL A;  4ER9 A;  3FOP A;  4IAQ A;  4WGZ A;  4N4W A;  4ULV A;  5JVE A;  2YKZ A;  4JEA A;  4D4N A;  3ZQV A;  4CIP A;  3HNL A;  1APC A;  1MQV A;  4CJG A;  1LM3 B;  3M4B A;  4WGY A;  2XL6 A;  2YLD A;  3QW1 A;  4JKV A;  2XLE A;  2BC5 A;  4CDY A;  1CGO A;  3DE8 A;  1E84 A;  5B3I A;  3C62 A;  3C63 A;  3ZQY A;  4CX9 A;  3ZTM A;  1CPR A;  2YLG A;  4EIY A;  4JEB A;  3NMJ A;  2XL8 A;  2XLH A;  2J8W A;  5JLI A;  1JAF A;  4NC3 A;  1A7V A;  3VRC A;  2YL3 A;  5JRA A;  3U8P A;  4CDV A;  2XM0 A;  1GQA A;  4IB4 A;  3QVY A;  2XLD A;  4JE9 A;  5JS5 A;  1E86 A;  1RCP A;  1YZC A;  4L6R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...