3QVZA

Crystal structure of the zn-ridc1 complex stabilized by bmoe crosslinks cocrystallized in the presence of cu(ii)
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
106
structure length
106
Chain Sequence
ADLEDNMETLNDNLKVIEKADNAAQVKDALTKMAAAAADAWSATPPKLEDKSPDSPEMHDFRHGFWILIGQIHDALHLANECKVKEAQAAAEQLKTTCNACHQKYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Cytochrome cb562
publication title Templated construction of a zn-selective protein dimerization motif.
pubmed doi rcsb
source organism Escherichia coli
total genus 46
structure length 106
sequence length 106
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-02-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 3qvzA00
4JEBA 3C63A 2BC5A 1E84A 1NBBA 3NMKA 3NMJA 4CJGA 4NC3A 5JRAA 1BBHA 2XLOA 1RCPA 5B3IA 5JP7A 3HNJA 4JEAA 3NMIA 2YKZA 3IQ5A 4D4XA 4JKVA 3ZWIA 3ZQVA 3L1MA 2XLHA 1S05A 1YZAA 3HNKA 256BA 1YYXA 4CX9A 1E85A 2J8WA 2YL0A 4EIYA 1E83A 5JT4A 3M4BA 1QPUA 1YYJA 1CGOA 3FOOA 3ZTZA 3C62A 3DE8A 2J9BA 4IB4A 2XLMA 2XLWA 3HNLA 3QVZA 3U8PA 4WGZA 3QVYA 4JE9A 5AGFA 1CPQA 3ZTMA 4CIPA 4ER9A 3QW0A 4U9DA 1E86A 3M15A 3VRCA 3TOLA 4WGYA 5JLIA 2XLVA 1MQVA 4IARA 1LM3B 4CDAA 2YLIA 2XLDA 4CJOA 2YL3A 4D4NA 2YL1A 5JSLA 4CDVA 1JAFA 3TOMA 4N4WA 5JUAA 1A7VA 4IAQA 2QLAA 1M6TA 2YLDA 2YL7A 3FOPA 3M4CA 1CGNA 2XM4A 4L6RA 5JS5A 2XM0A 2XL6A 2CCYA 3ZQYA 1YZCA 2YLGA 3HNIA 3QW1A 3DE9A 1APCA 2XLEA 5JVEA 1QQ3A 1EKYA 4CDYA 4ULVA 3IQ6A 1GQAA 1CPRA 4U9EA 4N6HA 3M79A 2XL8A
chains in the Genus database with same CATH superfamily
3EGXA 5BUOA 2Y3HA 2ZPAA 1TFKB 2EPKX 2GA0A 2ZXOA 3RVZA 4FESA 1G8XA 3C18A 2XXAA 2MHRA 3FAJA 4C3BA 4CJGA 2OU6A 1HMOA 2G3VA 2OOCA 2A0BA 1OW7A 1A41A 2J0XA 4JCZA 2EIMC 4OD5A 3RIPA 1BBHA 2JD3A 1Y6DA 3LNMB 2JPUA 2R25A 4OIPF 4C3DA 5B3IA 3SYNA 1WWPA 2FGYA 1VLTA 3K1IA 4X0RA 2J9VA 2CGEA 2R02A 3U3BA 2R7OA 3IQCA 4KC9A 4QI0A 3GEEA 1ZHTA 2IYLD 1OW6A 1FMVA 2VH3A 4A2NB 3UMHA 3RYLA 4DRJB 3I4UA 4YWQA 3OEOA 5KYNA 2PBEA 1VTMP 3O10A 1ST6A 2UUHA 1ZW2A 2LFFA 3AG2C 2EIKC 1NSGB 3KMIA 2J8WA 3ASNC 1HW1A 5JT4A 2KW3C 3M4BA 1FNTc 5L0IA 2GDCA 2NUPA 1E2XA 1ZW3A 1SF8A 1ZHWA 3ASOC 1ORJA 4RBNA 3MLGA 4G7HF 3RQFA 3NKEA 2CYDA 1ORSC 4YJWA 2J9BA 1D0YA 3JCUQ 4OINF 3S27A 4GYTA 4IB4A 3LAYA 4G7ZF 4P9TA 4UDVA 1YA9A 1T6IA 4YL3A 4YT5A 5IY5C 3AG1C 3GANA 3NRHA 4YT8A 1A7EA 1N1CA 3N2ZB 2NUTA 3WAQA 3EFOA 4JE9A 4PACA 1AVOB 3ZVRA 4CIPA 1JMWA 2QY9A 2V26A 2DI3A 3ZIBA 3AG3C 5HV9A 2P1AA 1C03A 4U9DA 3UR3C 5B3SC 1D0ZA 3M15A 3VRCA 3SXZA 3TOLA 1FTSA 3SP1A 4U5BE 2WVNA 1Q0FA 3E9VA 1MQVA 2XL4A 4PFPA 3CEXA 5CI8A 5DLJA 1Z63A 2XLDA 4U5DE 3LESA 4I1MA 1V4AA 4B6IA 4JIOA 4DBRA 4D4NA 2Q9CA 2VCBA 2RSEB 5HSWA 4MVOA 1M57C 2Z15A 1VYKA 3PMRA 4EBKA 4LACB 4WABA 4LLEA 4OD4A 4MW3A 4DVZA 2CNWD 1TWHA 1DOVA 3O6XA 3TD7A 4CS7A 4ULWA 3EGXB 1OCZC 4E7SA 3EHNA 2B0HA 1QSPA 5E3AA 2PF4E 2J9UA 2LIGA 5EK0A 3M4CA 2XXAB 3RW0A 1CGNA 2XS8A 1YAUO 3JTLO 4PJJA 4RD9A 1M2VB 1OR2A 2EPMX 3AQBA 1J8YF 3RF3A 5JS5A 1U0BB 2I8BA 2D4UA 2KYHA 1WOLA 3R7CA 2XL6A 2E87A 5T3WA 1ZZPA 3N0TA 3K7DA 1OXBA 4P6IC 3VYWA 1BR4A 4DXWA 2QTVA 2VCAA 1NLXA 3EZIA 3B0PA 1RMVA 4XPXA 1H7IA 3HKKA 3HNIA 2WZLA 2X51A 1T9KA 1UG7A 3T6BA 2A6HF 4GEHA 1D1BA 4MVZA 3Q7GA 2PFDA 3EGDA 4E0HA 1KTMA 3DM9B 2VC9A 3KL4A 2J0WA 3KYJA 3IQ6A 1ZHZA 2YWAA 3RKOF 1PV3A 2R7QA 1WATA 3F47A 4YT2A 5L3VA 4DVYP 3B0UX 4CSAC 3Q7LA 1EQ1A 2HKVA 2J46A 3U9MA 4YT4A 3JT1A 1WGWA 3UGPA 5FZTA 4BJ6C 4JTAB 2A6EF 2X0CA 1E84A 1NBBA 3ZDLA 3U0CA 1MMGA 1S7ZA 2LD6A 3A11A 1EA8A 2A68F 3DZAA 3NMKA 4NC3A 1C02A 1YDIA 3PCVA 5CIVA 1PD0A 1R5ID 3V7OA 3FAPB 2R03A 5A6BD 3CAXA 3JYHA 4KNWA 5DS5A 1ZYRF 4G0HA 4AL1A 4MVMA 4NQFA 1Z6AA 3QTHA 2AVKA 2NUTB 3AJMA 2WB7A 3I5PA 3EFOB 4MTGA 4CIHA 5L0CA 2XSEA 2KNHA 1JOGA 3ZWIA 1SR2A 1NFOA 2WVOA 1FFTC 3L1MA 1YA7O 1TR2A 1G5ZA 3ABKC 3ECSA 3V5ZA 1YZAA 2I15A 3HNKA 3N24A 2P61A 1Z7Qc 3LNRA 4CX9A 1Z5ZA 3NYMA 2OCCC 1E85A 2YL0A 1D0XA 4LDQA 4XEKA 3U5SA 2UUIA 1FAPB 1LI7A 2ICWG 4AX2A 3FXHA 3T9OA 1M2VA 1T01A 2OG2A 3EH2A 4MVSA 4N6CA 3W2VA 3ZTZA 4EBJA 4XEFA 2ZXWC 2AWCA 3DE8A 2EINC 1M2OA 2DB4A 2KJGA 2L6FA 2YHSA 3ATPA 3HTKC 4NTBA 4G7OF 2XLMA 1XWJA 1Z23A 3J06A 2WZGA 3MBGA 2GFHA 2Q7RA 2H7VC 3B71A 3QVZA 2Q3TA 3HJCA 2IOQA 3DI5A 3NYLA 4PFOA 4YN0B 2J9WA 5A6KA 3T6JA 5GPGB 2A0UA 4KI2A 3C8GA 2ZD9A 4JCHA 4RDAA 5KYYA 2Q00A 4O6MA 2OJQA 5EGYA 1E86A 2CW0F 2HMZA 4KNVA 3U2LA 1L3PA 4WGYA 2YEVA 1MMNA 2XLVA 1NZEA 4PJMA 3RQGA 2AU5A 1LM3B 3CSKA 3EG9A 1T6UA 2LK4A 5B1BC 4E18A 5BQHA 4XPWA 5KYXA 3TULA 1LS4A 3TJ6A 4Q7CA 3DAGA 2IXNA 3Q6NA 3RVYA 5L0HA 1HMDA 2GWWA 5JSLA 4BJ6A 4XPYA 1R4TA 3EGDB 2NG1A 4CS8C 1MNEA 2YRFA 5D92A 1BDJB 2KC3A 1JAFA 2PP4A 4G78A 2LFDA 4PR9A 4CDVA 5K0IA 3ZSUA 1OW8A 5DS4A 1HE1A 1HW2A 4A4AA 1UFBA 5JUAA 2HSBA 4QI2A 2QLAA 3GM2A 4N06A 2ETSA 2XS1A 2YL7A 1Q0KA 3KH2A 3M1CB 2W4BA 1NU7D 2XM4A 4L6RA 1M56C 2G62A 5F5HA 1T5OA 3L8IA 3W8IA 5EHHA 1VK5A 3H2VA 3NYJA 3U8VA 3E70C 3RH3A 2CCYA 2KSFA 5L0DA 3TK0A 1DOWA 2WZFA 4DOZA 2C04A 3R2PA 5CI9A 3EZHA 4CS9C 1I4YA 2YLGA 4MNDA 3BEHA 4DRIB 1PCXA 1L7CA 2XLEA 3V5XA 5COMA 1TFOB 3JRMO 1YVIA 4FAPB 5T3TA 1EKYA 1RKCA 3L34A 3W4YA 3GM3A 5T1DB 4W8KA 3Q6MA 4J30B 1GS9A 4ZLDA 1GQAA 4J32B 2HMQA 2KGOA 2DYSC 3AG4C 1QVXA 2PNOA 3AGTA 1TWGA 3AOUA 2VB6A 2XL8A 5TJ5E 1LKXA 4E17A 3C63A 3PHF2 2CDQA 2P6VA 3TQOA 1YARO 3B29A 3S29A 3WG7C 2EPOA 1JR8A 3LEOA 3FMSA 1OCCC 3WHNA 2R7RA 1MMAA 2HV6A 4LERA 1U6HA 1YLMA 1TWCA 3UMKA 2HSQA 4AL0A 2MWQA 2EILC 4AE4A 2M4EA 2GAQA 3LLIA 3US6A 3LEVA 3LLKA 1RJ9A 1RCPA 3MYFA 4WJ0A 1A7DA 3VF0A 1EI7A 5L0FA 4Z9IA 1TKNA 1W2WA 2Q9BA 3EPVA 4JEAA 4JURI 3O39A 4U5FE 2YKZA 2A69F 3C8GB 3IQ5A 4D4XA 4EKWA 5KYYB 3WODF 3UGOA 4JJFA 2J7PA 3HLZA 3NDBB 1J8MF 2NSGA 4IRUA 3ZQVA 1Z3IX 2Y3GA 2G3KA 1KNYA 3S90A 2EPLX 2WL8A 4MVRA 1F1MA 4CS8A 3K33A 4NTAA 4OIOF 4C7OA 1HY5A 3SXMA 2QE9A 256BA 3AGUA 3DMDA 5FCLA 3EG9B 2R9RB 5KYXB 3GORA 2PX0A 3UNGC 4BJ5C 4EIYA 1Y4CA 3L0IA 4U5CE 2EIJC 2LCHA 2L7AA 1YYJA 3W8HA 2R05A 3FOOA 1OCRC 3C7JA 4NY3A 3MX3A 2HFIA 3C62A 3G4XA 4O6NA 2OJED 5COFA 2XRHA 2QNLA 1ORYA 3S0XA 4IAOA 1RKEB 4J7TA 2V3CC 4NTFA 3H2UA 2KK1A 5F5FA 2EPNA 3FVYA 3PDMP 1NU9C 1ZHXA 2NPUA 2LP4A 1D1AA 3LJBA 3U8PA 4CS9A 4WGZA 4DJ9A 1CGME 1IW7F 1CPQA 4OIRF 3V5YA 3ZC4A 3ZTMA 1LS1A 3ABLC 3QW0A 2A1DD 3B9QA 5KYUA 5AC5A 2J45A 3L8JA 3EH1A 5DS6A 1XZQA 1O5HA 1SYQA 4ONSA 1G4WR 4IARA 3FHDA 2IBFA 5COGA 2YLIA 3AQCA 4CDAA 3OWTA 4CJOA 4P9FA 3KPHA 4BEMJ 4Q4ZF 5BQGA 1AUEA 2YL1A 3LS0A 3EHMA 4H54A 5DVWA 1LVKA 5A6JA 3NG1A 1LE4A 1PD1A 2IM8A 2H8AA 2HJMA 2R7WA 1V55C 4O6YA 1BZ4A 3TOMA 2L81A 3VM6A 4BJ1A 4PJNA 3ZG1A 1I4ZA 2R7SA 2RD9A 3IPMO 3OA1A 5KYWA 1K04A 3SXYA 1OR3A 1NFNA 3F46A 4MTOA 1M6TA 2VASA 2Y3BA 2YLDA 3EQLF 3JYYA 4IGGA 4F4BA 3FOPA 5L3QA 4XEVA 3DXJF 5A6AA 1ZHYA 2YVKA 4BJTA 1FMWA 4E7ZA 4AE4B 3SXKA 1ZVZA 1RJ9B 2HS5A 4EHPA 1OQCA 4IJJA 4JJGA 1YZCA 4KBLA 3QZCA 3C8GD 2HZ8A 3GM1A 4YL1A 4CSAA 2KQ9A 1OXKA 2OEXA 1U89A 3QW1A 4U5HA 3DE9A 4BJ5A 4JC7A 1ZU5A 5B1AC 2Y69C 5JVEA 1JRAA 1QQ3A 1YJGA 3IQTA 4Z9HA 3EJNA 3GEHA 3S28A 4CDYA 1GM5A 4ZLCA 4C7OB 4I3MA 4MVQA 4ULVA 2IXOA 1BR1A 2W9YA 3JRTA 4O7GA 2PX3A 1WTYA 1AEPA 1RKEA 1CPRA 2P7VA 3CQZA 4U9EA 3POVA 3S9OA 4FWVA 3M79A 4XTKA 5L0GA 2B0JA 4JEBA 2BC5A 4JZAA 2OKUA 4R32A 2Q4FA 3T4RA 3DD7A 1VLSA 4M63A 3NMJA 1KU2A 4K1OA 3X1OA 1SMYF 2M64A 3BRJA 5DQZA 4EUKB 1T6QA 5KYWB 4U5GA 4JRZA 5F28E 2H7BA 1LI5A 2HUJA 2Q9AA 4JTCB 4OIQF 5JRAA 5BQIA 1QLEC 1WN0A 2ASRA 2XLOA 2W4MA 2ZXPA 3DKAA 3MYIA 5JP7A 4Z9JA 3HNJA 4BEJA 4NCQA 3NKDA 3IHUA 3NMIA 1SZIA 3SZRA 2LQGA 1A0BA 2C03A 4LDRA 1B68A 1MMDA 2AP3A 4JKVA 5E33A 2Y39A 3RFYA 4XLPF 4DRHB 3K66A 3GWLA 5KYUB 3ITFA 4HEAJ 2BE5F 2DYRC 2L9JA 2O9XA 4U5EE 2XLHA 1QKRA 1S05A 3JZ0A 4H4KC 5AC4A 2QUPA 5E3CA 3MFNA 2R7VA 1YYXA 2ZXRA 1JPNA 4J7YA 4ANJA 2YZSA 1G4US 1IZMA 1E83A 2H7OA 2CNWA 3VAYA 3SEOA 2MYSA 1Q0DA 1QPUA 1C17M 1VYIA 2D5RB 1CGOA 2DGJA 4Q5SF 3GODA 3O55A 3G4ZA 1V74B 4EWCA 2R7UA 3GWNA 1OKKA 1FFHA 3DWWA 3UMIA 3I5QA 1O3UA 4MTFA 2XLWA 4GQHA 1I5NA 1JPJA 2W45A 3DAFA 2BL2A 3HNLA 3KYIA 3U9JA 4BG0A 4I44A 4PK4A 1Q0GA 1ZU4A 4HE8D 3QVYA 1V54C 2AWYA 4K0DA 4JW1A 4YL0A 5AGFA 2FAPB 4MS2A 1RXQA 3DJNB 4I1OB 2R7XA 2LSEA 4E0IA 2JX0A 4ER9A 1O87A 1OKKD 3QMKA 5D91A 3KKBA 2YQYA 3H65A 4YK5A 4W8PA 4XLNF 3K1IC 3T6GB 1VMAA 3LUTB 2TMVP 5JLIA 1BR2A 2IXPA 4JTDB 4XQ1A 3JSZA 2J7PD 1K40A 3X2QC 2OEVA 4DBQA 2YL3A 2Y3DA 4HFKB 5E2QA 4AK9A 5L0JA 3W2WA 4FX5A 5A69A 2OQMA 1H9TA 1GGQA 3U3FA 4EBBA 1LIHA 4MQ9F 1Q0MA 2VCCA 3IEEA 1XZPA 1H9GA 3DJUB 2IXMA 3A9CA 4N4WA 3LS1A 3U2MA 2NSFA 4MW8A 1A7VA 4IAQA 5A6BA 3C8ZA 2F22A 2NUPB 2R7TA 2HV7A 4C3EA 1VOMA 3JSEO 3CZ6A 1H6GA 4MVUA 1LPEA 4K7BA 1QZXA 2XM0A 3ZQYA 3SNHA 1LE2A 4LDKA 1MNDA 3B0VC 1HE9A 3K6BA 1VB5A 4IWBA 3GEIA 4O79A 1OCOC 4HFFB 1APCA 1NG1A 2L6HA 5DQTA 2P0NA 4PJLA 4BPMA 4XWJA 3DM5A 3TJ5A 3S84A 2WVQA 3G50A 2L6GA 3FDQA 1FR0A 2FFHA 1TQGA 4LLCA 1TWAA 4QDLA 4JVSA 1K05A 4N6HA 3K1HA 1D1CA 3RQEA 3ABMC 2HJ3A 4CBEA 1WASA
chains in the Genus database with same CATH topology
4JEBA 3C63A 2BC5A 1E84A 1NBBA 3NMKA 3NMJA 4CJGA 4NC3A 5JRAA 1BBHA 2XLOA 1RCPA 5B3IA 5JP7A 3HNJA 4JEAA 3NMIA 2YKZA 3IQ5A 4D4XA 4JKVA 3ZWIA 3ZQVA 3L1MA 2XLHA 1S05A 1YZAA 3HNKA 256BA 1YYXA 4CX9A 1E85A 2J8WA 2YL0A 4EIYA 1E83A 5JT4A 3M4BA 1QPUA 1YYJA 1CGOA 3FOOA 3ZTZA 3C62A 3DE8A 2J9BA 4IB4A 2XLMA 2XLWA 3HNLA 3QVZA 3U8PA 4WGZA 3QVYA 4JE9A 5AGFA 1CPQA 3ZTMA 4CIPA 4ER9A 3QW0A 4U9DA 1E86A 3M15A 3VRCA 3TOLA 4WGYA 5JLIA 2XLVA 1MQVA 4IARA 1LM3B 4CDAA 2YLIA 2XLDA 4CJOA 2YL3A 4D4NA 2YL1A 5JSLA 4CDVA 1JAFA 3TOMA 4N4WA 5JUAA 1A7VA 4IAQA 2QLAA 1M6TA 2YLDA 2YL7A 3FOPA 3M4CA 1CGNA 2XM4A 4L6RA 5JS5A 2XM0A 2XL6A 2CCYA 3ZQYA 1YZCA 2YLGA 3HNIA 3QW1A 3DE9A 1APCA 2XLEA 5JVEA 1QQ3A 1EKYA 4CDYA 4ULVA 3IQ6A 1GQAA 1CPRA 4U9EA 4N6HA 3M79A 2XL8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JEB A;  3C63 A;  2BC5 A;  1E84 A;  1NBB A;  3NMK A;  3NMJ A;  4CJG A;  4NC3 A;  5JRA A;  1BBH A;  2XLO A;  1RCP A;  5B3I A;  5JP7 A;  3HNJ A;  4JEA A;  3NMI A;  2YKZ A;  3IQ5 A;  4D4X A;  4JKV A;  3ZWI A;  3ZQV A;  3L1M A;  2XLH A;  1S05 A;  1YZA A;  3HNK A;  256B A;  1YYX A;  4CX9 A;  1E85 A;  2J8W A;  2YL0 A;  4EIY A;  1E83 A;  5JT4 A;  3M4B A;  1QPU A;  1YYJ A;  1CGO A;  3FOO A;  3ZTZ A;  3C62 A;  3DE8 A;  2J9B A;  4IB4 A;  2XLM A;  2XLW A;  3HNL A;  3QVZ A;  3U8P A;  4WGZ A;  3QVY A;  4JE9 A;  5AGF A;  1CPQ A;  3ZTM A;  4CIP A;  4ER9 A;  3QW0 A;  4U9D A;  1E86 A;  3M15 A;  3VRC A;  3TOL A;  4WGY A;  5JLI A;  2XLV A;  1MQV A;  4IAR A;  1LM3 B;  4CDA A;  2YLI A;  2XLD A;  4CJO A;  2YL3 A;  4D4N A;  2YL1 A;  5JSL A;  4CDV A;  1JAF A;  3TOM A;  4N4W A;  5JUA A;  1A7V A;  4IAQ A;  2QLA A;  1M6T A;  2YLD A;  2YL7 A;  3FOP A;  3M4C A;  1CGN A;  2XM4 A;  4L6R A;  5JS5 A;  2XM0 A;  2XL6 A;  2CCY A;  3ZQY A;  1YZC A;  2YLG A;  3HNI A;  3QW1 A;  3DE9 A;  1APC A;  2XLE A;  5JVE A;  1QQ3 A;  1EKY A;  4CDY A;  4ULV A;  3IQ6 A;  1GQA A;  1CPR A;  4U9E A;  4N6H A;  3M79 A;  2XL8 A; 
#chains in the Genus database with same CATH topology
 3EGX A;  5BUO A;  2Y3H A;  2ZPA A;  1TFK B;  2EPK X;  2GA0 A;  2ZXO A;  3RVZ A;  4FES A;  1G8X A;  3C18 A;  2XXA A;  2MHR A;  3FAJ A;  4C3B A;  4CJG A;  2OU6 A;  1HMO A;  2G3V A;  2OOC A;  2A0B A;  1OW7 A;  1A41 A;  2J0X A;  4JCZ A;  2EIM C;  4OD5 A;  3RIP A;  1BBH A;  2JD3 A;  1Y6D A;  3LNM B;  2JPU A;  2R25 A;  4OIP F;  4C3D A;  5B3I A;  3SYN A;  1WWP A;  2FGY A;  1VLT A;  3K1I A;  4X0R A;  2J9V A;  2CGE A;  2R02 A;  3U3B A;  2R7O A;  3IQC A;  4KC9 A;  4QI0 A;  3GEE A;  1ZHT A;  2IYL D;  1OW6 A;  1FMV A;  2VH3 A;  4A2N B;  3UMH A;  3RYL A;  4DRJ B;  3I4U A;  4YWQ A;  3OEO A;  5KYN A;  2PBE A;  1VTM P;  3O10 A;  1ST6 A;  2UUH A;  1ZW2 A;  2LFF A;  3AG2 C;  2EIK C;  1NSG B;  3KMI A;  2J8W A;  3ASN C;  1HW1 A;  5JT4 A;  2KW3 C;  3M4B A;  1FNT c;  5L0I A;  2GDC A;  2NUP A;  1E2X A;  1ZW3 A;  1SF8 A;  1ZHW A;  3ASO C;  1ORJ A;  4RBN A;  3MLG A;  4G7H F;  3RQF A;  3NKE A;  2CYD A;  1ORS C;  4YJW A;  2J9B A;  1D0Y A;  3JCU Q;  4OIN F;  3S27 A;  4GYT A;  4IB4 A;  3LAY A;  4G7Z F;  4P9T A;  4UDV A;  1YA9 A;  1T6I A;  4YL3 A;  4YT5 A;  5IY5 C;  3AG1 C;  3GAN A;  3NRH A;  4YT8 A;  1A7E A;  1N1C A;  3N2Z B;  2NUT A;  3WAQ A;  3EFO A;  4JE9 A;  4PAC A;  1AVO B;  3ZVR A;  4CIP A;  1JMW A;  2QY9 A;  2V26 A;  2DI3 A;  3ZIB A;  3AG3 C;  5HV9 A;  2P1A A;  1C03 A;  4U9D A;  3UR3 C;  5B3S C;  1D0Z A;  3M15 A;  3VRC A;  3SXZ A;  3TOL A;  1FTS A;  3SP1 A;  4U5B E;  2WVN A;  1Q0F A;  3E9V A;  1MQV A;  2XL4 A;  4PFP A;  3CEX A;  5CI8 A;  5DLJ A;  1Z63 A;  2XLD A;  4U5D E;  3LES A;  4I1M A;  1V4A A;  4B6I A;  4JIO A;  4DBR A;  4D4N A;  2Q9C A;  2VCB A;  2RSE B;  5HSW A;  4MVO A;  1M57 C;  2Z15 A;  1VYK A;  3PMR A;  4EBK A;  4LAC B;  4WAB A;  4LLE A;  4OD4 A;  4MW3 A;  4DVZ A;  2CNW D;  1TWH A;  1DOV A;  3O6X A;  3TD7 A;  4CS7 A;  4ULW A;  3EGX B;  1OCZ C;  4E7S A;  3EHN A;  2B0H A;  1QSP A;  5E3A A;  2PF4 E;  2J9U A;  2LIG A;  5EK0 A;  3M4C A;  2XXA B;  3RW0 A;  1CGN A;  2XS8 A;  1YAU O;  3JTL O;  4PJJ A;  4RD9 A;  1M2V B;  1OR2 A;  2EPM X;  3AQB A;  1J8Y F;  3RF3 A;  5JS5 A;  1U0B B;  2I8B A;  2D4U A;  2KYH A;  1WOL A;  3R7C A;  2XL6 A;  2E87 A;  5T3W A;  1ZZP A;  3N0T A;  3K7D A;  1OXB A;  4P6I C;  3VYW A;  1BR4 A;  4DXW A;  2QTV A;  2VCA A;  1NLX A;  3EZI A;  3B0P A;  1RMV A;  4XPX A;  1H7I A;  3HKK A;  3HNI A;  2WZL A;  2X51 A;  1T9K A;  1UG7 A;  3T6B A;  2A6H F;  4GEH A;  1D1B A;  4MVZ A;  3Q7G A;  2PFD A;  3EGD A;  4E0H A;  1KTM A;  3DM9 B;  2VC9 A;  3KL4 A;  2J0W A;  3KYJ A;  3IQ6 A;  1ZHZ A;  2YWA A;  3RKO F;  1PV3 A;  2R7Q A;  1WAT A;  3F47 A;  4YT2 A;  5L3V A;  4DVY P;  3B0U X;  4CSA C;  3Q7L A;  1EQ1 A;  2HKV A;  2J46 A;  3U9M A;  4YT4 A;  3JT1 A;  1WGW A;  3UGP A;  5FZT A;  4BJ6 C;  4JTA B;  2A6E F;  2X0C A;  1E84 A;  1NBB A;  3ZDL A;  3U0C A;  1MMG A;  1S7Z A;  2LD6 A;  3A11 A;  1EA8 A;  2A68 F;  3DZA A;  3NMK A;  4NC3 A;  1C02 A;  1YDI A;  3PCV A;  5CIV A;  1PD0 A;  1R5I D;  3V7O A;  3FAP B;  2R03 A;  5A6B D;  3CAX A;  3JYH A;  4KNW A;  5DS5 A;  1ZYR F;  4G0H A;  4AL1 A;  4MVM A;  4NQF A;  1Z6A A;  3QTH A;  2AVK A;  2NUT B;  3AJM A;  2WB7 A;  3I5P A;  3EFO B;  4MTG A;  4CIH A;  5L0C A;  2XSE A;  2KNH A;  1JOG A;  3ZWI A;  1SR2 A;  1NFO A;  2WVO A;  1FFT C;  3L1M A;  1YA7 O;  1TR2 A;  1G5Z A;  3ABK C;  3ECS A;  3V5Z A;  1YZA A;  2I15 A;  3HNK A;  3N24 A;  2P61 A;  1Z7Q c;  3LNR A;  4CX9 A;  1Z5Z A;  3NYM A;  2OCC C;  1E85 A;  2YL0 A;  1D0X A;  4LDQ A;  4XEK A;  3U5S A;  2UUI A;  1FAP B;  1LI7 A;  2ICW G;  4AX2 A;  3FXH A;  3T9O A;  1M2V A;  1T01 A;  2OG2 A;  3EH2 A;  4MVS A;  4N6C A;  3W2V A;  3ZTZ A;  4EBJ A;  4XEF A;  2ZXW C;  2AWC A;  3DE8 A;  2EIN C;  1M2O A;  2DB4 A;  2KJG A;  2L6F A;  2YHS A;  3ATP A;  3HTK C;  4NTB A;  4G7O F;  2XLM A;  1XWJ A;  1Z23 A;  3J06 A;  2WZG A;  3MBG A;  2GFH A;  2Q7R A;  2H7V C;  3B71 A;  3QVZ A;  2Q3T A;  3HJC A;  2IOQ A;  3DI5 A;  3NYL A;  4PFO A;  4YN0 B;  2J9W A;  5A6K A;  3T6J A;  5GPG B;  2A0U A;  4KI2 A;  3C8G A;  2ZD9 A;  4JCH A;  4RDA A;  5KYY A;  2Q00 A;  4O6M A;  2OJQ A;  5EGY A;  1E86 A;  2CW0 F;  2HMZ A;  4KNV A;  3U2L A;  1L3P A;  4WGY A;  2YEV A;  1MMN A;  2XLV A;  1NZE A;  4PJM A;  3RQG A;  2AU5 A;  1LM3 B;  3CSK A;  3EG9 A;  1T6U A;  2LK4 A;  5B1B C;  4E18 A;  5BQH A;  4XPW A;  5KYX A;  3TUL A;  1LS4 A;  3TJ6 A;  4Q7C A;  3DAG A;  2IXN A;  3Q6N A;  3RVY A;  5L0H A;  1HMD A;  2GWW A;  5JSL A;  4BJ6 A;  4XPY A;  1R4T A;  3EGD B;  2NG1 A;  4CS8 C;  1MNE A;  2YRF A;  5D92 A;  1BDJ B;  2KC3 A;  1JAF A;  2PP4 A;  4G78 A;  2LFD A;  4PR9 A;  4CDV A;  5K0I A;  3ZSU A;  1OW8 A;  5DS4 A;  1HE1 A;  1HW2 A;  4A4A A;  1UFB A;  5JUA A;  2HSB A;  4QI2 A;  2QLA A;  3GM2 A;  4N06 A;  2ETS A;  2XS1 A;  2YL7 A;  1Q0K A;  3KH2 A;  3M1C B;  2W4B A;  1NU7 D;  2XM4 A;  4L6R A;  1M56 C;  2G62 A;  5F5H A;  1T5O A;  3L8I A;  3W8I A;  5EHH A;  1VK5 A;  3H2V A;  3NYJ A;  3U8V A;  3E70 C;  3RH3 A;  2CCY A;  2KSF A;  5L0D A;  3TK0 A;  1DOW A;  2WZF A;  4DOZ A;  2C04 A;  3R2P A;  5CI9 A;  3EZH A;  4CS9 C;  1I4Y A;  2YLG A;  4MND A;  3BEH A;  4DRI B;  1PCX A;  1L7C A;  2XLE A;  3V5X A;  5COM A;  1TFO B;  3JRM O;  1YVI A;  4FAP B;  5T3T A;  1EKY A;  1RKC A;  3L34 A;  3W4Y A;  3GM3 A;  5T1D B;  4W8K A;  3Q6M A;  4J30 B;  1GS9 A;  4ZLD A;  1GQA A;  4J32 B;  2HMQ A;  2KGO A;  2DYS C;  3AG4 C;  1QVX A;  2PNO A;  3AGT A;  1TWG A;  3AOU A;  2VB6 A;  2XL8 A;  5TJ5 E;  1LKX A;  4E17 A;  3C63 A;  3PHF 2;  2CDQ A;  2P6V A;  3TQO A;  1YAR O;  3B29 A;  3S29 A;  3WG7 C;  2EPO A;  1JR8 A;  3LEO A;  3FMS A;  1OCC C;  3WHN A;  2R7R A;  1MMA A;  2HV6 A;  4LER A;  1U6H A;  1YLM A;  1TWC A;  3UMK A;  2HSQ A;  4AL0 A;  2MWQ A;  2EIL C;  4AE4 A;  2M4E A;  2GAQ A;  3LLI A;  3US6 A;  3LEV A;  3LLK A;  1RJ9 A;  1RCP A;  3MYF A;  4WJ0 A;  1A7D A;  3VF0 A;  1EI7 A;  5L0F A;  4Z9I A;  1TKN A;  1W2W A;  2Q9B A;  3EPV A;  4JEA A;  4JUR I;  3O39 A;  4U5F E;  2YKZ A;  2A69 F;  3C8G B;  3IQ5 A;  4D4X A;  4EKW A;  5KYY B;  3WOD F;  3UGO A;  4JJF A;  2J7P A;  3HLZ A;  3NDB B;  1J8M F;  2NSG A;  4IRU A;  3ZQV A;  1Z3I X;  2Y3G A;  2G3K A;  1KNY A;  3S90 A;  2EPL X;  2WL8 A;  4MVR A;  1F1M A;  4CS8 A;  3K33 A;  4NTA A;  4OIO F;  4C7O A;  1HY5 A;  3SXM A;  2QE9 A;  256B A;  3AGU A;  3DMD A;  5FCL A;  3EG9 B;  2R9R B;  5KYX B;  3GOR A;  2PX0 A;  3UNG C;  4BJ5 C;  4EIY A;  1Y4C A;  3L0I A;  4U5C E;  2EIJ C;  2LCH A;  2L7A A;  1YYJ A;  3W8H A;  2R05 A;  3FOO A;  1OCR C;  3C7J A;  4NY3 A;  3MX3 A;  2HFI A;  3C62 A;  3G4X A;  4O6N A;  2OJE D;  5COF A;  2XRH A;  2QNL A;  1ORY A;  3S0X A;  4IAO A;  1RKE B;  4J7T A;  2V3C C;  4NTF A;  3H2U A;  2KK1 A;  5F5F A;  2EPN A;  3FVY A;  3PDM P;  1NU9 C;  1ZHX A;  2NPU A;  2LP4 A;  1D1A A;  3LJB A;  3U8P A;  4CS9 A;  4WGZ A;  4DJ9 A;  1CGM E;  1IW7 F;  1CPQ A;  4OIR F;  3V5Y A;  3ZC4 A;  3ZTM A;  1LS1 A;  3ABL C;  3QW0 A;  2A1D D;  3B9Q A;  5KYU A;  5AC5 A;  2J45 A;  3L8J A;  3EH1 A;  5DS6 A;  1XZQ A;  1O5H A;  1SYQ A;  4ONS A;  1G4W R;  4IAR A;  3FHD A;  2IBF A;  5COG A;  2YLI A;  3AQC A;  4CDA A;  3OWT A;  4CJO A;  4P9F A;  3KPH A;  4BEM J;  4Q4Z F;  5BQG A;  1AUE A;  2YL1 A;  3LS0 A;  3EHM A;  4H54 A;  5DVW A;  1LVK A;  5A6J A;  3NG1 A;  1LE4 A;  1PD1 A;  2IM8 A;  2H8A A;  2HJM A;  2R7W A;  1V55 C;  4O6Y A;  1BZ4 A;  3TOM A;  2L81 A;  3VM6 A;  4BJ1 A;  4PJN A;  3ZG1 A;  1I4Z A;  2R7S A;  2RD9 A;  3IPM O;  3OA1 A;  5KYW A;  1K04 A;  3SXY A;  1OR3 A;  1NFN A;  3F46 A;  4MTO A;  1M6T A;  2VAS A;  2Y3B A;  2YLD A;  3EQL F;  3JYY A;  4IGG A;  4F4B A;  3FOP A;  5L3Q A;  4XEV A;  3DXJ F;  5A6A A;  1ZHY A;  2YVK A;  4BJT A;  1FMW A;  4E7Z A;  4AE4 B;  3SXK A;  1ZVZ A;  1RJ9 B;  2HS5 A;  4EHP A;  1OQC A;  4IJJ A;  4JJG A;  1YZC A;  4KBL A;  3QZC A;  3C8G D;  2HZ8 A;  3GM1 A;  4YL1 A;  4CSA A;  2KQ9 A;  1OXK A;  2OEX A;  1U89 A;  3QW1 A;  4U5H A;  3DE9 A;  4BJ5 A;  4JC7 A;  1ZU5 A;  5B1A C;  2Y69 C;  5JVE A;  1JRA A;  1QQ3 A;  1YJG A;  3IQT A;  4Z9H A;  3EJN A;  3GEH A;  3S28 A;  4CDY A;  1GM5 A;  4ZLC A;  4C7O B;  4I3M A;  4MVQ A;  4ULV A;  2IXO A;  1BR1 A;  2W9Y A;  3JRT A;  4O7G A;  2PX3 A;  1WTY A;  1AEP A;  1RKE A;  1CPR A;  2P7V A;  3CQZ A;  4U9E A;  3POV A;  3S9O A;  4FWV A;  3M79 A;  4XTK A;  5L0G A;  2B0J A;  4JEB A;  2BC5 A;  4JZA A;  2OKU A;  4R32 A;  2Q4F A;  3T4R A;  3DD7 A;  1VLS A;  4M63 A;  3NMJ A;  1KU2 A;  4K1O A;  3X1O A;  1SMY F;  2M64 A;  3BRJ A;  5DQZ A;  4EUK B;  1T6Q A;  5KYW B;  4U5G A;  4JRZ A;  5F28 E;  2H7B A;  1LI5 A;  2HUJ A;  2Q9A A;  4JTC B;  4OIQ F;  5JRA A;  5BQI A;  1QLE C;  1WN0 A;  2ASR A;  2XLO A;  2W4M A;  2ZXP A;  3DKA A;  3MYI A;  5JP7 A;  4Z9J A;  3HNJ A;  4BEJ A;  4NCQ A;  3NKD A;  3IHU A;  3NMI A;  1SZI A;  3SZR A;  2LQG A;  1A0B A;  2C03 A;  4LDR A;  1B68 A;  1MMD A;  2AP3 A;  4JKV A;  5E33 A;  2Y39 A;  3RFY A;  4XLP F;  4DRH B;  3K66 A;  3GWL A;  5KYU B;  3ITF A;  4HEA J;  2BE5 F;  2DYR C;  2L9J A;  2O9X A;  4U5E E;  2XLH A;  1QKR A;  1S05 A;  3JZ0 A;  4H4K C;  5AC4 A;  2QUP A;  5E3C A;  3MFN A;  2R7V A;  1YYX A;  2ZXR A;  1JPN A;  4J7Y A;  4ANJ A;  2YZS A;  1G4U S;  1IZM A;  1E83 A;  2H7O A;  2CNW A;  3VAY A;  3SEO A;  2MYS A;  1Q0D A;  1QPU A;  1C17 M;  1VYI A;  2D5R B;  1CGO A;  2DGJ A;  4Q5S F;  3GOD A;  3O55 A;  3G4Z A;  1V74 B;  4EWC A;  2R7U A;  3GWN A;  1OKK A;  1FFH A;  3DWW A;  3UMI A;  3I5Q A;  1O3U A;  4MTF A;  2XLW A;  4GQH A;  1I5N A;  1JPJ A;  2W45 A;  3DAF A;  2BL2 A;  3HNL A;  3KYI A;  3U9J A;  4BG0 A;  4I44 A;  4PK4 A;  1Q0G A;  1ZU4 A;  4HE8 D;  3QVY A;  1V54 C;  2AWY A;  4K0D A;  4JW1 A;  4YL0 A;  5AGF A;  2FAP B;  4MS2 A;  1RXQ A;  3DJN B;  4I1O B;  2R7X A;  2LSE A;  4E0I A;  2JX0 A;  4ER9 A;  1O87 A;  1OKK D;  3QMK A;  5D91 A;  3KKB A;  2YQY A;  3H65 A;  4YK5 A;  4W8P A;  4XLN F;  3K1I C;  3T6G B;  1VMA A;  3LUT B;  2TMV P;  5JLI A;  1BR2 A;  2IXP A;  4JTD B;  4XQ1 A;  3JSZ A;  2J7P D;  1K40 A;  3X2Q C;  2OEV A;  4DBQ A;  2YL3 A;  2Y3D A;  4HFK B;  5E2Q A;  4AK9 A;  5L0J A;  3W2W A;  4FX5 A;  5A69 A;  2OQM A;  1H9T A;  1GGQ A;  3U3F A;  4EBB A;  1LIH A;  4MQ9 F;  1Q0M A;  2VCC A;  3IEE A;  1XZP A;  1H9G A;  3DJU B;  2IXM A;  3A9C A;  4N4W A;  3LS1 A;  3U2M A;  2NSF A;  4MW8 A;  1A7V A;  4IAQ A;  5A6B A;  3C8Z A;  2F22 A;  2NUP B;  2R7T A;  2HV7 A;  4C3E A;  1VOM A;  3JSE O;  3CZ6 A;  1H6G A;  4MVU A;  1LPE A;  4K7B A;  1QZX A;  2XM0 A;  3ZQY A;  3SNH A;  1LE2 A;  4LDK A;  1MND A;  3B0V C;  1HE9 A;  3K6B A;  1VB5 A;  4IWB A;  3GEI A;  4O79 A;  1OCO C;  4HFF B;  1APC A;  1NG1 A;  2L6H A;  5DQT A;  2P0N A;  4PJL A;  4BPM A;  4XWJ A;  3DM5 A;  3TJ5 A;  3S84 A;  2WVQ A;  3G50 A;  2L6G A;  3FDQ A;  1FR0 A;  2FFH A;  1TQG A;  4LLC A;  1TWA A;  4QDL A;  4JVS A;  1K05 A;  4N6H A;  3K1H A;  1D1C A;  3RQE A;  3ABM C;  2HJ3 A;  4CBE A;  1WAS A; 
#chains in the Genus database with same CATH homology
 4JEB A;  3C63 A;  2BC5 A;  1E84 A;  1NBB A;  3NMK A;  3NMJ A;  4CJG A;  4NC3 A;  5JRA A;  1BBH A;  2XLO A;  1RCP A;  5B3I A;  5JP7 A;  3HNJ A;  4JEA A;  3NMI A;  2YKZ A;  3IQ5 A;  4D4X A;  4JKV A;  3ZWI A;  3ZQV A;  3L1M A;  2XLH A;  1S05 A;  1YZA A;  3HNK A;  256B A;  1YYX A;  4CX9 A;  1E85 A;  2J8W A;  2YL0 A;  4EIY A;  1E83 A;  5JT4 A;  3M4B A;  1QPU A;  1YYJ A;  1CGO A;  3FOO A;  3ZTZ A;  3C62 A;  3DE8 A;  2J9B A;  4IB4 A;  2XLM A;  2XLW A;  3HNL A;  3QVZ A;  3U8P A;  4WGZ A;  3QVY A;  4JE9 A;  5AGF A;  1CPQ A;  3ZTM A;  4CIP A;  4ER9 A;  3QW0 A;  4U9D A;  1E86 A;  3M15 A;  3VRC A;  3TOL A;  4WGY A;  5JLI A;  2XLV A;  1MQV A;  4IAR A;  1LM3 B;  4CDA A;  2YLI A;  2XLD A;  4CJO A;  2YL3 A;  4D4N A;  2YL1 A;  5JSL A;  4CDV A;  1JAF A;  3TOM A;  4N4W A;  5JUA A;  1A7V A;  4IAQ A;  2QLA A;  1M6T A;  2YLD A;  2YL7 A;  3FOP A;  3M4C A;  1CGN A;  2XM4 A;  4L6R A;  5JS5 A;  2XM0 A;  2XL6 A;  2CCY A;  3ZQY A;  1YZC A;  2YLG A;  3HNI A;  3QW1 A;  3DE9 A;  1APC A;  2XLE A;  5JVE A;  1QQ3 A;  1EKY A;  4CDY A;  4ULV A;  3IQ6 A;  1GQA A;  1CPR A;  4U9E A;  4N6H A;  3M79 A;  2XL8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...