1Y4CA

Designed helical protein fusion mbp
Total Genus 166
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
166
sequence length
490
structure length
480
Chain Sequence
b'EGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDEALKDAQTNSSSLGIEGRSSEELLKIALQEAQKTLQQAQELAKKGGGEEQLKRALKRADRNLWAAQELAKKGGGGEELLKQALQQAQQLLRQAQELAKKGGGEELLKQALQQAQQLLQQAQELAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Maltose binding protein fused with designed helical protein
publication title De novo design of an IL-4 antagonist and its structure at 1.9 A.
pubmed doi rcsb
source organism Escherichia coli
molecule tags De novo protein
total genus 166
structure length 480
sequence length 490
ec nomenclature
pdb deposition date 2004-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.660 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) IL-4 antagonist (De novo design) like domain 1y4cA03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1y4cA02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1y4cA01
1P1WA 2GHBA 3TMGA 3N94A 3K1PA 4KYDA 2HZKA 2YJPA 3RNNA 4XKPA 5F7VA 1ATGA 1A54A 1FTKA 5AA4B 4H5GA 2W7YA 3JV9A 1HSEA 1IIWA 1II5A 2Z23A 5KDTA 4OERA 1OIBA 2XXHA 5CBSA 3DM0A 4OYVA 1FQCA 2O69A 1FTOA 3KZGA 1MM7A 3TTMA 5IKBA 4IY6A 3Q25A 1MXVA 1QKAA 3UA8A 5TPAB 1SQYA 5HPQA 3SEUA 2XX8A 2H9BA 1US4A 1B3GA 2Y84A 2UXAA 4F3BA 3D4GA 2P0SA 1JW5A 4KI0E 3T9UA 4BDQA 1N84A 1URDA 4R72A 3EHSA 5DVIA 1H44A 3TCFA 4ELRA 5H8NA 3UN6A 2G29A 3B6WA 5HBCA 5DVFA 1MXXA 5AA2A 2O1MA 3VLWA 3V5AA 5ICTA 4ZEBA 1B51A 1B4HA 3TCHA 3T96B 3ECRA 1B3LA 3MVZA 1XVXA 4ZZEA 3TTKA 1S9TA 4NWCA 4WEDA 3UORA 1Y4CA 2VOZA 3CI8A 4IO2A 3U1OA 1GR2A 1D9VA 3C4MA 1EZOA 3QK6A 2F8DA 3O6GA 4H6DA 3B6TA 5I2KB 4LONB 3ZKLA 1P99A 4F18A 4NMYA 4LUBA 1KWHA 3H03A 1XT8A 1ANFA 3KSJA 4LA9A 4R6HA 3KBRA 5DEXB 4Z0IA 1IXCA 2LAOA 4FJPA 4G68B 3HCQA 3FVOA 1ZLQA 1Y4TA 4YKKA 5DTBA 3O2AA 4TOZA 2ONKE 1SW2A 2XXWA 4RPOA 4H1XA 3E3KA 1B0HA 4ZEKA 2QS1A 2Z22A 4NEDA 4ND9A 3E13X 4MF3A 2ZMBA 2WKYA 2Y7IA 1MDP1 1URSA 3H3GA 4GIZA 2NWJA 1P1UA 1N3XA 4ZEDA 4YMAA 3TUSA 1MDQA 3VLVA 5I56A 4N6PA 4EQ9A 4JWXA 3SETA 4F1VA 2NVUB 3M8UA 5FHNA 1DPPA 4YICA 1Y3NA 5CMBA 1P1QA 3EHUA 3SEYA 4EF2A 4PQJA 4KR5A 2UVIA 3FASA 1J1NA 5I59A 3FJ7A 1LCFA 3LR1A 5H8HB 5AE4A 1IXHA 4O3BA 4ESXA 3DLNA 1QUKA 3P7IA 2ZNUA 1LFHA 1FQAA 3U93A 4NE4A 4DXBA 4R9FA 1USYH 2DS9A 4IO4A 4NF6B 3H6WA 4F39A 1JVYA 4BLAA 1B5IA 1IITA 3EF7A 1BIYA 4YKJA 3N6UA 3BFUA 3QIMA 3H7MA 3BBRA 1CB6A 3MWBA 1GV8A 1B5JA 3KG2A 3MVWA 1A99A 1FW0A 4MLVA 1Y20A 2DE4A 5CMKA 3TQLA 2RCAA 4YB5A 1SYIA 4GL8A 1N0TA 4C1UA 4KPTA 3E4RA 4BDOA 2AL5A 1XC1A 4DXCA 4U4SA 3OO7A 1L5TA 3T9XB 1JNFA 3QSLA 1DTZA 4JBZA 4G8NA 4O3AA 1RKMA 4HCYA 3MZBA 4HTGA 1PEBA 3CRBA 3EN3A 4E0XA 3H4ZA 1FTLA 3B7DA 2AIXA 4ZEIA 2D21A 1QW0A 1DPEA 4U21A 3N6TA 2V25A 2DXYA 3CG3A 1PDAA 2RKMA 5I58A 1M5DA 4OFLA 4G4PA 4FORA 3AXFA 1B46A 3GZGA 1NMUA 3PPPA 3QAXA 2OBGA 5CC2A 4KCCA 5K2XA 3O6IA 1OQHA 3TQWA 3IB0A 1FTJA 2F5XA 2D5WA 1UTBA 4X48A 1GTKA 5FHOA 5FTHA 4JDFA 1UTHB 1MY2A 2RF1A 3BKIB 2DOJA 2HZ8A 4LP2B 5HM4B 1XVYA 1VR5A 2I3WA 4THIA 1Y1MA 3IX1A 2XD3A 2Z8DA 4IGTA 4AQ4A 1N7XA 2ZYNA 1XOCA 3TEPA 5KCJB 4ISUA 2PBWA 1EU8A 1T0KA 1N04A 5I84A 3TFLA 4N13A 4HS7A 2XXUA 4DZ1A 4IO5A 3FGSA 4LQ2A 1N76A 2GFEA 3VVDA 3FATA 2NOOA 1Y9UA 5JK4A 2ZYKA 1MQIA 3G3KA 1MQGA 5TP9A 3N26A 1I6QA 3HHFA 3Q28A 1LFIA 1JVXA 3TTLA 2O1LA 1PB9A 4DLDA 2H4IA 2QS2A 3MBPA 3C35A 1D9YA 4OMBA 3U94A 3FXUA 3EHTA 1B2HA 3DP4A 4DIGA 1F9BA 3TCGA 3C34A 3MPLA 2I49A 2F97A 3ILUB 3PU5A 2XHDA 5FTIA 2PX1A 4U22A 3K6VA 2O7UA 3PUWE 4PP0A 5CMCA 1AOVA 1VE4A 2VP1A 1MQDA 1QVSA 4DE8A 3KN7A 3O29A 2M8CA 3CSGA 2ALUA 1TWYA 5A5XB 1QKBA 2KLFA 3G3IA 2G93A 5H8FB 1XHYA 2OLBA 4PETA 3H6VA 2HXWA 1LAFE 1B52A 3IO6A 4RJZA 1PBQA 4NF4B 3SEWA 3TTRA 3F11A 2O68A 1MY4A 1R9QA 3VVFA 4XKRA 1MXUA 3RTWB 1XS5A 2D3IA 4IO7A 1IQ7A 1WVJA 2HAUA 5EHMA 4M4GA 3OEMA 1EZ9A 2HEUA 2Y7WA 3K1NA 2GRVA 2V3TA 5JTYA 4ZEFA 1MH3A 2XXIA 4OEUA 1LGBC 3K0VA 4UACA 5L8DA 3OEKA 1LCTA 4PE5B 3FVNA 3T9HB 1FQFA 1B0LA 3KGCA 3OSRA 4I62A 1JW1A 4F1YA 2THIA 3PPQA 4I1DA 1UIVA 3VFJA 2BJJX 2QL3A 1SDXA 2UVJA 3KFMA 2DWAA 2VD3A 1SI1A 4XKQA 2ZXTA 3SEXA 3W9VA 2A5SA 1BTJA 2DWJA 1PB7A 4GQOA 5FHMA 1YTVA 3LSLA 4MH5A 1QUJA 3UK4A 1MS7A 5M2VA 4BDNA 1SBPA 5H8QA 2DVCA 3ODBA 4M1VA 3UIFA 3S9MC 1R6ZA 1FQBA 1YAEA 1MY0A 4U4XA 1LB9A 4GRKA 2DQVA 3MQ9A 2QMXA 1I6AA 3S9NC 1N3WA 4GL0A 5KDTB 2QS3A 2F6PA 3GLBA 3FUZA 3U8QA 3CFXA 4Q0CA 5J1DA 1NNFA 1USYE 4YMBA 4KYSA 2PMSA 3K6WA 1LBBA 2GH9A 2HFBA 2X26A 3R26A 2P1SA 3KN8A 3FD3A 1B7UA 2QMWA 4JXIA 5B7DA 2PYYA 1QULA 1WDNA 4OXVA 3IOWA 3IB2A 1ZU0A 3PUZE 3CIJA 5H8NB 1MM6A 3U72A 4QFNA 2LFFA 4H65A 5AA2B 2R6GE 1B05A 3C36A 1MPCA 2F6GA 2A5TA 2H99A 3VDFA 4C1TA 2I0CA 2F36A 1AMFA 4Q30B 3MAMA 4X1BA 4JWYA 2RCBA 5CI5A 4YZZA 2XXRA 4XXUA 4RXLA 2HAVA 2XXYA 4Q8RA 3MZ1A 3K4UA 3RY3A 3H6UA 4KD5A 4R6YA 4EXKA 2V3QA 1URGA 4Z7EA 4G2ZA 3E9XA 4ECFA 3G3GA 2Y7PA 1M5EA 1TFDA 2OJTA 1NKXA 3PMWA 1OVBA 4NTLA 1A8EA 5I2NA 4OETA 3CSBA 4NF5A 4KQPA 5I57B 1JEUA 4IO3A 1MXYA 1QUIA 2Q9TA 1NNTA 4F1UA 3RPWA 3HSTA 3KOSA 3M3FA 2R71A 4MBPA 4TLLB 3PUVE 2FNCA 4WEPA 5BWJA 1UTHA 3FXQA 2PVUA 2Z8FA 4YKIA 3DELB 2HQ0A 4FEDA 2VHAA 2XXVA 1NNPA 1VSOA 3JZJA 2V93A 1B7ZA 3A3UA 1JEVA 5DT6A 5AA2D 2ZNSA 3K1MA 3U8VA 3K6UA 5F1QA 1B1HA 3EQ1A 3I6VA 1NH7A 3S2VA 1A55A 3MC2A 3L6GA 4R9GA 1VFDA 3O97A 4FEBA 4KHZE 1HSJA 1AIVA 1O64A 2F34A 2ONRA 5I56B 4H67A 3G3FA 2UVHA 1P1OA 1YCJA 4H5FA 1Z7NE 3HHGA 1HSLA 4IGRA 1TFAA 5K2YA 3LC8A 3RT6B 2I58A 3FZVA 5ELVA 1RYXA 4ELQA 3KJ7A 3ILTB 3RUMA 4FECA 3G3JA 3PUXE 4F2QA 3FVGA 3C31A 3V8XB 3OXNA 3PV0E 2E0SA 4NF8A 1LSTA 5I59B 4O3CA 1IEJA 3MUQA 2B3FA 1B32A 3U92A 5L9OA 1MH4A 1MY1A 1LAXA 1OMPA 1CE2A 3FJGA 4RK9A 4BDLA 3VXBA 3IK6B 1O63A 1A8FA 4ZECA 2CZLA 4F2OA 3G7WA 3R7XA 4OHNA 3I5OA 1MQHA 2R9JA 4QF9A 1TT1A 2ZNTA 1S7YA 4IY5A 3UP9A 4TQUQ 4HCWA 3K01A 4ESWA 3MP8A 1P1NA 3TZAA 2XXXA 4GXAA 4R6KA 3M3LA 2Q8JA 1A40A 4IO6A 1B58A 4H8JA 2XX7A 2QRYA 4F29A 1ZBMA 2H5YA 3KN3A 4E0WA 5AA4A 3FV1A 2ESNA 4KYEA 4FE8A 3VV5A 4C0RA 4POXA 1A7LA 3VLUA 3Q27A 3MJNA 2Q89A 1DSNA 1SW5A 1AL3A 1LBCA 4N07A 5I58B 2H98A 4IB2A 2I6EA 1R9LA 3KJTA 1LAHE 5TPAA 3SESA 2LFDA 4OFJA 1B5HA 1YPNA 4KCDA 4RA1A 1H3DA 4RYAA 4F3SA 2DP8A 2HCAA 4JWOA 5TU0A 1ZTYA 3Q26A 3CR9A 4R74A 5BUUA 5ICQA 4JB7A 2OCUA 2VGQA 2PT1A 4RPNA 4KFQA 3OELA 2Z8EA 4GXSB 3CG1A 2AL4A 3OO8A 2RC9A 3TDJA 4H0WA 3T9VA 4DCYA 3SDFA 5EHSA 3TELA 3IOVA 3O28A 3HO7A 3OSQA 2ZYOA 4QSCA 5B70A 5JEIA 3GBAA 5CBRA 1IXIA 5DYHA 4MFIA 4G8HA 1GGGA 1OLCA 3CFLA 3TYHA 2F7AA 4JSDA 3RLFE 4ELOA 1Y1ZA 1SW4A 3S9EA 1UQWA 2OWSA 3IR1A 2O84X 1B1XA 1IZ1A 1RYOA 5I2KA 2OZZA 4BDRA 4WXJA 4QFPA 3B6QA 5TP9B 1OQGA 2DYXA 3OO9A 3L6HA 3FVKA 3LSFB 2Q88A 2O6AA 2Y7RA 2DE2A 5DEXA 2H25A 2Q2CA 1GVCA 2UYEA 3CFZA 2DXRA 4U1OA 2DWHA 1POTA 4YKPA 4G68A 2GHAA 2X7QA 3IOTA 4GFRA 1ZIUA 4FAJA 3O66A 1TXFA 3MVYA 4EQBA 1OLAA 4ZS9A 1H45A 2RC7A 2V3UA 5H8SA 3SERA 5L9SA 3G3HA 4H8IA 1FQDA 2ANJA 4Q5TA 3RTFB 3PPOA 2DVZA 3M3KA 1Y3QA 3IO4A 4F19A 1D4NA 1B3HA 2B3BA 4LZ7A 4LVQA 4DDDA 3JYRA 4EDPA 3K6XA 4NWDA 5L9MA 4G68C 3W15C 4P0IA 4ZE9A 5AA3A 3PPRA 3MP1A 1LLSA 3QUJA 4L17A 3IORA 3TPAA 4QFLA 1ZMGA 4ZE8A 2HZLA 2UYFA 3D4CA 2Y7KA 4EUOA 3IAZA 4I9DA 2F78A 4AB6A 1DOTA 2NUVA 4XTCQ 3T66A 1MQJA 5JTYB 4R2BA 4OQOA 5H8HA 2F7BA 2REJA 2F7CA 5ITPA 5AA1A 3FV2A 1DTGA 4F3GA 3S9LC 1PC3A 4K3FA 5CRYA 1ZJLA 5CM6A 5I57A 4F31B 3R6UA 3OOAA 1EH3A 1POY1 3H06B 3FXRA 3IJOB 3ZKKA 1MRPA 4NF6A 1NL5A 1O7TA 2I48A 1OVTA 1IUDA 4GF8A 1PBPA 2NXOA 2QPQA 1Q35A 4U2RA 1FTMA 4XKNA 1MPDA 2UVGA 2P2AA 2OK2A 3LSXA 4QSDA 5H8QB 3W9WA 3ZSFA 5EYFA 4YB6A 4QRZA 1H43A 4R75A 1M5CA 1JETA 1SI0A 1SD3A 4POWA 4QSEA 2VD2A 2OWTA 3VE1B 3KOTA 3PGFA 3RQTA 3IJXB 4QFKA 4OESA 1B3EA 4F3PA 4EF1A 1JW4A 3O6HA 2ONSA 1SW1A 4P11A 4QFOA 2DSFA 2QS4A 1PB8A 2I4BA 3SEVA 1M5BA 4X9TA 4OEVA 2I3VA 1MXWA 3WAFA 3USDA 1I6BA 3VXCA 5DVJA 4OENA 2FA7A 3ONMA 1VFEA 1MPBA 1MG1A 1ELJA 2O51A 4EQ7A 3UGWA 4FATA 1NFTA 4I8CA 1ZKBA 2XXTA 3QUFA 4R2FA 3FIRA 3SKPA 4ZZAA 2REGA 2XXPA 4YU0A 3HN0A 1MXZA 4OFOA 4TLMB 4OZ9A 5KCJA 1LB8A 2A5TB 3T22A 3IB1A 3THIA 2QJEA 1DMBA 3I3VA 4GWOA 3WAEA 3HPIA 2PT2A 3LSWA 3PUYE 3PD8A 1US5A 1BP5A 3PMVA 1N7WA 4OWDA 5IAIA 3A3CA 4RNSA 4BDMA 3ZS6A 2CMOA 4PFTA 2ZYMA 3OMBA 3CVGA 4ONYA 4LATA 1Y3PA 2B65A 1I69A 3OD7A 3IOUA 1B40A 1MY3A 4HW8A 1FCKA 3LUYA 3K02A 1M5FA 2YPNA 1IXGA 2AYSA 1Q1KA 5I2NB 2RC8A 3N5LA 4NF5B 1BLFA 1B3FA 3O9PA 3MP6A 3MPKA 2YLNA 4UA8A 3KSXA 1UIUA 1H76A 3MVXA 3DP6A 3PPNA 4U1ZA 2O7IA 5LOMA 3VVEA 3A09A 3RN8A 4PFUA 2RINA 2E1SA 3V89B 4ZDMA 3GBBA 1WODA 3LBSA 5KZTA 3OENA 1D3KA 3OO6A 3H6TA 1SYHA 2DE3A 3BFTA 4RY1A 4XIGQ 4RK2A 4MLQA 1EZPA 3EPEA 1QJMA 2I0BA 4PFYA 4OVJA 3TTNA 1AH5A 4JSOA 5A5XA 1FQEA 3HV1A 3FJMA 4G77A 5H8FA 4R73A 4YAHX 3QXMA 3TAJA 2DWIA 4AB5A 1JQFA 4QHQA 1NNKA 1LFGA 1SVXB 3QYTA 3T93B 4U23A 3MZ9A 3K2DA 4NF4A 4WKMA 2ABHA 1NH8A 5CMMA 3PMXA 3TODA 1Z7ME 1B6HA 5ISUA 2V84A 4OTEA 2F35A 4G8MA 4NF8B 4PFWA 4X1DA 5ITOA 4F22A 4DXUA 3MW0A 3C33A 4LZ5A 3DP8A 2QSXA 2FYIA 1B4ZA 4LQ5A 4P0GA 4GLIA 3S4UA 2I4CA 3TKDA 3V83A 1UTBB 3RGYA 4EXLA 1B9JA 3GXAA 4LZ8A 4DCXA 2Q2AA 4FIMA 4YB7A 1S50A 2XD2A 1B7HA 2X7PA 3KEIA 2XX9A 1R1NA 4GD5A 3RT8A 4ELPA 4GVOA 3PD9A 3Q29A 2IEEA 1LAGE 4GOTA 2XXQA 1BKAA 3C9HA 3C32A 2IA4A 3IL1B 3K00A
chains in the Genus database with same CATH superfamily
1P1WA 2GHBA 3TMGA 2HKVA 2CEXA 3N94A 3T6BA 3K1PA 3TJ5A 4KYDA 2HZKA 2YJPA 3LUZA 4GWXA 1QKRA 3RNNA 3I5PA 3SXYA 3QVYA 5EQ7A 1CNQA 1IW7F 4XKPA 5F7VA 1MNDA 1ATGA 1A54A 1FTKA 2ZZWA 5AA4B 2OG2A 4XLNF 1NSGB 4H5GA 2W7YA 1TWCA 2LCHA 3FOOA 1HSEA 3JV9A 1Z3IX 1IIWA 1II5A 3IFCA 2Z23A 5KDTA 4OERA 1OIBA 1JMWA 4K7BA 4PJNA 2XXHA 5CBSA 3DM0A 4K1OA 4AE4A 2MYSA 4OYVA 2QE9A 1FQCA 2O69A 2PP4A 1FTOA 2L5VA 3KZGA 1HMOA 1MM7A 2YLDA 1FFTC 2ZXRA 3TTMA 2ASRA 5IKBA 4IY6A 2XLOA 3Q25A 3T6JA 1MXVA 3RQFA 1LS1A 3SZRA 2TMVP 1FR0A 1QKAA 3UA8A 5TPAB 1SQYA 5HPQA 3SEUA 1DCUA 3GM1A 5IZ1A 1R5ID 1XZQA 3LESA 2XX8A 2H9BA 1US4A 1B3GA 3AJMA 2BC5A 2Y84A 1V55C 1FPIA 2VH3A 3IHUA 2UXAA 4F3BA 1D1CA 3D4GA 4DXWA 3NOHA 3MYFA 2P0SA 1JW5A 4KI0E 3T9UA 4NQ8A 4BDQA 1N84A 1URDA 4R72A 1S7ZA 4EWCA 4MW8A 3QW0A 3EHSA 3LJBA 3LLIA 5DVIA 2PFYA 1H44A 2HPGA 5LDZA 2IXOA 3TCFA 5H8NA 1MMDA 1ZHYA 4ELRA 1D1BA 3UN6A 1GGQA 2G29A 3B6WA 5HBCA 4QXDA 1YAUO 5DVFA 1BR2A 1YLMA 1MXXA 5COMA 5AA2A 3ZQVA 1H9TA 2O1MA 3ROJA 3VLWA 2WBDA 4IAOA 3V5AA 5IZZA 2JJKA 4DI4B 5ICTA 4ZEBA 2R9RB 1B51A 1B4HA 3TCHA 1NFOA 3T96B 3ECRA 1B3LA 2LK4A 3MVZA 1XVXA 4ZZEA 3TTKA 3B0UX 1S9TA 5KYUA 4NWCA 2KJGA 4WEDA 4E7SA 1G4US 4C3DA 4GWUA 3UORA 4NTAA 2GA0A 3WAQA 1YDIA 1Y4CA 4OVPA 2FIEA 4RDAA 2VOZA 3CI8A 2GAQA 4IO2A 3U1OA 4K0DA 1GR2A 1D9VA 3C4MA 2LQGA 3EH2A 1EZOA 4JTCB 1E2XA 3QK6A 2F8DA 3SEOA 3U2MA 2KGOA 2R8TA 3O6GA 4H6DA 1GM5A 2J9VA 4IARA 3B6TA 5I2KB 1TWGA 2HMQA 3R2PA 4LONB 3ZKLA 1P99A 4F18A 4NMYA 4DRHB 2R7XA 4LUBA 1EYIA 1KWHA 3O6XA 4PJMA 4IR8A 4OVTA 3H03A 4JE9A 2WZFA 1XT8A 1ANFA 3KSJA 2WZLA 1M2VB 2EIKC 4LA9A 4R6HA 2KQZA 3KBRA 1LM3B 5DEXB 4Z0IA 4KXPA 1IXCA 2AU5A 2LAOA 4FJPA 2VT5A 3O10A 5DQZA 3S27A 4ER9A 4G68B 3HCQA 1ZHZA 3FVOA 1ZLQA 5COFA 1Y4TA 1OR2A 4JTAB 4YKKA 5DTBA 2WVOA 3O2AA 2Y69C 4TOZA 3FAJA 2ONKE 1SW2A 2XXWA 2J9WA 4RPOA 4XEQA 4CS9C 4CSAA 4H1XA 3E3KA 1B0HA 3ZIBA 4AX2A 2Q74A 1EYKA 4AS4A 4ZEKA 3EFOA 2QS1A 2CNWA 2YL3A 4W8KA 2QVUA 2ZXPA 2XLEA 1KA0A 3MYUA 5KYYA 4GX4A 4OA4A 1LVKA 2Z22A 4NEDA 4ND9A 3E13X 4MF3A 1I4YA 1V4AA 2R7SA 2OEXA 2ZMBA 1RJ9B 2WKYA 4U5DE 2Y7IA 1MDP1 4GWSA 1URSA 3M4CA 2QLAA 1TFOB 3H3GA 2LD6A 3TQOA 4GIZA 2NWJA 1P1UA 5ET5A 1C02A 2VPOA 1N3XA 5L3VA 5EYHA 4ZEDA 4YMAA 3TUSA 1MDQA 1TQGA 3VLVA 5I56A 2XXAB 4PTKA 4N6PA 1YZCA 4EQ9A 4JWXA 3SETA 4F1VA 2VASA 3F46A 4MNPA 1EKYA 2NVUB 3M8UA 4HFFB 5FHNA 3ABLC 1DPPA 4CDVA 4YICA 1Y3NA 3S29A 5CMBA 1P1QA 3EHUA 3SEYA 5L0HA 4EF2A 5GPGB 4PQJA 4KR5A 2UVIA 4BG0A 2ZZVA 3FDQA 1J1NA 3FASA 4O8MA 1Z7Qc 5I59A 3FJ7A 1LCFA 4JJFA 3LR1A 1FTSA 5H8HB 5AE4A 1IXHA 4BEJA 3UMIA 1ZHWA 4O3BA 2KQ9A 5L0GA 3GYYA 4ESXA 3DLNA 1QUKA 3A11A 1IMEA 4MVMA 3P7IA 2ZNUA 3QW1A 1LFHA 1FQAA 1VLTA 1LEVA 4O6NA 4N17A 3UGOA 3A29A 2EPNA 1Q9DA 3U93A 4NE4A 2AWCA 4DXBA 4R9FA 2B0JA 1USYH 2DS9A 1QSPA 1G4WR 3S0XA 4IO4A 4NF6B 2CW0F 3H6WA 1TWHA 2QY9A 2XLDA 3EG9B 3B50A 4F39A 1TR2A 4I3YA 4OD5A 1JVYA 1T9KA 4BLAA 1LKXA 1B5IA 4PAKA 1HW1A 1IITA 4PFPA 3EF7A 1BIYA 1KZ8A 5T1DB 2R7UA 1DK4A 4YKJA 5A69A 1JR8A 3N6UA 1PD0A 3BFUA 4IWBA 3QIMA 3AOUA 5JS5A 4N4UA 3NMJA 3H7MA 3BBRA 4CIHA 2OU6A 4PCDA 1CB6A 4JIOA 4N8YA 3MWBA 1GV8A 1B5JA 4LDQA 3KG2A 4MMPA 3MVWA 4JVSA 1A99A 3VF0A 1FW0A 4O94A 4MLVA 1Y20A 2DE4A 1JP4A 1T01A 5CMKA 3TQLA 2RCAA 4YB5A 1SYIA 4GL8A 1N0TA 4C1UA 3G4ZA 2VC9A 1HE9A 3ABMC 4KPTA 2XS1A 3E4RA 4BDOA 4JVDA 2AL5A 4MHFA 1XC1A 4DXCA 3HNJA 4Q4ZF 1YJGA 4U4SA 3OO7A 1L5TA 3MLGA 3T9XB 2YL0A 1JNFA 4N91A 1FRPA 3QSLA 2CZKA 1DTZA 4JBZA 4G8NA 4O3AA 1RKMA 4YL3A 3MZBA 4HCYA 1WWPA 4HTGA 1PEBA 1FTAA 3CRBA 3VAYA 1D0XA 3FMSA 2DGJA 1ZW2A 3EN3A 3NRHA 3RQGA 3BIGA 3ECSA 4E0XA 3DE8A 2GWWA 3H4ZA 1FTLA 3B7DA 1A0BA 2AIXA 4ZEIA 2D21A 2WYKA 1KNYA 4YK5A 1QW0A 1DPEA 4PBQA 4U21A 3N6TA 2V25A 1H9GA 1APCA 2OQMA 2L7AA 2DXYA 3CG3A 5IZ3B 1PDAA 3DD7A 3LEOA 4GYTA 2RKMA 1M5DA 2EPKX 5I58A 4PACA 4OFLA 5D91A 2I15A 4G4PA 1QQ3A 3SXZA 1TWAA 3U3FA 1LBWA 4FORA 3AG3C 3NDBB 1FPBA 3AXFA 3KC0A 1B46A 3GZGA 1NMUA 3F47A 3PPPA 3RH3A 3QAXA 2OBGA 5CC2A 3C8GB 4KCCA 5K2XA 1G5ZA 3O6IA 3CSKA 3K1HA 1OQHA 3TQWA 3IB0A 2QTVA 1FTJA 2F5XA 2D5WA 1UTBA 5A5LA 1GTKA 4X48A 1NV4A 5FHOA 2YZSA 4JEBA 5FTHA 4JDFA 1UTHB 1A7VA 1NI9A 1AVOB 1Q0FA 1MY2A 2RF1A 1FFHA 3BKIB 3NKDA 2DOJA 3RYLA 2HZ8A 4LP2B 3ZSUA 4MIJA 5HM4B 1XVYA 1VR5A 4HFKB 2I3WA 4THIA 1Y1MA 4OVRA 3IX1A 5BQGA 2XD3A 2KK1A 2Z8DA 4IGTA 4AQ4A 1N7XA 1DOWA 1RDXA 2ZYNA 1LE4A 1XOCA 3TEPA 4GEHA 5KCJB 4ISUA 2J7PD 5DS6A 1YA7O 2PBWA 1EU8A 1T0KA 4J30B 2EPOA 2MKZA 1N04A 3TOMA 4BJ1A 1OR3A 3ISPA 5I84A 3TFLA 4N13A 4U9EA 2R7VA 2R03A 4P9FA 4DRJB 4HS7A 2XXUA 4DZ1A 4IO5A 4BJ6A 4H45A 3FGSA 4LQ2A 1N76A 1HW2A 5IY5C 2GFEA 3VVDA 3ITFA 1MQVA 3FATA 2NOOA 1U89A 1Y9UA 2L9JA 5JK4A 2ZYKA 3I4UA 4N6DA 5JP7A 3KMIA 3NYLA 3IFAA 1MQIA 5L0DA 3G3KA 4Q7CA 1MQGA 4RBNA 2EILC 1FPGA 5TP9A 3RPLA 3N26A 1QPUA 1I6QA 3HKKA 3HHFA 1JPNA 4MCOA 1BZ4A 1A7DA 2QFLA 4P1LA 3Q28A 1LFIA 1JVXA 3TTLA 2D4UA 3ZG1A 2O1LA 4AS5A 1LBVA 2XL4A 1PB9A 1RCPA 2WL8A 4DLDA 1Q0MA 2H4IA 3C8GD 2QS2A 3UR3C 3BRJA 2FFHA 2P1AA 1FBFA 3MBPA 3V5ZA 1D9YA 3C35A 4OMBA 5D92A 3U94A 2G3KA 3FXUA 4MVSA 3EHTA 1NUXA 1B2HA 3DP4A 4IAQA 4DIGA 1F9BA 3TCGA 1FPDA 3N0TA 3W8HA 3C34A 3MPLA 2BE5F 2I49A 2F97A 3ILUB 3I5QA 3PU5A 2XHDA 5FTIA 2PX1A 4U22A 3DMDA 3IQTA 3K6VA 2O7UA 3X1OA 5B1AC 3PUWE 4PP0A 5CMCA 1AOVA 1VE4A 2LIGA 2B4LA 4YT5A 1ORSC 3GODA 1LE2A 2PF4E 2VP1A 1MQDA 1QVSA 3QMFA 4DE8A 3KN7A 1XZPA 3O29A 3Q7LA 2M8CA 3CSGA 2ALUA 1TWYA 5A5XB 1EYJA 1MMGA 5KYWA 1QKBA 2KLFA 3G3IA 5KYXA 3ABKC 4PJJA 1Z63A 4PF8A 4PFOA 2G93A 5B3SC 2WYPA 5H8FB 2L6HA 1XHYA 2OLBA 4PETA 3NKEA 4DBQA 5CIVA 1LS4A 5A6JA 3H6VA 2HXWA 3E78A 3B71A 1B52A 1LAFE 3IO6A 2R7WA 1FMWA 4RJZA 1PBQA 4JRZA 2J0XA 4P9KA 4NF4B 3SEWA 3TTRA 2WBBA 3PHF2 2A6EF 4IGGA 3F11A 2O68A 2OX3A 1CPQA 1RDZA 2H8AA 1MY4A 2Y5LA 4JJGA 1R9QA 3VVFA 4XKRA 1MXUA 3RTWB 1XS5A 2D3IA 3RYDA 5JUAA 4MVOA 4IO7A 1IQ7A 1WVJA 2HAUA 5EHMA 2WVQA 4M4GA 3OEMA 4JTDB 1EZ9A 2HEUA 2Y7WA 3K1NA 2GRVA 3EHMA 2V3TA 1JOGA 1K9ZA 1NV0A 5JTYA 2Z15A 3BEHA 4XPXA 4ZEFA 2EPLX 3WHNA 1MH3A 4PK4A 2XXIA 4OEUA 1LGBC 3K0VA 4AL0A 1ORJA 1KU2A 4UACA 5L8DA 3OEKA 4MTGA 5BUOA 1LCTA 1NV3A 4PE5B 1YZ0A 2XM4A 4DRIB 3FVNA 3T9HB 1FQFA 2FVZA 4F4BA 1B0LA 3KGCA 1O5HA 4N06A 3OSRA 3U0CA 1ZW3A 4XEKA 4I62A 2YL1A 2L6FA 1JW1A 2THIA 5IM2A 4F1YA 3PPQA 1BR4A 4I1DA 1UIVA 3EJNA 1NFNA 1D9QA 3VM6A 4GWZA 3VFJA 2BJJX 5A6BD 2HV7A 2QL3A 3ASOC 1SDXA 2UVJA 3KFMA 1ZHTA 2DWAA 4DVZA 1SI1A 2VD3A 4XKQA 3AGTA 2B4MA 3OA1A 2R05A 2ZXTA 3SEXA 3W9VA 2A5SA 1Q0KA 1BTJA 2DWJA 1PB7A 3FBPA 4GQOA 5FHMA 1YTVA 1OW6A 3LSLA 4MH5A 1QUJA 3UK4A 4P1EA 1Q0DA 3E70C 3PDMP 1MS7A 3RW0A 1Z6AA 4ONSA 3E9VA 4YWQA 5M2VA 4G78A 2F3DA 4BDNA 1LBZA 1SBPA 2XWVA 5H8QA 2DVCA 2NUPB 1I5NA 2J8WA 3ODBA 4M1VA 3UIFA 3S9MC 3KH2A 1R6ZA 1FQBA 2PX3A 2IOQA 3H2VA 1YAEA 4MVZA 1FMVA 1Z23A 2HSQA 1VLSA 2XL8A 1MY0A 4U4XA 4EIYA 2IBFA 1LB9A 4C7OA 3RF3A 2PFZA 4GRKA 5AC5A 1E83A 2DQVA 2Q4FA 3AQBA 4D4NA 3GM2A 3V7OA 2NUTB 3K1IA 2Y5KA 5DS5A 1CGME 2QMXA 3KC1A 1I6AA 3MQ9A 3S9NC 3NYMA 1M56C 4PDHA 3RVZA 2XWIA 4X04A 4CDAA 4I3MA 1N3WA 4PE3A 4GL0A 1M2OA 5KDTB 1SF8A 4P9TA 2QS3A 2F6PA 4JEAA 4AE4B 2Y39A 3GLBA 4AL1A 1DBZA 4X0RA 3NMIA 3BIHA 3FUZA 1T6UA 3U8QA 3CFXA 1TKNA 4Q0CA 5J1DA 1NNFA 4J7TA 4MS2A 3KL4A 2IXMA 1D0YA 1G0IA 1USYE 2WEFA 2CZIA 4YMBA 3RIPA 4G7ZF 4KYSA 2PMSA 3K6WA 3UGPA 3G50A 2WZGA 1LBBA 2AP3A 2GH9A 2HFBA 2KNHA 3JZ0A 2J46A 2X26A 3R26A 2P1SA 4N8GA 4EKWA 3DAGA 3KN8A 2XRHA 3NYJA 3ZTZA 4BJ5A 3FD3A 1B7UA 5BQIA 1I4ZA 5JSLA 1RKCA 3T6GB 1WN0A 2QMWA 1YA9A 4JXIA 1YYXA 5B7DA 2PYYA 3T9OA 1QULA 3K33A 1WDNA 4OXVA 3IOWA 2IXPA 3IB2A 4DVYP 3LV0A 4PAFA 1ZU0A 2W4BA 3PUZE 3SXMA 3DWWA 5EQ8A 5T3JA 4YT2A 3CIJA 4E0HA 4NGUA 5H8NB 3J06A 1MM6A 1CPRA 2PFDA 2ICWG 3U72A 1YXIA 2FGYA 3S9OA 4P3LA 4QFNA 2LFFA 4H65A 2V3CC 5AA2B 2R7QA 3DJNB 1FPLA 2R6GE 1B05A 3T1BA 2FIXA 3C36A 1MPCA 2F6GA 2A5TA 4N81A 2H99A 4YJWA 3VDFA 3AG1C 4XF5A 4C1TA 2I0CA 2Y3DA 3JT1A 2YQYA 4KNVA 1YYJA 1ZU4A 1E85A 1GQAA 4I44A 3HNLA 1FJ9A 4NF0A 2F36A 1AMFA 5ET8A 4N6KA 5KYUB 1L7CA 2J9BA 4Q30B 3W2VA 3MAMA 4X1BA 4JWYA 2RCBA 5CI5A 2Q00A 3DM5A 3HJCA 4YZZA 5KYNA 4QBAA 2XXRA 3JRMO 4N15A 1EQ1A 3L8IA 4CSAC 4XXUA 3VRCA 4RXLA 3GORA 4LDKA 2HAVA 2P7VA 3ASNC 2XXYA 1V74B 3DI5A 4Q8RA 3MZ1A 3K4UA 3RY3A 3H6UA 2IXNA 4MNIA 4KC9A 4YN0B 1QVXA 4KD5A 4R6YA 2A0BA 1F1MA 4NAPA 4EXKA 2V3QA 5L0IA 1URGA 2IM8A 4Z7EA 4G2ZA 4U5BE 3E9XA 4ECFA 3G3GA 2Y7PA 1G0HA 3M15A 1AEPA 1WATA 1A7EA 1M5EA 1TFDA 1NKXA 2OJTA 3PMWA 4MNDA 1OVBA 4NTLA 4G7HF 1A8EA 2MHRA 5DLJA 5I2NA 4OETA 3CSBA 3IEEA 4OD4A 2F3BA 4NF5A 4KQPA 3U2LA 3EGDA 5I57B 1JEUA 4IO3A 4WABA 1NV1A 2EPMX 1MXYA 3PCVA 1QUIA 4ANJA 3K7DA 5L0FA 4BEMJ 2Q9TA 1NNTA 3T4RA 3AG4C 3RPWA 4F1UA 5E3AA 3HSTA 3KOSA 3M3FA 3IQCA 2Q9CA 2R71A 3OEOA 2KR0A 4MBPA 4TLLB 1AWBA 3PUVE 5AGFA 1VK5A 4GWYA 2FNCA 2KC3A 3JSZA 4CIPA 1M6TA 5B3IA 4PGNA 4WEPA 5DW8A 4U5GA 4U5FE 2FAPB 5BWJA 1UTHA 3FXQA 2PVUA 2Z8FA 4YKIA 3DELB 2HQ0A 4FEDA 3MX3A 2VHAA 4CJGA 1OXKA 2XXVA 3EFOB 3S84A 4JVCA 1NNPA 1VSOA 2OWZA 3JZJA 2V93A 4XTKA 1OKKA 1B7ZA 3A3UA 1ZU5A 4EBJA 1JEVA 5DT6A 5AA2D 2ZNSA 2LSEA 3K1MA 3U8VA 1QGXA 5KYYB 2CYDA 2Y3BA 4XPWA 3K6UA 4PR9A 5F1QA 1RKEA 4KBLA 2CCYA 1B1HA 3EQ1A 2YLIA 3I6VA 5L0JA 1NH7A 2YKZA 1A55A 3S2VA 3TK0A 3MC2A 3PTYA 1HE1A 4EHPA 3L6GA 4R9GA 2H7OA 1VFDA 5HSWA 3O97A 5FZTA 4FEBA 4KHZE 1HSJA 1AIVA 1ORYA 1FPFA 1O64A 2F34A 2ONRA 5I56B 4H67A 3G3FA 1LPEA 2UVHA 1P1OA 3GEHA 1YCJA 3LS0A 4H5FA 4NTFA 1EA8A 1Z7NE 3HHGA 3E79A 2R25A 2NPUA 1HSLA 4IGRA 1FAPB 1ST6A 3DM9B 1TFAA 5K2YA 1VDWA 3W8IA 3LC8A 1VMAA 3ZQYA 3RT6B 2I58A 2E87A 3HNIA 3FZVA 1JAFA 5ELVA 2Q8MA 1RYXA 4I3EA 2QVVA 4NC3A 3B8BA 3KJ7A 4ELQA 3ILTB 3RUMA 3SNHA 4FECA 3G3JA 1W2WA 3PUXE 4F2QA 1IZMA 3FVGA 2BJIA 1T6QA 3EHNA 2R7RA 3C31A 1WTYA 3V8XB 3OXNA 4O6YA 3LNMB 3PV0E 2E0SA 3LNRA 2ZD9A 5A6AA 4NF8A 3KBZA 2PBEA 1LSTA 5I59B 5AC4A 4O3CA 5LTCA 3R7CA 2C03A 3SYNA 2Y3HA 1IEJA 3MUQA 1IMFA 2B3FA 1B32A 3U92A 5L9OA 1B68A 4FBPA 1ZYRF 2R02A 1MH4A 2HHMA 5F24A 2YRFA 3RFYA 1MY1A 2W4MA 1LAXA 1OMPA 2GQ1A 4O79A 1CE2A 3FJGA 4RK9A 1YVIA 4BDLA 2JD3A 3VXBA 1OCOC 3IK6B 1NV2A 1NU9C 3DAFA 1O63A 1A8FA 4J7YA 2CGEA 5EK0A 1IMDA 4ZECA 2CZLA 4IJJA 3AGUA 4F2OA 2JX0A 3G7WA 1Z5ZA 3R7XA 4OHNA 3I5OA 1MQHA 2OKUA 1ZZPA 1A41A 4UABA 2J9UA 2R9JA 2ZXOA 3M1CB 5T3WA 4NX1A 1C17M 1TT1A 4QF9A 3KYJA 3JTLO 4P6IC 3C63A 2ZNTA 1S7YA 1FNTc 3HLZA 1Q0GA 4IY5A 3UP9A 2XA5A 4TQUQ 1NG1A 2CNWD 4P56A 4HCWA 4G7OF 5F28E 3GEIA 2G62A 3ATPA 3K01A 4ESWA 5A6KA 2P3VA 3MP8A 2YLGA 4HEAJ 3JYHA 2VPNA 4GX6A 1SYQA 5TJ5E 2HXRA 1P1NA 3TZAA 1G8XA 1MMNA 2XXXA 3RQEA 4GXAA 4JC7A 4R6KA 3IPMO 3M3LA 3B29A 1UFBA 1WASA 1E84A 2Q8JA 3GANA 1A40A 5ESYA 4IO6A 1B58A 4UDVA 4H8JA 1NBBA 2XX7A 2QRYA 4F29A 1ZBMA 2DYSC 3UMHA 2CZHA 2H5YA 3K6BA 3KN3A 5EQ9A 4E0WA 5AA4A 4U5HA 2J0WA 3FV1A 3EPVA 3FXBA 2ESNA 4KYEA 4O7MA 4FE8A 3VV5A 4C0RA 4POXA 1A7LA 3VLUA 3Q27A 3MJNA 1S05A 2Q89A 3N2ZB 4MVRA 2ZPAA 1DSNA 1SW5A 5E3CA 256BA 5CI9A 2VCCA 1AL3A 2ETSA 2XLMA 4PAIA 1LBCA 3FXHA 4N07A 1JPJA 5I58B 4MNCA 4IB4A 3B9QA 2H98A 3GWLA 4IB2A 2I6EA 1R9LA 4EUKB 3KJTA 4DOZA 3JCUQ 2RD9A 1LAHE 4H46A 4HXVA 3ZC4A 3QTHA 4BJ6C 5TPAA 3SESA 2LFDA 4LN5A 4GWWA 2YVKA 4OFJA 1FBEA 4JVIA 2OJED 4EBKA 2L81A 3CAXA 1B5HA 1YPNA 1U0BB 1OCZC 4KCDA 4NTBA 4RA1A 3KPHA 1H3DA 4RYAA 3LLKA 4F3SA 2DP8A 2HCAA 4JWOA 4HE2A 5TU0A 2M64A 1ZTYA 3Q26A 3CR9A 4I40A 4YL1A 4R74A 3QVZA 5BUUA 5ICQA 4JB7A 2OCUA 4B6IA 2H7BA 3U3BA 4FX5A 2VGQA 3C8ZA 1XWJA 2OCCC 2PT1A 1H6GA 2X0CA 4RPNA 4KFQA 2PNOA 3OELA 2Z8EA 2JPUA 1U6HA 4GXSB 4OINF 4J32B 3CG1A 4PF6A 2AL4A 3OO8A 1K9YA 2RC9A 3TDJA 4CJOA 1OKKD 4H0WA 3T9VA 4PBHA 3L8JA 1YYZA 4DCYA 1FBCA 1NUYA 1AUEA 3SDFA 3H65A 1T6IA 3Q6NA 5EHSA 3TELA 3U8PA 3IOVA 1NV5A 3O28A 3B0VC 3HO7A 3OSQA 2ZYOA 2VCAA 4QSCA 2PX0A 5B70A 5JEIA 3GBAA 5CBRA 1IXIA 4XEFA 5DYHA 4MFIA 4G8HA 1FBPA 2YHSA 1JRAA 4GQHA 1GGGA 1OLCA 3CFLA 4HE8D 1VYIA 3TYHA 2F7AA 4JSDA 3RLFE 4ELOA 4JKVA 1Y1ZA 1SW4A 3S9EA 3HNKA 3DE9A 5I5PA 1FJ6A 5B1BC 1UQWA 2OWSA 3IR1A 2A6HF 5L0CA 2OEVA 2O84X 3W2WA 2HV6A 4AK9A 2J45A 3L34A 2VCBA 2NUTA 4PFIA 1B1XA 4CX9A 4YT4A 2CDQA 2AWYA 1K04A 1IZ1A 1RYOA 5I2KA 3FOPA 2OZZA 4BDRA 3U9JA 4WXJA 1HY5A 4QFPA 1SZIA 3B6QA 5TP9B 3RPLB 1OQGA 2UUIA 4XFEA 5JLIA 3FHDA 5JVEA 5I7IA 2DYXA 3OO9A 3L6HA 4U5CE 3FVKA 1J8YF 2BL2A 4XEVA 1FPKA 2Q88A 1M2VA 3LSFB 2O6AA 2WX9A 2Y7RA 4YL0A 4A2NB 4XQ1A 2DE2A 4YT8A 5DEXA 2H25A 3PMRA 2YEVA 1E86A 2Q2CA 4OVQA 1GVCA 3U5SA 3JRTA 2Q3TA 2UYEA 2ZXWC 3CFZA 2DXRA 1BBHA 5EGYA 4U1OA 1GS9A 2DWHA 1POTA 2GFHA 4YKPA 5DS4A 4G68A 1CGOA 1NUZA 1HMDA 1H7IA 1L3PA 2GHAA 2X7QA 3IOTA 1MNEA 5E33A 5EHHA 4GFRA 2HMZA 3NG1A 1ZIUA 2V4CA 4FAJA 4H54A 4ZLDA 1FPEA 3O66A 2B0HA 1TXFA 3MVYA 5L3QA 3H2UA 2XS8A 4EQBA 3M79A 3EGXB 1OLAA 4ZS9A 1H45A 2RC7A 2L6GA 2V3UA 5H8SA 3GWNA 3SERA 1SR2A 3MFNA 5L9SA 3G3HA 4H8IA 3L0IA 1FQDA 1SPIA 4PC9A 2ANJA 4Q5TA 4E0IA 4C3BA 5EYGA 4PJLA 3RTFB 3PPOA 2GDCA 4KNWA 5JRAA 2DVZA 5CI8A 3M3KA 1Y3QA 3IO4A 4F19A 4MVUA 3SP1A 2HUJA 1D4NA 1PV3A 1RJ9A 5BQHA 1B3HA 2B3BA 3K66A 4LZ7A 4LVQA 4DDDA 3JYRA 3AQCA 3ZDLA 5KYWB 4EDPA 3DXJF 3JYYA 5T3TA 3K6XA 5KYXB 4NWDA 5L9MA 3KKBA 4G68C 3W15C 4OIOF 4P0IA 2XXAA 1T5OA 3C62A 4ZE9A 5AA3A 2HSBA 3PPRA 3MP1A 4BPMA 1LLSA 3QUJA 1WGWA 4L17A 3IORA 4MX6A 3TPAA 4QFLA 3GM3A 1ZMGA 4ZE8A 2HZLA 1LIHA 3T0JA 2UYFA 3D4CA 2W45A 2P6VA 4CS9A 3DZAA 2IYLD 1NUWA 2Y7KA 4EUOA 3IAZA 4I9DA 2QNLA 2F78A 5JT4A 4AB6A 2DYRC 1DOTA 2NUVA 4XTCQ 3T66A 3VYWA 1MQJA 1OCCC 3WG7C 5JTYB 4R2BA 4XLPF 4OQOA 5H8HA 4R32A 3LAYA 4G0HA 4JCZA 2F7BA 2REJA 3S90A 1FSAA 2F7CA 5ITPA 4CS7A 5AA1A 3WODF 2YWAA 3FV2A 3O39A 3V5XA 1DTGA 2A69F 4F3GA 3DJUB 3S9LC 1PC3A 4K3FA 3TD7A 5CRYA 1Y6DA 1ZJLA 5CM6A 5I57A 4F31B 4JURI 3K1IC 4D4XA 3R6UA 1EH3A 3OOAA 1POY1 4C3EA 3H06B 3FXRA 3IJOB 3ZKKA 4NQFA 1MRPA 2XLVA 4NF6A 1UG7A 1NL5A 1O7TA 3EG9A 4NG7A 1IMBA 2I48A 1OVTA 4CDYA 1IUDA 4GF8A 1PBPA 1IMCA 2NXOA 2QPQA 4FWVA 1Q35A 2P61A 4N6CA 2HJ3A 2XWOA 4U2RA 1ZVZA 3LEVA 1FTMA 4I1MA 1VTMP 4XKNA 1OCRC 1BK4A 1MPDA 4X8RA 2XSEA 2UVGA 1K40A 2P2AA 3QMKA 3LS1A 2P3NA 4PDDA 2OK2A 3RVYA 3LSXA 4QSDA 5H8QB 3W9WA 2J7PA 5EYFA 3ZSFA 4LDRA 4LACB 4YB6A 2LP4A 2YL7A 4QRZA 2WB7A 4BJ5C 2KW3C 1H43A 4R75A 1M5CA 2OOCA 2A1DD 1JETA 1SI0A 1SD3A 4POWA 4QSEA 2VD2A 4DI3D 2OWTA 3FAPB 4MEVA 1PD1A 4WGYA 4E7ZA 4EBBA 4C7OB 4OVSA 4JCHA 3VE1B 1OW7A 4HE1A 2QVRA 3KOTA 3PGFA 3RQTA 3A9CA 1LI5A 1FPJA 4Z9JA 3LUTB 3POVA 3TULA 4MAGA 4MW3A 3IJXB 4QFKA 4OESA 1B3EA 4F3PA 3MSTA 4ULWA 4EF1A 1JW4A 4Z9IA 2M4EA 3O6HA 2UUHA 1O87A 2ONSA 4OIRF 1SW1A 5IZ3A 5FCLA 4P11A 4NCQA 5I3SA 2XL6A 4QFOA 1K05A 3KYIA 2DSFA 2A0UA 2XXKA 2QS4A 2HS5A 1PB8A 4MTFA 2NSGA 2I4BA 3SEVA 1M5BA 4X9TA 3C8GA 4OEVA 1BR1A 4LLEA 1RXQA 1RDYA 2C04A 2I3VA 4MTOA 1MXWA 3SXKA 4O7IA 3WAFA 3USDA 1I6BA 3VXCA 4FESA 5DVJA 4OENA 2FA7A 1C03A 4WJ0A 3ONMA 1DOVA 1VFEA 4N4WA 1MPBA 3HFUA 2G3VA 1EI7A 1MG1A 1ELJA 1FBHA 2O51A 2V26A 3EQLF 4EQ7A 1KA1A 3UGWA 3C18A 4FATA 2R7OA 2NSFA 4JZAA 1NFTA 3OWTA 4I8CA 1ZKBA 2HFIA 1FBGA 2XXTA 1LBYA 3CZ6A 3QUFA 1O3UA 4R2FA 3FIRA 3SKPA 4ZZAA 2REGA 3QZCA 2A68F 2XXPA 4YU0A 3HN0A 1MXZA 2MWQA 5COGA 4OFOA 4DJ9A 4TLMB 3ZTMA 4OZ9A 2EIJC 2X51A 3EZHA 5KCJA 1LB8A 2F22A 2A5TB 4N6HA 2VB6A 3T22A 3IB1A 3THIA 3U9MA 4NN3A 4P47A 2QJEA 1WOLA 3AG2C 3EZIA 4RD9A 1NLXA 4A4AA 3O55A 1BDJB 1OXBA 4XWJA 1DMBA 3I3VA 4PFBA 3GEEA 4GWOA 3WAEA 3HPIA 2PT2A 2Y3GA 3LSWA 3PUYE 3PD8A 1R4TA 1US5A 1J8MF 2DDKA 3HTKC 1BP5A 3PMVA 1N7WA 3FVYA 4LLCA 4OWDA 5IAIA 1NV6A 3A3CA 4RNSA 4BDMA 4ULVA 3ZS6A 4L6RA 2DB4A 1V54C 2CMOA 3IQ5A 4PFTA 2ZYMA 3OMBA 3CVGA 1M57C 2QUPA 4KI2A 4LATA 4ONYA 5F5HA 2AVKA 3G4XA 1Y3PA 2B65A 1LI7A 2HJMA 4GBWA 3DKAA 5ET7A 1I69A 3OD7A 3IOUA 3X2QC 1B40A 1MY3A 4HW8A 1NU7D 4P8BA 1FCKA 4MJOA 2XWKA 3LUYA 5DQTA 3K02A 1M5FA 2YPNA 1IXGA 4QI2A 2AYSA 1Q1KA 5I2NB 3B0PA 2CEYA 2RC8A 3N5LA 4NF5B 1BLFA 5F5FA 1B3FA 1FBDA 2XM0A 1VOMA 3O9PA 3EGDB 1QLEC 4LERA 3MP6A 2FBPA 1YARO 1N1CA 3MPKA 2YLNA 4UA8A 4MVQA 3KSXA 3CQZA 1NZEA 1UIUA 3UNGC 1H76A 3MVXA 3DP6A 3PPNA 4U1ZA 3SZPA 4XPYA 2O7IA 3M4BA 5LOMA 1D0ZA 2XLHA 3RKOF 3VVEA 3A09A 5A6BA 3CHGA 2Q9AA 3RN8A 4PFUA 2RINA 2E1SA 1NV7A 3V89B 3TOLA 4FAPB 4GX3A 3EH1A 3Q7GA 4E18A 5E2QA 4ZDMA 3GBBA 1WODA 3LBSA 5KZTA 3OENA 1D3KA 1OW8A 4H4KC 3OO6A 3H6TA 1SYHA 2KSFA 2DE3A 3BFTA 4RY1A 4XIGQ 4RK2A 4HE0A 5K0IA 2DI3A 4Z9HA 2R7TA 4MLQA 1EZPA 3EPEA 1XI6A 1RKEB 1QJMA 2I0BA 5ET6A 3MYIA 5HV9A 3MBGA 4PFYA 4GBVA 4OVJA 4I1OB 3TTNA 4U5EE 1AH5A 1D1AA 4JSOA 4QDLA 5A5XA 3JSEO 1FQEA 3U65A 3HV1A 4ZLCA 3FJMA 4Q5SF 4G77A 2Q7RA 5H8FA 4R73A 4YAHX 3QXMA 4NY3A 3TAJA 3ZWIA 2DWIA 4AB5A 1JQFA 4QHQA 1NNKA 5IGAA 1QZXA 1LFGA 1SVXB 3QYTA 3T93B 2PCRA 1VYKA 4U23A 3MZ9A 3K2DA 4G61A 4NF4A 4WKMA 4O6MA 3D1RA 2ABHA 1TFKB 1NH8A 5CMMA 4OIPF 4PFRA 5DVWA 3PMXA 3TODA 2RSEB 3CEXA 1Z7ME 4MQ9F 1B6HA 2W9YA 3L1MA 3S28A 2P0NA 1PCXA 5EQAA 1YZAA 5ISUA 4CS8A 2V84A 2KYHA 1VB5A 4OTEA 2F35A 4G8MA 2WVNA 1IMAA 1OQCA 4NF8B 4WGZA 4PFWA 4X1DA 5ITOA 4F22A 4DXUA 2XLWA 3MW0A 2EINC 1INPA 2D5RB 3C33A 2EIMC 4LZ5A 3DP8A 2QSXA 3W4YA 2FYIA 2NG1A 2I8BA 4NHBA 3TJ6A 4QI0A 1ZHXA 1B4ZA 4LQ5A 4P0GA 1SMYF 4GLIA 3S4UA 2I4CA 3TKDA 3V83A 4CBEA 1UTBB 3RGYA 4EXLA 4W8PA 2FHYA 4O7GA 4U9DA 1B9JA 3GXAA 3V5YA 4LZ8A 4DCXA 2O9XA 2Q2AA 4FIMA 4YB7A 4PGPA 3NMKA 1S50A 2XD2A 2Q9BA 1B7HA 2X7PA 3KEIA 4E17A 2XX9A 3US6A 3C7JA 1R1NA 2H7VC 4GD5A 3EGXA 4CS8C 3EKIA 4BJTA 3RT8A 4ELPA 4GVOA 3N24A 3PD9A 1LBXA 2OJQA 3IQ6A 3Q29A 4IRUA 1RMVA 3Q6MA 2IEEA 1MMAA 1LAGE 2ZZXA 3UMKA 1CGNA 4GOTA 2XXQA 5FBPA 1BKAA 3C9HA 1KTMA 4JW1A 4M63A 3C32A 5J16A 3ZVRA 2NUPA 2IA4A 3IL1B 3K00A 4DBRA 4OIQF 4OANA
chains in the Genus database with same CATH topology
1P1WA 2GHBA 3TMGA 3N94A 3K1PA 4KYDA 2HZKA 2YJPA 3RNNA 4XKPA 5F7VA 1ATGA 1A54A 1FTKA 5AA4B 4H5GA 2W7YA 3JV9A 1HSEA 1IIWA 1II5A 2Z23A 5KDTA 4OERA 1OIBA 2XXHA 5CBSA 3DM0A 4OYVA 1FQCA 2O69A 1FTOA 3KZGA 1MM7A 3TTMA 5IKBA 4IY6A 3Q25A 1MXVA 1QKAA 3UA8A 5TPAB 1SQYA 5HPQA 3SEUA 2XX8A 2H9BA 1US4A 1B3GA 2Y84A 2UXAA 4F3BA 3D4GA 2P0SA 1JW5A 4KI0E 3T9UA 4BDQA 1N84A 1URDA 4R72A 3EHSA 5DVIA 1H44A 3TCFA 4ELRA 5H8NA 3UN6A 2G29A 3B6WA 5HBCA 5DVFA 1MXXA 5AA2A 2O1MA 3VLWA 3V5AA 5ICTA 4ZEBA 1B51A 1B4HA 3TCHA 3T96B 3ECRA 1B3LA 3MVZA 1XVXA 4ZZEA 3TTKA 1S9TA 4NWCA 4WEDA 3UORA 1Y4CA 2VOZA 3CI8A 4IO2A 3U1OA 1GR2A 1D9VA 3C4MA 1EZOA 3QK6A 2F8DA 3O6GA 4H6DA 3B6TA 5I2KB 4LONB 3ZKLA 1P99A 4F18A 4NMYA 4LUBA 1KWHA 3H03A 1XT8A 1ANFA 3KSJA 4LA9A 4R6HA 3KBRA 5DEXB 4Z0IA 1IXCA 2LAOA 4FJPA 4G68B 3HCQA 3FVOA 1ZLQA 1Y4TA 4YKKA 5DTBA 3O2AA 4TOZA 2ONKE 1SW2A 2XXWA 4RPOA 4H1XA 3E3KA 1B0HA 4ZEKA 2QS1A 2Z22A 4NEDA 4ND9A 3E13X 4MF3A 2ZMBA 2WKYA 2Y7IA 1MDP1 1URSA 3H3GA 4GIZA 2NWJA 1P1UA 1N3XA 4ZEDA 4YMAA 3TUSA 1MDQA 3VLVA 5I56A 4N6PA 4EQ9A 4JWXA 3SETA 4F1VA 2NVUB 3M8UA 5FHNA 1DPPA 4YICA 1Y3NA 5CMBA 1P1QA 3EHUA 3SEYA 4EF2A 4PQJA 4KR5A 2UVIA 3FASA 1J1NA 5I59A 3FJ7A 1LCFA 3LR1A 5H8HB 5AE4A 1IXHA 4O3BA 4ESXA 3DLNA 1QUKA 3P7IA 2ZNUA 1LFHA 1FQAA 3U93A 4NE4A 4DXBA 4R9FA 1USYH 2DS9A 4IO4A 4NF6B 3H6WA 4F39A 1JVYA 4BLAA 1B5IA 1IITA 3EF7A 1BIYA 4YKJA 3N6UA 3BFUA 3QIMA 3H7MA 3BBRA 1CB6A 3MWBA 1GV8A 1B5JA 3KG2A 3MVWA 1A99A 1FW0A 4MLVA 1Y20A 2DE4A 5CMKA 3TQLA 2RCAA 4YB5A 1SYIA 4GL8A 1N0TA 4C1UA 4KPTA 3E4RA 4BDOA 2AL5A 1XC1A 4DXCA 4U4SA 3OO7A 1L5TA 3T9XB 1JNFA 3QSLA 1DTZA 4JBZA 4G8NA 4O3AA 1RKMA 4HCYA 3MZBA 4HTGA 1PEBA 3CRBA 3EN3A 4E0XA 3H4ZA 1FTLA 3B7DA 2AIXA 4ZEIA 2D21A 1QW0A 1DPEA 4U21A 3N6TA 2V25A 2DXYA 3CG3A 1PDAA 2RKMA 5I58A 1M5DA 4OFLA 4G4PA 4FORA 3AXFA 1B46A 3GZGA 1NMUA 3PPPA 3QAXA 2OBGA 5CC2A 4KCCA 5K2XA 3O6IA 1OQHA 3TQWA 3IB0A 1FTJA 2F5XA 2D5WA 1UTBA 4X48A 1GTKA 5FHOA 5FTHA 4JDFA 1UTHB 1MY2A 2RF1A 3BKIB 2DOJA 2HZ8A 4LP2B 5HM4B 1XVYA 1VR5A 2I3WA 4THIA 1Y1MA 3IX1A 2XD3A 2Z8DA 4IGTA 4AQ4A 1N7XA 2ZYNA 1XOCA 3TEPA 5KCJB 4ISUA 2PBWA 1EU8A 1T0KA 1N04A 5I84A 3TFLA 4N13A 4HS7A 2XXUA 4DZ1A 4IO5A 3FGSA 4LQ2A 1N76A 2GFEA 3VVDA 3FATA 2NOOA 1Y9UA 5JK4A 2ZYKA 1MQIA 3G3KA 1MQGA 5TP9A 3N26A 1I6QA 3HHFA 3Q28A 1LFIA 1JVXA 3TTLA 2O1LA 1PB9A 4DLDA 2H4IA 2QS2A 3MBPA 3C35A 1D9YA 4OMBA 3U94A 3FXUA 3EHTA 1B2HA 3DP4A 4DIGA 1F9BA 3TCGA 3C34A 3MPLA 2I49A 2F97A 3ILUB 3PU5A 2XHDA 5FTIA 2PX1A 4U22A 3K6VA 2O7UA 3PUWE 4PP0A 5CMCA 1AOVA 1VE4A 2VP1A 1MQDA 1QVSA 4DE8A 3KN7A 3O29A 2M8CA 3CSGA 2ALUA 1TWYA 5A5XB 1QKBA 2KLFA 3G3IA 2G93A 5H8FB 1XHYA 2OLBA 4PETA 3H6VA 2HXWA 1LAFE 1B52A 3IO6A 4RJZA 1PBQA 4NF4B 3SEWA 3TTRA 3F11A 2O68A 1MY4A 1R9QA 3VVFA 4XKRA 1MXUA 3RTWB 1XS5A 2D3IA 4IO7A 1IQ7A 1WVJA 2HAUA 5EHMA 4M4GA 3OEMA 1EZ9A 2HEUA 2Y7WA 3K1NA 2GRVA 2V3TA 5JTYA 4ZEFA 1MH3A 2XXIA 4OEUA 1LGBC 3K0VA 4UACA 5L8DA 3OEKA 1LCTA 4PE5B 3FVNA 3T9HB 1FQFA 1B0LA 3KGCA 3OSRA 4I62A 1JW1A 4F1YA 2THIA 3PPQA 4I1DA 1UIVA 3VFJA 2BJJX 2QL3A 1SDXA 2UVJA 3KFMA 2DWAA 2VD3A 1SI1A 4XKQA 2ZXTA 3SEXA 3W9VA 2A5SA 1BTJA 2DWJA 1PB7A 4GQOA 5FHMA 1YTVA 3LSLA 4MH5A 1QUJA 3UK4A 1MS7A 5M2VA 4BDNA 1SBPA 5H8QA 2DVCA 3ODBA 4M1VA 3UIFA 3S9MC 1R6ZA 1FQBA 1YAEA 1MY0A 4U4XA 1LB9A 4GRKA 2DQVA 3MQ9A 2QMXA 1I6AA 3S9NC 1N3WA 4GL0A 5KDTB 2QS3A 2F6PA 3GLBA 3FUZA 3U8QA 3CFXA 4Q0CA 5J1DA 1NNFA 1USYE 4YMBA 4KYSA 2PMSA 3K6WA 1LBBA 2GH9A 2HFBA 2X26A 3R26A 2P1SA 3KN8A 3FD3A 1B7UA 2QMWA 4JXIA 5B7DA 2PYYA 1QULA 1WDNA 4OXVA 3IOWA 3IB2A 1ZU0A 3PUZE 3CIJA 5H8NB 1MM6A 3U72A 4QFNA 2LFFA 4H65A 5AA2B 2R6GE 1B05A 3C36A 1MPCA 2F6GA 2A5TA 2H99A 3VDFA 4C1TA 2I0CA 2F36A 1AMFA 4Q30B 3MAMA 4X1BA 4JWYA 2RCBA 5CI5A 4YZZA 2XXRA 4XXUA 4RXLA 2HAVA 2XXYA 4Q8RA 3MZ1A 3K4UA 3RY3A 3H6UA 4KD5A 4R6YA 4EXKA 2V3QA 1URGA 4Z7EA 4G2ZA 3E9XA 4ECFA 3G3GA 2Y7PA 1M5EA 1TFDA 2OJTA 1NKXA 3PMWA 1OVBA 4NTLA 1A8EA 5I2NA 4OETA 3CSBA 4NF5A 4KQPA 5I57B 1JEUA 4IO3A 1MXYA 1QUIA 2Q9TA 1NNTA 4F1UA 3RPWA 3HSTA 3KOSA 3M3FA 2R71A 4MBPA 4TLLB 3PUVE 2FNCA 4WEPA 5BWJA 1UTHA 3FXQA 2PVUA 2Z8FA 4YKIA 3DELB 2HQ0A 4FEDA 2VHAA 2XXVA 1NNPA 1VSOA 3JZJA 2V93A 1B7ZA 3A3UA 1JEVA 5DT6A 5AA2D 2ZNSA 3K1MA 3U8VA 3K6UA 5F1QA 1B1HA 3EQ1A 3I6VA 1NH7A 3S2VA 1A55A 3MC2A 3L6GA 4R9GA 1VFDA 3O97A 4FEBA 4KHZE 1HSJA 1AIVA 1O64A 2F34A 2ONRA 5I56B 4H67A 3G3FA 2UVHA 1P1OA 1YCJA 4H5FA 1Z7NE 3HHGA 1HSLA 4IGRA 1TFAA 5K2YA 3LC8A 3RT6B 2I58A 3FZVA 5ELVA 1RYXA 4ELQA 3KJ7A 3ILTB 3RUMA 4FECA 3G3JA 3PUXE 4F2QA 3FVGA 3C31A 3V8XB 3OXNA 3PV0E 2E0SA 4NF8A 1LSTA 5I59B 4O3CA 1IEJA 3MUQA 2B3FA 1B32A 3U92A 5L9OA 1MH4A 1MY1A 1LAXA 1OMPA 1CE2A 3FJGA 4RK9A 4BDLA 3VXBA 3IK6B 1O63A 1A8FA 4ZECA 2CZLA 4F2OA 3G7WA 3R7XA 4OHNA 3I5OA 1MQHA 2R9JA 4QF9A 1TT1A 2ZNTA 1S7YA 4IY5A 3UP9A 4TQUQ 4HCWA 3K01A 4ESWA 3MP8A 1P1NA 3TZAA 2XXXA 4GXAA 4R6KA 3M3LA 2Q8JA 1A40A 4IO6A 1B58A 4H8JA 2XX7A 2QRYA 4F29A 1ZBMA 2H5YA 3KN3A 4E0WA 5AA4A 3FV1A 2ESNA 4KYEA 4FE8A 3VV5A 4C0RA 4POXA 1A7LA 3VLUA 3Q27A 3MJNA 2Q89A 1DSNA 1SW5A 1AL3A 1LBCA 4N07A 5I58B 2H98A 4IB2A 2I6EA 1R9LA 3KJTA 1LAHE 5TPAA 3SESA 2LFDA 4OFJA 1B5HA 1YPNA 4KCDA 4RA1A 1H3DA 4RYAA 4F3SA 2DP8A 2HCAA 4JWOA 5TU0A 1ZTYA 3Q26A 3CR9A 4R74A 5BUUA 5ICQA 4JB7A 2OCUA 2VGQA 2PT1A 4RPNA 4KFQA 3OELA 2Z8EA 4GXSB 3CG1A 2AL4A 3OO8A 2RC9A 3TDJA 4H0WA 3T9VA 4DCYA 3SDFA 5EHSA 3TELA 3IOVA 3O28A 3HO7A 3OSQA 2ZYOA 4QSCA 5B70A 5JEIA 3GBAA 5CBRA 1IXIA 5DYHA 4MFIA 4G8HA 1GGGA 1OLCA 3CFLA 3TYHA 2F7AA 4JSDA 3RLFE 4ELOA 1Y1ZA 1SW4A 3S9EA 1UQWA 2OWSA 3IR1A 2O84X 1B1XA 1IZ1A 1RYOA 5I2KA 2OZZA 4BDRA 4WXJA 4QFPA 3B6QA 5TP9B 1OQGA 2DYXA 3OO9A 3L6HA 3FVKA 3LSFB 2Q88A 2O6AA 2Y7RA 2DE2A 5DEXA 2H25A 2Q2CA 1GVCA 2UYEA 3CFZA 2DXRA 4U1OA 2DWHA 1POTA 4YKPA 4G68A 2GHAA 2X7QA 3IOTA 4GFRA 1ZIUA 4FAJA 3O66A 1TXFA 3MVYA 4EQBA 1OLAA 4ZS9A 1H45A 2RC7A 2V3UA 5H8SA 3SERA 5L9SA 3G3HA 4H8IA 1FQDA 2ANJA 4Q5TA 3RTFB 3PPOA 2DVZA 3M3KA 1Y3QA 3IO4A 4F19A 1D4NA 1B3HA 2B3BA 4LZ7A 4LVQA 4DDDA 3JYRA 4EDPA 3K6XA 4NWDA 5L9MA 4G68C 3W15C 4P0IA 4ZE9A 5AA3A 3PPRA 3MP1A 1LLSA 3QUJA 4L17A 3IORA 3TPAA 4QFLA 1ZMGA 4ZE8A 2HZLA 2UYFA 3D4CA 2Y7KA 4EUOA 3IAZA 4I9DA 2F78A 4AB6A 1DOTA 2NUVA 4XTCQ 3T66A 1MQJA 5JTYB 4R2BA 4OQOA 5H8HA 2F7BA 2REJA 2F7CA 5ITPA 5AA1A 3FV2A 1DTGA 4F3GA 3S9LC 1PC3A 4K3FA 5CRYA 1ZJLA 5CM6A 5I57A 4F31B 3R6UA 3OOAA 1EH3A 1POY1 3H06B 3FXRA 3IJOB 3ZKKA 1MRPA 4NF6A 1NL5A 1O7TA 2I48A 1OVTA 1IUDA 4GF8A 1PBPA 2NXOA 2QPQA 1Q35A 4U2RA 1FTMA 4XKNA 1MPDA 2UVGA 2P2AA 2OK2A 3LSXA 4QSDA 5H8QB 3W9WA 3ZSFA 5EYFA 4YB6A 4QRZA 1H43A 4R75A 1M5CA 1JETA 1SI0A 1SD3A 4POWA 4QSEA 2VD2A 2OWTA 3VE1B 3KOTA 3PGFA 3RQTA 3IJXB 4QFKA 4OESA 1B3EA 4F3PA 4EF1A 1JW4A 3O6HA 2ONSA 1SW1A 4P11A 4QFOA 2DSFA 2QS4A 1PB8A 2I4BA 3SEVA 1M5BA 4X9TA 4OEVA 2I3VA 1MXWA 3WAFA 3USDA 1I6BA 3VXCA 5DVJA 4OENA 2FA7A 3ONMA 1VFEA 1MPBA 1MG1A 1ELJA 2O51A 4EQ7A 3UGWA 4FATA 1NFTA 4I8CA 1ZKBA 2XXTA 3QUFA 4R2FA 3FIRA 3SKPA 4ZZAA 2REGA 2XXPA 4YU0A 3HN0A 1MXZA 4OFOA 4TLMB 4OZ9A 5KCJA 1LB8A 2A5TB 3T22A 3IB1A 3THIA 2QJEA 1DMBA 3I3VA 4GWOA 3WAEA 3HPIA 2PT2A 3LSWA 3PUYE 3PD8A 1US5A 1BP5A 3PMVA 1N7WA 4OWDA 5IAIA 3A3CA 4RNSA 4BDMA 3ZS6A 2CMOA 4PFTA 2ZYMA 3OMBA 3CVGA 4ONYA 4LATA 1Y3PA 2B65A 1I69A 3OD7A 3IOUA 1B40A 1MY3A 4HW8A 1FCKA 3LUYA 3K02A 1M5FA 2YPNA 1IXGA 2AYSA 1Q1KA 5I2NB 2RC8A 3N5LA 4NF5B 1BLFA 1B3FA 3O9PA 3MP6A 3MPKA 2YLNA 4UA8A 3KSXA 1UIUA 1H76A 3MVXA 3DP6A 3PPNA 4U1ZA 2O7IA 5LOMA 3VVEA 3A09A 3RN8A 4PFUA 2RINA 2E1SA 3V89B 4ZDMA 3GBBA 1WODA 3LBSA 5KZTA 3OENA 1D3KA 3OO6A 3H6TA 1SYHA 2DE3A 3BFTA 4RY1A 4XIGQ 4RK2A 4MLQA 1EZPA 3EPEA 1QJMA 2I0BA 4PFYA 4OVJA 3TTNA 1AH5A 4JSOA 5A5XA 1FQEA 3HV1A 3FJMA 4G77A 5H8FA 4R73A 4YAHX 3QXMA 3TAJA 2DWIA 4AB5A 1JQFA 4QHQA 1NNKA 1LFGA 1SVXB 3QYTA 3T93B 4U23A 3MZ9A 3K2DA 4NF4A 4WKMA 2ABHA 1NH8A 5CMMA 3PMXA 3TODA 1Z7ME 1B6HA 5ISUA 2V84A 4OTEA 2F35A 4G8MA 4NF8B 4PFWA 4X1DA 5ITOA 4F22A 4DXUA 3MW0A 3C33A 4LZ5A 3DP8A 2QSXA 2FYIA 1B4ZA 4LQ5A 4P0GA 4GLIA 3S4UA 2I4CA 3TKDA 3V83A 1UTBB 3RGYA 4EXLA 1B9JA 3GXAA 4LZ8A 4DCXA 2Q2AA 4FIMA 4YB7A 1S50A 2XD2A 1B7HA 2X7PA 3KEIA 2XX9A 1R1NA 4GD5A 3RT8A 4ELPA 4GVOA 3PD9A 3Q29A 2IEEA 1LAGE 4GOTA 2XXQA 1BKAA 3C9HA 3C32A 2IA4A 3IL1B 3K00A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P1W A;  2GHB A;  3TMG A;  3N94 A;  3K1P A;  4KYD A;  2HZK A;  2YJP A;  3RNN A;  4XKP A;  5F7V A;  1ATG A;  1A54 A;  1FTK A;  5AA4 B;  4H5G A;  2W7Y A;  3JV9 A;  1HSE A;  1IIW A;  1II5 A;  2Z23 A;  5KDT A;  4OER A;  1OIB A;  2XXH A;  5CBS A;  3DM0 A;  4OYV A;  1FQC A;  2O69 A;  1FTO A;  3KZG A;  1MM7 A;  3TTM A;  5IKB A;  4IY6 A;  3Q25 A;  1MXV A;  1QKA A;  3UA8 A;  5TPA B;  1SQY A;  5HPQ A;  3SEU A;  2XX8 A;  2H9B A;  1US4 A;  1B3G A;  2Y84 A;  2UXA A;  4F3B A;  3D4G A;  2P0S A;  1JW5 A;  4KI0 E;  3T9U A;  4BDQ A;  1N84 A;  1URD A;  4R72 A;  3EHS A;  5DVI A;  1H44 A;  3TCF A;  4ELR A;  5H8N A;  3UN6 A;  2G29 A;  3B6W A;  5HBC A;  5DVF A;  1MXX A;  5AA2 A;  2O1M A;  3VLW A;  3V5A A;  5ICT A;  4ZEB A;  1B51 A;  1B4H A;  3TCH A;  3T96 B;  3ECR A;  1B3L A;  3MVZ A;  1XVX A;  4ZZE A;  3TTK A;  1S9T A;  4NWC A;  4WED A;  3UOR A;  1Y4C A;  2VOZ A;  3CI8 A;  4IO2 A;  3U1O A;  1GR2 A;  1D9V A;  3C4M A;  1EZO A;  3QK6 A;  2F8D A;  3O6G A;  4H6D A;  3B6T A;  5I2K B;  4LON B;  3ZKL A;  1P99 A;  4F18 A;  4NMY A;  4LUB A;  1KWH A;  3H03 A;  1XT8 A;  1ANF A;  3KSJ A;  4LA9 A;  4R6H A;  3KBR A;  5DEX B;  4Z0I A;  1IXC A;  2LAO A;  4FJP A;  4G68 B;  3HCQ A;  3FVO A;  1ZLQ A;  1Y4T A;  4YKK A;  5DTB A;  3O2A A;  4TOZ A;  2ONK E;  1SW2 A;  2XXW A;  4RPO A;  4H1X A;  3E3K A;  1B0H A;  4ZEK A;  2QS1 A;  2Z22 A;  4NED A;  4ND9 A;  3E13 X;  4MF3 A;  2ZMB A;  2WKY A;  2Y7I A;  1MDP 1;  1URS A;  3H3G A;  4GIZ A;  2NWJ A;  1P1U A;  1N3X A;  4ZED A;  4YMA A;  3TUS A;  1MDQ A;  3VLV A;  5I56 A;  4N6P A;  4EQ9 A;  4JWX A;  3SET A;  4F1V A;  2NVU B;  3M8U A;  5FHN A;  1DPP A;  4YIC A;  1Y3N A;  5CMB A;  1P1Q A;  3EHU A;  3SEY A;  4EF2 A;  4PQJ A;  4KR5 A;  2UVI A;  3FAS A;  1J1N A;  5I59 A;  3FJ7 A;  1LCF A;  3LR1 A;  5H8H B;  5AE4 A;  1IXH A;  4O3B A;  4ESX A;  3DLN A;  1QUK A;  3P7I A;  2ZNU A;  1LFH A;  1FQA A;  3U93 A;  4NE4 A;  4DXB A;  4R9F A;  1USY H;  2DS9 A;  4IO4 A;  4NF6 B;  3H6W A;  4F39 A;  1JVY A;  4BLA A;  1B5I A;  1IIT A;  3EF7 A;  1BIY A;  4YKJ A;  3N6U A;  3BFU A;  3QIM A;  3H7M A;  3BBR A;  1CB6 A;  3MWB A;  1GV8 A;  1B5J A;  3KG2 A;  3MVW A;  1A99 A;  1FW0 A;  4MLV A;  1Y20 A;  2DE4 A;  5CMK A;  3TQL A;  2RCA A;  4YB5 A;  1SYI A;  4GL8 A;  1N0T A;  4C1U A;  4KPT A;  3E4R A;  4BDO A;  2AL5 A;  1XC1 A;  4DXC A;  4U4S A;  3OO7 A;  1L5T A;  3T9X B;  1JNF A;  3QSL A;  1DTZ A;  4JBZ A;  4G8N A;  4O3A A;  1RKM A;  4HCY A;  3MZB A;  4HTG A;  1PEB A;  3CRB A;  3EN3 A;  4E0X A;  3H4Z A;  1FTL A;  3B7D A;  2AIX A;  4ZEI A;  2D21 A;  1QW0 A;  1DPE A;  4U21 A;  3N6T A;  2V25 A;  2DXY A;  3CG3 A;  1PDA A;  2RKM A;  5I58 A;  1M5D A;  4OFL A;  4G4P A;  4FOR A;  3AXF A;  1B46 A;  3GZG A;  1NMU A;  3PPP A;  3QAX A;  2OBG A;  5CC2 A;  4KCC A;  5K2X A;  3O6I A;  1OQH A;  3TQW A;  3IB0 A;  1FTJ A;  2F5X A;  2D5W A;  1UTB A;  4X48 A;  1GTK A;  5FHO A;  5FTH A;  4JDF A;  1UTH B;  1MY2 A;  2RF1 A;  3BKI B;  2DOJ A;  2HZ8 A;  4LP2 B;  5HM4 B;  1XVY A;  1VR5 A;  2I3W A;  4THI A;  1Y1M A;  3IX1 A;  2XD3 A;  2Z8D A;  4IGT A;  4AQ4 A;  1N7X A;  2ZYN A;  1XOC A;  3TEP A;  5KCJ B;  4ISU A;  2PBW A;  1EU8 A;  1T0K A;  1N04 A;  5I84 A;  3TFL A;  4N13 A;  4HS7 A;  2XXU A;  4DZ1 A;  4IO5 A;  3FGS A;  4LQ2 A;  1N76 A;  2GFE A;  3VVD A;  3FAT A;  2NOO A;  1Y9U A;  5JK4 A;  2ZYK A;  1MQI A;  3G3K A;  1MQG A;  5TP9 A;  3N26 A;  1I6Q A;  3HHF A;  3Q28 A;  1LFI A;  1JVX A;  3TTL A;  2O1L A;  1PB9 A;  4DLD A;  2H4I A;  2QS2 A;  3MBP A;  3C35 A;  1D9Y A;  4OMB A;  3U94 A;  3FXU A;  3EHT A;  1B2H A;  3DP4 A;  4DIG A;  1F9B A;  3TCG A;  3C34 A;  3MPL A;  2I49 A;  2F97 A;  3ILU B;  3PU5 A;  2XHD A;  5FTI A;  2PX1 A;  4U22 A;  3K6V A;  2O7U A;  3PUW E;  4PP0 A;  5CMC A;  1AOV A;  1VE4 A;  2VP1 A;  1MQD A;  1QVS A;  4DE8 A;  3KN7 A;  3O29 A;  2M8C A;  3CSG A;  2ALU A;  1TWY A;  5A5X B;  1QKB A;  2KLF A;  3G3I A;  2G93 A;  5H8F B;  1XHY A;  2OLB A;  4PET A;  3H6V A;  2HXW A;  1LAF E;  1B52 A;  3IO6 A;  4RJZ A;  1PBQ A;  4NF4 B;  3SEW A;  3TTR A;  3F11 A;  2O68 A;  1MY4 A;  1R9Q A;  3VVF A;  4XKR A;  1MXU A;  3RTW B;  1XS5 A;  2D3I A;  4IO7 A;  1IQ7 A;  1WVJ A;  2HAU A;  5EHM A;  4M4G A;  3OEM A;  1EZ9 A;  2HEU A;  2Y7W A;  3K1N A;  2GRV A;  2V3T A;  5JTY A;  4ZEF A;  1MH3 A;  2XXI A;  4OEU A;  1LGB C;  3K0V A;  4UAC A;  5L8D A;  3OEK A;  1LCT A;  4PE5 B;  3FVN A;  3T9H B;  1FQF A;  1B0L A;  3KGC A;  3OSR A;  4I62 A;  1JW1 A;  4F1Y A;  2THI A;  3PPQ A;  4I1D A;  1UIV A;  3VFJ A;  2BJJ X;  2QL3 A;  1SDX A;  2UVJ A;  3KFM A;  2DWA A;  2VD3 A;  1SI1 A;  4XKQ A;  2ZXT A;  3SEX A;  3W9V A;  2A5S A;  1BTJ A;  2DWJ A;  1PB7 A;  4GQO A;  5FHM A;  1YTV A;  3LSL A;  4MH5 A;  1QUJ A;  3UK4 A;  1MS7 A;  5M2V A;  4BDN A;  1SBP A;  5H8Q A;  2DVC A;  3ODB A;  4M1V A;  3UIF A;  3S9M C;  1R6Z A;  1FQB A;  1YAE A;  1MY0 A;  4U4X A;  1LB9 A;  4GRK A;  2DQV A;  3MQ9 A;  2QMX A;  1I6A A;  3S9N C;  1N3W A;  4GL0 A;  5KDT B;  2QS3 A;  2F6P A;  3GLB A;  3FUZ A;  3U8Q A;  3CFX A;  4Q0C A;  5J1D A;  1NNF A;  1USY E;  4YMB A;  4KYS A;  2PMS A;  3K6W A;  1LBB A;  2GH9 A;  2HFB A;  2X26 A;  3R26 A;  2P1S A;  3KN8 A;  3FD3 A;  1B7U A;  2QMW A;  4JXI A;  5B7D A;  2PYY A;  1QUL A;  1WDN A;  4OXV A;  3IOW A;  3IB2 A;  1ZU0 A;  3PUZ E;  3CIJ A;  5H8N B;  1MM6 A;  3U72 A;  4QFN A;  2LFF A;  4H65 A;  5AA2 B;  2R6G E;  1B05 A;  3C36 A;  1MPC A;  2F6G A;  2A5T A;  2H99 A;  3VDF A;  4C1T A;  2I0C A;  2F36 A;  1AMF A;  4Q30 B;  3MAM A;  4X1B A;  4JWY A;  2RCB A;  5CI5 A;  4YZZ A;  2XXR A;  4XXU A;  4RXL A;  2HAV A;  2XXY A;  4Q8R A;  3MZ1 A;  3K4U A;  3RY3 A;  3H6U A;  4KD5 A;  4R6Y A;  4EXK A;  2V3Q A;  1URG A;  4Z7E A;  4G2Z A;  3E9X A;  4ECF A;  3G3G A;  2Y7P A;  1M5E A;  1TFD A;  2OJT A;  1NKX A;  3PMW A;  1OVB A;  4NTL A;  1A8E A;  5I2N A;  4OET A;  3CSB A;  4NF5 A;  4KQP A;  5I57 B;  1JEU A;  4IO3 A;  1MXY A;  1QUI A;  2Q9T A;  1NNT A;  4F1U A;  3RPW A;  3HST A;  3KOS A;  3M3F A;  2R71 A;  4MBP A;  4TLL B;  3PUV E;  2FNC A;  4WEP A;  5BWJ A;  1UTH A;  3FXQ A;  2PVU A;  2Z8F A;  4YKI A;  3DEL B;  2HQ0 A;  4FED A;  2VHA A;  2XXV A;  1NNP A;  1VSO A;  3JZJ A;  2V93 A;  1B7Z A;  3A3U A;  1JEV A;  5DT6 A;  5AA2 D;  2ZNS A;  3K1M A;  3U8V A;  3K6U A;  5F1Q A;  1B1H A;  3EQ1 A;  3I6V A;  1NH7 A;  3S2V A;  1A55 A;  3MC2 A;  3L6G A;  4R9G A;  1VFD A;  3O97 A;  4FEB A;  4KHZ E;  1HSJ A;  1AIV A;  1O64 A;  2F34 A;  2ONR A;  5I56 B;  4H67 A;  3G3F A;  2UVH A;  1P1O A;  1YCJ A;  4H5F A;  1Z7N E;  3HHG A;  1HSL A;  4IGR A;  1TFA A;  5K2Y A;  3LC8 A;  3RT6 B;  2I58 A;  3FZV A;  5ELV A;  1RYX A;  4ELQ A;  3KJ7 A;  3ILT B;  3RUM A;  4FEC A;  3G3J A;  3PUX E;  4F2Q A;  3FVG A;  3C31 A;  3V8X B;  3OXN A;  3PV0 E;  2E0S A;  4NF8 A;  1LST A;  5I59 B;  4O3C A;  1IEJ A;  3MUQ A;  2B3F A;  1B32 A;  3U92 A;  5L9O A;  1MH4 A;  1MY1 A;  1LAX A;  1OMP A;  1CE2 A;  3FJG A;  4RK9 A;  4BDL A;  3VXB A;  3IK6 B;  1O63 A;  1A8F A;  4ZEC A;  2CZL A;  4F2O A;  3G7W A;  3R7X A;  4OHN A;  3I5O A;  1MQH A;  2R9J A;  4QF9 A;  1TT1 A;  2ZNT A;  1S7Y A;  4IY5 A;  3UP9 A;  4TQU Q;  4HCW A;  3K01 A;  4ESW A;  3MP8 A;  1P1N A;  3TZA A;  2XXX A;  4GXA A;  4R6K A;  3M3L A;  2Q8J A;  1A40 A;  4IO6 A;  1B58 A;  4H8J A;  2XX7 A;  2QRY A;  4F29 A;  1ZBM A;  2H5Y A;  3KN3 A;  4E0W A;  5AA4 A;  3FV1 A;  2ESN A;  4KYE A;  4FE8 A;  3VV5 A;  4C0R A;  4POX A;  1A7L A;  3VLU A;  3Q27 A;  3MJN A;  2Q89 A;  1DSN A;  1SW5 A;  1AL3 A;  1LBC A;  4N07 A;  5I58 B;  2H98 A;  4IB2 A;  2I6E A;  1R9L A;  3KJT A;  1LAH E;  5TPA A;  3SES A;  2LFD A;  4OFJ A;  1B5H A;  1YPN A;  4KCD A;  4RA1 A;  1H3D A;  4RYA A;  4F3S A;  2DP8 A;  2HCA A;  4JWO A;  5TU0 A;  1ZTY A;  3Q26 A;  3CR9 A;  4R74 A;  5BUU A;  5ICQ A;  4JB7 A;  2OCU A;  2VGQ A;  2PT1 A;  4RPN A;  4KFQ A;  3OEL A;  2Z8E A;  4GXS B;  3CG1 A;  2AL4 A;  3OO8 A;  2RC9 A;  3TDJ A;  4H0W A;  3T9V A;  4DCY A;  3SDF A;  5EHS A;  3TEL A;  3IOV A;  3O28 A;  3HO7 A;  3OSQ A;  2ZYO A;  4QSC A;  5B70 A;  5JEI A;  3GBA A;  5CBR A;  1IXI A;  5DYH A;  4MFI A;  4G8H A;  1GGG A;  1OLC A;  3CFL A;  3TYH A;  2F7A A;  4JSD A;  3RLF E;  4ELO A;  1Y1Z A;  1SW4 A;  3S9E A;  1UQW A;  2OWS A;  3IR1 A;  2O84 X;  1B1X A;  1IZ1 A;  1RYO A;  5I2K A;  2OZZ A;  4BDR A;  4WXJ A;  4QFP A;  3B6Q A;  5TP9 B;  1OQG A;  2DYX A;  3OO9 A;  3L6H A;  3FVK A;  3LSF B;  2Q88 A;  2O6A A;  2Y7R A;  2DE2 A;  5DEX A;  2H25 A;  2Q2C A;  1GVC A;  2UYE A;  3CFZ A;  2DXR A;  4U1O A;  2DWH A;  1POT A;  4YKP A;  4G68 A;  2GHA A;  2X7Q A;  3IOT A;  4GFR A;  1ZIU A;  4FAJ A;  3O66 A;  1TXF A;  3MVY A;  4EQB A;  1OLA A;  4ZS9 A;  1H45 A;  2RC7 A;  2V3U A;  5H8S A;  3SER A;  5L9S A;  3G3H A;  4H8I A;  1FQD A;  2ANJ A;  4Q5T A;  3RTF B;  3PPO A;  2DVZ A;  3M3K A;  1Y3Q A;  3IO4 A;  4F19 A;  1D4N A;  1B3H A;  2B3B A;  4LZ7 A;  4LVQ A;  4DDD A;  3JYR A;  4EDP A;  3K6X A;  4NWD A;  5L9M A;  4G68 C;  3W15 C;  4P0I A;  4ZE9 A;  5AA3 A;  3PPR A;  3MP1 A;  1LLS A;  3QUJ A;  4L17 A;  3IOR A;  3TPA A;  4QFL A;  1ZMG A;  4ZE8 A;  2HZL A;  2UYF A;  3D4C A;  2Y7K A;  4EUO A;  3IAZ A;  4I9D A;  2F78 A;  4AB6 A;  1DOT A;  2NUV A;  4XTC Q;  3T66 A;  1MQJ A;  5JTY B;  4R2B A;  4OQO A;  5H8H A;  2F7B A;  2REJ A;  2F7C A;  5ITP A;  5AA1 A;  3FV2 A;  1DTG A;  4F3G A;  3S9L C;  1PC3 A;  4K3F A;  5CRY A;  1ZJL A;  5CM6 A;  5I57 A;  4F31 B;  3R6U A;  3OOA A;  1EH3 A;  1POY 1;  3H06 B;  3FXR A;  3IJO B;  3ZKK A;  1MRP A;  4NF6 A;  1NL5 A;  1O7T A;  2I48 A;  1OVT A;  1IUD A;  4GF8 A;  1PBP A;  2NXO A;  2QPQ A;  1Q35 A;  4U2R A;  1FTM A;  4XKN A;  1MPD A;  2UVG A;  2P2A A;  2OK2 A;  3LSX A;  4QSD A;  5H8Q B;  3W9W A;  3ZSF A;  5EYF A;  4YB6 A;  4QRZ A;  1H43 A;  4R75 A;  1M5C A;  1JET A;  1SI0 A;  1SD3 A;  4POW A;  4QSE A;  2VD2 A;  2OWT A;  3VE1 B;  3KOT A;  3PGF A;  3RQT A;  3IJX B;  4QFK A;  4OES A;  1B3E A;  4F3P A;  4EF1 A;  1JW4 A;  3O6H A;  2ONS A;  1SW1 A;  4P11 A;  4QFO A;  2DSF A;  2QS4 A;  1PB8 A;  2I4B A;  3SEV A;  1M5B A;  4X9T A;  4OEV A;  2I3V A;  1MXW A;  3WAF A;  3USD A;  1I6B A;  3VXC A;  5DVJ A;  4OEN A;  2FA7 A;  3ONM A;  1VFE A;  1MPB A;  1MG1 A;  1ELJ A;  2O51 A;  4EQ7 A;  3UGW A;  4FAT A;  1NFT A;  4I8C A;  1ZKB A;  2XXT A;  3QUF A;  4R2F A;  3FIR A;  3SKP A;  4ZZA A;  2REG A;  2XXP A;  4YU0 A;  3HN0 A;  1MXZ A;  4OFO A;  4TLM B;  4OZ9 A;  5KCJ A;  1LB8 A;  2A5T B;  3T22 A;  3IB1 A;  3THI A;  2QJE A;  1DMB A;  3I3V A;  4GWO A;  3WAE A;  3HPI A;  2PT2 A;  3LSW A;  3PUY E;  3PD8 A;  1US5 A;  1BP5 A;  3PMV A;  1N7W A;  4OWD A;  5IAI A;  3A3C A;  4RNS A;  4BDM A;  3ZS6 A;  2CMO A;  4PFT A;  2ZYM A;  3OMB A;  3CVG A;  4ONY A;  4LAT A;  1Y3P A;  2B65 A;  1I69 A;  3OD7 A;  3IOU A;  1B40 A;  1MY3 A;  4HW8 A;  1FCK A;  3LUY A;  3K02 A;  1M5F A;  2YPN A;  1IXG A;  2AYS A;  1Q1K A;  5I2N B;  2RC8 A;  3N5L A;  4NF5 B;  1BLF A;  1B3F A;  3O9P A;  3MP6 A;  3MPK A;  2YLN A;  4UA8 A;  3KSX A;  1UIU A;  1H76 A;  3MVX A;  3DP6 A;  3PPN A;  4U1Z A;  2O7I A;  5LOM A;  3VVE A;  3A09 A;  3RN8 A;  4PFU A;  2RIN A;  2E1S A;  3V89 B;  4ZDM A;  3GBB A;  1WOD A;  3LBS A;  5KZT A;  3OEN A;  1D3K A;  3OO6 A;  3H6T A;  1SYH A;  2DE3 A;  3BFT A;  4RY1 A;  4XIG Q;  4RK2 A;  4MLQ A;  1EZP A;  3EPE A;  1QJM A;  2I0B A;  4PFY A;  4OVJ A;  3TTN A;  1AH5 A;  4JSO A;  5A5X A;  1FQE A;  3HV1 A;  3FJM A;  4G77 A;  5H8F A;  4R73 A;  4YAH X;  3QXM A;  3TAJ A;  2DWI A;  4AB5 A;  1JQF A;  4QHQ A;  1NNK A;  1LFG A;  1SVX B;  3QYT A;  3T93 B;  4U23 A;  3MZ9 A;  3K2D A;  4NF4 A;  4WKM A;  2ABH A;  1NH8 A;  5CMM A;  3PMX A;  3TOD A;  1Z7M E;  1B6H A;  5ISU A;  2V84 A;  4OTE A;  2F35 A;  4G8M A;  4NF8 B;  4PFW A;  4X1D A;  5ITO A;  4F22 A;  4DXU A;  3MW0 A;  3C33 A;  4LZ5 A;  3DP8 A;  2QSX A;  2FYI A;  1B4Z A;  4LQ5 A;  4P0G A;  4GLI A;  3S4U A;  2I4C A;  3TKD A;  3V83 A;  1UTB B;  3RGY A;  4EXL A;  1B9J A;  3GXA A;  4LZ8 A;  4DCX A;  2Q2A A;  4FIM A;  4YB7 A;  1S50 A;  2XD2 A;  1B7H A;  2X7P A;  3KEI A;  2XX9 A;  1R1N A;  4GD5 A;  3RT8 A;  4ELP A;  4GVO A;  3PD9 A;  3Q29 A;  2IEE A;  1LAG E;  4GOT A;  2XXQ A;  1BKA A;  3C9H A;  3C32 A;  2IA4 A;  3IL1 B;  3K00 A; 
#chains in the Genus database with same CATH topology
 1P1W A;  2GHB A;  3TMG A;  2HKV A;  2CEX A;  3N94 A;  3T6B A;  3K1P A;  3TJ5 A;  4KYD A;  2HZK A;  2YJP A;  3LUZ A;  4GWX A;  1QKR A;  3RNN A;  3I5P A;  3SXY A;  3QVY A;  5EQ7 A;  1CNQ A;  1IW7 F;  4XKP A;  5F7V A;  1MND A;  1ATG A;  1A54 A;  1FTK A;  2ZZW A;  5AA4 B;  2OG2 A;  4XLN F;  1NSG B;  4H5G A;  2W7Y A;  1TWC A;  2LCH A;  3FOO A;  1HSE A;  3JV9 A;  1Z3I X;  1IIW A;  1II5 A;  3IFC A;  2Z23 A;  5KDT A;  4OER A;  1OIB A;  1JMW A;  4K7B A;  4PJN A;  2XXH A;  5CBS A;  3DM0 A;  4K1O A;  4AE4 A;  2MYS A;  4OYV A;  2QE9 A;  1FQC A;  2O69 A;  2PP4 A;  1FTO A;  2L5V A;  3KZG A;  1HMO A;  1MM7 A;  2YLD A;  1FFT C;  2ZXR A;  3TTM A;  2ASR A;  5IKB A;  4IY6 A;  2XLO A;  3Q25 A;  3T6J A;  1MXV A;  3RQF A;  1LS1 A;  3SZR A;  2TMV P;  1FR0 A;  1QKA A;  3UA8 A;  5TPA B;  1SQY A;  5HPQ A;  3SEU A;  1DCU A;  3GM1 A;  5IZ1 A;  1R5I D;  1XZQ A;  3LES A;  2XX8 A;  2H9B A;  1US4 A;  1B3G A;  3AJM A;  2BC5 A;  2Y84 A;  1V55 C;  1FPI A;  2VH3 A;  3IHU A;  2UXA A;  4F3B A;  1D1C A;  3D4G A;  4DXW A;  3NOH A;  3MYF A;  2P0S A;  1JW5 A;  4KI0 E;  3T9U A;  4NQ8 A;  4BDQ A;  1N84 A;  1URD A;  4R72 A;  1S7Z A;  4EWC A;  4MW8 A;  3QW0 A;  3EHS A;  3LJB A;  3LLI A;  5DVI A;  2PFY A;  1H44 A;  2HPG A;  5LDZ A;  2IXO A;  3TCF A;  5H8N A;  1MMD A;  1ZHY A;  4ELR A;  1D1B A;  3UN6 A;  1GGQ A;  2G29 A;  3B6W A;  5HBC A;  4QXD A;  1YAU O;  5DVF A;  1BR2 A;  1YLM A;  1MXX A;  5COM A;  5AA2 A;  3ZQV A;  1H9T A;  2O1M A;  3ROJ A;  3VLW A;  2WBD A;  4IAO A;  3V5A A;  5IZZ A;  2JJK A;  4DI4 B;  5ICT A;  4ZEB A;  2R9R B;  1B51 A;  1B4H A;  3TCH A;  1NFO A;  3T96 B;  3ECR A;  1B3L A;  2LK4 A;  3MVZ A;  1XVX A;  4ZZE A;  3TTK A;  3B0U X;  1S9T A;  5KYU A;  4NWC A;  2KJG A;  4WED A;  4E7S A;  1G4U S;  4C3D A;  4GWU A;  3UOR A;  4NTA A;  2GA0 A;  3WAQ A;  1YDI A;  1Y4C A;  4OVP A;  2FIE A;  4RDA A;  2VOZ A;  3CI8 A;  2GAQ A;  4IO2 A;  3U1O A;  4K0D A;  1GR2 A;  1D9V A;  3C4M A;  2LQG A;  3EH2 A;  1EZO A;  4JTC B;  1E2X A;  3QK6 A;  2F8D A;  3SEO A;  3U2M A;  2KGO A;  2R8T A;  3O6G A;  4H6D A;  1GM5 A;  2J9V A;  4IAR A;  3B6T A;  5I2K B;  1TWG A;  2HMQ A;  3R2P A;  4LON B;  3ZKL A;  1P99 A;  4F18 A;  4NMY A;  4DRH B;  2R7X A;  4LUB A;  1EYI A;  1KWH A;  3O6X A;  4PJM A;  4IR8 A;  4OVT A;  3H03 A;  4JE9 A;  2WZF A;  1XT8 A;  1ANF A;  3KSJ A;  2WZL A;  1M2V B;  2EIK C;  4LA9 A;  4R6H A;  2KQZ A;  3KBR A;  1LM3 B;  5DEX B;  4Z0I A;  4KXP A;  1IXC A;  2AU5 A;  2LAO A;  4FJP A;  2VT5 A;  3O10 A;  5DQZ A;  3S27 A;  4ER9 A;  4G68 B;  3HCQ A;  1ZHZ A;  3FVO A;  1ZLQ A;  5COF A;  1Y4T A;  1OR2 A;  4JTA B;  4YKK A;  5DTB A;  2WVO A;  3O2A A;  2Y69 C;  4TOZ A;  3FAJ A;  2ONK E;  1SW2 A;  2XXW A;  2J9W A;  4RPO A;  4XEQ A;  4CS9 C;  4CSA A;  4H1X A;  3E3K A;  1B0H A;  3ZIB A;  4AX2 A;  2Q74 A;  1EYK A;  4AS4 A;  4ZEK A;  3EFO A;  2QS1 A;  2CNW A;  2YL3 A;  4W8K A;  2QVU A;  2ZXP A;  2XLE A;  1KA0 A;  3MYU A;  5KYY A;  4GX4 A;  4OA4 A;  1LVK A;  2Z22 A;  4NED A;  4ND9 A;  3E13 X;  4MF3 A;  1I4Y A;  1V4A A;  2R7S A;  2OEX A;  2ZMB A;  1RJ9 B;  2WKY A;  4U5D E;  2Y7I A;  1MDP 1;  4GWS A;  1URS A;  3M4C A;  2QLA A;  1TFO B;  3H3G A;  2LD6 A;  3TQO A;  4GIZ A;  2NWJ A;  1P1U A;  5ET5 A;  1C02 A;  2VPO A;  1N3X A;  5L3V A;  5EYH A;  4ZED A;  4YMA A;  3TUS A;  1MDQ A;  1TQG A;  3VLV A;  5I56 A;  2XXA B;  4PTK A;  4N6P A;  1YZC A;  4EQ9 A;  4JWX A;  3SET A;  4F1V A;  2VAS A;  3F46 A;  4MNP A;  1EKY A;  2NVU B;  3M8U A;  4HFF B;  5FHN A;  3ABL C;  1DPP A;  4CDV A;  4YIC A;  1Y3N A;  3S29 A;  5CMB A;  1P1Q A;  3EHU A;  3SEY A;  5L0H A;  4EF2 A;  5GPG B;  4PQJ A;  4KR5 A;  2UVI A;  4BG0 A;  2ZZV A;  3FDQ A;  1J1N A;  3FAS A;  4O8M A;  1Z7Q c;  5I59 A;  3FJ7 A;  1LCF A;  4JJF A;  3LR1 A;  1FTS A;  5H8H B;  5AE4 A;  1IXH A;  4BEJ A;  3UMI A;  1ZHW A;  4O3B A;  2KQ9 A;  5L0G A;  3GYY A;  4ESX A;  3DLN A;  1QUK A;  3A11 A;  1IME A;  4MVM A;  3P7I A;  2ZNU A;  3QW1 A;  1LFH A;  1FQA A;  1VLT A;  1LEV A;  4O6N A;  4N17 A;  3UGO A;  3A29 A;  2EPN A;  1Q9D A;  3U93 A;  4NE4 A;  2AWC A;  4DXB A;  4R9F A;  2B0J A;  1USY H;  2DS9 A;  1QSP A;  1G4W R;  3S0X A;  4IO4 A;  4NF6 B;  2CW0 F;  3H6W A;  1TWH A;  2QY9 A;  2XLD A;  3EG9 B;  3B50 A;  4F39 A;  1TR2 A;  4I3Y A;  4OD5 A;  1JVY A;  1T9K A;  4BLA A;  1LKX A;  1B5I A;  4PAK A;  1HW1 A;  1IIT A;  4PFP A;  3EF7 A;  1BIY A;  1KZ8 A;  5T1D B;  2R7U A;  1DK4 A;  4YKJ A;  5A69 A;  1JR8 A;  3N6U A;  1PD0 A;  3BFU A;  4IWB A;  3QIM A;  3AOU A;  5JS5 A;  4N4U A;  3NMJ A;  3H7M A;  3BBR A;  4CIH A;  2OU6 A;  4PCD A;  1CB6 A;  4JIO A;  4N8Y A;  3MWB A;  1GV8 A;  1B5J A;  4LDQ A;  3KG2 A;  4MMP A;  3MVW A;  4JVS A;  1A99 A;  3VF0 A;  1FW0 A;  4O94 A;  4MLV A;  1Y20 A;  2DE4 A;  1JP4 A;  1T01 A;  5CMK A;  3TQL A;  2RCA A;  4YB5 A;  1SYI A;  4GL8 A;  1N0T A;  4C1U A;  3G4Z A;  2VC9 A;  1HE9 A;  3ABM C;  4KPT A;  2XS1 A;  3E4R A;  4BDO A;  4JVD A;  2AL5 A;  4MHF A;  1XC1 A;  4DXC A;  3HNJ A;  4Q4Z F;  1YJG A;  4U4S A;  3OO7 A;  1L5T A;  3MLG A;  3T9X B;  2YL0 A;  1JNF A;  4N91 A;  1FRP A;  3QSL A;  2CZK A;  1DTZ A;  4JBZ A;  4G8N A;  4O3A A;  1RKM A;  4YL3 A;  3MZB A;  4HCY A;  1WWP A;  4HTG A;  1PEB A;  1FTA A;  3CRB A;  3VAY A;  1D0X A;  3FMS A;  2DGJ A;  1ZW2 A;  3EN3 A;  3NRH A;  3RQG A;  3BIG A;  3ECS A;  4E0X A;  3DE8 A;  2GWW A;  3H4Z A;  1FTL A;  3B7D A;  1A0B A;  2AIX A;  4ZEI A;  2D21 A;  2WYK A;  1KNY A;  4YK5 A;  1QW0 A;  1DPE A;  4PBQ A;  4U21 A;  3N6T A;  2V25 A;  1H9G A;  1APC A;  2OQM A;  2L7A A;  2DXY A;  3CG3 A;  5IZ3 B;  1PDA A;  3DD7 A;  3LEO A;  4GYT A;  2RKM A;  1M5D A;  2EPK X;  5I58 A;  4PAC A;  4OFL A;  5D91 A;  2I15 A;  4G4P A;  1QQ3 A;  3SXZ A;  1TWA A;  3U3F A;  1LBW A;  4FOR A;  3AG3 C;  3NDB B;  1FPB A;  3AXF A;  3KC0 A;  1B46 A;  3GZG A;  1NMU A;  3F47 A;  3PPP A;  3RH3 A;  3QAX A;  2OBG A;  5CC2 A;  3C8G B;  4KCC A;  5K2X A;  1G5Z A;  3O6I A;  3CSK A;  3K1H A;  1OQH A;  3TQW A;  3IB0 A;  2QTV A;  1FTJ A;  2F5X A;  2D5W A;  1UTB A;  5A5L A;  1GTK A;  4X48 A;  1NV4 A;  5FHO A;  2YZS A;  4JEB A;  5FTH A;  4JDF A;  1UTH B;  1A7V A;  1NI9 A;  1AVO B;  1Q0F A;  1MY2 A;  2RF1 A;  1FFH A;  3BKI B;  3NKD A;  2DOJ A;  3RYL A;  2HZ8 A;  4LP2 B;  3ZSU A;  4MIJ A;  5HM4 B;  1XVY A;  1VR5 A;  4HFK B;  2I3W A;  4THI A;  1Y1M A;  4OVR A;  3IX1 A;  5BQG A;  2XD3 A;  2KK1 A;  2Z8D A;  4IGT A;  4AQ4 A;  1N7X A;  1DOW A;  1RDX A;  2ZYN A;  1LE4 A;  1XOC A;  3TEP A;  4GEH A;  5KCJ B;  4ISU A;  2J7P D;  5DS6 A;  1YA7 O;  2PBW A;  1EU8 A;  1T0K A;  4J30 B;  2EPO A;  2MKZ A;  1N04 A;  3TOM A;  4BJ1 A;  1OR3 A;  3ISP A;  5I84 A;  3TFL A;  4N13 A;  4U9E A;  2R7V A;  2R03 A;  4P9F A;  4DRJ B;  4HS7 A;  2XXU A;  4DZ1 A;  4IO5 A;  4BJ6 A;  4H45 A;  3FGS A;  4LQ2 A;  1N76 A;  1HW2 A;  5IY5 C;  2GFE A;  3VVD A;  3ITF A;  1MQV A;  3FAT A;  2NOO A;  1U89 A;  1Y9U A;  2L9J A;  5JK4 A;  2ZYK A;  3I4U A;  4N6D A;  5JP7 A;  3KMI A;  3NYL A;  3IFA A;  1MQI A;  5L0D A;  3G3K A;  4Q7C A;  1MQG A;  4RBN A;  2EIL C;  1FPG A;  5TP9 A;  3RPL A;  3N26 A;  1QPU A;  1I6Q A;  3HKK A;  3HHF A;  1JPN A;  4MCO A;  1BZ4 A;  1A7D A;  2QFL A;  4P1L A;  3Q28 A;  1LFI A;  1JVX A;  3TTL A;  2D4U A;  3ZG1 A;  2O1L A;  4AS5 A;  1LBV A;  2XL4 A;  1PB9 A;  1RCP A;  2WL8 A;  4DLD A;  1Q0M A;  2H4I A;  3C8G D;  2QS2 A;  3UR3 C;  3BRJ A;  2FFH A;  2P1A A;  1FBF A;  3MBP A;  3V5Z A;  1D9Y A;  3C35 A;  4OMB A;  5D92 A;  3U94 A;  2G3K A;  3FXU A;  4MVS A;  3EHT A;  1NUX A;  1B2H A;  3DP4 A;  4IAQ A;  4DIG A;  1F9B A;  3TCG A;  1FPD A;  3N0T A;  3W8H A;  3C34 A;  3MPL A;  2BE5 F;  2I49 A;  2F97 A;  3ILU B;  3I5Q A;  3PU5 A;  2XHD A;  5FTI A;  2PX1 A;  4U22 A;  3DMD A;  3IQT A;  3K6V A;  2O7U A;  3X1O A;  5B1A C;  3PUW E;  4PP0 A;  5CMC A;  1AOV A;  1VE4 A;  2LIG A;  2B4L A;  4YT5 A;  1ORS C;  3GOD A;  1LE2 A;  2PF4 E;  2VP1 A;  1MQD A;  1QVS A;  3QMF A;  4DE8 A;  3KN7 A;  1XZP A;  3O29 A;  3Q7L A;  2M8C A;  3CSG A;  2ALU A;  1TWY A;  5A5X B;  1EYJ A;  1MMG A;  5KYW A;  1QKB A;  2KLF A;  3G3I A;  5KYX A;  3ABK C;  4PJJ A;  1Z63 A;  4PF8 A;  4PFO A;  2G93 A;  5B3S C;  2WYP A;  5H8F B;  2L6H A;  1XHY A;  2OLB A;  4PET A;  3NKE A;  4DBQ A;  5CIV A;  1LS4 A;  5A6J A;  3H6V A;  2HXW A;  3E78 A;  3B71 A;  1B52 A;  1LAF E;  3IO6 A;  2R7W A;  1FMW A;  4RJZ A;  1PBQ A;  4JRZ A;  2J0X A;  4P9K A;  4NF4 B;  3SEW A;  3TTR A;  2WBB A;  3PHF 2;  2A6E F;  4IGG A;  3F11 A;  2O68 A;  2OX3 A;  1CPQ A;  1RDZ A;  2H8A A;  1MY4 A;  2Y5L A;  4JJG A;  1R9Q A;  3VVF A;  4XKR A;  1MXU A;  3RTW B;  1XS5 A;  2D3I A;  3RYD A;  5JUA A;  4MVO A;  4IO7 A;  1IQ7 A;  1WVJ A;  2HAU A;  5EHM A;  2WVQ A;  4M4G A;  3OEM A;  4JTD B;  1EZ9 A;  2HEU A;  2Y7W A;  3K1N A;  2GRV A;  3EHM A;  2V3T A;  1JOG A;  1K9Z A;  1NV0 A;  5JTY A;  2Z15 A;  3BEH A;  4XPX A;  4ZEF A;  2EPL X;  3WHN A;  1MH3 A;  4PK4 A;  2XXI A;  4OEU A;  1LGB C;  3K0V A;  4AL0 A;  1ORJ A;  1KU2 A;  4UAC A;  5L8D A;  3OEK A;  4MTG A;  5BUO A;  1LCT A;  1NV3 A;  4PE5 B;  1YZ0 A;  2XM4 A;  4DRI B;  3FVN A;  3T9H B;  1FQF A;  2FVZ A;  4F4B A;  1B0L A;  3KGC A;  1O5H A;  4N06 A;  3OSR A;  3U0C A;  1ZW3 A;  4XEK A;  4I62 A;  2YL1 A;  2L6F A;  1JW1 A;  2THI A;  5IM2 A;  4F1Y A;  3PPQ A;  1BR4 A;  4I1D A;  1UIV A;  3EJN A;  1NFN A;  1D9Q A;  3VM6 A;  4GWZ A;  3VFJ A;  2BJJ X;  5A6B D;  2HV7 A;  2QL3 A;  3ASO C;  1SDX A;  2UVJ A;  3KFM A;  1ZHT A;  2DWA A;  4DVZ A;  1SI1 A;  2VD3 A;  4XKQ A;  3AGT A;  2B4M A;  3OA1 A;  2R05 A;  2ZXT A;  3SEX A;  3W9V A;  2A5S A;  1Q0K A;  1BTJ A;  2DWJ A;  1PB7 A;  3FBP A;  4GQO A;  5FHM A;  1YTV A;  1OW6 A;  3LSL A;  4MH5 A;  1QUJ A;  3UK4 A;  4P1E A;  1Q0D A;  3E70 C;  3PDM P;  1MS7 A;  3RW0 A;  1Z6A A;  4ONS A;  3E9V A;  4YWQ A;  5M2V A;  4G78 A;  2F3D A;  4BDN A;  1LBZ A;  1SBP A;  2XWV A;  5H8Q A;  2DVC A;  2NUP B;  1I5N A;  2J8W A;  3ODB A;  4M1V A;  3UIF A;  3S9M C;  3KH2 A;  1R6Z A;  1FQB A;  2PX3 A;  2IOQ A;  3H2V A;  1YAE A;  4MVZ A;  1FMV A;  1Z23 A;  2HSQ A;  1VLS A;  2XL8 A;  1MY0 A;  4U4X A;  4EIY A;  2IBF A;  1LB9 A;  4C7O A;  3RF3 A;  2PFZ A;  4GRK A;  5AC5 A;  1E83 A;  2DQV A;  2Q4F A;  3AQB A;  4D4N A;  3GM2 A;  3V7O A;  2NUT B;  3K1I A;  2Y5K A;  5DS5 A;  1CGM E;  2QMX A;  3KC1 A;  1I6A A;  3MQ9 A;  3S9N C;  3NYM A;  1M56 C;  4PDH A;  3RVZ A;  2XWI A;  4X04 A;  4CDA A;  4I3M A;  1N3W A;  4PE3 A;  4GL0 A;  1M2O A;  5KDT B;  1SF8 A;  4P9T A;  2QS3 A;  2F6P A;  4JEA A;  4AE4 B;  2Y39 A;  3GLB A;  4AL1 A;  1DBZ A;  4X0R A;  3NMI A;  3BIH A;  3FUZ A;  1T6U A;  3U8Q A;  3CFX A;  1TKN A;  4Q0C A;  5J1D A;  1NNF A;  4J7T A;  4MS2 A;  3KL4 A;  2IXM A;  1D0Y A;  1G0I A;  1USY E;  2WEF A;  2CZI A;  4YMB A;  3RIP A;  4G7Z F;  4KYS A;  2PMS A;  3K6W A;  3UGP A;  3G50 A;  2WZG A;  1LBB A;  2AP3 A;  2GH9 A;  2HFB A;  2KNH A;  3JZ0 A;  2J46 A;  2X26 A;  3R26 A;  2P1S A;  4N8G A;  4EKW A;  3DAG A;  3KN8 A;  2XRH A;  3NYJ A;  3ZTZ A;  4BJ5 A;  3FD3 A;  1B7U A;  5BQI A;  1I4Z A;  5JSL A;  1RKC A;  3T6G B;  1WN0 A;  2QMW A;  1YA9 A;  4JXI A;  1YYX A;  5B7D A;  2PYY A;  3T9O A;  1QUL A;  3K33 A;  1WDN A;  4OXV A;  3IOW A;  2IXP A;  3IB2 A;  4DVY P;  3LV0 A;  4PAF A;  1ZU0 A;  2W4B A;  3PUZ E;  3SXM A;  3DWW A;  5EQ8 A;  5T3J A;  4YT2 A;  3CIJ A;  4E0H A;  4NGU A;  5H8N B;  3J06 A;  1MM6 A;  1CPR A;  2PFD A;  2ICW G;  3U72 A;  1YXI A;  2FGY A;  3S9O A;  4P3L A;  4QFN A;  2LFF A;  4H65 A;  2V3C C;  5AA2 B;  2R7Q A;  3DJN B;  1FPL A;  2R6G E;  1B05 A;  3T1B A;  2FIX A;  3C36 A;  1MPC A;  2F6G A;  2A5T A;  4N81 A;  2H99 A;  4YJW A;  3VDF A;  3AG1 C;  4XF5 A;  4C1T A;  2I0C A;  2Y3D A;  3JT1 A;  2YQY A;  4KNV A;  1YYJ A;  1ZU4 A;  1E85 A;  1GQA A;  4I44 A;  3HNL A;  1FJ9 A;  4NF0 A;  2F36 A;  1AMF A;  5ET8 A;  4N6K A;  5KYU B;  1L7C A;  2J9B A;  4Q30 B;  3W2V A;  3MAM A;  4X1B A;  4JWY A;  2RCB A;  5CI5 A;  2Q00 A;  3DM5 A;  3HJC A;  4YZZ A;  5KYN A;  4QBA A;  2XXR A;  3JRM O;  4N15 A;  1EQ1 A;  3L8I A;  4CSA C;  4XXU A;  3VRC A;  4RXL A;  3GOR A;  4LDK A;  2HAV A;  2P7V A;  3ASN C;  2XXY A;  1V74 B;  3DI5 A;  4Q8R A;  3MZ1 A;  3K4U A;  3RY3 A;  3H6U A;  2IXN A;  4MNI A;  4KC9 A;  4YN0 B;  1QVX A;  4KD5 A;  4R6Y A;  2A0B A;  1F1M A;  4NAP A;  4EXK A;  2V3Q A;  5L0I A;  1URG A;  2IM8 A;  4Z7E A;  4G2Z A;  4U5B E;  3E9X A;  4ECF A;  3G3G A;  2Y7P A;  1G0H A;  3M15 A;  1AEP A;  1WAT A;  1A7E A;  1M5E A;  1TFD A;  1NKX A;  2OJT A;  3PMW A;  4MND A;  1OVB A;  4NTL A;  4G7H F;  1A8E A;  2MHR A;  5DLJ A;  5I2N A;  4OET A;  3CSB A;  3IEE A;  4OD4 A;  2F3B A;  4NF5 A;  4KQP A;  3U2L A;  3EGD A;  5I57 B;  1JEU A;  4IO3 A;  4WAB A;  1NV1 A;  2EPM X;  1MXY A;  3PCV A;  1QUI A;  4ANJ A;  3K7D A;  5L0F A;  4BEM J;  2Q9T A;  1NNT A;  3T4R A;  3AG4 C;  3RPW A;  4F1U A;  5E3A A;  3HST A;  3KOS A;  3M3F A;  3IQC A;  2Q9C A;  2R71 A;  3OEO A;  2KR0 A;  4MBP A;  4TLL B;  1AWB A;  3PUV E;  5AGF A;  1VK5 A;  4GWY A;  2FNC A;  2KC3 A;  3JSZ A;  4CIP A;  1M6T A;  5B3I A;  4PGN A;  4WEP A;  5DW8 A;  4U5G A;  4U5F E;  2FAP B;  5BWJ A;  1UTH A;  3FXQ A;  2PVU A;  2Z8F A;  4YKI A;  3DEL B;  2HQ0 A;  4FED A;  3MX3 A;  2VHA A;  4CJG A;  1OXK A;  2XXV A;  3EFO B;  3S84 A;  4JVC A;  1NNP A;  1VSO A;  2OWZ A;  3JZJ A;  2V93 A;  4XTK A;  1OKK A;  1B7Z A;  3A3U A;  1ZU5 A;  4EBJ A;  1JEV A;  5DT6 A;  5AA2 D;  2ZNS A;  2LSE A;  3K1M A;  3U8V A;  1QGX A;  5KYY B;  2CYD A;  2Y3B A;  4XPW A;  3K6U A;  4PR9 A;  5F1Q A;  1RKE A;  4KBL A;  2CCY A;  1B1H A;  3EQ1 A;  2YLI A;  3I6V A;  5L0J A;  1NH7 A;  2YKZ A;  1A55 A;  3S2V A;  3TK0 A;  3MC2 A;  3PTY A;  1HE1 A;  4EHP A;  3L6G A;  4R9G A;  2H7O A;  1VFD A;  5HSW A;  3O97 A;  5FZT A;  4FEB A;  4KHZ E;  1HSJ A;  1AIV A;  1ORY A;  1FPF A;  1O64 A;  2F34 A;  2ONR A;  5I56 B;  4H67 A;  3G3F A;  1LPE A;  2UVH A;  1P1O A;  3GEH A;  1YCJ A;  3LS0 A;  4H5F A;  4NTF A;  1EA8 A;  1Z7N E;  3HHG A;  3E79 A;  2R25 A;  2NPU A;  1HSL A;  4IGR A;  1FAP B;  1ST6 A;  3DM9 B;  1TFA A;  5K2Y A;  1VDW A;  3W8I A;  3LC8 A;  1VMA A;  3ZQY A;  3RT6 B;  2I58 A;  2E87 A;  3HNI A;  3FZV A;  1JAF A;  5ELV A;  2Q8M A;  1RYX A;  4I3E A;  2QVV A;  4NC3 A;  3B8B A;  3KJ7 A;  4ELQ A;  3ILT B;  3RUM A;  3SNH A;  4FEC A;  3G3J A;  1W2W A;  3PUX E;  4F2Q A;  1IZM A;  3FVG A;  2BJI A;  1T6Q A;  3EHN A;  2R7R A;  3C31 A;  1WTY A;  3V8X B;  3OXN A;  4O6Y A;  3LNM B;  3PV0 E;  2E0S A;  3LNR A;  2ZD9 A;  5A6A A;  4NF8 A;  3KBZ A;  2PBE A;  1LST A;  5I59 B;  5AC4 A;  4O3C A;  5LTC A;  3R7C A;  2C03 A;  3SYN A;  2Y3H A;  1IEJ A;  3MUQ A;  1IMF A;  2B3F A;  1B32 A;  3U92 A;  5L9O A;  1B68 A;  4FBP A;  1ZYR F;  2R02 A;  1MH4 A;  2HHM A;  5F24 A;  2YRF A;  3RFY A;  1MY1 A;  2W4M A;  1LAX A;  1OMP A;  2GQ1 A;  4O79 A;  1CE2 A;  3FJG A;  4RK9 A;  1YVI A;  4BDL A;  2JD3 A;  3VXB A;  1OCO C;  3IK6 B;  1NV2 A;  1NU9 C;  3DAF A;  1O63 A;  1A8F A;  4J7Y A;  2CGE A;  5EK0 A;  1IMD A;  4ZEC A;  2CZL A;  4IJJ A;  3AGU A;  4F2O A;  2JX0 A;  3G7W A;  1Z5Z A;  3R7X A;  4OHN A;  3I5O A;  1MQH A;  2OKU A;  1ZZP A;  1A41 A;  4UAB A;  2J9U A;  2R9J A;  2ZXO A;  3M1C B;  5T3W A;  4NX1 A;  1C17 M;  1TT1 A;  4QF9 A;  3KYJ A;  3JTL O;  4P6I C;  3C63 A;  2ZNT A;  1S7Y A;  1FNT c;  3HLZ A;  1Q0G A;  4IY5 A;  3UP9 A;  2XA5 A;  4TQU Q;  1NG1 A;  2CNW D;  4P56 A;  4HCW A;  4G7O F;  5F28 E;  3GEI A;  2G62 A;  3ATP A;  3K01 A;  4ESW A;  5A6K A;  2P3V A;  3MP8 A;  2YLG A;  4HEA J;  3JYH A;  2VPN A;  4GX6 A;  1SYQ A;  5TJ5 E;  2HXR A;  1P1N A;  3TZA A;  1G8X A;  1MMN A;  2XXX A;  3RQE A;  4GXA A;  4JC7 A;  4R6K A;  3IPM O;  3M3L A;  3B29 A;  1UFB A;  1WAS A;  1E84 A;  2Q8J A;  3GAN A;  1A40 A;  5ESY A;  4IO6 A;  1B58 A;  4UDV A;  4H8J A;  1NBB A;  2XX7 A;  2QRY A;  4F29 A;  1ZBM A;  2DYS C;  3UMH A;  2CZH A;  2H5Y A;  3K6B A;  3KN3 A;  5EQ9 A;  4E0W A;  5AA4 A;  4U5H A;  2J0W A;  3FV1 A;  3EPV A;  3FXB A;  2ESN A;  4KYE A;  4O7M A;  4FE8 A;  3VV5 A;  4C0R A;  4POX A;  1A7L A;  3VLU A;  3Q27 A;  3MJN A;  1S05 A;  2Q89 A;  3N2Z B;  4MVR A;  2ZPA A;  1DSN A;  1SW5 A;  5E3C A;  256B A;  5CI9 A;  2VCC A;  1AL3 A;  2ETS A;  2XLM A;  4PAI A;  1LBC A;  3FXH A;  4N07 A;  1JPJ A;  5I58 B;  4MNC A;  4IB4 A;  3B9Q A;  2H98 A;  3GWL A;  4IB2 A;  2I6E A;  1R9L A;  4EUK B;  3KJT A;  4DOZ A;  3JCU Q;  2RD9 A;  1LAH E;  4H46 A;  4HXV A;  3ZC4 A;  3QTH A;  4BJ6 C;  5TPA A;  3SES A;  2LFD A;  4LN5 A;  4GWW A;  2YVK A;  4OFJ A;  1FBE A;  4JVI A;  2OJE D;  4EBK A;  2L81 A;  3CAX A;  1B5H A;  1YPN A;  1U0B B;  1OCZ C;  4KCD A;  4NTB A;  4RA1 A;  3KPH A;  1H3D A;  4RYA A;  3LLK A;  4F3S A;  2DP8 A;  2HCA A;  4JWO A;  4HE2 A;  5TU0 A;  2M64 A;  1ZTY A;  3Q26 A;  3CR9 A;  4I40 A;  4YL1 A;  4R74 A;  3QVZ A;  5BUU A;  5ICQ A;  4JB7 A;  2OCU A;  4B6I A;  2H7B A;  3U3B A;  4FX5 A;  2VGQ A;  3C8Z A;  1XWJ A;  2OCC C;  2PT1 A;  1H6G A;  2X0C A;  4RPN A;  4KFQ A;  2PNO A;  3OEL A;  2Z8E A;  2JPU A;  1U6H A;  4GXS B;  4OIN F;  4J32 B;  3CG1 A;  4PF6 A;  2AL4 A;  3OO8 A;  1K9Y A;  2RC9 A;  3TDJ A;  4CJO A;  1OKK D;  4H0W A;  3T9V A;  4PBH A;  3L8J A;  1YYZ A;  4DCY A;  1FBC A;  1NUY A;  1AUE A;  3SDF A;  3H65 A;  1T6I A;  3Q6N A;  5EHS A;  3TEL A;  3U8P A;  3IOV A;  1NV5 A;  3O28 A;  3B0V C;  3HO7 A;  3OSQ A;  2ZYO A;  2VCA A;  4QSC A;  2PX0 A;  5B70 A;  5JEI A;  3GBA A;  5CBR A;  1IXI A;  4XEF A;  5DYH A;  4MFI A;  4G8H A;  1FBP A;  2YHS A;  1JRA A;  4GQH A;  1GGG A;  1OLC A;  3CFL A;  4HE8 D;  1VYI A;  3TYH A;  2F7A A;  4JSD A;  3RLF E;  4ELO A;  4JKV A;  1Y1Z A;  1SW4 A;  3S9E A;  3HNK A;  3DE9 A;  5I5P A;  1FJ6 A;  5B1B C;  1UQW A;  2OWS A;  3IR1 A;  2A6H F;  5L0C A;  2OEV A;  2O84 X;  3W2W A;  2HV6 A;  4AK9 A;  2J45 A;  3L34 A;  2VCB A;  2NUT A;  4PFI A;  1B1X A;  4CX9 A;  4YT4 A;  2CDQ A;  2AWY A;  1K04 A;  1IZ1 A;  1RYO A;  5I2K A;  3FOP A;  2OZZ A;  4BDR A;  3U9J A;  4WXJ A;  1HY5 A;  4QFP A;  1SZI A;  3B6Q A;  5TP9 B;  3RPL B;  1OQG A;  2UUI A;  4XFE A;  5JLI A;  3FHD A;  5JVE A;  5I7I A;  2DYX A;  3OO9 A;  3L6H A;  4U5C E;  3FVK A;  1J8Y F;  2BL2 A;  4XEV A;  1FPK A;  2Q88 A;  1M2V A;  3LSF B;  2O6A A;  2WX9 A;  2Y7R A;  4YL0 A;  4A2N B;  4XQ1 A;  2DE2 A;  4YT8 A;  5DEX A;  2H25 A;  3PMR A;  2YEV A;  1E86 A;  2Q2C A;  4OVQ A;  1GVC A;  3U5S A;  3JRT A;  2Q3T A;  2UYE A;  2ZXW C;  3CFZ A;  2DXR A;  1BBH A;  5EGY A;  4U1O A;  1GS9 A;  2DWH A;  1POT A;  2GFH A;  4YKP A;  5DS4 A;  4G68 A;  1CGO A;  1NUZ A;  1HMD A;  1H7I A;  1L3P A;  2GHA A;  2X7Q A;  3IOT A;  1MNE A;  5E33 A;  5EHH A;  4GFR A;  2HMZ A;  3NG1 A;  1ZIU A;  2V4C A;  4FAJ A;  4H54 A;  4ZLD A;  1FPE A;  3O66 A;  2B0H A;  1TXF A;  3MVY A;  5L3Q A;  3H2U A;  2XS8 A;  4EQB A;  3M79 A;  3EGX B;  1OLA A;  4ZS9 A;  1H45 A;  2RC7 A;  2L6G A;  2V3U A;  5H8S A;  3GWN A;  3SER A;  1SR2 A;  3MFN A;  5L9S A;  3G3H A;  4H8I A;  3L0I A;  1FQD A;  1SPI A;  4PC9 A;  2ANJ A;  4Q5T A;  4E0I A;  4C3B A;  5EYG A;  4PJL A;  3RTF B;  3PPO A;  2GDC A;  4KNW A;  5JRA A;  2DVZ A;  5CI8 A;  3M3K A;  1Y3Q A;  3IO4 A;  4F19 A;  4MVU A;  3SP1 A;  2HUJ A;  1D4N A;  1PV3 A;  1RJ9 A;  5BQH A;  1B3H A;  2B3B A;  3K66 A;  4LZ7 A;  4LVQ A;  4DDD A;  3JYR A;  3AQC A;  3ZDL A;  5KYW B;  4EDP A;  3DXJ F;  3JYY A;  5T3T A;  3K6X A;  5KYX B;  4NWD A;  5L9M A;  3KKB A;  4G68 C;  3W15 C;  4OIO F;  4P0I A;  2XXA A;  1T5O A;  3C62 A;  4ZE9 A;  5AA3 A;  2HSB A;  3PPR A;  3MP1 A;  4BPM A;  1LLS A;  3QUJ A;  1WGW A;  4L17 A;  3IOR A;  4MX6 A;  3TPA A;  4QFL A;  3GM3 A;  1ZMG A;  4ZE8 A;  2HZL A;  1LIH A;  3T0J A;  2UYF A;  3D4C A;  2W45 A;  2P6V A;  4CS9 A;  3DZA A;  2IYL D;  1NUW A;  2Y7K A;  4EUO A;  3IAZ A;  4I9D A;  2QNL A;  2F78 A;  5JT4 A;  4AB6 A;  2DYR C;  1DOT A;  2NUV A;  4XTC Q;  3T66 A;  3VYW A;  1MQJ A;  1OCC C;  3WG7 C;  5JTY B;  4R2B A;  4XLP F;  4OQO A;  5H8H A;  4R32 A;  3LAY A;  4G0H A;  4JCZ A;  2F7B A;  2REJ A;  3S90 A;  1FSA A;  2F7C A;  5ITP A;  4CS7 A;  5AA1 A;  3WOD F;  2YWA A;  3FV2 A;  3O39 A;  3V5X A;  1DTG A;  2A69 F;  4F3G A;  3DJU B;  3S9L C;  1PC3 A;  4K3F A;  3TD7 A;  5CRY A;  1Y6D A;  1ZJL A;  5CM6 A;  5I57 A;  4F31 B;  4JUR I;  3K1I C;  4D4X A;  3R6U A;  1EH3 A;  3OOA A;  1POY 1;  4C3E A;  3H06 B;  3FXR A;  3IJO B;  3ZKK A;  4NQF A;  1MRP A;  2XLV A;  4NF6 A;  1UG7 A;  1NL5 A;  1O7T A;  3EG9 A;  4NG7 A;  1IMB A;  2I48 A;  1OVT A;  4CDY A;  1IUD A;  4GF8 A;  1PBP A;  1IMC A;  2NXO A;  2QPQ A;  4FWV A;  1Q35 A;  2P61 A;  4N6C A;  2HJ3 A;  2XWO A;  4U2R A;  1ZVZ A;  3LEV A;  1FTM A;  4I1M A;  1VTM P;  4XKN A;  1OCR C;  1BK4 A;  1MPD A;  4X8R A;  2XSE A;  2UVG A;  1K40 A;  2P2A A;  3QMK A;  3LS1 A;  2P3N A;  4PDD A;  2OK2 A;  3RVY A;  3LSX A;  4QSD A;  5H8Q B;  3W9W A;  2J7P A;  5EYF A;  3ZSF A;  4LDR A;  4LAC B;  4YB6 A;  2LP4 A;  2YL7 A;  4QRZ A;  2WB7 A;  4BJ5 C;  2KW3 C;  1H43 A;  4R75 A;  1M5C A;  2OOC A;  2A1D D;  1JET A;  1SI0 A;  1SD3 A;  4POW A;  4QSE A;  2VD2 A;  4DI3 D;  2OWT A;  3FAP B;  4MEV A;  1PD1 A;  4WGY A;  4E7Z A;  4EBB A;  4C7O B;  4OVS A;  4JCH A;  3VE1 B;  1OW7 A;  4HE1 A;  2QVR A;  3KOT A;  3PGF A;  3RQT A;  3A9C A;  1LI5 A;  1FPJ A;  4Z9J A;  3LUT B;  3POV A;  3TUL A;  4MAG A;  4MW3 A;  3IJX B;  4QFK A;  4OES A;  1B3E A;  4F3P A;  3MST A;  4ULW A;  4EF1 A;  1JW4 A;  4Z9I A;  2M4E A;  3O6H A;  2UUH A;  1O87 A;  2ONS A;  4OIR F;  1SW1 A;  5IZ3 A;  5FCL A;  4P11 A;  4NCQ A;  5I3S A;  2XL6 A;  4QFO A;  1K05 A;  3KYI A;  2DSF A;  2A0U A;  2XXK A;  2QS4 A;  2HS5 A;  1PB8 A;  4MTF A;  2NSG A;  2I4B A;  3SEV A;  1M5B A;  4X9T A;  3C8G A;  4OEV A;  1BR1 A;  4LLE A;  1RXQ A;  1RDY A;  2C04 A;  2I3V A;  4MTO A;  1MXW A;  3SXK A;  4O7I A;  3WAF A;  3USD A;  1I6B A;  3VXC A;  4FES A;  5DVJ A;  4OEN A;  2FA7 A;  1C03 A;  4WJ0 A;  3ONM A;  1DOV A;  1VFE A;  4N4W A;  1MPB A;  3HFU A;  2G3V A;  1EI7 A;  1MG1 A;  1ELJ A;  1FBH A;  2O51 A;  2V26 A;  3EQL F;  4EQ7 A;  1KA1 A;  3UGW A;  3C18 A;  4FAT A;  2R7O A;  2NSF A;  4JZA A;  1NFT A;  3OWT A;  4I8C A;  1ZKB A;  2HFI A;  1FBG A;  2XXT A;  1LBY A;  3CZ6 A;  3QUF A;  1O3U A;  4R2F A;  3FIR A;  3SKP A;  4ZZA A;  2REG A;  3QZC A;  2A68 F;  2XXP A;  4YU0 A;  3HN0 A;  1MXZ A;  2MWQ A;  5COG A;  4OFO A;  4DJ9 A;  4TLM B;  3ZTM A;  4OZ9 A;  2EIJ C;  2X51 A;  3EZH A;  5KCJ A;  1LB8 A;  2F22 A;  2A5T B;  4N6H A;  2VB6 A;  3T22 A;  3IB1 A;  3THI A;  3U9M A;  4NN3 A;  4P47 A;  2QJE A;  1WOL A;  3AG2 C;  3EZI A;  4RD9 A;  1NLX A;  4A4A A;  3O55 A;  1BDJ B;  1OXB A;  4XWJ A;  1DMB A;  3I3V A;  4PFB A;  3GEE A;  4GWO A;  3WAE A;  3HPI A;  2PT2 A;  2Y3G A;  3LSW A;  3PUY E;  3PD8 A;  1R4T A;  1US5 A;  1J8M F;  2DDK A;  3HTK C;  1BP5 A;  3PMV A;  1N7W A;  3FVY A;  4LLC A;  4OWD A;  5IAI A;  1NV6 A;  3A3C A;  4RNS A;  4BDM A;  4ULV A;  3ZS6 A;  4L6R A;  2DB4 A;  1V54 C;  2CMO A;  3IQ5 A;  4PFT A;  2ZYM A;  3OMB A;  3CVG A;  1M57 C;  2QUP A;  4KI2 A;  4LAT A;  4ONY A;  5F5H A;  2AVK A;  3G4X A;  1Y3P A;  2B65 A;  1LI7 A;  2HJM A;  4GBW A;  3DKA A;  5ET7 A;  1I69 A;  3OD7 A;  3IOU A;  3X2Q C;  1B40 A;  1MY3 A;  4HW8 A;  1NU7 D;  4P8B A;  1FCK A;  4MJO A;  2XWK A;  3LUY A;  5DQT A;  3K02 A;  1M5F A;  2YPN A;  1IXG A;  4QI2 A;  2AYS A;  1Q1K A;  5I2N B;  3B0P A;  2CEY A;  2RC8 A;  3N5L A;  4NF5 B;  1BLF A;  5F5F A;  1B3F A;  1FBD A;  2XM0 A;  1VOM A;  3O9P A;  3EGD B;  1QLE C;  4LER A;  3MP6 A;  2FBP A;  1YAR O;  1N1C A;  3MPK A;  2YLN A;  4UA8 A;  4MVQ A;  3KSX A;  3CQZ A;  1NZE A;  1UIU A;  3UNG C;  1H76 A;  3MVX A;  3DP6 A;  3PPN A;  4U1Z A;  3SZP A;  4XPY A;  2O7I A;  3M4B A;  5LOM A;  1D0Z A;  2XLH A;  3RKO F;  3VVE A;  3A09 A;  5A6B A;  3CHG A;  2Q9A A;  3RN8 A;  4PFU A;  2RIN A;  2E1S A;  1NV7 A;  3V89 B;  3TOL A;  4FAP B;  4GX3 A;  3EH1 A;  3Q7G A;  4E18 A;  5E2Q A;  4ZDM A;  3GBB A;  1WOD A;  3LBS A;  5KZT A;  3OEN A;  1D3K A;  1OW8 A;  4H4K C;  3OO6 A;  3H6T A;  1SYH A;  2KSF A;  2DE3 A;  3BFT A;  4RY1 A;  4XIG Q;  4RK2 A;  4HE0 A;  5K0I A;  2DI3 A;  4Z9H A;  2R7T A;  4MLQ A;  1EZP A;  3EPE A;  1XI6 A;  1RKE B;  1QJM A;  2I0B A;  5ET6 A;  3MYI A;  5HV9 A;  3MBG A;  4PFY A;  4GBV A;  4OVJ A;  4I1O B;  3TTN A;  4U5E E;  1AH5 A;  1D1A A;  4JSO A;  4QDL A;  5A5X A;  3JSE O;  1FQE A;  3U65 A;  3HV1 A;  4ZLC A;  3FJM A;  4Q5S F;  4G77 A;  2Q7R A;  5H8F A;  4R73 A;  4YAH X;  3QXM A;  4NY3 A;  3TAJ A;  3ZWI A;  2DWI A;  4AB5 A;  1JQF A;  4QHQ A;  1NNK A;  5IGA A;  1QZX A;  1LFG A;  1SVX B;  3QYT A;  3T93 B;  2PCR A;  1VYK A;  4U23 A;  3MZ9 A;  3K2D A;  4G61 A;  4NF4 A;  4WKM A;  4O6M A;  3D1R A;  2ABH A;  1TFK B;  1NH8 A;  5CMM A;  4OIP F;  4PFR A;  5DVW A;  3PMX A;  3TOD A;  2RSE B;  3CEX A;  1Z7M E;  4MQ9 F;  1B6H A;  2W9Y A;  3L1M A;  3S28 A;  2P0N A;  1PCX A;  5EQA A;  1YZA A;  5ISU A;  4CS8 A;  2V84 A;  2KYH A;  1VB5 A;  4OTE A;  2F35 A;  4G8M A;  2WVN A;  1IMA A;  1OQC A;  4NF8 B;  4WGZ A;  4PFW A;  4X1D A;  5ITO A;  4F22 A;  4DXU A;  2XLW A;  3MW0 A;  2EIN C;  1INP A;  2D5R B;  3C33 A;  2EIM C;  4LZ5 A;  3DP8 A;  2QSX A;  3W4Y A;  2FYI A;  2NG1 A;  2I8B A;  4NHB A;  3TJ6 A;  4QI0 A;  1ZHX A;  1B4Z A;  4LQ5 A;  4P0G A;  1SMY F;  4GLI A;  3S4U A;  2I4C A;  3TKD A;  3V83 A;  4CBE A;  1UTB B;  3RGY A;  4EXL A;  4W8P A;  2FHY A;  4O7G A;  4U9D A;  1B9J A;  3GXA A;  3V5Y A;  4LZ8 A;  4DCX A;  2O9X A;  2Q2A A;  4FIM A;  4YB7 A;  4PGP A;  3NMK A;  1S50 A;  2XD2 A;  2Q9B A;  1B7H A;  2X7P A;  3KEI A;  4E17 A;  2XX9 A;  3US6 A;  3C7J A;  1R1N A;  2H7V C;  4GD5 A;  3EGX A;  4CS8 C;  3EKI A;  4BJT A;  3RT8 A;  4ELP A;  4GVO A;  3N24 A;  3PD9 A;  1LBX A;  2OJQ A;  3IQ6 A;  3Q29 A;  4IRU A;  1RMV A;  3Q6M A;  2IEE A;  1MMA A;  1LAG E;  2ZZX A;  3UMK A;  1CGN A;  4GOT A;  2XXQ A;  5FBP A;  1BKA A;  3C9H A;  1KTM A;  4JW1 A;  4M63 A;  3C32 A;  5J16 A;  3ZVR A;  2NUP A;  2IA4 A;  3IL1 B;  3K00 A;  4DBR A;  4OIQ F;  4OAN A; 
#chains in the Genus database with same CATH homology
 1P1W A;  2GHB A;  3TMG A;  3N94 A;  3K1P A;  4KYD A;  2HZK A;  2YJP A;  3RNN A;  4XKP A;  5F7V A;  1ATG A;  1A54 A;  1FTK A;  5AA4 B;  4H5G A;  2W7Y A;  3JV9 A;  1HSE A;  1IIW A;  1II5 A;  2Z23 A;  5KDT A;  4OER A;  1OIB A;  2XXH A;  5CBS A;  3DM0 A;  4OYV A;  1FQC A;  2O69 A;  1FTO A;  3KZG A;  1MM7 A;  3TTM A;  5IKB A;  4IY6 A;  3Q25 A;  1MXV A;  1QKA A;  3UA8 A;  5TPA B;  1SQY A;  5HPQ A;  3SEU A;  2XX8 A;  2H9B A;  1US4 A;  1B3G A;  2Y84 A;  2UXA A;  4F3B A;  3D4G A;  2P0S A;  1JW5 A;  4KI0 E;  3T9U A;  4BDQ A;  1N84 A;  1URD A;  4R72 A;  3EHS A;  5DVI A;  1H44 A;  3TCF A;  4ELR A;  5H8N A;  3UN6 A;  2G29 A;  3B6W A;  5HBC A;  5DVF A;  1MXX A;  5AA2 A;  2O1M A;  3VLW A;  3V5A A;  5ICT A;  4ZEB A;  1B51 A;  1B4H A;  3TCH A;  3T96 B;  3ECR A;  1B3L A;  3MVZ A;  1XVX A;  4ZZE A;  3TTK A;  1S9T A;  4NWC A;  4WED A;  3UOR A;  1Y4C A;  2VOZ A;  3CI8 A;  4IO2 A;  3U1O A;  1GR2 A;  1D9V A;  3C4M A;  1EZO A;  3QK6 A;  2F8D A;  3O6G A;  4H6D A;  3B6T A;  5I2K B;  4LON B;  3ZKL A;  1P99 A;  4F18 A;  4NMY A;  4LUB A;  1KWH A;  3H03 A;  1XT8 A;  1ANF A;  3KSJ A;  4LA9 A;  4R6H A;  3KBR A;  5DEX B;  4Z0I A;  1IXC A;  2LAO A;  4FJP A;  4G68 B;  3HCQ A;  3FVO A;  1ZLQ A;  1Y4T A;  4YKK A;  5DTB A;  3O2A A;  4TOZ A;  2ONK E;  1SW2 A;  2XXW A;  4RPO A;  4H1X A;  3E3K A;  1B0H A;  4ZEK A;  2QS1 A;  2Z22 A;  4NED A;  4ND9 A;  3E13 X;  4MF3 A;  2ZMB A;  2WKY A;  2Y7I A;  1MDP 1;  1URS A;  3H3G A;  4GIZ A;  2NWJ A;  1P1U A;  1N3X A;  4ZED A;  4YMA A;  3TUS A;  1MDQ A;  3VLV A;  5I56 A;  4N6P A;  4EQ9 A;  4JWX A;  3SET A;  4F1V A;  2NVU B;  3M8U A;  5FHN A;  1DPP A;  4YIC A;  1Y3N A;  5CMB A;  1P1Q A;  3EHU A;  3SEY A;  4EF2 A;  4PQJ A;  4KR5 A;  2UVI A;  3FAS A;  1J1N A;  5I59 A;  3FJ7 A;  1LCF A;  3LR1 A;  5H8H B;  5AE4 A;  1IXH A;  4O3B A;  4ESX A;  3DLN A;  1QUK A;  3P7I A;  2ZNU A;  1LFH A;  1FQA A;  3U93 A;  4NE4 A;  4DXB A;  4R9F A;  1USY H;  2DS9 A;  4IO4 A;  4NF6 B;  3H6W A;  4F39 A;  1JVY A;  4BLA A;  1B5I A;  1IIT A;  3EF7 A;  1BIY A;  4YKJ A;  3N6U A;  3BFU A;  3QIM A;  3H7M A;  3BBR A;  1CB6 A;  3MWB A;  1GV8 A;  1B5J A;  3KG2 A;  3MVW A;  1A99 A;  1FW0 A;  4MLV A;  1Y20 A;  2DE4 A;  5CMK A;  3TQL A;  2RCA A;  4YB5 A;  1SYI A;  4GL8 A;  1N0T A;  4C1U A;  4KPT A;  3E4R A;  4BDO A;  2AL5 A;  1XC1 A;  4DXC A;  4U4S A;  3OO7 A;  1L5T A;  3T9X B;  1JNF A;  3QSL A;  1DTZ A;  4JBZ A;  4G8N A;  4O3A A;  1RKM A;  4HCY A;  3MZB A;  4HTG A;  1PEB A;  3CRB A;  3EN3 A;  4E0X A;  3H4Z A;  1FTL A;  3B7D A;  2AIX A;  4ZEI A;  2D21 A;  1QW0 A;  1DPE A;  4U21 A;  3N6T A;  2V25 A;  2DXY A;  3CG3 A;  1PDA A;  2RKM A;  5I58 A;  1M5D A;  4OFL A;  4G4P A;  4FOR A;  3AXF A;  1B46 A;  3GZG A;  1NMU A;  3PPP A;  3QAX A;  2OBG A;  5CC2 A;  4KCC A;  5K2X A;  3O6I A;  1OQH A;  3TQW A;  3IB0 A;  1FTJ A;  2F5X A;  2D5W A;  1UTB A;  4X48 A;  1GTK A;  5FHO A;  5FTH A;  4JDF A;  1UTH B;  1MY2 A;  2RF1 A;  3BKI B;  2DOJ A;  2HZ8 A;  4LP2 B;  5HM4 B;  1XVY A;  1VR5 A;  2I3W A;  4THI A;  1Y1M A;  3IX1 A;  2XD3 A;  2Z8D A;  4IGT A;  4AQ4 A;  1N7X A;  2ZYN A;  1XOC A;  3TEP A;  5KCJ B;  4ISU A;  2PBW A;  1EU8 A;  1T0K A;  1N04 A;  5I84 A;  3TFL A;  4N13 A;  4HS7 A;  2XXU A;  4DZ1 A;  4IO5 A;  3FGS A;  4LQ2 A;  1N76 A;  2GFE A;  3VVD A;  3FAT A;  2NOO A;  1Y9U A;  5JK4 A;  2ZYK A;  1MQI A;  3G3K A;  1MQG A;  5TP9 A;  3N26 A;  1I6Q A;  3HHF A;  3Q28 A;  1LFI A;  1JVX A;  3TTL A;  2O1L A;  1PB9 A;  4DLD A;  2H4I A;  2QS2 A;  3MBP A;  3C35 A;  1D9Y A;  4OMB A;  3U94 A;  3FXU A;  3EHT A;  1B2H A;  3DP4 A;  4DIG A;  1F9B A;  3TCG A;  3C34 A;  3MPL A;  2I49 A;  2F97 A;  3ILU B;  3PU5 A;  2XHD A;  5FTI A;  2PX1 A;  4U22 A;  3K6V A;  2O7U A;  3PUW E;  4PP0 A;  5CMC A;  1AOV A;  1VE4 A;  2VP1 A;  1MQD A;  1QVS A;  4DE8 A;  3KN7 A;  3O29 A;  2M8C A;  3CSG A;  2ALU A;  1TWY A;  5A5X B;  1QKB A;  2KLF A;  3G3I A;  2G93 A;  5H8F B;  1XHY A;  2OLB A;  4PET A;  3H6V A;  2HXW A;  1LAF E;  1B52 A;  3IO6 A;  4RJZ A;  1PBQ A;  4NF4 B;  3SEW A;  3TTR A;  3F11 A;  2O68 A;  1MY4 A;  1R9Q A;  3VVF A;  4XKR A;  1MXU A;  3RTW B;  1XS5 A;  2D3I A;  4IO7 A;  1IQ7 A;  1WVJ A;  2HAU A;  5EHM A;  4M4G A;  3OEM A;  1EZ9 A;  2HEU A;  2Y7W A;  3K1N A;  2GRV A;  2V3T A;  5JTY A;  4ZEF A;  1MH3 A;  2XXI A;  4OEU A;  1LGB C;  3K0V A;  4UAC A;  5L8D A;  3OEK A;  1LCT A;  4PE5 B;  3FVN A;  3T9H B;  1FQF A;  1B0L A;  3KGC A;  3OSR A;  4I62 A;  1JW1 A;  4F1Y A;  2THI A;  3PPQ A;  4I1D A;  1UIV A;  3VFJ A;  2BJJ X;  2QL3 A;  1SDX A;  2UVJ A;  3KFM A;  2DWA A;  2VD3 A;  1SI1 A;  4XKQ A;  2ZXT A;  3SEX A;  3W9V A;  2A5S A;  1BTJ A;  2DWJ A;  1PB7 A;  4GQO A;  5FHM A;  1YTV A;  3LSL A;  4MH5 A;  1QUJ A;  3UK4 A;  1MS7 A;  5M2V A;  4BDN A;  1SBP A;  5H8Q A;  2DVC A;  3ODB A;  4M1V A;  3UIF A;  3S9M C;  1R6Z A;  1FQB A;  1YAE A;  1MY0 A;  4U4X A;  1LB9 A;  4GRK A;  2DQV A;  3MQ9 A;  2QMX A;  1I6A A;  3S9N C;  1N3W A;  4GL0 A;  5KDT B;  2QS3 A;  2F6P A;  3GLB A;  3FUZ A;  3U8Q A;  3CFX A;  4Q0C A;  5J1D A;  1NNF A;  1USY E;  4YMB A;  4KYS A;  2PMS A;  3K6W A;  1LBB A;  2GH9 A;  2HFB A;  2X26 A;  3R26 A;  2P1S A;  3KN8 A;  3FD3 A;  1B7U A;  2QMW A;  4JXI A;  5B7D A;  2PYY A;  1QUL A;  1WDN A;  4OXV A;  3IOW A;  3IB2 A;  1ZU0 A;  3PUZ E;  3CIJ A;  5H8N B;  1MM6 A;  3U72 A;  4QFN A;  2LFF A;  4H65 A;  5AA2 B;  2R6G E;  1B05 A;  3C36 A;  1MPC A;  2F6G A;  2A5T A;  2H99 A;  3VDF A;  4C1T A;  2I0C A;  2F36 A;  1AMF A;  4Q30 B;  3MAM A;  4X1B A;  4JWY A;  2RCB A;  5CI5 A;  4YZZ A;  2XXR A;  4XXU A;  4RXL A;  2HAV A;  2XXY A;  4Q8R A;  3MZ1 A;  3K4U A;  3RY3 A;  3H6U A;  4KD5 A;  4R6Y A;  4EXK A;  2V3Q A;  1URG A;  4Z7E A;  4G2Z A;  3E9X A;  4ECF A;  3G3G A;  2Y7P A;  1M5E A;  1TFD A;  2OJT A;  1NKX A;  3PMW A;  1OVB A;  4NTL A;  1A8E A;  5I2N A;  4OET A;  3CSB A;  4NF5 A;  4KQP A;  5I57 B;  1JEU A;  4IO3 A;  1MXY A;  1QUI A;  2Q9T A;  1NNT A;  4F1U A;  3RPW A;  3HST A;  3KOS A;  3M3F A;  2R71 A;  4MBP A;  4TLL B;  3PUV E;  2FNC A;  4WEP A;  5BWJ A;  1UTH A;  3FXQ A;  2PVU A;  2Z8F A;  4YKI A;  3DEL B;  2HQ0 A;  4FED A;  2VHA A;  2XXV A;  1NNP A;  1VSO A;  3JZJ A;  2V93 A;  1B7Z A;  3A3U A;  1JEV A;  5DT6 A;  5AA2 D;  2ZNS A;  3K1M A;  3U8V A;  3K6U A;  5F1Q A;  1B1H A;  3EQ1 A;  3I6V A;  1NH7 A;  3S2V A;  1A55 A;  3MC2 A;  3L6G A;  4R9G A;  1VFD A;  3O97 A;  4FEB A;  4KHZ E;  1HSJ A;  1AIV A;  1O64 A;  2F34 A;  2ONR A;  5I56 B;  4H67 A;  3G3F A;  2UVH A;  1P1O A;  1YCJ A;  4H5F A;  1Z7N E;  3HHG A;  1HSL A;  4IGR A;  1TFA A;  5K2Y A;  3LC8 A;  3RT6 B;  2I58 A;  3FZV A;  5ELV A;  1RYX A;  4ELQ A;  3KJ7 A;  3ILT B;  3RUM A;  4FEC A;  3G3J A;  3PUX E;  4F2Q A;  3FVG A;  3C31 A;  3V8X B;  3OXN A;  3PV0 E;  2E0S A;  4NF8 A;  1LST A;  5I59 B;  4O3C A;  1IEJ A;  3MUQ A;  2B3F A;  1B32 A;  3U92 A;  5L9O A;  1MH4 A;  1MY1 A;  1LAX A;  1OMP A;  1CE2 A;  3FJG A;  4RK9 A;  4BDL A;  3VXB A;  3IK6 B;  1O63 A;  1A8F A;  4ZEC A;  2CZL A;  4F2O A;  3G7W A;  3R7X A;  4OHN A;  3I5O A;  1MQH A;  2R9J A;  4QF9 A;  1TT1 A;  2ZNT A;  1S7Y A;  4IY5 A;  3UP9 A;  4TQU Q;  4HCW A;  3K01 A;  4ESW A;  3MP8 A;  1P1N A;  3TZA A;  2XXX A;  4GXA A;  4R6K A;  3M3L A;  2Q8J A;  1A40 A;  4IO6 A;  1B58 A;  4H8J A;  2XX7 A;  2QRY A;  4F29 A;  1ZBM A;  2H5Y A;  3KN3 A;  4E0W A;  5AA4 A;  3FV1 A;  2ESN A;  4KYE A;  4FE8 A;  3VV5 A;  4C0R A;  4POX A;  1A7L A;  3VLU A;  3Q27 A;  3MJN A;  2Q89 A;  1DSN A;  1SW5 A;  1AL3 A;  1LBC A;  4N07 A;  5I58 B;  2H98 A;  4IB2 A;  2I6E A;  1R9L A;  3KJT A;  1LAH E;  5TPA A;  3SES A;  2LFD A;  4OFJ A;  1B5H A;  1YPN A;  4KCD A;  4RA1 A;  1H3D A;  4RYA A;  4F3S A;  2DP8 A;  2HCA A;  4JWO A;  5TU0 A;  1ZTY A;  3Q26 A;  3CR9 A;  4R74 A;  5BUU A;  5ICQ A;  4JB7 A;  2OCU A;  2VGQ A;  2PT1 A;  4RPN A;  4KFQ A;  3OEL A;  2Z8E A;  4GXS B;  3CG1 A;  2AL4 A;  3OO8 A;  2RC9 A;  3TDJ A;  4H0W A;  3T9V A;  4DCY A;  3SDF A;  5EHS A;  3TEL A;  3IOV A;  3O28 A;  3HO7 A;  3OSQ A;  2ZYO A;  4QSC A;  5B70 A;  5JEI A;  3GBA A;  5CBR A;  1IXI A;  5DYH A;  4MFI A;  4G8H A;  1GGG A;  1OLC A;  3CFL A;  3TYH A;  2F7A A;  4JSD A;  3RLF E;  4ELO A;  1Y1Z A;  1SW4 A;  3S9E A;  1UQW A;  2OWS A;  3IR1 A;  2O84 X;  1B1X A;  1IZ1 A;  1RYO A;  5I2K A;  2OZZ A;  4BDR A;  4WXJ A;  4QFP A;  3B6Q A;  5TP9 B;  1OQG A;  2DYX A;  3OO9 A;  3L6H A;  3FVK A;  3LSF B;  2Q88 A;  2O6A A;  2Y7R A;  2DE2 A;  5DEX A;  2H25 A;  2Q2C A;  1GVC A;  2UYE A;  3CFZ A;  2DXR A;  4U1O A;  2DWH A;  1POT A;  4YKP A;  4G68 A;  2GHA A;  2X7Q A;  3IOT A;  4GFR A;  1ZIU A;  4FAJ A;  3O66 A;  1TXF A;  3MVY A;  4EQB A;  1OLA A;  4ZS9 A;  1H45 A;  2RC7 A;  2V3U A;  5H8S A;  3SER A;  5L9S A;  3G3H A;  4H8I A;  1FQD A;  2ANJ A;  4Q5T A;  3RTF B;  3PPO A;  2DVZ A;  3M3K A;  1Y3Q A;  3IO4 A;  4F19 A;  1D4N A;  1B3H A;  2B3B A;  4LZ7 A;  4LVQ A;  4DDD A;  3JYR A;  4EDP A;  3K6X A;  4NWD A;  5L9M A;  4G68 C;  3W15 C;  4P0I A;  4ZE9 A;  5AA3 A;  3PPR A;  3MP1 A;  1LLS A;  3QUJ A;  4L17 A;  3IOR A;  3TPA A;  4QFL A;  1ZMG A;  4ZE8 A;  2HZL A;  2UYF A;  3D4C A;  2Y7K A;  4EUO A;  3IAZ A;  4I9D A;  2F78 A;  4AB6 A;  1DOT A;  2NUV A;  4XTC Q;  3T66 A;  1MQJ A;  5JTY B;  4R2B A;  4OQO A;  5H8H A;  2F7B A;  2REJ A;  2F7C A;  5ITP A;  5AA1 A;  3FV2 A;  1DTG A;  4F3G A;  3S9L C;  1PC3 A;  4K3F A;  5CRY A;  1ZJL A;  5CM6 A;  5I57 A;  4F31 B;  3R6U A;  3OOA A;  1EH3 A;  1POY 1;  3H06 B;  3FXR A;  3IJO B;  3ZKK A;  1MRP A;  4NF6 A;  1NL5 A;  1O7T A;  2I48 A;  1OVT A;  1IUD A;  4GF8 A;  1PBP A;  2NXO A;  2QPQ A;  1Q35 A;  4U2R A;  1FTM A;  4XKN A;  1MPD A;  2UVG A;  2P2A A;  2OK2 A;  3LSX A;  4QSD A;  5H8Q B;  3W9W A;  3ZSF A;  5EYF A;  4YB6 A;  4QRZ A;  1H43 A;  4R75 A;  1M5C A;  1JET A;  1SI0 A;  1SD3 A;  4POW A;  4QSE A;  2VD2 A;  2OWT A;  3VE1 B;  3KOT A;  3PGF A;  3RQT A;  3IJX B;  4QFK A;  4OES A;  1B3E A;  4F3P A;  4EF1 A;  1JW4 A;  3O6H A;  2ONS A;  1SW1 A;  4P11 A;  4QFO A;  2DSF A;  2QS4 A;  1PB8 A;  2I4B A;  3SEV A;  1M5B A;  4X9T A;  4OEV A;  2I3V A;  1MXW A;  3WAF A;  3USD A;  1I6B A;  3VXC A;  5DVJ A;  4OEN A;  2FA7 A;  3ONM A;  1VFE A;  1MPB A;  1MG1 A;  1ELJ A;  2O51 A;  4EQ7 A;  3UGW A;  4FAT A;  1NFT A;  4I8C A;  1ZKB A;  2XXT A;  3QUF A;  4R2F A;  3FIR A;  3SKP A;  4ZZA A;  2REG A;  2XXP A;  4YU0 A;  3HN0 A;  1MXZ A;  4OFO A;  4TLM B;  4OZ9 A;  5KCJ A;  1LB8 A;  2A5T B;  3T22 A;  3IB1 A;  3THI A;  2QJE A;  1DMB A;  3I3V A;  4GWO A;  3WAE A;  3HPI A;  2PT2 A;  3LSW A;  3PUY E;  3PD8 A;  1US5 A;  1BP5 A;  3PMV A;  1N7W A;  4OWD A;  5IAI A;  3A3C A;  4RNS A;  4BDM A;  3ZS6 A;  2CMO A;  4PFT A;  2ZYM A;  3OMB A;  3CVG A;  4ONY A;  4LAT A;  1Y3P A;  2B65 A;  1I69 A;  3OD7 A;  3IOU A;  1B40 A;  1MY3 A;  4HW8 A;  1FCK A;  3LUY A;  3K02 A;  1M5F A;  2YPN A;  1IXG A;  2AYS A;  1Q1K A;  5I2N B;  2RC8 A;  3N5L A;  4NF5 B;  1BLF A;  1B3F A;  3O9P A;  3MP6 A;  3MPK A;  2YLN A;  4UA8 A;  3KSX A;  1UIU A;  1H76 A;  3MVX A;  3DP6 A;  3PPN A;  4U1Z A;  2O7I A;  5LOM A;  3VVE A;  3A09 A;  3RN8 A;  4PFU A;  2RIN A;  2E1S A;  3V89 B;  4ZDM A;  3GBB A;  1WOD A;  3LBS A;  5KZT A;  3OEN A;  1D3K A;  3OO6 A;  3H6T A;  1SYH A;  2DE3 A;  3BFT A;  4RY1 A;  4XIG Q;  4RK2 A;  4MLQ A;  1EZP A;  3EPE A;  1QJM A;  2I0B A;  4PFY A;  4OVJ A;  3TTN A;  1AH5 A;  4JSO A;  5A5X A;  1FQE A;  3HV1 A;  3FJM A;  4G77 A;  5H8F A;  4R73 A;  4YAH X;  3QXM A;  3TAJ A;  2DWI A;  4AB5 A;  1JQF A;  4QHQ A;  1NNK A;  1LFG A;  1SVX B;  3QYT A;  3T93 B;  4U23 A;  3MZ9 A;  3K2D A;  4NF4 A;  4WKM A;  2ABH A;  1NH8 A;  5CMM A;  3PMX A;  3TOD A;  1Z7M E;  1B6H A;  5ISU A;  2V84 A;  4OTE A;  2F35 A;  4G8M A;  4NF8 B;  4PFW A;  4X1D A;  5ITO A;  4F22 A;  4DXU A;  3MW0 A;  3C33 A;  4LZ5 A;  3DP8 A;  2QSX A;  2FYI A;  1B4Z A;  4LQ5 A;  4P0G A;  4GLI A;  3S4U A;  2I4C A;  3TKD A;  3V83 A;  1UTB B;  3RGY A;  4EXL A;  1B9J A;  3GXA A;  4LZ8 A;  4DCX A;  2Q2A A;  4FIM A;  4YB7 A;  1S50 A;  2XD2 A;  1B7H A;  2X7P A;  3KEI A;  2XX9 A;  1R1N A;  4GD5 A;  3RT8 A;  4ELP A;  4GVO A;  3PD9 A;  3Q29 A;  2IEE A;  1LAG E;  4GOT A;  2XXQ A;  1BKA A;  3C9H A;  3C32 A;  2IA4 A;  3IL1 B;  3K00 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...