1Y4CA

Designed helical protein fusion mbp
Total Genus 166
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
166
sequence length
490
structure length
480
Chain Sequence
EGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDEALKDAQTNSSSLGIEGRSSEELLKIALQEAQKTLQQAQELAKKGGGEEQLKRALKRADRNLWAAQELAKKGGGGEELLKQALQQAQQLLRQAQELAKKGGGEELLKQALQQAQQLLQQAQELAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Maltose binding protein fused with designed helical protein
publication title De novo design of an IL-4 antagonist and its structure at 1.9 A.
pubmed doi rcsb
source organism Escherichia coli
molecule tags De novo protein
total genus 166
structure length 480
sequence length 490
ec nomenclature
pdb deposition date 2004-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.660 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) IL-4 antagonist (De novo design) like domain 1y4cA03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1y4cA02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1y4cA01
3T66A 3TCHA 1CB6A 4UACA 2HFBA 3M8UA 1XT8A 2CZLA 4H67A 4KYEA 1RYOA 1IXHA 2D21A 1LCFA 3VV5A 3G3IA 3KN8A 4YB5A 1A99A 1FQFA 2B3BA 5K2YA 1NH7A 5CMMA 1J1NA 3RY3A 5ISUA 3TPAA 1MDQA 2I3VA 1URDA 4EQBA 1M5FA 4FAJA 2PYYA 2Y7RA 4F3BA 3O2AA 4OZ9A 3MVXA 3N6UA 3KFMA 4ZEIA 4PP0A 3K6XA 4ZS9A 3HO7A 1JVXA 1UQWA 4G68A 1ZMGA 5FHNA 4U21A 1BKAA 3G7WA 2DWHA 4HCYA 4X1DA 3QK6A 4RK2A 2AIXA 4F3SA 2HZ8A 3IOUA 4JXIA 3B6QA 3PPPA 3IOVA 3GLBA 2I0CA 5K2XA 4U2RA 3UK4A 4IGTA 4OVJA 3MZ9A 3KGCA 2V3QA 4G4PA 4YKKA 3IJOB 3KSXA 4R73A 4PFYA 4P0GA 4QFKA 3CFZA 3N5LA 4BDLA 2HCAA 3ECRA 3PUVE 3VLWA 1R1NA 1B0LA 1DTGA 4F39A 2H25A 3TTKA 2XXYA 2XXVA 3KJTA 3MC2A 4KI0E 1TFAA 4TLMB 4RJZA 1JW1A 4EQ7A 1YCJA 3GBAA 2HZLA 5H8HA 1MXXA 2P2AA 4NTLA 1P1OA 4F19A 2WKYA 3CVGA 1BP5A 4U23A 5TP9A 5LOMA 4FEBA 2ZMBA 2LFFA 3TTMA 3TTLA 4OQOA 1JETA 1LAFE 4R6YA 2F5XA 4ISUA 3DP6A 2XXWA 3A3CA 3EHTA 1N3XA 2W7YA 3MBPA 1OLAA 3IK6B 4YMAA 3JV9A 4OETA 3IORA 3A3UA 2QMWA 1B7ZA 4ND9A 3VVDA 2AL4A 3OD7A 1NMUA 4IO4A 1B1XA 3O6HA 4F2QA 1B05A 1RKMA 3HHGA 3O66A 3G3HA 4TLLB 3B6TA 2I3WA 3E9XA 4QHQA 5KDTB 1YPNA 3FXRA 2XXXA 4YICA 1D4NA 1AL3A 2AL5A 3PPRA 2RKMA 5F7VA 5DVIA 3O28A 4ELQA 2UVHA 3USDA 5ITOA 2CMOA 5AA1A 3RT6B 3T9UA 4ELPA 3VXCA 3KG2A 4ZECA 4L17A 2VP1A 3CG3A 2F6PA 1NFTA 3MVWA 2OK2A 1SW1A 3R26A 1TWYA 3UGWA 1H3DA 1ZIUA 2VHAA 1AOVA 4DIGA 3O29A 1Q35A 1MRPA 1B5IA 1DMBA 1JVYA 1XS5A 4EF2A 3QAXA 2LAOA 2XD3A 4NF6B 2RC8A 3MZ1A 1NNKA 3U72A 5AA3A 4GL0A 3U94A 4F31B 2ALUA 2OBGA 5I57B 3OMBA 5KCJB 4KQPA 5M2VA 4I9DA 4JWXA 1IIWA 2O1MA 4Q5TA 3IAZA 1I6BA 3DM0A 5FTIA 3I5OA 3M3FA 4IO6A 2I4BA 4M4GA 3VVFA 1B6HA 3L6GA 2I58A 4ZEKA 1H43A 3LSWA 2DE2A 2F35A 1L5TA 5KZTA 4XKRA 4WKMA 4GD5A 5CC2A 2O6AA 4LQ2A 1GVCA 3E4RA 1YTVA 3MVZA 3U92A 1QJMA 1AH5A 3TCFA 1OLCA 1LGBC 3VLUA 4OFLA 4IO7A 3RTFB 1OVTA 1A54A 3K02A 4BDMA 1D9YA 4PE5B 4JBZA 1MPBA 2NUVA 4PFTA 2BJJX 1ZTYA 4LATA 3CSGA 3Q27A 3G3JA 3IB0A 2I0BA 3K0VA 4YB6A 4G8HA 1A40A 4THIA 4P0IA 4GIZA 3MZBA 3KJ7A 1N76A 4QFLA 2IEEA 4U1ZA 3V8XB 1I69A 1CE2A 4OERA 4NF8A 4MF3A 1FTKA 3EHSA 3SESA 2PBWA 3M3LA 1MQHA 4GXSB 2XD2A 3CFXA 2GHBA 4IO3A 5TPAA 3FZVA 1MY1A 2QL3A 4OXVA 4MH5A 1DTZA 2XXRA 1MXYA 1ZJLA 1SVXB 3MP6A 3V89B 3PUYE 2XXPA 3FV1A 4KFQA 3RNNA 2B65A 1B7HA 4I1DA 3IO4A 4IY5A 4OHNA 1US4A 2P1SA 1UTBB 3PD8A 1OQGA 4QFOA 2ZNTA 3HHFA 4IO2A 4LONB 2AYSA 1R9QA 4QSEA 1IUDA 3OO9A 3TZAA 1M5BA 3EN3A 4ZEFA 1I6AA 2YJPA 4OFOA 3IOWA 5CMKA 4OTEA 3OENA 2DQVA 1VFEA 2LFDA 5CMBA 3C35A 4EUOA 3GXAA 4BLAA 5A5XA 4XXUA 1Z7NE 5JEIA 4RXLA 4OEVA 1S50A 3MPLA 4P11A 1B51A 2PMSA 4OENA 4OFJA 1H44A 3GZGA 1GV8A 3EF7A 1QUIA 4ZEBA 3FVKA 2RC9A 3PMWA 2HXWA 1SW4A 2HQ0A 2GFEA 2PX1A 2ESNA 1LB9A 1ZBMA 2Z23A 1B3LA 1USYH 3FXUA 2DWIA 1ZU0A 1M5CA 4I62A 3VFJA 2V93A 4H8IA 4FIMA 1O64A 3LSLA 3MVYA 4OEUA 4OESA 4YMBA 5I58B 5FTHA 3TQWA 3SEXA 3IO6A 1S9TA 4O3CA 4H65A 2RC7A 5AA2D 3TEPA 4G2ZA 2H4IA 2QSXA 2ZNUA 1Z7ME 2VOZA 1EZ9A 4DXCA 2HAUA 2REGA 4GF8A 3R6UA 1B9JA 2NVUB 1XHYA 3H6WA 4Q8RA 1BLFA 1PBPA 4EF1A 4X1BA 1OQHA 2REJA 1MQIA 2XHDA 3IR1A 1FQAA 3MAMA 3QYTA 3BFUA 1MM7A 1POY1 4C0RA 1Y4TA 2F78A 1B0HA 1Y1MA 4U4SA 3TODA 5I56B 2F6GA 4H8JA 5CMCA 1MG1A 3RGYA 4HS7A 3D4GA 2UYFA 4F2OA 4GQOA 3MP8A 4G77A 1PB7A 4GLIA 3T93B 2D3IA 3C32A 2OLBA 3SEVA 1KWHA 3FD3A 1II5A 3ZKKA 3M3KA 2UYEA 1SW5A 4LUBA 3LBSA 1B46A 3H6VA 1LFHA 1S7YA 2XXQA 4O3BA 5KDTA 1OVBA 1MY3A 3OEMA 4ZDMA 3UORA 4LQ5A 1LAGE 4G8MA 1LCTA 2O1LA 5H8QB 4GXAA 3C36A 1B3EA 1JNFA 4NMYA 1IITA 3LUYA 1LSTA 2I49A 3MUQA 1FW0A 1EH3A 1T0KA 4KYSA 1JEVA 5I59B 4NF4B 4EDPA 2ONKE 3PMXA 4AQ4A 2ANJA 3C34A 4QRZA 1MPDA 1B40A 2DXRA 2HEUA 4NF6A 3KZGA 1IXCA 3ODBA 1D3KA 3U8VA 2QPQA 1DPEA 5I57A 5KCJA 4H0WA 2QS2A 1Y1ZA 1UTHB 1YAEA 1MXUA 5AA2B 4F3GA 1SYIA 3DP8A 2DS9A 3MQ9A 3UIFA 2XXUA 3MPKA 1HSLA 5CI5A 4RPOA 4X9TA 1AMFA 2A5SA 4BDOA 2PT1A 5I2KB 3S9LC 5H8SA 2UVIA 1JW4A 1P99A 4ELOA 2H99A 1IQ7A 1DPPA 1EZPA 5H8NB 1ELJA 1R9LA 1NNPA 2DXYA 2O7UA 4AB6A 1US5A 1VR5A 4BDNA 1NNTA 1NNFA 2P0SA 4ZZEA 3Q25A 1IXIA 3OO7A 1PB8A 4TOZA 2UVJA 1VE4A 4E0WA 3CIJA 4R72A 4YB7A 3K6VA 4U4XA 3WAFA 2UVGA 1O7TA 3OSQA 2V25A 3PUZE 3PPQA 4R74A 4RK9A 3QIMA 4DZ1A 4Z0IA 4LA9A 1MQDA 4IGRA 1IZ1A 4ELRA 4C1UA 2OZZA 3OO6A 3K01A 2A5TB 2ZNSA 2GH9A 3TKDA 5J1DA 1EU8A 1R6ZA 2F7AA 2ZXTA 3H7MA 2ABHA 3LC8A 1MXVA 3T9XB 3C33A 1URGA 2OWSA 1FQDA 2RCBA 2PVUA 1N7XA 4LVQA 3S2VA 3O6IA 4F1UA 3OOAA 4BDRA 1GR2A 3THIA 2R71A 3QSLA 4NF5B 3FGSA 1WODA 3GBBA 4EXLA 4XKPA 4RPNA 3QUJA 3L6HA 2ONSA 1QKBA 4FORA 1B3GA 5ELVA 1Y4CA 2Y7WA 1SI1A 3PGFA 2NWJA 3G3KA 4NE4A 1UTBA 1B32A 4N07A 1WDNA 3SERA 1JW5A 4U22A 1EZOA 4ESXA 2Z22A 4RA1A 2F97A 4TQUQ 3VLVA 2DE4A 1AIVA 3N6TA 3K6WA 3CRBA 1N04A 2FYIA 3DLNA 3FV2A 3H4ZA 3DELB 4ZZAA 4WEDA 4ZE9A 4OMBA 4I8CA 4XTCQ 5HM4B 4AB5A 4H6DA 3VVEA 4Z7EA 4RY1A 3WAEA 3U93A 2O69A 4KR5A 4WXJA 5CBRA 1SD3A 5L8DA 1XC1A 1HSJA 1Y3NA 1F9BA 3C31A 4YKJA 3SEWA 1ZLQA 2DOJA 3SETA 5H8FB 3G3FA 3RTWB 3TTNA 1UIVA 4XIGQ 4ESWA 3FASA 3D4CA 2DWJA 3VXBA 2H98A 4OYVA 1QKAA 2QS4A 5JK4A 2Q88A 3FJMA 3S9EA 4R9FA 3RT8A 4JSOA 1FTLA 3TDJA 2DVZA 5I58A 1MXZA 1NL5A 1B52A 4QFPA 2PT2A 2G93A 3B7DA 3E13X 3OSRA 4F3PA 1USYE 1MS7A 1TFDA 1Y9UA 2F34A 4H5FA 2QMXA 1XVYA 3DP4A 3K1MA 1JEUA 1D9VA 2KLFA 1PC3A 4C1TA 3RPWA 2E0SA 1H76A 4LZ5A 2NXOA 5I56A 4F1YA 3TMGA 3BFTA 3K00A 1QVSA 2DP8A 2Q8JA 5IAIA 3HSTA 2D5WA 3K4UA 3IB1A 2F8DA 2Z8EA 3CI8A 2O51A 3CFLA 4GWOA 2O68A 3PMVA 3KN3A 3KBRA 3UA8A 1MQGA 3Q28A 3TYHA 5AA4B 4G68C 4HCWA 1LB8A 1IXGA 1QULA 2E1SA 3OO8A 1FQEA 4JB7A 1A8FA 4DE8A 2DE3A 3EQ1A 3FJ7A 2FNCA 5DEXB 3R7XA 5I2NB 4R6HA 1MQJA 3T22A 5H8QA 4YKPA 3V83A 3FVNA 3P7IA 1A8EA 3SKPA 1PEBA 5JTYB 2V3UA 5HBCA 5I59A 4NF4A 3C9HA 3KEIA 1GGGA 5HPQA 3ILUB 5TU0A 2GHAA 2RINA 2X7QA 1SW2A 2YPNA 1MY2A 4QFNA 5ICQA 4JSDA 1SDXA 3TQLA 4R6KA 4YAHX 3T96B 4RNSA 2GRVA 1FQCA 1SYHA 1B5JA 3K1PA 3O97A 2QS3A 4QSCA 2V3TA 4JWYA 3UP9A 1N0TA 1FTJA 4R2FA 5A5XB 2Y7PA 5DYHA 4F1VA 4MBPA 2OJTA 4F18A 2R6GE 3K6UA 1UTHA 1PBQA 4YU0A 3F11A 1B7UA 5FHOA 5AA2A 5ICTA 2DSFA 4UA8A 2Q89A 4DXBA 3CSBA 3EPEA 3SDFA 3FIRA 1A7LA 3S9NC 1O63A 1B3FA 3TFLA 2O7IA 2ZYMA 3O6GA 3EHUA 4IB2A 3O9PA 5I2KA 5FHMA 4K3FA 5DT6A 3MW0A 3I3VA 4JDFA 3JZJA 5CRYA 3QUFA 3HCQA 3FVOA 4MLQA 2ZYKA 1MY4A 5H8NA 4WEPA 4IY6A 4E0XA 1PB9A 4GVOA 3BBRA 5AE4A 3W9VA 3IOTA 4YKIA 3ZS6A 4XKQA 1NKXA 2YLNA 2Z8FA 5IKBA 4HW8A 3LR1A 1MXWA 4GRKA 1N3WA 5L9MA 4NWCA 5CBSA 1TT1A 4G68B 5EHMA 2X7PA 3IL1B 2G29A 3S4UA 3U1OA 1ZKBA 3I6VA 4ONYA 2M8CA 3PD9A 2Q2CA 2ZYNA 3MP1A 1N7WA 3FXQA 1P1WA 3H6TA 2A5TA 1M5DA 1MH3A 4RYAA 1VFDA 3H3GA 1DSNA 4R75A 4KCDA 2Y7KA 2THIA 1POTA 4ZEDA 4NF5A 1UIUA 1VSOA 3UN6A 1BIYA 2H9BA 1OMPA 3PPOA 4GL8A 5I84A 3PV0E 2FA7A 3G3GA 4KCCA 4EXKA 1GTKA 1IEJA 3TELA 1H45A 2RCAA 1URSA 1LBCA 4Q30B 3Q29A 4FATA 1JQFA 3B6WA 3KSJA 1ATGA 5H8HB 4GFRA 2F7BA 3A09A 4IO5A 3N26A 3FJGA 4N6PA 3JYRA 5BUUA 3RQTA 1B2HA 1B58A 3KN7A 2IA4A 5L9OA 5TP9B 3TAJA 1Q1KA 2I4CA 3HV1A 2VD2A 4LZ7A 3IB2A 1NH8A 4OWDA 1MY0A 3W15C 5EYFA 4QSDA 5BWJA 4DLDA 4KPTA 1A55A 1SQYA 1Y20A 3OELA 5L9SA 3QXMA 1LBBA 3CG1A 1P1NA 1BTJA 3OXNA 4PFUA 3PPNA 4LZ8A 1TXFA 3H6UA 1QUKA 4O3AA 3LSXA 1MDP1 4XKNA 3K2DA 3K1NA 1FTOA 5H8FA 3E3KA 3N94A 2VGQA 1B3HA 1M5EA 2QJEA 1RYXA 4F22A 4H1XA 5B7DA 1B4HA 3Q26A 2Q2AA 1OIBA 2Q9TA 1LAXA 3VDFA 3MJNA 4FE8A 4HTGA 2UXAA 3RLFE 2OWTA 1FCKA 5DVFA 2DVCA 4KHZE 2Z8DA 1SBPA 2Y7IA 3ONMA 4EQ9A 3HPIA 3LSFB 4U1OA 2VD3A 1I6QA 3H06B 3FUZA 1QUJA 4M1VA 3FVGA 4KYDA 1SI0A 4DCXA 1FQBA 1WVJA 3AXFA 4X48A 2R9JA 5EHSA 4F29A 3OEKA 3C4MA 2XX7A 4ZE8A 3ILTB 4JWOA 2NOOA 1Y3PA 1LLSA 4POXA 3RN8A 4MFIA 2I6EA 4POWA 5DTBA 3TCGA 3FATA 1PDAA 3SEUA 2ZYOA 2I48A 5F1QA 4R2BA 2F36A 1XOCA 4DXUA 4G8NA 2XXHA 1FTMA 3VE1B 5AA4A 1B1HA 4H5GA 1MM6A 2Y84A 3U8QA 2HZKA 2B3FA 1N84A 4KD5A 5B70A 3PUXE 4NEDA 1B5HA 3V5AA 2F7CA 3W9WA 1DOTA 5DEXA 2QRYA 5I2NA 2HAVA 2H5YA 2X26A 4R9GA 4PQJA 3H03A 5JTYA 3IJXB 2XXTA 1MPCA 3IX1A 1HSEA 1LFGA 4NWDA 3MWBA 2ONRA 3KOTA 5DVJA 4ECFA 1B4ZA 3T9VA 1MH4A 1LFIA 1QW0A 3PUWE 2QS1A 3PU5A 3RUMA 4LP2B 5CM6A 2XXIA 4FJPA 3ZSFA 2XX8A 3TTRA 4Q0CA 2RF1A 2V84A 4DCYA 2XX9A 3ZKLA 3BKIB 2DWAA 1Y3QA 3T9HB 4NF8B 4YZZA 4FEDA 1XVXA 2O84X 3KOSA 3SEYA 2OCUA 5ITPA 4PETA 4GOTA 1LAHE 4BDQA 3TUSA 4FECA 1P1QA 4QF9A 1ANFA 3S9MC 3CR9A 3HN0A 4MLVA 4N13A 5TPAB 1P1UA 2DYXA 4DDDA 4PFWA
chains in the Genus database with same CATH superfamily
3T66A 3TCHA 1IMDA 3N24A 1CB6A 4UACA 2VCBA 4DBRA 1NV4A 2HFBA 3NKEA 4CS9C 1OXBA 2DB4A 1SF8A 3M8UA 1OKKA 1XT8A 1YAUO 2CZLA 4H67A 1CNQA 4KYEA 3ZVRA 1RYOA 3ABKC 1IXHA 2D21A 1GGQA 3L1MA 1W2WA 2LSEA 1LCFA 3VV5A 3G3IA 3KN8A 4YB5A 1V74B 4DI3D 1A99A 1OW7A 1FQFA 2B3BA 4C3BA 1XZQA 2OKUA 5K2YA 1NH7A 5CMMA 1J1NA 3RY3A 1U0BB 5ISUA 4WGYA 3TPAA 4ULVA 1MDQA 2EPOA 1BR4A 2I3VA 5EQ7A 3B0UX 3NOHA 1URDA 4EQBA 2LP4A 1M5FA 3QW1A 4FAJA 2PYYA 4GX3A 4U5EE 1MNEA 2Y7RA 1G0IA 1FPJA 3B9QA 2GA0A 2IM8A 2XXKA 4F3BA 3O2AA 4OZ9A 3MVXA 4JEBA 2XL8A 3N6UA 3KFMA 3UMKA 2OJQA 3AQBA 2KYHA 4ZEIA 4PP0A 4Z9IA 4O7GA 5EYHA 3K6XA 4ZS9A 3HO7A 5L0HA 3FOPA 3W8IA 1JVXA 1UQWA 2R05A 1G4US 1ZYRF 3ZWIA 4G68A 2ZXPA 1ZMGA 3QVZA 5FHNA 4U21A 1BKAA 3G7WA 2DWHA 2FGYA 3H2VA 4QDLA 3S28A 4HCYA 4DVYP 4X1DA 3QK6A 1Q0KA 3DD7A 5B3IA 4RK2A 1RCPA 3QZCA 2YLDA 2QFLA 1CGNA 2KW3C 2MHRA 4YK5A 3MLGA 2AIXA 4F3SA 2EPMX 2HZ8A 3IOUA 2QY9A 4JXIA 3B6QA 3KC0A 3PPPA 1M57C 3IOVA 3GLBA 1PD1A 2J9UA 2KQZA 2WZFA 1ZHTA 3C8GA 4N81A 2I0CA 5K2XA 4U2RA 1WATA 3UK4A 4IGTA 4MNDA 2XLOA 4OVJA 4DJ9A 1VLSA 4IR8A 2X51A 2TMVP 3MZ9A 1Z23A 3IEEA 4OA4A 4H4KC 3KL4A 1T6QA 1OR2A 3KGCA 3UNGC 2V3QA 4G4PA 4HFKB 4YKKA 1ZHWA 3IJOB 3IQ6A 3KSXA 4R73A 2CNWA 4IWBA 3IQCA 4PFYA 4P0GA 4QFKA 4JTDB 5BQHA 3CFZA 3N5LA 4BDLA 2Q9BA 4PFPA 4MHFA 2HCAA 2KK1A 3ECRA 3DAFA 3DZAA 3PUVE 3VLWA 1R1NA 3EZIA 5A6AA 1GS9A 2WYPA 1B0LA 4PAFA 1DTGA 2VPOA 4F39A 1KNYA 2H25A 2ZD9A 3TTKA 3NDBB 2XXYA 2L5VA 2XXVA 3KJTA 3MC2A 5KYUA 4KI0E 2QE9A 3O39A 2NUTA 3MYFA 4IAQA 4JCZA 4KBLA 1TFAA 2CZIA 4TLMB 4RJZA 1JW1A 4H45A 3RQFA 4N6KA 5E3CA 4EQ7A 2KQ9A 2QVVA 3NMIA 1YCJA 1RMVA 3GBAA 3R7CA 3O6XA 2HZLA 1G5ZA 5H8HA 3JYYA 1D1AA 1MXXA 2PNOA 1V4AA 2P2AA 4XEVA 4NTLA 3UGPA 1P1OA 4F19A 2OEXA 2L7AA 2WKYA 3CVGA 1BP5A 4U23A 4PJJA 5TP9A 5LOMA 2YEVA 4FEBA 2ZMBA 2LFFA 3TTMA 4HE2A 3TTLA 2WVNA 4OQOA 1JETA 3DXJF 1G0HA 2IBFA 3EQLF 1LAFE 4G78A 4R6YA 1MMNA 3AG1C 2F5XA 4ISUA 3FBPA 4FX5A 3DP6A 2XXWA 3A9CA 3A3CA 5BQGA 4CS8C 4DRIB 4G7ZF 1Z63A 3EHTA 1N3XA 2W7YA 3MBPA 3A29A 1OLAA 3IK6B 4YMAA 2QLAA 1JP4A 2YHSA 1LPEA 1RXQA 1AVOB 3JZ0A 2LIGA 2V26A 3JV9A 4MCOA 4OETA 2J9VA 4YT2A 3IORA 3A3UA 3AG3C 1UG7A 2WEFA 1ZHYA 2QMWA 1B7ZA 1NFNA 4ND9A 3S29A 4YWQA 2H7BA 2HV7A 3VVDA 1QKRA 4AE4B 1V54C 2AL4A 3OD7A 3MBGA 1NMUA 4GBVA 4IO4A 2R7WA 1B1XA 3O6HA 4R32A 4F2QA 2R9RB 4CS7A 3OWTA 1B05A 3IQTA 1TR2A 2OCCC 2J7PD 2R02A 4A2NB 3KPHA 3ZIBA 2YL7A 1RKMA 4P47A 2W4MA 1LVKA 1NFOA 4N91A 1NV3A 3HHGA 2Y3GA 4OD5A 3O66A 3G3HA 4H46A 4TLLB 3AGTA 3B6TA 2I3WA 3LNRA 1FNTc 3E78A 3E9XA 5ESYA 1NBBA 2P3NA 4QHQA 3N2ZB 3NG1A 2XWVA 2Y69C 1YPNA 5KDTB 3FXRA 2XXXA 4YICA 1D4NA 1AL3A 2AL5A 3PPRA 3FDQA 4PJLA 5E2QA 2RKMA 5F7VA 5DVIA 3HJCA 3O28A 2KR0A 1M2VB 1FBCA 4ELQA 2UVHA 3USDA 1VDWA 4JVDA 1FPIA 1QZXA 5ITOA 1WTYA 3X2QC 4E0IA 2CMOA 4XPYA 4W8PA 3MYIA 5AA1A 3RT6B 3T9UA 4ELPA 3VXCA 1LKXA 3KG2A 3EZHA 1NU7D 4ZECA 4L17A 1RJ9A 2A69F 3K7DA 2VP1A 1J8YF 2EPNA 3CG3A 2F6PA 1G8XA 5COFA 1NFTA 2YWAA 3MVWA 4O7IA 3RIPA 2OK2A 1SW1A 3R26A 4P8BA 1MMDA 3A11A 1TWYA 3UGWA 2J7PA 1JOGA 2AVKA 4AS5A 3GM3A 1H3DA 4K1OA 1ZIUA 2VHAA 2Y39A 1DK4A 4UABA 1ZW2A 4DIGA 1AOVA 3O29A 1Q35A 3DM5A 1MRPA 1B5IA 4I44A 2XLMA 1DMBA 1JVYA 1XS5A 4BJ1A 4EF2A 2ZZVA 3QAXA 2LAOA 2XD3A 4NF6B 1XWJA 3QMFA 1NV6A 3ZTMA 2RC8A 3S9OA 3MZ1A 4XTKA 1NNKA 1VB5A 3FXHA 3U72A 5AA3A 4PACA 4NQ8A 3U0CA 4GL0A 3U94A 3RKOF 4L6RA 2ALUA 2OBGA 4F31B 3PTYA 1OCRC 5I57B 3OMBA 3ZQVA 5KCJB 3EGXB 2Y3HA 4YJWA 1HW1A 4KQPA 4YL3A 4NX1A 4LLEA 5M2VA 4I9DA 4JWXA 1IIWA 2O1MA 4Q5TA 2A0BA 2VB6A 3IAZA 5ET7A 4W8KA 1I6BA 3ECSA 3DM0A 3LLKA 1LE4A 5FTIA 3I5OA 4BJ6C 3M3FA 4IO6A 1BR1A 3L8JA 2I4BA 4M4GA 2J9WA 4P1EA 3T4RA 2D4UA 3VVFA 3DJUB 1B6HA 3L6GA 1YA9A 2WZLA 3K6BA 4EWCA 2I58A 4I1MA 4ZEKA 2KSFA 1H43A 3LSWA 3U3BA 1OW6A 2DE2A 2F35A 1L5TA 5KZTA 4XKRA 4WKMA 4GD5A 5CC2A 2O6AA 2Q74A 3LUZA 1FPFA 1JPNA 1CPRA 1SR2A 4PFWA 4LQ2A 1Q0MA 1GVCA 3E4RA 1YTVA 4JJFA 3MVZA 1QLEC 3U92A 3T6JA 1AH5A 1QJMA 3TCFA 1OLCA 4BJ5A 1LGBC 3VLUA 4OFLA 4IO7A 3RTFB 1OVTA 3B0PA 4LACB 1A54A 4OIRF 3K02A 3EG9B 2IXPA 4BDMA 1D9YA 4PE5B 3H2UA 4P6IC 4JBZA 2B0JA 4NTBA 4XLNF 3Q7LA 3QMKA 1MPBA 4FAPB 2KJGA 4XWJA 2NUVA 4U5HA 4PFTA 2KC3A 2BJJX 2NPUA 4OINF 3SYNA 4U5DE 1ZTYA 4LATA 4LDQA 3FAJA 3CSGA 3Q27A 3VYWA 3G3JA 3IB0A 2W4BA 1BBHA 2XLHA 2HFIA 2I0BA 3K0VA 4YB6A 4G8HA 1A40A 4THIA 4P0IA 3TULA 4GIZA 4FESA 3MZBA 3DI5A 3JSZA 3KJ7A 4PC9A 1N76A 4QFLA 3DAGA 2XRHA 2IEEA 4U1ZA 3V8XB 5EQ9A 1I69A 4NCQA 4U9DA 5D91A 1CE2A 4PFBA 4OERA 4NF8A 2I8BA 4GWUA 4MF3A 1FTKA 3EHSA 3SESA 1TFKB 4K0DA 2YRFA 5IZ3A 5DQZA 2ETSA 3HNLA 2PBWA 3M3LA 1MQHA 4LDKA 1Z5ZA 1AWBA 2R7SA 1J8MF 4CX9A 4O79A 4MVUA 3FHDA 2WVOA 2XD2A 3CFXA 1M56C 2GHBA 4GXSB 1WGWA 3EPVA 4IO3A 4ONSA 1FPEA 5TPAA 3FZVA 1MY1A 4P9KA 2QL3A 4GX6A 4OXVA 4MH5A 1DTZA 1E84A 4KXPA 2XXRA 1D1BA 4MW3A 5T3TA 2VPNA 1E2XA 1MXYA 1ZJLA 4OVRA 1FPBA 1SVXB 3MP6A 2XS1A 3V89B 4XEFA 3PUYE 2XXPA 1YVIA 3FV1A 4KFQA 4DRHB 3RNNA 1OR3A 2B65A 4PCDA 2J0XA 1B7HA 1XZPA 1IW7F 2GQ1A 4DVZA 5K0IA 2UUHA 4I1DA 2L6FA 3IO4A 4U5GA 3TOLA 5KYXB 4IY5A 1YYJA 4MVQA 4OHNA 2Z15A 3AGUA 2HSBA 1US4A 1G4WR 3Q7GA 2P1SA 1ZVZA 1UTBB 1NLXA 3PD8A 3DWWA 1S7ZA 1OQGA 1VYIA 4QFOA 2QTVA 4MVOA 2ZNTA 3HHFA 4IO2A 4Q5SF 2LCHA 4LONB 5F24A 2AYSA 1R9QA 1NZEA 3E70C 4QSEA 2PFYA 1IUDA 3OO9A 3TZAA 1M5BA 4LLCA 2XM0A 5E33A 3EN3A 4ZEFA 1I6AA 3K1IC 2YJPA 4OFOA 3IOWA 5CMKA 4OTEA 3MYUA 3OENA 5L3QA 2DQVA 2FIXA 3LV0A 1ORSC 2YVKA 2DGJA 1VFEA 2LFDA 4YT4A 5CMBA 5KYYB 3C35A 4EUOA 2RD9A 3GXAA 2ASRA 1NUYA 4BLAA 5A5XA 2IYLD 1EYJA 2A0UA 4XXUA 2LK4A 1FPLA 1Z7NE 5JEIA 4Q7CA 4RXLA 4OEVA 1R4TA 1S50A 3MPLA 5DS4A 4P11A 1B51A 2PMSA 4OENA 4OFJA 1O87A 3S90A 1H44A 2Q3TA 3GZGA 1H6GA 2J46A 1GV8A 2R03A 3I4UA 3EF7A 1QUIA 4ZEBA 3FVKA 4EIYA 1UFBA 2RC9A 5HV9A 3PMWA 2LD6A 2HXWA 4GX4A 1SW4A 2HQ0A 2OJED 4EUKB 4PFOA 2GFEA 1TKNA 2BC5A 2PX1A 5J16A 1FFHA 2ESNA 4XEKA 1LB9A 1SPIA 1ZBMA 2Z23A 1NV5A 1B3LA 1USYH 3FXUA 1HMOA 2DWIA 1ZU0A 1M5CA 4I62A 3VFJA 3T6BA 4MEVA 1MQVA 3SXMA 3ITFA 2V93A 1FAPB 4H8IA 4M63A 4FIMA 1O64A 5B1BC 3SEOA 4PDHA 3LSLA 3MVYA 2JD3A 4OEUA 4XPXA 3BRJA 2XLEA 3BEHA 2EIKC 4OESA 4YMBA 4LN5A 5I58B 2EPLX 5FTHA 3TQWA 3SEXA 2HKVA 3IO6A 2F3DA 1CGOA 1S9TA 4O3CA 5EQAA 3QW0A 2RC7A 1NV7A 4H65A 5AA2D 3TEPA 4EBKA 4G2ZA 2HV6A 3H65A 1LBYA 3ASOC 2H4IA 2QSXA 3SXZA 4EKWA 2ZNUA 1Z7ME 2B4MA 4G61A 5A6BD 2VOZA 1EZ9A 4DXCA 3LS1A 2WVQA 2HAUA 2REGA 4GF8A 5EYGA 1N1CA 5KYWB 3R6UA 1B9JA 2NVUB 1XHYA 3H6WA 2HMQA 3UMHA 1BLFA 4Q8RA 1HY5A 2XSEA 4DOZA 2R7TA 1PBPA 4EF1A 4PGPA 4J32B 4X1BA 1OQHA 5A69A 2REJA 1MQIA 2XHDA 2PFZA 3IR1A 1FQAA 3MAMA 1IMBA 3QYTA 3BFUA 1BDJB 1MM7A 1POY1 4C0RA 1Y4TA 2ZXRA 4CS9A 4N17A 3NMJA 2F78A 1B0HA 1Y1MA 4U4SA 4PF6A 3TODA 4ANJA 5I56B 2F6GA 3HTKC 4H8JA 3ZQYA 4JURI 4N8YA 5HSWA 5CMCA 1MG1A 1TWHA 1VYKA 3RGYA 4HS7A 3D4GA 1LI7A 2UYFA 1ZU4A 4AL0A 4AE4A 2YZSA 1EI7A 4F2OA 1PD0A 4GQOA 4N06A 3MP8A 4G77A 1PB7A 2PX3A 3SP1A 5L0GA 4GLIA 3T93B 2D3IA 2DI3A 2J8WA 5BQIA 4QI0A 4WJ0A 3C32A 2OLBA 3SEVA 1KWHA 3FD3A 4U5CE 1II5A 3ZKKA 3M3KA 4GWZA 2UYEA 1SW5A 4YL1A 4LUBA 1FJ6A 3LBSA 3WG7C 1LBWA 3C8ZA 1B46A 3H6VA 4GBWA 1LFHA 4I1OB 4WGZA 3ZTZA 1S7YA 2XXQA 2GFHA 4O3BA 4RDAA 4EBBA 5KDTA 1OVBA 1MY3A 5L0IA 1V55C 2CYDA 5DLJA 3OEMA 2NSGA 4ZDMA 2ZZXA 3UORA 4LQ5A 1LAGE 1QGXA 4G8MA 1LCTA 3S0XA 3F46A 2O1LA 5H8QB 4GXAA 4OVPA 3C36A 1B3EA 1JNFA 1RDYA 5I5PA 4NMYA 1IITA 4NC3A 3LUYA 2H7VC 1LSTA 2I49A 3MUQA 3C63A 1EH3A 1FW0A 1T0KA 4KC9A 3S27A 4KYSA 2M64A 1JEVA 1QPUA 1SYQA 5I59B 4NF4B 3IFCA 3IQ5A 3LESA 4JRZA 2JX0A 1DOVA 2XLDA 5D92A 3T0JA 2LQGA 4EDPA 1YXIA 1YDIA 2ONKE 4GEHA 1EA8A 2R7XA 3PMXA 2L6HA 4AQ4A 3T9OA 2ANJA 3C34A 4PBQA 4QRZA 1MPDA 4NY3A 1OCZC 1B40A 4C3DA 3CAXA 4CIPA 2OX3A 2KNHA 3TK0A 2DXRA 2HEUA 4NF6A 3KZGA 3C7JA 2Y5LA 1IXCA 5CI9A 2V4CA 3ODBA 1D3KA 1RDXA 1YA7O 3U8VA 2QPQA 1DPEA 5I57A 4LDRA 5KCJA 3EGXA 4H0WA 4JE9A 5A5LA 2QS2A 2ICWG 4O8MA 1Y1ZA 4DXWA 1UTHB 2W9YA 4HE1A 5DW8A 3LEVA 1YAEA 1FTAA 2XLWA 4JJGA 2CZKA 1MXUA 3US6A 4C3EA 5F5FA 5AA2B 3HNKA 4F3GA 1VTMP 4MNIA 1SYIA 3DP8A 2DS9A 2FFHA 4NAPA 2PX0A 3LNMB 2XA5A 3MQ9A 3C18A 4MW8A 1NV0A 3UIFA 2PF4E 1A41A 1WWPA 3KC1A 3W2WA 3PCVA 2XXUA 3MPKA 5DQTA 1HSLA 2QNLA 1VK5A 5CI5A 4RPOA 4X9TA 1AMFA 2A5SA 4BDOA 4H54A 2PT1A 2BE5F 5I2KB 3S9LC 3W4YA 4MNCA 3AG2C 5H8SA 3FVYA 2UVIA 2H8AA 1JW4A 5EHHA 4CS8A 1P99A 4ELOA 2G3KA 2H99A 4P9FA 1IQ7A 1DPPA 3U2LA 3C62A 1KA0A 4KNVA 1EZPA 4IB4A 4EBJA 1YARO 3GEHA 1A7DA 4GQHA 5H8NB 2AWCA 1VOMA 1ELJA 2I15A 3KMIA 1R9LA 1NNPA 2DXYA 4J30B 2O7UA 4MTGA 3M1CB 3RVZA 1I4YA 4AB6A 1US5A 1VR5A 4BDNA 4IAOA 2GDCA 1NNTA 1NUZA 1NNFA 5FZTA 2P0SA 4MTOA 4ZZEA 3Q25A 4MX6A 3KYIA 3U3FA 1IXIA 2HJ3A 3GANA 3OO7A 1PB8A 1D0ZA 2NG1A 5JS5A 4TOZA 2UVJA 4DI4B 3B29A 1VE4A 4E0WA 3NYLA 2GWWA 3CIJA 1ZW3A 4R72A 4YB7A 5JLIA 3K6VA 4U4XA 2C03A 3WAFA 3JTLO 2Y3BA 2PFDA 1H7IA 2AP3A 1VLTA 3JSEO 2PP4A 2UVGA 1O7TA 3OSQA 1TWCA 2V25A 3PPQA 3G4ZA 3PUZE 4MJOA 4R74A 4RK9A 4FBPA 3QIMA 4DZ1A 2DDKA 4Z0IA 4G7OF 3IPMO 4IARA 1MQDA 4LA9A 4IGRA 4IGGA 1IZ1A 3B71A 4ELRA 4C1UA 2P61A 2OZZA 4OVQA 3OO6A 3PHF2 1NI9A 1PCXA 5JRAA 3K01A 5I3SA 1A7VA 2A5TB 2ZNSA 4PAKA 2GH9A 5I7IA 3TKDA 2CZHA 5J1DA 4F4BA 1EU8A 1R6ZA 2IXOA 2F7AA 2ZXTA 3H7MA 2ABHA 1AUEA 5KYNA 1MMGA 3LC8A 1MXVA 1Q0DA 3T9XB 3C33A 1URGA 2OWSA 1FQDA 2F22A 3L8IA 1T6IA 2PVUA 2RCBA 1ORJA 3EGDB 3HNJA 3RVYA 4MIJA 1N7XA 4LVQA 2HMZA 1NSGB 4JIOA 2CEYA 4OVTA 3O6IA 3S2VA 3OOAA 4BDRA 1GR2A 3DE9A 3THIA 4F1UA 3UMIA 2R71A 3QSLA 1H9TA 4NF5B 3FGSA 3GWLA 3G50A 1NUWA 3ABLC 1WODA 2NSFA 1SZIA 2OOCA 3GBBA 1FBDA 3EFOB 1FBPA 2E87A 4EXLA 3M15A 4XKPA 4RPNA 3QUJA 3L6HA 2ONSA 3RYLA 1QKBA 4FORA 1B3GA 5ELVA 1Y4CA 5KYXA 5IGAA 3ZG1A 2Y7WA 4AS4A 4P3LA 3KKBA 2WYKA 3AJMA 5IY5C 3L0IA 1SI1A 4UDVA 4CSAC 3PGFA 2NWJA 3G3KA 4RD9A 4NE4A 1UTBA 1B32A 4N07A 1WDNA 3SERA 1JW5A 4U22A 1EZOA 3NRHA 1I4ZA 3V5ZA 4ESXA 3KBZA 2FIEA 2Z22A 4RA1A 2FAPB 2BJIA 2F97A 3DE8A 4TQUQ 5T3JA 1QSPA 3VLVA 3NYMA 2DE4A 1AIVA 4HFFB 3N6TA 3K6WA 3MFNA 4N6DA 3CRBA 1N04A 4BJ6A 4NHBA 5A6KA 2FYIA 1ORYA 3DLNA 3FV2A 3H4ZA 4PR9A 3DELB 4ZZAA 1NV1A 4WEDA 4ZE9A 2Y5KA 4OMBA 1FPKA 4I8CA 4XTCQ 3FMSA 5ET6A 4H6DA 4AB5A 2A68F 2BL2A 5HM4B 3VVEA 1LBVA 4Z7EA 5KYYA 2HPGA 1KZ8A 3B8BA 4RY1A 3WAEA 3U93A 3B0VC 2MKZA 2O69A 4KR5A 1L3PA 4WXJA 4P9TA 5AC4A 1HMDA 5CBRA 1Z6AA 4YL0A 5ET8A 1QQ3A 2B4LA 1SD3A 3CHGA 3DMDA 4BJTA 1S05A 2XS8A 3U8PA 5L8DA 2HSQA 2R8TA 3X1OA 3KYJA 1XC1A 2ZXWC 1HSJA 1Y3NA 1F9BA 3C31A 4YKJA 3SEWA 1ZLQA 1R5ID 1LM3B 2DOJA 2Q8MA 3SETA 3EHMA 5TJ5E 5H8FB 5E3AA 3G3FA 3RTWB 3TTNA 1UIVA 4PGNA 3LUTB 1IZMA 3NMKA 5AC5A 4E0HA 1Y6DA 4DBQA 4XIGQ 3VF0A 3FASA 3D4CA 5F5HA 2DWJA 3VXBA 4ESWA 2H98A 1MMAA 1YZAA 1QKAA 4OYVA 4YT8A 1XI6A 2QS4A 5JK4A 2Q88A 3FJMA 3S9EA 3FXBA 2EIMC 4R9FA 3RT8A 1LBXA 2P0NA 2EPKX 4JSOA 1FTLA 4P1LA 5FCLA 4GWXA 2J9BA 3TDJA 3BIGA 2W45A 3ABMC 2DVZA 5I58A 1MXZA 1NL5A 1LS4A 3OEOA 4JZAA 3O55A 1B52A 4O94A 4QFPA 1MNDA 4J7TA 1ZHZA 3EJNA 2PT2A 4NG7A 4LERA 4XPWA 2G93A 3RQGA 3B7DA 3E13X 4NTAA 3OSRA 4F3PA 2EILC 4I3MA 1USYE 2L9JA 3DM9B 4N4UA 4YN0B 1MS7A 1TFDA 2WBDA 3U65A 3U9JA 1Y9UA 2F34A 5KYWA 2UUIA 4H5FA 1OKKD 4U5BE 2QMXA 1TFOB 2OWZA 1XVYA 3DP4A 5DVWA 1O3UA 5F28E 5JUAA 3K1MA 5A6JA 3RFYA 3N0TA 4E17A 1JEUA 1D9VA 2KLFA 3GEEA 1PC3A 3TD7A 4C1TA 2XXAB 2NUPB 3RPWA 2E0SA 1H76A 3HNIA 4LZ5A 3GORA 2NXOA 2WBBA 5I56A 4F1YA 4N8GA 3BFTA 3TMGA 2IXMA 3K00A 3W2VA 1QVSA 5L0JA 4ER9A 2YLGA 2DP8A 1NUXA 1Z7Qc 2Q8JA 4CBEA 2FBPA 5IAIA 3HSTA 5B1AC 5JVEA 2P3VA 1L7CA 1K9ZA 2D5WA 3WHNA 2FHYA 1D0XA 4B6IA 3K4UA 2RSEB 4XFEA 2MYSA 3IB1A 2F8DA 2Z8EA 3M4CA 2X0CA 3CI8A 2O51A 3CFLA 4GWOA 2O68A 3TJ6A 3PMVA 4U5FE 1FPDA 3KN3A 3W8HA 2R7QA 3KBRA 3UA8A 1MQGA 3Q28A 3V5YA 3TYHA 1M6TA 5AA4B 3GODA 1K05A 1FJ9A 4PJMA 1FRPA 4G68C 4HCWA 2OG2A 2L81A 1I5NA 1LB8A 1IXGA 2XL6A 5T1DB 4OIOF 1QULA 2E1SA 2WX9A 3OO8A 1FQEA 3HKKA 4JB7A 5EQ8A 1A8FA 4DE8A 3AG4C 1C03A 2DE3A 3EQ1A 4OIPF 3TQOA 4BG0A 3FJ7A 3QTHA 4X8RA 2FNCA 4PAIA 1RKEB 5DEXB 3R7XA 5I2NB 4C7OB 4R6HA 4JCHA 3K1IA 3C8GD 1MQJA 3T22A 1ST6A 5H8QA 4YKPA 3V83A 3FVNA 3P7IA 5L0FA 1A8EA 5COMA 1FSAA 3SKPA 1PEBA 5JTYB 2V3UA 5HBCA 4MVZA 4JC7A 3JRMO 3RF3A 2VC9A 5I59A 4OIQF 4NF4A 3CQZA 2CNWD 2H7OA 3ATPA 1OQCA 3GM2A 4N6CA 4CJGA 3C9HA 4G7HF 3KEIA 5GPGB 1GGGA 5HPQA 3ILUB 1YYXA 2A1DD 4JTCB 1YYZA 1T01A 5TU0A 4I3EA 2GHAA 2RINA 2X7QA 1SW2A 2YPNA 1EYKA 1MY2A 5DS6A 4QFNA 3EH1A 5ICQA 3M79A 4JSDA 1SDXA 3TQLA 1KA1A 4R6KA 4YAHX 4JVSA 3SXYA 3ZSUA 3AQCA 3T96B 3JT1A 4RNSA 3ASNC 2GRVA 4PFRA 3Q6NA 1TQGA 2L6GA 3RPLB 2QVRA 1FQCA 5L0CA 1SYHA 1E85A 1B5JA 4JEAA 3M4BA 3K1PA 3O97A 2QS3A 4QSCA 3WODF 2MWQA 2V3TA 2WL8A 4JWYA 1TWAA 3FAPB 3UP9A 1N0TA 2QVUA 4BEJA 1FTJA 1FBFA 3FOOA 2HUJA 4R2FA 2P7VA 5A5XB 2Y7PA 5DYHA 4E7ZA 1NU9C 2ZXOA 5AGFA 2R7UA 4F1VA 2O9XA 2OJTA 4MBPA 4F18A 2R6GE 1LI5A 3K6UA 1UTHA 1PBQA 4YU0A 3LJBA 3F11A 1Z3IX 1B7UA 5FHOA 5AA2A 5ICTA 2DSFA 5FBPA 4UA8A 4XEQA 4BEMJ 2Q89A 3PDMP 4DXBA 3CSBA 3EPEA 3SDFA 2Q9AA 4P56A 1EQ1A 3FIRA 4MNPA 1A7LA 5A6BA 1D9QA 3S9NC 4RBNA 1D1CA 1O63A 3O10A 1B3FA 3TFLA 2B0HA 2QUPA 2O7IA 2ZYMA 1M2VA 4MVSA 3EHUA 3O6GA 4QBAA 1A0BA 3DJNB 2G3VA 3IHUA 4IB2A 3O9PA 4O6NA 5FHMA 4K3FA 5I2KA 3UGOA 5DT6A 1DBZA 2IXNA 3MW0A 4DRJB 3I3VA 4JDFA 2HJMA 3JZJA 4HXVA 5CRYA 4I40A 3QUFA 4D4XA 5JT4A 4CJOA 3RQEA 4QXDA 3HCQA 3FVOA 1C02A 1DCUA 2XWOA 4MLQA 2ZYKA 2DYSC 2XM4A 3LEOA 1HE9A 1MY4A 5H8NA 1TWGA 3SZRA 4WEPA 4IY6A 4E0XA 2IOQA 1BZ4A 2P6VA 3SXKA 3POVA 1PB9A 4GVOA 3BBRA 5AE4A 3W9VA 3IOTA 4YKIA 3ZS6A 4XKQA 3ZDLA 4IJJA 1NKXA 2YLNA 1OCOC 2Z8FA 5IKBA 5IM2A 2HS5A 3E9VA 4HW8A 3LR1A 1JMWA 4J7YA 2CDQA 4ZLDA 1MXWA 4YT5A 1N3WA 4GRKA 1M2OA 1YZ0A 5L9MA 5CI8A 4NWCA 1AEPA 5CBSA 5L0DA 1TT1A 4G68B 3BIHA 5EHMA 4ULWA 4MVRA 4U9EA 4Z9JA 4KI2A 2X7PA 3IL1B 2G29A 3S4UA 3U1OA 2JJKA 1ZKBA 3I6VA 3PMRA 4ONYA 2M8CA 4A4AA 4PTKA 3PD9A 4HEAJ 2Q2CA 4MS2A 1B68A 3L34A 2ZYNA 3MP1A 4X04A 5EGYA 3C8GB 1N7WA 3FXQA 2G62A 1P1WA 3H6TA 4PJNA 3UR3C 3AOUA 2A5TA 1K9YA 1T6UA 1M5DA 1MH3A 4RYAA 1VFDA 3H3GA 2YKZA 1OCCC 1IMAA 3U5SA 2YL1A 4ZLCA 1LIHA 1DSNA 1FBGA 4R75A 3EGDA 3ZC4A 1K40A 4KCDA 2Y7KA 1EKYA 2THIA 2YQYA 2ZPAA 4HE0A 3LS0A 1POTA 4ZEDA 4O7MA 1INPA 1FMWA 3WAQA 4NF5A 1UIUA 1VSOA 3EH2A 3Q6MA 5EK0A 4GWWA 1BIYA 3UN6A 3KH2A 2H9BA 3EFOA 3VAYA 1OMPA 1EYIA 3J06A 1K04A 1ZZPA 1ZU5A 5LDZA 3PPOA 5KYUB 4GL8A 2CW0F 5I84A 4EHPA 3PV0E 2NUTB 1OW8A 2FA7A 3V7OA 3G3GA 4KCCA 4KNWA 1NV2A 4EXKA 1GTKA 1YJGA 1IEJA 3TELA 2Q00A 4CDAA 2EIJC 3T6GB 1KU2A 3VM6A 3SZPA 2VASA 1H45A 2RCAA 1URSA 1LBCA 4Q30B 3Q29A 4GWSA 1JQFA 4FATA 3B6WA 3KSJA 1ATGA 2WZGA 3EG9A 5H8HB 4GFRA 2VCCA 2F7BA 3A09A 4OD4A 4IO5A 3N26A 3FJGA 5JSLA 1T9KA 4O6MA 1IMCA 4Q4ZF 4N6PA 3JYRA 5BUUA 3RQTA 1KTMA 2YL3A 1B2HA 1RDZA 1B58A 3KN7A 2IA4A 5L9OA 2D5RB 1E86A 5TP9B 3K1HA 1Q0GA 3TAJA 1Q1KA 2I4CA 3HV1A 3LAYA 2VD2A 4O6YA 4LZ7A 2Y3DA 4JTAB 3TJ5A 3V5XA 1U6HA 3IB2A 3NKDA 4OVSA 5IZZA 1NH8A 4OWDA 1MY0A 1APCA 3W15C 3I5QA 3NYJA 4G0HA 5EYFA 3VRCA 4QSDA 2OQMA 4NGUA 5BWJA 1ZHXA 2F3BA 4DLDA 2R7RA 4KPTA 256BA 4BJ5C 1PV3A 1A55A 1SQYA 1Y20A 2P1AA 3CSKA 3OELA 5L9SA 3QXMA 1LBBA 3CG1A 1P1NA 1BTJA 3EHNA 1WASA 3OXNA 4PFUA 2R25A 1JAFA 2YL0A 3HFUA 3PPNA 2XLVA 4LZ8A 5BUOA 1VMAA 1TXFA 2FVZA 3H6UA 1QUKA 4O3AA 4MVMA 1YZCA 4AK9A 3S84A 3LSXA 4NF0A 4OANA 1FPGA 2Q9CA 1MDP1 3JRTA 3K2DA 4XKNA 3K1NA 1FTOA 5H8FA 2OEVA 3E3KA 2PBEA 4NQFA 1IMFA 3N94A 2VGQA 1B3HA 1M5EA 2QJEA 1RYXA 4F22A 4H1XA 5B7DA 1B4HA 3Q26A 2Q2AA 1OIBA 2PCRA 3IFAA 2Q9TA 1LAXA 3VDFA 3MJNA 4FE8A 1FBHA 4HTGA 4CIHA 2UXAA 1H9GA 1E83A 3RLFE 3MX3A 4PFIA 2OWTA 1HW2A 1FCKA 5DVFA 3GYYA 2DVCA 1U89A 1JRAA 2R7OA 4GYTA 5COGA 2Z8DA 4KHZE 3I5PA 4PK4A 1SBPA 2Y7IA 2HHMA 5B3SC 3ONMA 2CCYA 4EQ9A 3HPIA 3LSFB 4U1OA 5LTCA 2GAQA 2VD3A 1I6QA 3DKAA 5T3WA 3H06B 1RJ9B 4JVIA 3FUZA 1C17M 4MMPA 1QUJA 4M1VA 3GWNA 2J45A 3FVGA 3K33A 4KYDA 1SI0A 4DCXA 4E18A 2AU5A 4XQ1A 1FR0A 2ZZWA 3QVYA 5IZ1A 1FQBA 1WVJA 3AXFA 3GM1A 3R2PA 4WABA 2V3CC 4X48A 4HE8D 2R9JA 4JVCA 5EHSA 4F29A 3OEKA 4CDVA 3T1BA 3C4MA 1WN0A 4PE3A 2XX7A 5JP7A 2XXAA 2NUPA 1HE1A 4ZE8A 3ILTB 4JWOA 4AX2A 1JPJA 2NOOA 3CEXA 1Y3PA 4IRUA 1LLSA 1CPQA 3K66A 2DYRC 1F1MA 1D0YA 4NTFA 2XL4A 4POXA 3RN8A 1GQAA 3TOMA 3U9MA 4MFIA 2I6EA 4POWA 5DTBA 4K7BA 3TCGA 2Q7RA 4PF8A 3FATA 2HXRA 1PDAA 1CGME 1GM5A 3SEUA 4MTFA 3HLZA 4JW1A 3RYDA 4AL1A 1NG1A 3JYHA 2I48A 2ZYOA 5F1QA 4R2BA 3U2MA 2F36A 1XOCA 4N4WA 4D4NA 2AWYA 4DXUA 2M4EA 2CGEA 4G8NA 2XXHA 3MSTA 1FTMA 3VE1B 4CSAA 3F47A 5AA4A 1B1HA 3CZ6A 4PDDA 4H5GA 1MM6A 3ISPA 3JCUQ 2Y84A 3OA1A 2VH3A 1DOWA 3U8QA 2HZKA 2EINC 2B3FA 1N84A 4KD5A 1IMEA 5B70A 3PUXE 2A6HF 2WB7A 1B5HA 4NEDA 1FTSA 4XF5A 3V5AA 2F7CA 4JKVA 1RKCA 2YLIA 3W9WA 1Q9DA 4XLPF 1DOTA 3G4XA 4FWVA 1RKEA 4X0RA 5DEXA 2QRYA 1FMVA 5I2NA 2HAVA 3B50A 4C7OA 2H5YA 4MAGA 2X26A 2XWIA 3LLIA 4R9GA 2OU6A 4PBHA 5L3VA 2VT5A 4MQ9F 4PQJA 3H03A 1FBEA 1LE2A 3IJXB 5JTYA 4QI2A 2XXTA 1MPCA 2Q4FA 4E7SA 1FFTC 3IX1A 1HSEA 3GEIA 1LFGA 2VCAA 3D1RA 4NWDA 3MWBA 1JR8A 1O5HA 2ONRA 3KOTA 5DVJA 1T5OA 3EKIA 3RH3A 1A7EA 4ECFA 1WOLA 1B4ZA 3T9VA 1MH4A 1LFIA 1QW0A 3PUWE 4NN3A 4I3YA 2QS1A 3ROJA 3PU5A 3E79A 5ET5A 3RUMA 4LP2B 1Q0FA 2XWKA 5CM6A 5DS5A 3RW0A 2XXIA 2KGOA 4FJPA 3ZSFA 3RPLA 2XX8A 3TTRA 4Q0CA 2RF1A 2V84A 4DCYA 2XX9A 3ZKLA 3BKIB 1QVXA 4N6HA 2DWAA 1Y3QA 2A6EF 4Z9HA 4GWYA 3T9HB 1OXKA 2R7VA 4NF8B 4YZZA 4FEDA 1XVXA 2O84X 5IZ3B 1BK4A 3KOSA 3SEYA 2OCUA 2CEXA 5ITPA 4PETA 4GOTA 1SMYF 1LAHE 4BDQA 5CIVA 3TUSA 4BPMA 4FECA 4CDYA 1P1QA 4QF9A 1ANFA 3S9MC 3CR9A 1BR2A 3HN0A 4MLVA 4N13A 5TPAB 1P1UA 1YLMA 2DYXA 1LEVA 1LS1A 4DDDA 2JPUA 2C04A 4N15A 1LBZA 2J0WA 3SNHA
chains in the Genus database with same CATH topology
3T66A 3TCHA 1CB6A 4UACA 2HFBA 3M8UA 1XT8A 2CZLA 4H67A 4KYEA 1RYOA 1IXHA 2D21A 1LCFA 3VV5A 3G3IA 3KN8A 4YB5A 1A99A 1FQFA 2B3BA 5K2YA 1NH7A 5CMMA 1J1NA 3RY3A 5ISUA 3TPAA 1MDQA 2I3VA 1URDA 4EQBA 1M5FA 4FAJA 2PYYA 2Y7RA 4F3BA 3O2AA 4OZ9A 3MVXA 3N6UA 3KFMA 4ZEIA 4PP0A 3K6XA 4ZS9A 3HO7A 1JVXA 1UQWA 4G68A 1ZMGA 5FHNA 4U21A 1BKAA 3G7WA 2DWHA 4HCYA 4X1DA 3QK6A 4RK2A 2AIXA 4F3SA 2HZ8A 3IOUA 4JXIA 3B6QA 3PPPA 3IOVA 3GLBA 2I0CA 5K2XA 4U2RA 3UK4A 4IGTA 4OVJA 3MZ9A 3KGCA 2V3QA 4G4PA 4YKKA 3IJOB 3KSXA 4R73A 4PFYA 4P0GA 4QFKA 3CFZA 3N5LA 4BDLA 2HCAA 3ECRA 3PUVE 3VLWA 1R1NA 1B0LA 1DTGA 4F39A 2H25A 3TTKA 2XXYA 2XXVA 3KJTA 3MC2A 4KI0E 1TFAA 4TLMB 4RJZA 1JW1A 4EQ7A 1YCJA 3GBAA 2HZLA 5H8HA 1MXXA 2P2AA 4NTLA 1P1OA 4F19A 2WKYA 3CVGA 1BP5A 4U23A 5TP9A 5LOMA 4FEBA 2ZMBA 2LFFA 3TTMA 3TTLA 4OQOA 1JETA 1LAFE 4R6YA 2F5XA 4ISUA 3DP6A 2XXWA 3A3CA 3EHTA 1N3XA 2W7YA 3MBPA 1OLAA 3IK6B 4YMAA 3JV9A 4OETA 3IORA 3A3UA 2QMWA 1B7ZA 4ND9A 3VVDA 2AL4A 3OD7A 1NMUA 4IO4A 1B1XA 3O6HA 4F2QA 1B05A 1RKMA 3HHGA 3O66A 3G3HA 4TLLB 3B6TA 2I3WA 3E9XA 4QHQA 5KDTB 1YPNA 3FXRA 2XXXA 4YICA 1D4NA 1AL3A 2AL5A 3PPRA 2RKMA 5F7VA 5DVIA 3O28A 4ELQA 2UVHA 3USDA 5ITOA 2CMOA 5AA1A 3RT6B 3T9UA 4ELPA 3VXCA 3KG2A 4ZECA 4L17A 2VP1A 3CG3A 2F6PA 1NFTA 3MVWA 2OK2A 1SW1A 3R26A 1TWYA 3UGWA 1H3DA 1ZIUA 2VHAA 1AOVA 4DIGA 3O29A 1Q35A 1MRPA 1B5IA 1DMBA 1JVYA 1XS5A 4EF2A 3QAXA 2LAOA 2XD3A 4NF6B 2RC8A 3MZ1A 1NNKA 3U72A 5AA3A 4GL0A 3U94A 4F31B 2ALUA 2OBGA 5I57B 3OMBA 5KCJB 4KQPA 5M2VA 4I9DA 4JWXA 1IIWA 2O1MA 4Q5TA 3IAZA 1I6BA 3DM0A 5FTIA 3I5OA 3M3FA 4IO6A 2I4BA 4M4GA 3VVFA 1B6HA 3L6GA 2I58A 4ZEKA 1H43A 3LSWA 2DE2A 2F35A 1L5TA 5KZTA 4XKRA 4WKMA 4GD5A 5CC2A 2O6AA 4LQ2A 1GVCA 3E4RA 1YTVA 3MVZA 3U92A 1QJMA 1AH5A 3TCFA 1OLCA 1LGBC 3VLUA 4OFLA 4IO7A 3RTFB 1OVTA 1A54A 3K02A 4BDMA 1D9YA 4PE5B 4JBZA 1MPBA 2NUVA 4PFTA 2BJJX 1ZTYA 4LATA 3CSGA 3Q27A 3G3JA 3IB0A 2I0BA 3K0VA 4YB6A 4G8HA 1A40A 4THIA 4P0IA 4GIZA 3MZBA 3KJ7A 1N76A 4QFLA 2IEEA 4U1ZA 3V8XB 1I69A 1CE2A 4OERA 4NF8A 4MF3A 1FTKA 3EHSA 3SESA 2PBWA 3M3LA 1MQHA 4GXSB 2XD2A 3CFXA 2GHBA 4IO3A 5TPAA 3FZVA 1MY1A 2QL3A 4OXVA 4MH5A 1DTZA 2XXRA 1MXYA 1ZJLA 1SVXB 3MP6A 3V89B 3PUYE 2XXPA 3FV1A 4KFQA 3RNNA 2B65A 1B7HA 4I1DA 3IO4A 4IY5A 4OHNA 1US4A 2P1SA 1UTBB 3PD8A 1OQGA 4QFOA 2ZNTA 3HHFA 4IO2A 4LONB 2AYSA 1R9QA 4QSEA 1IUDA 3OO9A 3TZAA 1M5BA 3EN3A 4ZEFA 1I6AA 2YJPA 4OFOA 3IOWA 5CMKA 4OTEA 3OENA 2DQVA 1VFEA 2LFDA 5CMBA 3C35A 4EUOA 3GXAA 4BLAA 5A5XA 4XXUA 1Z7NE 5JEIA 4RXLA 4OEVA 1S50A 3MPLA 4P11A 1B51A 2PMSA 4OENA 4OFJA 1H44A 3GZGA 1GV8A 3EF7A 1QUIA 4ZEBA 3FVKA 2RC9A 3PMWA 2HXWA 1SW4A 2HQ0A 2GFEA 2PX1A 2ESNA 1LB9A 1ZBMA 2Z23A 1B3LA 1USYH 3FXUA 2DWIA 1ZU0A 1M5CA 4I62A 3VFJA 2V93A 4H8IA 4FIMA 1O64A 3LSLA 3MVYA 4OEUA 4OESA 4YMBA 5I58B 5FTHA 3TQWA 3SEXA 3IO6A 1S9TA 4O3CA 4H65A 2RC7A 5AA2D 3TEPA 4G2ZA 2H4IA 2QSXA 2ZNUA 1Z7ME 2VOZA 1EZ9A 4DXCA 2HAUA 2REGA 4GF8A 3R6UA 1B9JA 2NVUB 1XHYA 3H6WA 4Q8RA 1BLFA 1PBPA 4EF1A 4X1BA 1OQHA 2REJA 1MQIA 2XHDA 3IR1A 1FQAA 3MAMA 3QYTA 3BFUA 1MM7A 1POY1 4C0RA 1Y4TA 2F78A 1B0HA 1Y1MA 4U4SA 3TODA 5I56B 2F6GA 4H8JA 5CMCA 1MG1A 3RGYA 4HS7A 3D4GA 2UYFA 4F2OA 4GQOA 3MP8A 4G77A 1PB7A 4GLIA 3T93B 2D3IA 3C32A 2OLBA 3SEVA 1KWHA 3FD3A 1II5A 3ZKKA 3M3KA 2UYEA 1SW5A 4LUBA 3LBSA 1B46A 3H6VA 1LFHA 1S7YA 2XXQA 4O3BA 5KDTA 1OVBA 1MY3A 3OEMA 4ZDMA 3UORA 4LQ5A 1LAGE 4G8MA 1LCTA 2O1LA 5H8QB 4GXAA 3C36A 1B3EA 1JNFA 4NMYA 1IITA 3LUYA 1LSTA 2I49A 3MUQA 1FW0A 1EH3A 1T0KA 4KYSA 1JEVA 5I59B 4NF4B 4EDPA 2ONKE 3PMXA 4AQ4A 2ANJA 3C34A 4QRZA 1MPDA 1B40A 2DXRA 2HEUA 4NF6A 3KZGA 1IXCA 3ODBA 1D3KA 3U8VA 2QPQA 1DPEA 5I57A 5KCJA 4H0WA 2QS2A 1Y1ZA 1UTHB 1YAEA 1MXUA 5AA2B 4F3GA 1SYIA 3DP8A 2DS9A 3MQ9A 3UIFA 2XXUA 3MPKA 1HSLA 5CI5A 4RPOA 4X9TA 1AMFA 2A5SA 4BDOA 2PT1A 5I2KB 3S9LC 5H8SA 2UVIA 1JW4A 1P99A 4ELOA 2H99A 1IQ7A 1DPPA 1EZPA 5H8NB 1ELJA 1R9LA 1NNPA 2DXYA 2O7UA 4AB6A 1US5A 1VR5A 4BDNA 1NNTA 1NNFA 2P0SA 4ZZEA 3Q25A 1IXIA 3OO7A 1PB8A 4TOZA 2UVJA 1VE4A 4E0WA 3CIJA 4R72A 4YB7A 3K6VA 4U4XA 3WAFA 2UVGA 1O7TA 3OSQA 2V25A 3PUZE 3PPQA 4R74A 4RK9A 3QIMA 4DZ1A 4Z0IA 4LA9A 1MQDA 4IGRA 1IZ1A 4ELRA 4C1UA 2OZZA 3OO6A 3K01A 2A5TB 2ZNSA 2GH9A 3TKDA 5J1DA 1EU8A 1R6ZA 2F7AA 2ZXTA 3H7MA 2ABHA 3LC8A 1MXVA 3T9XB 3C33A 1URGA 2OWSA 1FQDA 2RCBA 2PVUA 1N7XA 4LVQA 3S2VA 3O6IA 4F1UA 3OOAA 4BDRA 1GR2A 3THIA 2R71A 3QSLA 4NF5B 3FGSA 1WODA 3GBBA 4EXLA 4XKPA 4RPNA 3QUJA 3L6HA 2ONSA 1QKBA 4FORA 1B3GA 5ELVA 1Y4CA 2Y7WA 1SI1A 3PGFA 2NWJA 3G3KA 4NE4A 1UTBA 1B32A 4N07A 1WDNA 3SERA 1JW5A 4U22A 1EZOA 4ESXA 2Z22A 4RA1A 2F97A 4TQUQ 3VLVA 2DE4A 1AIVA 3N6TA 3K6WA 3CRBA 1N04A 2FYIA 3DLNA 3FV2A 3H4ZA 3DELB 4ZZAA 4WEDA 4ZE9A 4OMBA 4I8CA 4XTCQ 5HM4B 4AB5A 4H6DA 3VVEA 4Z7EA 4RY1A 3WAEA 3U93A 2O69A 4KR5A 4WXJA 5CBRA 1SD3A 5L8DA 1XC1A 1HSJA 1Y3NA 1F9BA 3C31A 4YKJA 3SEWA 1ZLQA 2DOJA 3SETA 5H8FB 3G3FA 3RTWB 3TTNA 1UIVA 4XIGQ 4ESWA 3FASA 3D4CA 2DWJA 3VXBA 2H98A 4OYVA 1QKAA 2QS4A 5JK4A 2Q88A 3FJMA 3S9EA 4R9FA 3RT8A 4JSOA 1FTLA 3TDJA 2DVZA 5I58A 1MXZA 1NL5A 1B52A 4QFPA 2PT2A 2G93A 3B7DA 3E13X 3OSRA 4F3PA 1USYE 1MS7A 1TFDA 1Y9UA 2F34A 4H5FA 2QMXA 1XVYA 3DP4A 3K1MA 1JEUA 1D9VA 2KLFA 1PC3A 4C1TA 3RPWA 2E0SA 1H76A 4LZ5A 2NXOA 5I56A 4F1YA 3TMGA 3BFTA 3K00A 1QVSA 2DP8A 2Q8JA 5IAIA 3HSTA 2D5WA 3K4UA 3IB1A 2F8DA 2Z8EA 3CI8A 2O51A 3CFLA 4GWOA 2O68A 3PMVA 3KN3A 3KBRA 3UA8A 1MQGA 3Q28A 3TYHA 5AA4B 4G68C 4HCWA 1LB8A 1IXGA 1QULA 2E1SA 3OO8A 1FQEA 4JB7A 1A8FA 4DE8A 2DE3A 3EQ1A 3FJ7A 2FNCA 5DEXB 3R7XA 5I2NB 4R6HA 1MQJA 3T22A 5H8QA 4YKPA 3V83A 3FVNA 3P7IA 1A8EA 3SKPA 1PEBA 5JTYB 2V3UA 5HBCA 5I59A 4NF4A 3C9HA 3KEIA 1GGGA 5HPQA 3ILUB 5TU0A 2GHAA 2RINA 2X7QA 1SW2A 2YPNA 1MY2A 4QFNA 5ICQA 4JSDA 1SDXA 3TQLA 4R6KA 4YAHX 3T96B 4RNSA 2GRVA 1FQCA 1SYHA 1B5JA 3K1PA 3O97A 2QS3A 4QSCA 2V3TA 4JWYA 3UP9A 1N0TA 1FTJA 4R2FA 5A5XB 2Y7PA 5DYHA 4F1VA 4MBPA 2OJTA 4F18A 2R6GE 3K6UA 1UTHA 1PBQA 4YU0A 3F11A 1B7UA 5FHOA 5AA2A 5ICTA 2DSFA 4UA8A 2Q89A 4DXBA 3CSBA 3EPEA 3SDFA 3FIRA 1A7LA 3S9NC 1O63A 1B3FA 3TFLA 2O7IA 2ZYMA 3O6GA 3EHUA 4IB2A 3O9PA 5I2KA 5FHMA 4K3FA 5DT6A 3MW0A 3I3VA 4JDFA 3JZJA 5CRYA 3QUFA 3HCQA 3FVOA 4MLQA 2ZYKA 1MY4A 5H8NA 4WEPA 4IY6A 4E0XA 1PB9A 4GVOA 3BBRA 5AE4A 3W9VA 3IOTA 4YKIA 3ZS6A 4XKQA 1NKXA 2YLNA 2Z8FA 5IKBA 4HW8A 3LR1A 1MXWA 4GRKA 1N3WA 5L9MA 4NWCA 5CBSA 1TT1A 4G68B 5EHMA 2X7PA 3IL1B 2G29A 3S4UA 3U1OA 1ZKBA 3I6VA 4ONYA 2M8CA 3PD9A 2Q2CA 2ZYNA 3MP1A 1N7WA 3FXQA 1P1WA 3H6TA 2A5TA 1M5DA 1MH3A 4RYAA 1VFDA 3H3GA 1DSNA 4R75A 4KCDA 2Y7KA 2THIA 1POTA 4ZEDA 4NF5A 1UIUA 1VSOA 3UN6A 1BIYA 2H9BA 1OMPA 3PPOA 4GL8A 5I84A 3PV0E 2FA7A 3G3GA 4KCCA 4EXKA 1GTKA 1IEJA 3TELA 1H45A 2RCAA 1URSA 1LBCA 4Q30B 3Q29A 4FATA 1JQFA 3B6WA 3KSJA 1ATGA 5H8HB 4GFRA 2F7BA 3A09A 4IO5A 3N26A 3FJGA 4N6PA 3JYRA 5BUUA 3RQTA 1B2HA 1B58A 3KN7A 2IA4A 5L9OA 5TP9B 3TAJA 1Q1KA 2I4CA 3HV1A 2VD2A 4LZ7A 3IB2A 1NH8A 4OWDA 1MY0A 3W15C 5EYFA 4QSDA 5BWJA 4DLDA 4KPTA 1A55A 1SQYA 1Y20A 3OELA 5L9SA 3QXMA 1LBBA 3CG1A 1P1NA 1BTJA 3OXNA 4PFUA 3PPNA 4LZ8A 1TXFA 3H6UA 1QUKA 4O3AA 3LSXA 1MDP1 4XKNA 3K2DA 3K1NA 1FTOA 5H8FA 3E3KA 3N94A 2VGQA 1B3HA 1M5EA 2QJEA 1RYXA 4F22A 4H1XA 5B7DA 1B4HA 3Q26A 2Q2AA 1OIBA 2Q9TA 1LAXA 3VDFA 3MJNA 4FE8A 4HTGA 2UXAA 3RLFE 2OWTA 1FCKA 5DVFA 2DVCA 4KHZE 2Z8DA 1SBPA 2Y7IA 3ONMA 4EQ9A 3HPIA 3LSFB 4U1OA 2VD3A 1I6QA 3H06B 3FUZA 1QUJA 4M1VA 3FVGA 4KYDA 1SI0A 4DCXA 1FQBA 1WVJA 3AXFA 4X48A 2R9JA 5EHSA 4F29A 3OEKA 3C4MA 2XX7A 4ZE8A 3ILTB 4JWOA 2NOOA 1Y3PA 1LLSA 4POXA 3RN8A 4MFIA 2I6EA 4POWA 5DTBA 3TCGA 3FATA 1PDAA 3SEUA 2ZYOA 2I48A 5F1QA 4R2BA 2F36A 1XOCA 4DXUA 4G8NA 2XXHA 1FTMA 3VE1B 5AA4A 1B1HA 4H5GA 1MM6A 2Y84A 3U8QA 2HZKA 2B3FA 1N84A 4KD5A 5B70A 3PUXE 4NEDA 1B5HA 3V5AA 2F7CA 3W9WA 1DOTA 5DEXA 2QRYA 5I2NA 2HAVA 2H5YA 2X26A 4R9GA 4PQJA 3H03A 5JTYA 3IJXB 2XXTA 1MPCA 3IX1A 1HSEA 1LFGA 4NWDA 3MWBA 2ONRA 3KOTA 5DVJA 4ECFA 1B4ZA 3T9VA 1MH4A 1LFIA 1QW0A 3PUWE 2QS1A 3PU5A 3RUMA 4LP2B 5CM6A 2XXIA 4FJPA 3ZSFA 2XX8A 3TTRA 4Q0CA 2RF1A 2V84A 4DCYA 2XX9A 3ZKLA 3BKIB 2DWAA 1Y3QA 3T9HB 4NF8B 4YZZA 4FEDA 1XVXA 2O84X 3KOSA 3SEYA 2OCUA 5ITPA 4PETA 4GOTA 1LAHE 4BDQA 3TUSA 4FECA 1P1QA 4QF9A 1ANFA 3S9MC 3CR9A 3HN0A 4MLVA 4N13A 5TPAB 1P1UA 2DYXA 4DDDA 4PFWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T66 A;  3TCH A;  1CB6 A;  4UAC A;  2HFB A;  3M8U A;  1XT8 A;  2CZL A;  4H67 A;  4KYE A;  1RYO A;  1IXH A;  2D21 A;  1LCF A;  3VV5 A;  3G3I A;  3KN8 A;  4YB5 A;  1A99 A;  1FQF A;  2B3B A;  5K2Y A;  1NH7 A;  5CMM A;  1J1N A;  3RY3 A;  5ISU A;  3TPA A;  1MDQ A;  2I3V A;  1URD A;  4EQB A;  1M5F A;  4FAJ A;  2PYY A;  2Y7R A;  4F3B A;  3O2A A;  4OZ9 A;  3MVX A;  3N6U A;  3KFM A;  4ZEI A;  4PP0 A;  3K6X A;  4ZS9 A;  3HO7 A;  1JVX A;  1UQW A;  4G68 A;  1ZMG A;  5FHN A;  4U21 A;  1BKA A;  3G7W A;  2DWH A;  4HCY A;  4X1D A;  3QK6 A;  4RK2 A;  2AIX A;  4F3S A;  2HZ8 A;  3IOU A;  4JXI A;  3B6Q A;  3PPP A;  3IOV A;  3GLB A;  2I0C A;  5K2X A;  4U2R A;  3UK4 A;  4IGT A;  4OVJ A;  3MZ9 A;  3KGC A;  2V3Q A;  4G4P A;  4YKK A;  3IJO B;  3KSX A;  4R73 A;  4PFY A;  4P0G A;  4QFK A;  3CFZ A;  3N5L A;  4BDL A;  2HCA A;  3ECR A;  3PUV E;  3VLW A;  1R1N A;  1B0L A;  1DTG A;  4F39 A;  2H25 A;  3TTK A;  2XXY A;  2XXV A;  3KJT A;  3MC2 A;  4KI0 E;  1TFA A;  4TLM B;  4RJZ A;  1JW1 A;  4EQ7 A;  1YCJ A;  3GBA A;  2HZL A;  5H8H A;  1MXX A;  2P2A A;  4NTL A;  1P1O A;  4F19 A;  2WKY A;  3CVG A;  1BP5 A;  4U23 A;  5TP9 A;  5LOM A;  4FEB A;  2ZMB A;  2LFF A;  3TTM A;  3TTL A;  4OQO A;  1JET A;  1LAF E;  4R6Y A;  2F5X A;  4ISU A;  3DP6 A;  2XXW A;  3A3C A;  3EHT A;  1N3X A;  2W7Y A;  3MBP A;  1OLA A;  3IK6 B;  4YMA A;  3JV9 A;  4OET A;  3IOR A;  3A3U A;  2QMW A;  1B7Z A;  4ND9 A;  3VVD A;  2AL4 A;  3OD7 A;  1NMU A;  4IO4 A;  1B1X A;  3O6H A;  4F2Q A;  1B05 A;  1RKM A;  3HHG A;  3O66 A;  3G3H A;  4TLL B;  3B6T A;  2I3W A;  3E9X A;  4QHQ A;  5KDT B;  1YPN A;  3FXR A;  2XXX A;  4YIC A;  1D4N A;  1AL3 A;  2AL5 A;  3PPR A;  2RKM A;  5F7V A;  5DVI A;  3O28 A;  4ELQ A;  2UVH A;  3USD A;  5ITO A;  2CMO A;  5AA1 A;  3RT6 B;  3T9U A;  4ELP A;  3VXC A;  3KG2 A;  4ZEC A;  4L17 A;  2VP1 A;  3CG3 A;  2F6P A;  1NFT A;  3MVW A;  2OK2 A;  1SW1 A;  3R26 A;  1TWY A;  3UGW A;  1H3D A;  1ZIU A;  2VHA A;  1AOV A;  4DIG A;  3O29 A;  1Q35 A;  1MRP A;  1B5I A;  1DMB A;  1JVY A;  1XS5 A;  4EF2 A;  3QAX A;  2LAO A;  2XD3 A;  4NF6 B;  2RC8 A;  3MZ1 A;  1NNK A;  3U72 A;  5AA3 A;  4GL0 A;  3U94 A;  4F31 B;  2ALU A;  2OBG A;  5I57 B;  3OMB A;  5KCJ B;  4KQP A;  5M2V A;  4I9D A;  4JWX A;  1IIW A;  2O1M A;  4Q5T A;  3IAZ A;  1I6B A;  3DM0 A;  5FTI A;  3I5O A;  3M3F A;  4IO6 A;  2I4B A;  4M4G A;  3VVF A;  1B6H A;  3L6G A;  2I58 A;  4ZEK A;  1H43 A;  3LSW A;  2DE2 A;  2F35 A;  1L5T A;  5KZT A;  4XKR A;  4WKM A;  4GD5 A;  5CC2 A;  2O6A A;  4LQ2 A;  1GVC A;  3E4R A;  1YTV A;  3MVZ A;  3U92 A;  1QJM A;  1AH5 A;  3TCF A;  1OLC A;  1LGB C;  3VLU A;  4OFL A;  4IO7 A;  3RTF B;  1OVT A;  1A54 A;  3K02 A;  4BDM A;  1D9Y A;  4PE5 B;  4JBZ A;  1MPB A;  2NUV A;  4PFT A;  2BJJ X;  1ZTY A;  4LAT A;  3CSG A;  3Q27 A;  3G3J A;  3IB0 A;  2I0B A;  3K0V A;  4YB6 A;  4G8H A;  1A40 A;  4THI A;  4P0I A;  4GIZ A;  3MZB A;  3KJ7 A;  1N76 A;  4QFL A;  2IEE A;  4U1Z A;  3V8X B;  1I69 A;  1CE2 A;  4OER A;  4NF8 A;  4MF3 A;  1FTK A;  3EHS A;  3SES A;  2PBW A;  3M3L A;  1MQH A;  4GXS B;  2XD2 A;  3CFX A;  2GHB A;  4IO3 A;  5TPA A;  3FZV A;  1MY1 A;  2QL3 A;  4OXV A;  4MH5 A;  1DTZ A;  2XXR A;  1MXY A;  1ZJL A;  1SVX B;  3MP6 A;  3V89 B;  3PUY E;  2XXP A;  3FV1 A;  4KFQ A;  3RNN A;  2B65 A;  1B7H A;  4I1D A;  3IO4 A;  4IY5 A;  4OHN A;  1US4 A;  2P1S A;  1UTB B;  3PD8 A;  1OQG A;  4QFO A;  2ZNT A;  3HHF A;  4IO2 A;  4LON B;  2AYS A;  1R9Q A;  4QSE A;  1IUD A;  3OO9 A;  3TZA A;  1M5B A;  3EN3 A;  4ZEF A;  1I6A A;  2YJP A;  4OFO A;  3IOW A;  5CMK A;  4OTE A;  3OEN A;  2DQV A;  1VFE A;  2LFD A;  5CMB A;  3C35 A;  4EUO A;  3GXA A;  4BLA A;  5A5X A;  4XXU A;  1Z7N E;  5JEI A;  4RXL A;  4OEV A;  1S50 A;  3MPL A;  4P11 A;  1B51 A;  2PMS A;  4OEN A;  4OFJ A;  1H44 A;  3GZG A;  1GV8 A;  3EF7 A;  1QUI A;  4ZEB A;  3FVK A;  2RC9 A;  3PMW A;  2HXW A;  1SW4 A;  2HQ0 A;  2GFE A;  2PX1 A;  2ESN A;  1LB9 A;  1ZBM A;  2Z23 A;  1B3L A;  1USY H;  3FXU A;  2DWI A;  1ZU0 A;  1M5C A;  4I62 A;  3VFJ A;  2V93 A;  4H8I A;  4FIM A;  1O64 A;  3LSL A;  3MVY A;  4OEU A;  4OES A;  4YMB A;  5I58 B;  5FTH A;  3TQW A;  3SEX A;  3IO6 A;  1S9T A;  4O3C A;  4H65 A;  2RC7 A;  5AA2 D;  3TEP A;  4G2Z A;  2H4I A;  2QSX A;  2ZNU A;  1Z7M E;  2VOZ A;  1EZ9 A;  4DXC A;  2HAU A;  2REG A;  4GF8 A;  3R6U A;  1B9J A;  2NVU B;  1XHY A;  3H6W A;  4Q8R A;  1BLF A;  1PBP A;  4EF1 A;  4X1B A;  1OQH A;  2REJ A;  1MQI A;  2XHD A;  3IR1 A;  1FQA A;  3MAM A;  3QYT A;  3BFU A;  1MM7 A;  1POY 1;  4C0R A;  1Y4T A;  2F78 A;  1B0H A;  1Y1M A;  4U4S A;  3TOD A;  5I56 B;  2F6G A;  4H8J A;  5CMC A;  1MG1 A;  3RGY A;  4HS7 A;  3D4G A;  2UYF A;  4F2O A;  4GQO A;  3MP8 A;  4G77 A;  1PB7 A;  4GLI A;  3T93 B;  2D3I A;  3C32 A;  2OLB A;  3SEV A;  1KWH A;  3FD3 A;  1II5 A;  3ZKK A;  3M3K A;  2UYE A;  1SW5 A;  4LUB A;  3LBS A;  1B46 A;  3H6V A;  1LFH A;  1S7Y A;  2XXQ A;  4O3B A;  5KDT A;  1OVB A;  1MY3 A;  3OEM A;  4ZDM A;  3UOR A;  4LQ5 A;  1LAG E;  4G8M A;  1LCT A;  2O1L A;  5H8Q B;  4GXA A;  3C36 A;  1B3E A;  1JNF A;  4NMY A;  1IIT A;  3LUY A;  1LST A;  2I49 A;  3MUQ A;  1FW0 A;  1EH3 A;  1T0K A;  4KYS A;  1JEV A;  5I59 B;  4NF4 B;  4EDP A;  2ONK E;  3PMX A;  4AQ4 A;  2ANJ A;  3C34 A;  4QRZ A;  1MPD A;  1B40 A;  2DXR A;  2HEU A;  4NF6 A;  3KZG A;  1IXC A;  3ODB A;  1D3K A;  3U8V A;  2QPQ A;  1DPE A;  5I57 A;  5KCJ A;  4H0W A;  2QS2 A;  1Y1Z A;  1UTH B;  1YAE A;  1MXU A;  5AA2 B;  4F3G A;  1SYI A;  3DP8 A;  2DS9 A;  3MQ9 A;  3UIF A;  2XXU A;  3MPK A;  1HSL A;  5CI5 A;  4RPO A;  4X9T A;  1AMF A;  2A5S A;  4BDO A;  2PT1 A;  5I2K B;  3S9L C;  5H8S A;  2UVI A;  1JW4 A;  1P99 A;  4ELO A;  2H99 A;  1IQ7 A;  1DPP A;  1EZP A;  5H8N B;  1ELJ A;  1R9L A;  1NNP A;  2DXY A;  2O7U A;  4AB6 A;  1US5 A;  1VR5 A;  4BDN A;  1NNT A;  1NNF A;  2P0S A;  4ZZE A;  3Q25 A;  1IXI A;  3OO7 A;  1PB8 A;  4TOZ A;  2UVJ A;  1VE4 A;  4E0W A;  3CIJ A;  4R72 A;  4YB7 A;  3K6V A;  4U4X A;  3WAF A;  2UVG A;  1O7T A;  3OSQ A;  2V25 A;  3PUZ E;  3PPQ A;  4R74 A;  4RK9 A;  3QIM A;  4DZ1 A;  4Z0I A;  4LA9 A;  1MQD A;  4IGR A;  1IZ1 A;  4ELR A;  4C1U A;  2OZZ A;  3OO6 A;  3K01 A;  2A5T B;  2ZNS A;  2GH9 A;  3TKD A;  5J1D A;  1EU8 A;  1R6Z A;  2F7A A;  2ZXT A;  3H7M A;  2ABH A;  3LC8 A;  1MXV A;  3T9X B;  3C33 A;  1URG A;  2OWS A;  1FQD A;  2RCB A;  2PVU A;  1N7X A;  4LVQ A;  3S2V A;  3O6I A;  4F1U A;  3OOA A;  4BDR A;  1GR2 A;  3THI A;  2R71 A;  3QSL A;  4NF5 B;  3FGS A;  1WOD A;  3GBB A;  4EXL A;  4XKP A;  4RPN A;  3QUJ A;  3L6H A;  2ONS A;  1QKB A;  4FOR A;  1B3G A;  5ELV A;  1Y4C A;  2Y7W A;  1SI1 A;  3PGF A;  2NWJ A;  3G3K A;  4NE4 A;  1UTB A;  1B32 A;  4N07 A;  1WDN A;  3SER A;  1JW5 A;  4U22 A;  1EZO A;  4ESX A;  2Z22 A;  4RA1 A;  2F97 A;  4TQU Q;  3VLV A;  2DE4 A;  1AIV A;  3N6T A;  3K6W A;  3CRB A;  1N04 A;  2FYI A;  3DLN A;  3FV2 A;  3H4Z A;  3DEL B;  4ZZA A;  4WED A;  4ZE9 A;  4OMB A;  4I8C A;  4XTC Q;  5HM4 B;  4AB5 A;  4H6D A;  3VVE A;  4Z7E A;  4RY1 A;  3WAE A;  3U93 A;  2O69 A;  4KR5 A;  4WXJ A;  5CBR A;  1SD3 A;  5L8D A;  1XC1 A;  1HSJ A;  1Y3N A;  1F9B A;  3C31 A;  4YKJ A;  3SEW A;  1ZLQ A;  2DOJ A;  3SET A;  5H8F B;  3G3F A;  3RTW B;  3TTN A;  1UIV A;  4XIG Q;  4ESW A;  3FAS A;  3D4C A;  2DWJ A;  3VXB A;  2H98 A;  4OYV A;  1QKA A;  2QS4 A;  5JK4 A;  2Q88 A;  3FJM A;  3S9E A;  4R9F A;  3RT8 A;  4JSO A;  1FTL A;  3TDJ A;  2DVZ A;  5I58 A;  1MXZ A;  1NL5 A;  1B52 A;  4QFP A;  2PT2 A;  2G93 A;  3B7D A;  3E13 X;  3OSR A;  4F3P A;  1USY E;  1MS7 A;  1TFD A;  1Y9U A;  2F34 A;  4H5F A;  2QMX A;  1XVY A;  3DP4 A;  3K1M A;  1JEU A;  1D9V A;  2KLF A;  1PC3 A;  4C1T A;  3RPW A;  2E0S A;  1H76 A;  4LZ5 A;  2NXO A;  5I56 A;  4F1Y A;  3TMG A;  3BFT A;  3K00 A;  1QVS A;  2DP8 A;  2Q8J A;  5IAI A;  3HST A;  2D5W A;  3K4U A;  3IB1 A;  2F8D A;  2Z8E A;  3CI8 A;  2O51 A;  3CFL A;  4GWO A;  2O68 A;  3PMV A;  3KN3 A;  3KBR A;  3UA8 A;  1MQG A;  3Q28 A;  3TYH A;  5AA4 B;  4G68 C;  4HCW A;  1LB8 A;  1IXG A;  1QUL A;  2E1S A;  3OO8 A;  1FQE A;  4JB7 A;  1A8F A;  4DE8 A;  2DE3 A;  3EQ1 A;  3FJ7 A;  2FNC A;  5DEX B;  3R7X A;  5I2N B;  4R6H A;  1MQJ A;  3T22 A;  5H8Q A;  4YKP A;  3V83 A;  3FVN A;  3P7I A;  1A8E A;  3SKP A;  1PEB A;  5JTY B;  2V3U A;  5HBC A;  5I59 A;  4NF4 A;  3C9H A;  3KEI A;  1GGG A;  5HPQ A;  3ILU B;  5TU0 A;  2GHA A;  2RIN A;  2X7Q A;  1SW2 A;  2YPN A;  1MY2 A;  4QFN A;  5ICQ A;  4JSD A;  1SDX A;  3TQL A;  4R6K A;  4YAH X;  3T96 B;  4RNS A;  2GRV A;  1FQC A;  1SYH A;  1B5J A;  3K1P A;  3O97 A;  2QS3 A;  4QSC A;  2V3T A;  4JWY A;  3UP9 A;  1N0T A;  1FTJ A;  4R2F A;  5A5X B;  2Y7P A;  5DYH A;  4F1V A;  4MBP A;  2OJT A;  4F18 A;  2R6G E;  3K6U A;  1UTH A;  1PBQ A;  4YU0 A;  3F11 A;  1B7U A;  5FHO A;  5AA2 A;  5ICT A;  2DSF A;  4UA8 A;  2Q89 A;  4DXB A;  3CSB A;  3EPE A;  3SDF A;  3FIR A;  1A7L A;  3S9N C;  1O63 A;  1B3F A;  3TFL A;  2O7I A;  2ZYM A;  3O6G A;  3EHU A;  4IB2 A;  3O9P A;  5I2K A;  5FHM A;  4K3F A;  5DT6 A;  3MW0 A;  3I3V A;  4JDF A;  3JZJ A;  5CRY A;  3QUF A;  3HCQ A;  3FVO A;  4MLQ A;  2ZYK A;  1MY4 A;  5H8N A;  4WEP A;  4IY6 A;  4E0X A;  1PB9 A;  4GVO A;  3BBR A;  5AE4 A;  3W9V A;  3IOT A;  4YKI A;  3ZS6 A;  4XKQ A;  1NKX A;  2YLN A;  2Z8F A;  5IKB A;  4HW8 A;  3LR1 A;  1MXW A;  4GRK A;  1N3W A;  5L9M A;  4NWC A;  5CBS A;  1TT1 A;  4G68 B;  5EHM A;  2X7P A;  3IL1 B;  2G29 A;  3S4U A;  3U1O A;  1ZKB A;  3I6V A;  4ONY A;  2M8C A;  3PD9 A;  2Q2C A;  2ZYN A;  3MP1 A;  1N7W A;  3FXQ A;  1P1W A;  3H6T A;  2A5T A;  1M5D A;  1MH3 A;  4RYA A;  1VFD A;  3H3G A;  1DSN A;  4R75 A;  4KCD A;  2Y7K A;  2THI A;  1POT A;  4ZED A;  4NF5 A;  1UIU A;  1VSO A;  3UN6 A;  1BIY A;  2H9B A;  1OMP A;  3PPO A;  4GL8 A;  5I84 A;  3PV0 E;  2FA7 A;  3G3G A;  4KCC A;  4EXK A;  1GTK A;  1IEJ A;  3TEL A;  1H45 A;  2RCA A;  1URS A;  1LBC A;  4Q30 B;  3Q29 A;  4FAT A;  1JQF A;  3B6W A;  3KSJ A;  1ATG A;  5H8H B;  4GFR A;  2F7B A;  3A09 A;  4IO5 A;  3N26 A;  3FJG A;  4N6P A;  3JYR A;  5BUU A;  3RQT A;  1B2H A;  1B58 A;  3KN7 A;  2IA4 A;  5L9O A;  5TP9 B;  3TAJ A;  1Q1K A;  2I4C A;  3HV1 A;  2VD2 A;  4LZ7 A;  3IB2 A;  1NH8 A;  4OWD A;  1MY0 A;  3W15 C;  5EYF A;  4QSD A;  5BWJ A;  4DLD A;  4KPT A;  1A55 A;  1SQY A;  1Y20 A;  3OEL A;  5L9S A;  3QXM A;  1LBB A;  3CG1 A;  1P1N A;  1BTJ A;  3OXN A;  4PFU A;  3PPN A;  4LZ8 A;  1TXF A;  3H6U A;  1QUK A;  4O3A A;  3LSX A;  1MDP 1;  4XKN A;  3K2D A;  3K1N A;  1FTO A;  5H8F A;  3E3K A;  3N94 A;  2VGQ A;  1B3H A;  1M5E A;  2QJE A;  1RYX A;  4F22 A;  4H1X A;  5B7D A;  1B4H A;  3Q26 A;  2Q2A A;  1OIB A;  2Q9T A;  1LAX A;  3VDF A;  3MJN A;  4FE8 A;  4HTG A;  2UXA A;  3RLF E;  2OWT A;  1FCK A;  5DVF A;  2DVC A;  4KHZ E;  2Z8D A;  1SBP A;  2Y7I A;  3ONM A;  4EQ9 A;  3HPI A;  3LSF B;  4U1O A;  2VD3 A;  1I6Q A;  3H06 B;  3FUZ A;  1QUJ A;  4M1V A;  3FVG A;  4KYD A;  1SI0 A;  4DCX A;  1FQB A;  1WVJ A;  3AXF A;  4X48 A;  2R9J A;  5EHS A;  4F29 A;  3OEK A;  3C4M A;  2XX7 A;  4ZE8 A;  3ILT B;  4JWO A;  2NOO A;  1Y3P A;  1LLS A;  4POX A;  3RN8 A;  4MFI A;  2I6E A;  4POW A;  5DTB A;  3TCG A;  3FAT A;  1PDA A;  3SEU A;  2ZYO A;  2I48 A;  5F1Q A;  4R2B A;  2F36 A;  1XOC A;  4DXU A;  4G8N A;  2XXH A;  1FTM A;  3VE1 B;  5AA4 A;  1B1H A;  4H5G A;  1MM6 A;  2Y84 A;  3U8Q A;  2HZK A;  2B3F A;  1N84 A;  4KD5 A;  5B70 A;  3PUX E;  4NED A;  1B5H A;  3V5A A;  2F7C A;  3W9W A;  1DOT A;  5DEX A;  2QRY A;  5I2N A;  2HAV A;  2H5Y A;  2X26 A;  4R9G A;  4PQJ A;  3H03 A;  5JTY A;  3IJX B;  2XXT A;  1MPC A;  3IX1 A;  1HSE A;  1LFG A;  4NWD A;  3MWB A;  2ONR A;  3KOT A;  5DVJ A;  4ECF A;  1B4Z A;  3T9V A;  1MH4 A;  1LFI A;  1QW0 A;  3PUW E;  2QS1 A;  3PU5 A;  3RUM A;  4LP2 B;  5CM6 A;  2XXI A;  4FJP A;  3ZSF A;  2XX8 A;  3TTR A;  4Q0C A;  2RF1 A;  2V84 A;  4DCY A;  2XX9 A;  3ZKL A;  3BKI B;  2DWA A;  1Y3Q A;  3T9H B;  4NF8 B;  4YZZ A;  4FED A;  1XVX A;  2O84 X;  3KOS A;  3SEY A;  2OCU A;  5ITP A;  4PET A;  4GOT A;  1LAH E;  4BDQ A;  3TUS A;  4FEC A;  1P1Q A;  4QF9 A;  1ANF A;  3S9M C;  3CR9 A;  3HN0 A;  4MLV A;  4N13 A;  5TPA B;  1P1U A;  2DYX A;  4DDD A;  4PFW A; 
#chains in the Genus database with same CATH topology
 3T66 A;  3TCH A;  1IMD A;  3N24 A;  1CB6 A;  4UAC A;  2VCB A;  4DBR A;  1NV4 A;  2HFB A;  3NKE A;  4CS9 C;  1OXB A;  2DB4 A;  1SF8 A;  3M8U A;  1OKK A;  1XT8 A;  1YAU O;  2CZL A;  4H67 A;  1CNQ A;  4KYE A;  3ZVR A;  1RYO A;  3ABK C;  1IXH A;  2D21 A;  1GGQ A;  3L1M A;  1W2W A;  2LSE A;  1LCF A;  3VV5 A;  3G3I A;  3KN8 A;  4YB5 A;  1V74 B;  4DI3 D;  1A99 A;  1OW7 A;  1FQF A;  2B3B A;  4C3B A;  1XZQ A;  2OKU A;  5K2Y A;  1NH7 A;  5CMM A;  1J1N A;  3RY3 A;  1U0B B;  5ISU A;  4WGY A;  3TPA A;  4ULV A;  1MDQ A;  2EPO A;  1BR4 A;  2I3V A;  5EQ7 A;  3B0U X;  3NOH A;  1URD A;  4EQB A;  2LP4 A;  1M5F A;  3QW1 A;  4FAJ A;  2PYY A;  4GX3 A;  4U5E E;  1MNE A;  2Y7R A;  1G0I A;  1FPJ A;  3B9Q A;  2GA0 A;  2IM8 A;  2XXK A;  4F3B A;  3O2A A;  4OZ9 A;  3MVX A;  4JEB A;  2XL8 A;  3N6U A;  3KFM A;  3UMK A;  2OJQ A;  3AQB A;  2KYH A;  4ZEI A;  4PP0 A;  4Z9I A;  4O7G A;  5EYH A;  3K6X A;  4ZS9 A;  3HO7 A;  5L0H A;  3FOP A;  3W8I A;  1JVX A;  1UQW A;  2R05 A;  1G4U S;  1ZYR F;  3ZWI A;  4G68 A;  2ZXP A;  1ZMG A;  3QVZ A;  5FHN A;  4U21 A;  1BKA A;  3G7W A;  2DWH A;  2FGY A;  3H2V A;  4QDL A;  3S28 A;  4HCY A;  4DVY P;  4X1D A;  3QK6 A;  1Q0K A;  3DD7 A;  5B3I A;  4RK2 A;  1RCP A;  3QZC A;  2YLD A;  2QFL A;  1CGN A;  2KW3 C;  2MHR A;  4YK5 A;  3MLG A;  2AIX A;  4F3S A;  2EPM X;  2HZ8 A;  3IOU A;  2QY9 A;  4JXI A;  3B6Q A;  3KC0 A;  3PPP A;  1M57 C;  3IOV A;  3GLB A;  1PD1 A;  2J9U A;  2KQZ A;  2WZF A;  1ZHT A;  3C8G A;  4N81 A;  2I0C A;  5K2X A;  4U2R A;  1WAT A;  3UK4 A;  4IGT A;  4MND A;  2XLO A;  4OVJ A;  4DJ9 A;  1VLS A;  4IR8 A;  2X51 A;  2TMV P;  3MZ9 A;  1Z23 A;  3IEE A;  4OA4 A;  4H4K C;  3KL4 A;  1T6Q A;  1OR2 A;  3KGC A;  3UNG C;  2V3Q A;  4G4P A;  4HFK B;  4YKK A;  1ZHW A;  3IJO B;  3IQ6 A;  3KSX A;  4R73 A;  2CNW A;  4IWB A;  3IQC A;  4PFY A;  4P0G A;  4QFK A;  4JTD B;  5BQH A;  3CFZ A;  3N5L A;  4BDL A;  2Q9B A;  4PFP A;  4MHF A;  2HCA A;  2KK1 A;  3ECR A;  3DAF A;  3DZA A;  3PUV E;  3VLW A;  1R1N A;  3EZI A;  5A6A A;  1GS9 A;  2WYP A;  1B0L A;  4PAF A;  1DTG A;  2VPO A;  4F39 A;  1KNY A;  2H25 A;  2ZD9 A;  3TTK A;  3NDB B;  2XXY A;  2L5V A;  2XXV A;  3KJT A;  3MC2 A;  5KYU A;  4KI0 E;  2QE9 A;  3O39 A;  2NUT A;  3MYF A;  4IAQ A;  4JCZ A;  4KBL A;  1TFA A;  2CZI A;  4TLM B;  4RJZ A;  1JW1 A;  4H45 A;  3RQF A;  4N6K A;  5E3C A;  4EQ7 A;  2KQ9 A;  2QVV A;  3NMI A;  1YCJ A;  1RMV A;  3GBA A;  3R7C A;  3O6X A;  2HZL A;  1G5Z A;  5H8H A;  3JYY A;  1D1A A;  1MXX A;  2PNO A;  1V4A A;  2P2A A;  4XEV A;  4NTL A;  3UGP A;  1P1O A;  4F19 A;  2OEX A;  2L7A A;  2WKY A;  3CVG A;  1BP5 A;  4U23 A;  4PJJ A;  5TP9 A;  5LOM A;  2YEV A;  4FEB A;  2ZMB A;  2LFF A;  3TTM A;  4HE2 A;  3TTL A;  2WVN A;  4OQO A;  1JET A;  3DXJ F;  1G0H A;  2IBF A;  3EQL F;  1LAF E;  4G78 A;  4R6Y A;  1MMN A;  3AG1 C;  2F5X A;  4ISU A;  3FBP A;  4FX5 A;  3DP6 A;  2XXW A;  3A9C A;  3A3C A;  5BQG A;  4CS8 C;  4DRI B;  4G7Z F;  1Z63 A;  3EHT A;  1N3X A;  2W7Y A;  3MBP A;  3A29 A;  1OLA A;  3IK6 B;  4YMA A;  2QLA A;  1JP4 A;  2YHS A;  1LPE A;  1RXQ A;  1AVO B;  3JZ0 A;  2LIG A;  2V26 A;  3JV9 A;  4MCO A;  4OET A;  2J9V A;  4YT2 A;  3IOR A;  3A3U A;  3AG3 C;  1UG7 A;  2WEF A;  1ZHY A;  2QMW A;  1B7Z A;  1NFN A;  4ND9 A;  3S29 A;  4YWQ A;  2H7B A;  2HV7 A;  3VVD A;  1QKR A;  4AE4 B;  1V54 C;  2AL4 A;  3OD7 A;  3MBG A;  1NMU A;  4GBV A;  4IO4 A;  2R7W A;  1B1X A;  3O6H A;  4R32 A;  4F2Q A;  2R9R B;  4CS7 A;  3OWT A;  1B05 A;  3IQT A;  1TR2 A;  2OCC C;  2J7P D;  2R02 A;  4A2N B;  3KPH A;  3ZIB A;  2YL7 A;  1RKM A;  4P47 A;  2W4M A;  1LVK A;  1NFO A;  4N91 A;  1NV3 A;  3HHG A;  2Y3G A;  4OD5 A;  3O66 A;  3G3H A;  4H46 A;  4TLL B;  3AGT A;  3B6T A;  2I3W A;  3LNR A;  1FNT c;  3E78 A;  3E9X A;  5ESY A;  1NBB A;  2P3N A;  4QHQ A;  3N2Z B;  3NG1 A;  2XWV A;  2Y69 C;  1YPN A;  5KDT B;  3FXR A;  2XXX A;  4YIC A;  1D4N A;  1AL3 A;  2AL5 A;  3PPR A;  3FDQ A;  4PJL A;  5E2Q A;  2RKM A;  5F7V A;  5DVI A;  3HJC A;  3O28 A;  2KR0 A;  1M2V B;  1FBC A;  4ELQ A;  2UVH A;  3USD A;  1VDW A;  4JVD A;  1FPI A;  1QZX A;  5ITO A;  1WTY A;  3X2Q C;  4E0I A;  2CMO A;  4XPY A;  4W8P A;  3MYI A;  5AA1 A;  3RT6 B;  3T9U A;  4ELP A;  3VXC A;  1LKX A;  3KG2 A;  3EZH A;  1NU7 D;  4ZEC A;  4L17 A;  1RJ9 A;  2A69 F;  3K7D A;  2VP1 A;  1J8Y F;  2EPN A;  3CG3 A;  2F6P A;  1G8X A;  5COF A;  1NFT A;  2YWA A;  3MVW A;  4O7I A;  3RIP A;  2OK2 A;  1SW1 A;  3R26 A;  4P8B A;  1MMD A;  3A11 A;  1TWY A;  3UGW A;  2J7P A;  1JOG A;  2AVK A;  4AS5 A;  3GM3 A;  1H3D A;  4K1O A;  1ZIU A;  2VHA A;  2Y39 A;  1DK4 A;  4UAB A;  1ZW2 A;  4DIG A;  1AOV A;  3O29 A;  1Q35 A;  3DM5 A;  1MRP A;  1B5I A;  4I44 A;  2XLM A;  1DMB A;  1JVY A;  1XS5 A;  4BJ1 A;  4EF2 A;  2ZZV A;  3QAX A;  2LAO A;  2XD3 A;  4NF6 B;  1XWJ A;  3QMF A;  1NV6 A;  3ZTM A;  2RC8 A;  3S9O A;  3MZ1 A;  4XTK A;  1NNK A;  1VB5 A;  3FXH A;  3U72 A;  5AA3 A;  4PAC A;  4NQ8 A;  3U0C A;  4GL0 A;  3U94 A;  3RKO F;  4L6R A;  2ALU A;  2OBG A;  4F31 B;  3PTY A;  1OCR C;  5I57 B;  3OMB A;  3ZQV A;  5KCJ B;  3EGX B;  2Y3H A;  4YJW A;  1HW1 A;  4KQP A;  4YL3 A;  4NX1 A;  4LLE A;  5M2V A;  4I9D A;  4JWX A;  1IIW A;  2O1M A;  4Q5T A;  2A0B A;  2VB6 A;  3IAZ A;  5ET7 A;  4W8K A;  1I6B A;  3ECS A;  3DM0 A;  3LLK A;  1LE4 A;  5FTI A;  3I5O A;  4BJ6 C;  3M3F A;  4IO6 A;  1BR1 A;  3L8J A;  2I4B A;  4M4G A;  2J9W A;  4P1E A;  3T4R A;  2D4U A;  3VVF A;  3DJU B;  1B6H A;  3L6G A;  1YA9 A;  2WZL A;  3K6B A;  4EWC A;  2I58 A;  4I1M A;  4ZEK A;  2KSF A;  1H43 A;  3LSW A;  3U3B A;  1OW6 A;  2DE2 A;  2F35 A;  1L5T A;  5KZT A;  4XKR A;  4WKM A;  4GD5 A;  5CC2 A;  2O6A A;  2Q74 A;  3LUZ A;  1FPF A;  1JPN A;  1CPR A;  1SR2 A;  4PFW A;  4LQ2 A;  1Q0M A;  1GVC A;  3E4R A;  1YTV A;  4JJF A;  3MVZ A;  1QLE C;  3U92 A;  3T6J A;  1AH5 A;  1QJM A;  3TCF A;  1OLC A;  4BJ5 A;  1LGB C;  3VLU A;  4OFL A;  4IO7 A;  3RTF B;  1OVT A;  3B0P A;  4LAC B;  1A54 A;  4OIR F;  3K02 A;  3EG9 B;  2IXP A;  4BDM A;  1D9Y A;  4PE5 B;  3H2U A;  4P6I C;  4JBZ A;  2B0J A;  4NTB A;  4XLN F;  3Q7L A;  3QMK A;  1MPB A;  4FAP B;  2KJG A;  4XWJ A;  2NUV A;  4U5H A;  4PFT A;  2KC3 A;  2BJJ X;  2NPU A;  4OIN F;  3SYN A;  4U5D E;  1ZTY A;  4LAT A;  4LDQ A;  3FAJ A;  3CSG A;  3Q27 A;  3VYW A;  3G3J A;  3IB0 A;  2W4B A;  1BBH A;  2XLH A;  2HFI A;  2I0B A;  3K0V A;  4YB6 A;  4G8H A;  1A40 A;  4THI A;  4P0I A;  3TUL A;  4GIZ A;  4FES A;  3MZB A;  3DI5 A;  3JSZ A;  3KJ7 A;  4PC9 A;  1N76 A;  4QFL A;  3DAG A;  2XRH A;  2IEE A;  4U1Z A;  3V8X B;  5EQ9 A;  1I69 A;  4NCQ A;  4U9D A;  5D91 A;  1CE2 A;  4PFB A;  4OER A;  4NF8 A;  2I8B A;  4GWU A;  4MF3 A;  1FTK A;  3EHS A;  3SES A;  1TFK B;  4K0D A;  2YRF A;  5IZ3 A;  5DQZ A;  2ETS A;  3HNL A;  2PBW A;  3M3L A;  1MQH A;  4LDK A;  1Z5Z A;  1AWB A;  2R7S A;  1J8M F;  4CX9 A;  4O79 A;  4MVU A;  3FHD A;  2WVO A;  2XD2 A;  3CFX A;  1M56 C;  2GHB A;  4GXS B;  1WGW A;  3EPV A;  4IO3 A;  4ONS A;  1FPE A;  5TPA A;  3FZV A;  1MY1 A;  4P9K A;  2QL3 A;  4GX6 A;  4OXV A;  4MH5 A;  1DTZ A;  1E84 A;  4KXP A;  2XXR A;  1D1B A;  4MW3 A;  5T3T A;  2VPN A;  1E2X A;  1MXY A;  1ZJL A;  4OVR A;  1FPB A;  1SVX B;  3MP6 A;  2XS1 A;  3V89 B;  4XEF A;  3PUY E;  2XXP A;  1YVI A;  3FV1 A;  4KFQ A;  4DRH B;  3RNN A;  1OR3 A;  2B65 A;  4PCD A;  2J0X A;  1B7H A;  1XZP A;  1IW7 F;  2GQ1 A;  4DVZ A;  5K0I A;  2UUH A;  4I1D A;  2L6F A;  3IO4 A;  4U5G A;  3TOL A;  5KYX B;  4IY5 A;  1YYJ A;  4MVQ A;  4OHN A;  2Z15 A;  3AGU A;  2HSB A;  1US4 A;  1G4W R;  3Q7G A;  2P1S A;  1ZVZ A;  1UTB B;  1NLX A;  3PD8 A;  3DWW A;  1S7Z A;  1OQG A;  1VYI A;  4QFO A;  2QTV A;  4MVO A;  2ZNT A;  3HHF A;  4IO2 A;  4Q5S F;  2LCH A;  4LON B;  5F24 A;  2AYS A;  1R9Q A;  1NZE A;  3E70 C;  4QSE A;  2PFY A;  1IUD A;  3OO9 A;  3TZA A;  1M5B A;  4LLC A;  2XM0 A;  5E33 A;  3EN3 A;  4ZEF A;  1I6A A;  3K1I C;  2YJP A;  4OFO A;  3IOW A;  5CMK A;  4OTE A;  3MYU A;  3OEN A;  5L3Q A;  2DQV A;  2FIX A;  3LV0 A;  1ORS C;  2YVK A;  2DGJ A;  1VFE A;  2LFD A;  4YT4 A;  5CMB A;  5KYY B;  3C35 A;  4EUO A;  2RD9 A;  3GXA A;  2ASR A;  1NUY A;  4BLA A;  5A5X A;  2IYL D;  1EYJ A;  2A0U A;  4XXU A;  2LK4 A;  1FPL A;  1Z7N E;  5JEI A;  4Q7C A;  4RXL A;  4OEV A;  1R4T A;  1S50 A;  3MPL A;  5DS4 A;  4P11 A;  1B51 A;  2PMS A;  4OEN A;  4OFJ A;  1O87 A;  3S90 A;  1H44 A;  2Q3T A;  3GZG A;  1H6G A;  2J46 A;  1GV8 A;  2R03 A;  3I4U A;  3EF7 A;  1QUI A;  4ZEB A;  3FVK A;  4EIY A;  1UFB A;  2RC9 A;  5HV9 A;  3PMW A;  2LD6 A;  2HXW A;  4GX4 A;  1SW4 A;  2HQ0 A;  2OJE D;  4EUK B;  4PFO A;  2GFE A;  1TKN A;  2BC5 A;  2PX1 A;  5J16 A;  1FFH A;  2ESN A;  4XEK A;  1LB9 A;  1SPI A;  1ZBM A;  2Z23 A;  1NV5 A;  1B3L A;  1USY H;  3FXU A;  1HMO A;  2DWI A;  1ZU0 A;  1M5C A;  4I62 A;  3VFJ A;  3T6B A;  4MEV A;  1MQV A;  3SXM A;  3ITF A;  2V93 A;  1FAP B;  4H8I A;  4M63 A;  4FIM A;  1O64 A;  5B1B C;  3SEO A;  4PDH A;  3LSL A;  3MVY A;  2JD3 A;  4OEU A;  4XPX A;  3BRJ A;  2XLE A;  3BEH A;  2EIK C;  4OES A;  4YMB A;  4LN5 A;  5I58 B;  2EPL X;  5FTH A;  3TQW A;  3SEX A;  2HKV A;  3IO6 A;  2F3D A;  1CGO A;  1S9T A;  4O3C A;  5EQA A;  3QW0 A;  2RC7 A;  1NV7 A;  4H65 A;  5AA2 D;  3TEP A;  4EBK A;  4G2Z A;  2HV6 A;  3H65 A;  1LBY A;  3ASO C;  2H4I A;  2QSX A;  3SXZ A;  4EKW A;  2ZNU A;  1Z7M E;  2B4M A;  4G61 A;  5A6B D;  2VOZ A;  1EZ9 A;  4DXC A;  3LS1 A;  2WVQ A;  2HAU A;  2REG A;  4GF8 A;  5EYG A;  1N1C A;  5KYW B;  3R6U A;  1B9J A;  2NVU B;  1XHY A;  3H6W A;  2HMQ A;  3UMH A;  1BLF A;  4Q8R A;  1HY5 A;  2XSE A;  4DOZ A;  2R7T A;  1PBP A;  4EF1 A;  4PGP A;  4J32 B;  4X1B A;  1OQH A;  5A69 A;  2REJ A;  1MQI A;  2XHD A;  2PFZ A;  3IR1 A;  1FQA A;  3MAM A;  1IMB A;  3QYT A;  3BFU A;  1BDJ B;  1MM7 A;  1POY 1;  4C0R A;  1Y4T A;  2ZXR A;  4CS9 A;  4N17 A;  3NMJ A;  2F78 A;  1B0H A;  1Y1M A;  4U4S A;  4PF6 A;  3TOD A;  4ANJ A;  5I56 B;  2F6G A;  3HTK C;  4H8J A;  3ZQY A;  4JUR I;  4N8Y A;  5HSW A;  5CMC A;  1MG1 A;  1TWH A;  1VYK A;  3RGY A;  4HS7 A;  3D4G A;  1LI7 A;  2UYF A;  1ZU4 A;  4AL0 A;  4AE4 A;  2YZS A;  1EI7 A;  4F2O A;  1PD0 A;  4GQO A;  4N06 A;  3MP8 A;  4G77 A;  1PB7 A;  2PX3 A;  3SP1 A;  5L0G A;  4GLI A;  3T93 B;  2D3I A;  2DI3 A;  2J8W A;  5BQI A;  4QI0 A;  4WJ0 A;  3C32 A;  2OLB A;  3SEV A;  1KWH A;  3FD3 A;  4U5C E;  1II5 A;  3ZKK A;  3M3K A;  4GWZ A;  2UYE A;  1SW5 A;  4YL1 A;  4LUB A;  1FJ6 A;  3LBS A;  3WG7 C;  1LBW A;  3C8Z A;  1B46 A;  3H6V A;  4GBW A;  1LFH A;  4I1O B;  4WGZ A;  3ZTZ A;  1S7Y A;  2XXQ A;  2GFH A;  4O3B A;  4RDA A;  4EBB A;  5KDT A;  1OVB A;  1MY3 A;  5L0I A;  1V55 C;  2CYD A;  5DLJ A;  3OEM A;  2NSG A;  4ZDM A;  2ZZX A;  3UOR A;  4LQ5 A;  1LAG E;  1QGX A;  4G8M A;  1LCT A;  3S0X A;  3F46 A;  2O1L A;  5H8Q B;  4GXA A;  4OVP A;  3C36 A;  1B3E A;  1JNF A;  1RDY A;  5I5P A;  4NMY A;  1IIT A;  4NC3 A;  3LUY A;  2H7V C;  1LST A;  2I49 A;  3MUQ A;  3C63 A;  1EH3 A;  1FW0 A;  1T0K A;  4KC9 A;  3S27 A;  4KYS A;  2M64 A;  1JEV A;  1QPU A;  1SYQ A;  5I59 B;  4NF4 B;  3IFC A;  3IQ5 A;  3LES A;  4JRZ A;  2JX0 A;  1DOV A;  2XLD A;  5D92 A;  3T0J A;  2LQG A;  4EDP A;  1YXI A;  1YDI A;  2ONK E;  4GEH A;  1EA8 A;  2R7X A;  3PMX A;  2L6H A;  4AQ4 A;  3T9O A;  2ANJ A;  3C34 A;  4PBQ A;  4QRZ A;  1MPD A;  4NY3 A;  1OCZ C;  1B40 A;  4C3D A;  3CAX A;  4CIP A;  2OX3 A;  2KNH A;  3TK0 A;  2DXR A;  2HEU A;  4NF6 A;  3KZG A;  3C7J A;  2Y5L A;  1IXC A;  5CI9 A;  2V4C A;  3ODB A;  1D3K A;  1RDX A;  1YA7 O;  3U8V A;  2QPQ A;  1DPE A;  5I57 A;  4LDR A;  5KCJ A;  3EGX A;  4H0W A;  4JE9 A;  5A5L A;  2QS2 A;  2ICW G;  4O8M A;  1Y1Z A;  4DXW A;  1UTH B;  2W9Y A;  4HE1 A;  5DW8 A;  3LEV A;  1YAE A;  1FTA A;  2XLW A;  4JJG A;  2CZK A;  1MXU A;  3US6 A;  4C3E A;  5F5F A;  5AA2 B;  3HNK A;  4F3G A;  1VTM P;  4MNI A;  1SYI A;  3DP8 A;  2DS9 A;  2FFH A;  4NAP A;  2PX0 A;  3LNM B;  2XA5 A;  3MQ9 A;  3C18 A;  4MW8 A;  1NV0 A;  3UIF A;  2PF4 E;  1A41 A;  1WWP A;  3KC1 A;  3W2W A;  3PCV A;  2XXU A;  3MPK A;  5DQT A;  1HSL A;  2QNL A;  1VK5 A;  5CI5 A;  4RPO A;  4X9T A;  1AMF A;  2A5S A;  4BDO A;  4H54 A;  2PT1 A;  2BE5 F;  5I2K B;  3S9L C;  3W4Y A;  4MNC A;  3AG2 C;  5H8S A;  3FVY A;  2UVI A;  2H8A A;  1JW4 A;  5EHH A;  4CS8 A;  1P99 A;  4ELO A;  2G3K A;  2H99 A;  4P9F A;  1IQ7 A;  1DPP A;  3U2L A;  3C62 A;  1KA0 A;  4KNV A;  1EZP A;  4IB4 A;  4EBJ A;  1YAR O;  3GEH A;  1A7D A;  4GQH A;  5H8N B;  2AWC A;  1VOM A;  1ELJ A;  2I15 A;  3KMI A;  1R9L A;  1NNP A;  2DXY A;  4J30 B;  2O7U A;  4MTG A;  3M1C B;  3RVZ A;  1I4Y A;  4AB6 A;  1US5 A;  1VR5 A;  4BDN A;  4IAO A;  2GDC A;  1NNT A;  1NUZ A;  1NNF A;  5FZT A;  2P0S A;  4MTO A;  4ZZE A;  3Q25 A;  4MX6 A;  3KYI A;  3U3F A;  1IXI A;  2HJ3 A;  3GAN A;  3OO7 A;  1PB8 A;  1D0Z A;  2NG1 A;  5JS5 A;  4TOZ A;  2UVJ A;  4DI4 B;  3B29 A;  1VE4 A;  4E0W A;  3NYL A;  2GWW A;  3CIJ A;  1ZW3 A;  4R72 A;  4YB7 A;  5JLI A;  3K6V A;  4U4X A;  2C03 A;  3WAF A;  3JTL O;  2Y3B A;  2PFD A;  1H7I A;  2AP3 A;  1VLT A;  3JSE O;  2PP4 A;  2UVG A;  1O7T A;  3OSQ A;  1TWC A;  2V25 A;  3PPQ A;  3G4Z A;  3PUZ E;  4MJO A;  4R74 A;  4RK9 A;  4FBP A;  3QIM A;  4DZ1 A;  2DDK A;  4Z0I A;  4G7O F;  3IPM O;  4IAR A;  1MQD A;  4LA9 A;  4IGR A;  4IGG A;  1IZ1 A;  3B71 A;  4ELR A;  4C1U A;  2P61 A;  2OZZ A;  4OVQ A;  3OO6 A;  3PHF 2;  1NI9 A;  1PCX A;  5JRA A;  3K01 A;  5I3S A;  1A7V A;  2A5T B;  2ZNS A;  4PAK A;  2GH9 A;  5I7I A;  3TKD A;  2CZH A;  5J1D A;  4F4B A;  1EU8 A;  1R6Z A;  2IXO A;  2F7A A;  2ZXT A;  3H7M A;  2ABH A;  1AUE A;  5KYN A;  1MMG A;  3LC8 A;  1MXV A;  1Q0D A;  3T9X B;  3C33 A;  1URG A;  2OWS A;  1FQD A;  2F22 A;  3L8I A;  1T6I A;  2PVU A;  2RCB A;  1ORJ A;  3EGD B;  3HNJ A;  3RVY A;  4MIJ A;  1N7X A;  4LVQ A;  2HMZ A;  1NSG B;  4JIO A;  2CEY A;  4OVT A;  3O6I A;  3S2V A;  3OOA A;  4BDR A;  1GR2 A;  3DE9 A;  3THI A;  4F1U A;  3UMI A;  2R71 A;  3QSL A;  1H9T A;  4NF5 B;  3FGS A;  3GWL A;  3G50 A;  1NUW A;  3ABL C;  1WOD A;  2NSF A;  1SZI A;  2OOC A;  3GBB A;  1FBD A;  3EFO B;  1FBP A;  2E87 A;  4EXL A;  3M15 A;  4XKP A;  4RPN A;  3QUJ A;  3L6H A;  2ONS A;  3RYL A;  1QKB A;  4FOR A;  1B3G A;  5ELV A;  1Y4C A;  5KYX A;  5IGA A;  3ZG1 A;  2Y7W A;  4AS4 A;  4P3L A;  3KKB A;  2WYK A;  3AJM A;  5IY5 C;  3L0I A;  1SI1 A;  4UDV A;  4CSA C;  3PGF A;  2NWJ A;  3G3K A;  4RD9 A;  4NE4 A;  1UTB A;  1B32 A;  4N07 A;  1WDN A;  3SER A;  1JW5 A;  4U22 A;  1EZO A;  3NRH A;  1I4Z A;  3V5Z A;  4ESX A;  3KBZ A;  2FIE A;  2Z22 A;  4RA1 A;  2FAP B;  2BJI A;  2F97 A;  3DE8 A;  4TQU Q;  5T3J A;  1QSP A;  3VLV A;  3NYM A;  2DE4 A;  1AIV A;  4HFF B;  3N6T A;  3K6W A;  3MFN A;  4N6D A;  3CRB A;  1N04 A;  4BJ6 A;  4NHB A;  5A6K A;  2FYI A;  1ORY A;  3DLN A;  3FV2 A;  3H4Z A;  4PR9 A;  3DEL B;  4ZZA A;  1NV1 A;  4WED A;  4ZE9 A;  2Y5K A;  4OMB A;  1FPK A;  4I8C A;  4XTC Q;  3FMS A;  5ET6 A;  4H6D A;  4AB5 A;  2A68 F;  2BL2 A;  5HM4 B;  3VVE A;  1LBV A;  4Z7E A;  5KYY A;  2HPG A;  1KZ8 A;  3B8B A;  4RY1 A;  3WAE A;  3U93 A;  3B0V C;  2MKZ A;  2O69 A;  4KR5 A;  1L3P A;  4WXJ A;  4P9T A;  5AC4 A;  1HMD A;  5CBR A;  1Z6A A;  4YL0 A;  5ET8 A;  1QQ3 A;  2B4L A;  1SD3 A;  3CHG A;  3DMD A;  4BJT A;  1S05 A;  2XS8 A;  3U8P A;  5L8D A;  2HSQ A;  2R8T A;  3X1O A;  3KYJ A;  1XC1 A;  2ZXW C;  1HSJ A;  1Y3N A;  1F9B A;  3C31 A;  4YKJ A;  3SEW A;  1ZLQ A;  1R5I D;  1LM3 B;  2DOJ A;  2Q8M A;  3SET A;  3EHM A;  5TJ5 E;  5H8F B;  5E3A A;  3G3F A;  3RTW B;  3TTN A;  1UIV A;  4PGN A;  3LUT B;  1IZM A;  3NMK A;  5AC5 A;  4E0H A;  1Y6D A;  4DBQ A;  4XIG Q;  3VF0 A;  3FAS A;  3D4C A;  5F5H A;  2DWJ A;  3VXB A;  4ESW A;  2H98 A;  1MMA A;  1YZA A;  1QKA A;  4OYV A;  4YT8 A;  1XI6 A;  2QS4 A;  5JK4 A;  2Q88 A;  3FJM A;  3S9E A;  3FXB A;  2EIM C;  4R9F A;  3RT8 A;  1LBX A;  2P0N A;  2EPK X;  4JSO A;  1FTL A;  4P1L A;  5FCL A;  4GWX A;  2J9B A;  3TDJ A;  3BIG A;  2W45 A;  3ABM C;  2DVZ A;  5I58 A;  1MXZ A;  1NL5 A;  1LS4 A;  3OEO A;  4JZA A;  3O55 A;  1B52 A;  4O94 A;  4QFP A;  1MND A;  4J7T A;  1ZHZ A;  3EJN A;  2PT2 A;  4NG7 A;  4LER A;  4XPW A;  2G93 A;  3RQG A;  3B7D A;  3E13 X;  4NTA A;  3OSR A;  4F3P A;  2EIL C;  4I3M A;  1USY E;  2L9J A;  3DM9 B;  4N4U A;  4YN0 B;  1MS7 A;  1TFD A;  2WBD A;  3U65 A;  3U9J A;  1Y9U A;  2F34 A;  5KYW A;  2UUI A;  4H5F A;  1OKK D;  4U5B E;  2QMX A;  1TFO B;  2OWZ A;  1XVY A;  3DP4 A;  5DVW A;  1O3U A;  5F28 E;  5JUA A;  3K1M A;  5A6J A;  3RFY A;  3N0T A;  4E17 A;  1JEU A;  1D9V A;  2KLF A;  3GEE A;  1PC3 A;  3TD7 A;  4C1T A;  2XXA B;  2NUP B;  3RPW A;  2E0S A;  1H76 A;  3HNI A;  4LZ5 A;  3GOR A;  2NXO A;  2WBB A;  5I56 A;  4F1Y A;  4N8G A;  3BFT A;  3TMG A;  2IXM A;  3K00 A;  3W2V A;  1QVS A;  5L0J A;  4ER9 A;  2YLG A;  2DP8 A;  1NUX A;  1Z7Q c;  2Q8J A;  4CBE A;  2FBP A;  5IAI A;  3HST A;  5B1A C;  5JVE A;  2P3V A;  1L7C A;  1K9Z A;  2D5W A;  3WHN A;  2FHY A;  1D0X A;  4B6I A;  3K4U A;  2RSE B;  4XFE A;  2MYS A;  3IB1 A;  2F8D A;  2Z8E A;  3M4C A;  2X0C A;  3CI8 A;  2O51 A;  3CFL A;  4GWO A;  2O68 A;  3TJ6 A;  3PMV A;  4U5F E;  1FPD A;  3KN3 A;  3W8H A;  2R7Q A;  3KBR A;  3UA8 A;  1MQG A;  3Q28 A;  3V5Y A;  3TYH A;  1M6T A;  5AA4 B;  3GOD A;  1K05 A;  1FJ9 A;  4PJM A;  1FRP A;  4G68 C;  4HCW A;  2OG2 A;  2L81 A;  1I5N A;  1LB8 A;  1IXG A;  2XL6 A;  5T1D B;  4OIO F;  1QUL A;  2E1S A;  2WX9 A;  3OO8 A;  1FQE A;  3HKK A;  4JB7 A;  5EQ8 A;  1A8F A;  4DE8 A;  3AG4 C;  1C03 A;  2DE3 A;  3EQ1 A;  4OIP F;  3TQO A;  4BG0 A;  3FJ7 A;  3QTH A;  4X8R A;  2FNC A;  4PAI A;  1RKE B;  5DEX B;  3R7X A;  5I2N B;  4C7O B;  4R6H A;  4JCH A;  3K1I A;  3C8G D;  1MQJ A;  3T22 A;  1ST6 A;  5H8Q A;  4YKP A;  3V83 A;  3FVN A;  3P7I A;  5L0F A;  1A8E A;  5COM A;  1FSA A;  3SKP A;  1PEB A;  5JTY B;  2V3U A;  5HBC A;  4MVZ A;  4JC7 A;  3JRM O;  3RF3 A;  2VC9 A;  5I59 A;  4OIQ F;  4NF4 A;  3CQZ A;  2CNW D;  2H7O A;  3ATP A;  1OQC A;  3GM2 A;  4N6C A;  4CJG A;  3C9H A;  4G7H F;  3KEI A;  5GPG B;  1GGG A;  5HPQ A;  3ILU B;  1YYX A;  2A1D D;  4JTC B;  1YYZ A;  1T01 A;  5TU0 A;  4I3E A;  2GHA A;  2RIN A;  2X7Q A;  1SW2 A;  2YPN A;  1EYK A;  1MY2 A;  5DS6 A;  4QFN A;  3EH1 A;  5ICQ A;  3M79 A;  4JSD A;  1SDX A;  3TQL A;  1KA1 A;  4R6K A;  4YAH X;  4JVS A;  3SXY A;  3ZSU A;  3AQC A;  3T96 B;  3JT1 A;  4RNS A;  3ASN C;  2GRV A;  4PFR A;  3Q6N A;  1TQG A;  2L6G A;  3RPL B;  2QVR A;  1FQC A;  5L0C A;  1SYH A;  1E85 A;  1B5J A;  4JEA A;  3M4B A;  3K1P A;  3O97 A;  2QS3 A;  4QSC A;  3WOD F;  2MWQ A;  2V3T A;  2WL8 A;  4JWY A;  1TWA A;  3FAP B;  3UP9 A;  1N0T A;  2QVU A;  4BEJ A;  1FTJ A;  1FBF A;  3FOO A;  2HUJ A;  4R2F A;  2P7V A;  5A5X B;  2Y7P A;  5DYH A;  4E7Z A;  1NU9 C;  2ZXO A;  5AGF A;  2R7U A;  4F1V A;  2O9X A;  2OJT A;  4MBP A;  4F18 A;  2R6G E;  1LI5 A;  3K6U A;  1UTH A;  1PBQ A;  4YU0 A;  3LJB A;  3F11 A;  1Z3I X;  1B7U A;  5FHO A;  5AA2 A;  5ICT A;  2DSF A;  5FBP A;  4UA8 A;  4XEQ A;  4BEM J;  2Q89 A;  3PDM P;  4DXB A;  3CSB A;  3EPE A;  3SDF A;  2Q9A A;  4P56 A;  1EQ1 A;  3FIR A;  4MNP A;  1A7L A;  5A6B A;  1D9Q A;  3S9N C;  4RBN A;  1D1C A;  1O63 A;  3O10 A;  1B3F A;  3TFL A;  2B0H A;  2QUP A;  2O7I A;  2ZYM A;  1M2V A;  4MVS A;  3EHU A;  3O6G A;  4QBA A;  1A0B A;  3DJN B;  2G3V A;  3IHU A;  4IB2 A;  3O9P A;  4O6N A;  5FHM A;  4K3F A;  5I2K A;  3UGO A;  5DT6 A;  1DBZ A;  2IXN A;  3MW0 A;  4DRJ B;  3I3V A;  4JDF A;  2HJM A;  3JZJ A;  4HXV A;  5CRY A;  4I40 A;  3QUF A;  4D4X A;  5JT4 A;  4CJO A;  3RQE A;  4QXD A;  3HCQ A;  3FVO A;  1C02 A;  1DCU A;  2XWO A;  4MLQ A;  2ZYK A;  2DYS C;  2XM4 A;  3LEO A;  1HE9 A;  1MY4 A;  5H8N A;  1TWG A;  3SZR A;  4WEP A;  4IY6 A;  4E0X A;  2IOQ A;  1BZ4 A;  2P6V A;  3SXK A;  3POV A;  1PB9 A;  4GVO A;  3BBR A;  5AE4 A;  3W9V A;  3IOT A;  4YKI A;  3ZS6 A;  4XKQ A;  3ZDL A;  4IJJ A;  1NKX A;  2YLN A;  1OCO C;  2Z8F A;  5IKB A;  5IM2 A;  2HS5 A;  3E9V A;  4HW8 A;  3LR1 A;  1JMW A;  4J7Y A;  2CDQ A;  4ZLD A;  1MXW A;  4YT5 A;  1N3W A;  4GRK A;  1M2O A;  1YZ0 A;  5L9M A;  5CI8 A;  4NWC A;  1AEP A;  5CBS A;  5L0D A;  1TT1 A;  4G68 B;  3BIH A;  5EHM A;  4ULW A;  4MVR A;  4U9E A;  4Z9J A;  4KI2 A;  2X7P A;  3IL1 B;  2G29 A;  3S4U A;  3U1O A;  2JJK A;  1ZKB A;  3I6V A;  3PMR A;  4ONY A;  2M8C A;  4A4A A;  4PTK A;  3PD9 A;  4HEA J;  2Q2C A;  4MS2 A;  1B68 A;  3L34 A;  2ZYN A;  3MP1 A;  4X04 A;  5EGY A;  3C8G B;  1N7W A;  3FXQ A;  2G62 A;  1P1W A;  3H6T A;  4PJN A;  3UR3 C;  3AOU A;  2A5T A;  1K9Y A;  1T6U A;  1M5D A;  1MH3 A;  4RYA A;  1VFD A;  3H3G A;  2YKZ A;  1OCC C;  1IMA A;  3U5S A;  2YL1 A;  4ZLC A;  1LIH A;  1DSN A;  1FBG A;  4R75 A;  3EGD A;  3ZC4 A;  1K40 A;  4KCD A;  2Y7K A;  1EKY A;  2THI A;  2YQY A;  2ZPA A;  4HE0 A;  3LS0 A;  1POT A;  4ZED A;  4O7M A;  1INP A;  1FMW A;  3WAQ A;  4NF5 A;  1UIU A;  1VSO A;  3EH2 A;  3Q6M A;  5EK0 A;  4GWW A;  1BIY A;  3UN6 A;  3KH2 A;  2H9B A;  3EFO A;  3VAY A;  1OMP A;  1EYI A;  3J06 A;  1K04 A;  1ZZP A;  1ZU5 A;  5LDZ A;  3PPO A;  5KYU B;  4GL8 A;  2CW0 F;  5I84 A;  4EHP A;  3PV0 E;  2NUT B;  1OW8 A;  2FA7 A;  3V7O A;  3G3G A;  4KCC A;  4KNW A;  1NV2 A;  4EXK A;  1GTK A;  1YJG A;  1IEJ A;  3TEL A;  2Q00 A;  4CDA A;  2EIJ C;  3T6G B;  1KU2 A;  3VM6 A;  3SZP A;  2VAS A;  1H45 A;  2RCA A;  1URS A;  1LBC A;  4Q30 B;  3Q29 A;  4GWS A;  1JQF A;  4FAT A;  3B6W A;  3KSJ A;  1ATG A;  2WZG A;  3EG9 A;  5H8H B;  4GFR A;  2VCC A;  2F7B A;  3A09 A;  4OD4 A;  4IO5 A;  3N26 A;  3FJG A;  5JSL A;  1T9K A;  4O6M A;  1IMC A;  4Q4Z F;  4N6P A;  3JYR A;  5BUU A;  3RQT A;  1KTM A;  2YL3 A;  1B2H A;  1RDZ A;  1B58 A;  3KN7 A;  2IA4 A;  5L9O A;  2D5R B;  1E86 A;  5TP9 B;  3K1H A;  1Q0G A;  3TAJ A;  1Q1K A;  2I4C A;  3HV1 A;  3LAY A;  2VD2 A;  4O6Y A;  4LZ7 A;  2Y3D A;  4JTA B;  3TJ5 A;  3V5X A;  1U6H A;  3IB2 A;  3NKD A;  4OVS A;  5IZZ A;  1NH8 A;  4OWD A;  1MY0 A;  1APC A;  3W15 C;  3I5Q A;  3NYJ A;  4G0H A;  5EYF A;  3VRC A;  4QSD A;  2OQM A;  4NGU A;  5BWJ A;  1ZHX A;  2F3B A;  4DLD A;  2R7R A;  4KPT A;  256B A;  4BJ5 C;  1PV3 A;  1A55 A;  1SQY A;  1Y20 A;  2P1A A;  3CSK A;  3OEL A;  5L9S A;  3QXM A;  1LBB A;  3CG1 A;  1P1N A;  1BTJ A;  3EHN A;  1WAS A;  3OXN A;  4PFU A;  2R25 A;  1JAF A;  2YL0 A;  3HFU A;  3PPN A;  2XLV A;  4LZ8 A;  5BUO A;  1VMA A;  1TXF A;  2FVZ A;  3H6U A;  1QUK A;  4O3A A;  4MVM A;  1YZC A;  4AK9 A;  3S84 A;  3LSX A;  4NF0 A;  4OAN A;  1FPG A;  2Q9C A;  1MDP 1;  3JRT A;  3K2D A;  4XKN A;  3K1N A;  1FTO A;  5H8F A;  2OEV A;  3E3K A;  2PBE A;  4NQF A;  1IMF A;  3N94 A;  2VGQ A;  1B3H A;  1M5E A;  2QJE A;  1RYX A;  4F22 A;  4H1X A;  5B7D A;  1B4H A;  3Q26 A;  2Q2A A;  1OIB A;  2PCR A;  3IFA A;  2Q9T A;  1LAX A;  3VDF A;  3MJN A;  4FE8 A;  1FBH A;  4HTG A;  4CIH A;  2UXA A;  1H9G A;  1E83 A;  3RLF E;  3MX3 A;  4PFI A;  2OWT A;  1HW2 A;  1FCK A;  5DVF A;  3GYY A;  2DVC A;  1U89 A;  1JRA A;  2R7O A;  4GYT A;  5COG A;  2Z8D A;  4KHZ E;  3I5P A;  4PK4 A;  1SBP A;  2Y7I A;  2HHM A;  5B3S C;  3ONM A;  2CCY A;  4EQ9 A;  3HPI A;  3LSF B;  4U1O A;  5LTC A;  2GAQ A;  2VD3 A;  1I6Q A;  3DKA A;  5T3W A;  3H06 B;  1RJ9 B;  4JVI A;  3FUZ A;  1C17 M;  4MMP A;  1QUJ A;  4M1V A;  3GWN A;  2J45 A;  3FVG A;  3K33 A;  4KYD A;  1SI0 A;  4DCX A;  4E18 A;  2AU5 A;  4XQ1 A;  1FR0 A;  2ZZW A;  3QVY A;  5IZ1 A;  1FQB A;  1WVJ A;  3AXF A;  3GM1 A;  3R2P A;  4WAB A;  2V3C C;  4X48 A;  4HE8 D;  2R9J A;  4JVC A;  5EHS A;  4F29 A;  3OEK A;  4CDV A;  3T1B A;  3C4M A;  1WN0 A;  4PE3 A;  2XX7 A;  5JP7 A;  2XXA A;  2NUP A;  1HE1 A;  4ZE8 A;  3ILT B;  4JWO A;  4AX2 A;  1JPJ A;  2NOO A;  3CEX A;  1Y3P A;  4IRU A;  1LLS A;  1CPQ A;  3K66 A;  2DYR C;  1F1M A;  1D0Y A;  4NTF A;  2XL4 A;  4POX A;  3RN8 A;  1GQA A;  3TOM A;  3U9M A;  4MFI A;  2I6E A;  4POW A;  5DTB A;  4K7B A;  3TCG A;  2Q7R A;  4PF8 A;  3FAT A;  2HXR A;  1PDA A;  1CGM E;  1GM5 A;  3SEU A;  4MTF A;  3HLZ A;  4JW1 A;  3RYD A;  4AL1 A;  1NG1 A;  3JYH A;  2I48 A;  2ZYO A;  5F1Q A;  4R2B A;  3U2M A;  2F36 A;  1XOC A;  4N4W A;  4D4N A;  2AWY A;  4DXU A;  2M4E A;  2CGE A;  4G8N A;  2XXH A;  3MST A;  1FTM A;  3VE1 B;  4CSA A;  3F47 A;  5AA4 A;  1B1H A;  3CZ6 A;  4PDD A;  4H5G A;  1MM6 A;  3ISP A;  3JCU Q;  2Y84 A;  3OA1 A;  2VH3 A;  1DOW A;  3U8Q A;  2HZK A;  2EIN C;  2B3F A;  1N84 A;  4KD5 A;  1IME A;  5B70 A;  3PUX E;  2A6H F;  2WB7 A;  1B5H A;  4NED A;  1FTS A;  4XF5 A;  3V5A A;  2F7C A;  4JKV A;  1RKC A;  2YLI A;  3W9W A;  1Q9D A;  4XLP F;  1DOT A;  3G4X A;  4FWV A;  1RKE A;  4X0R A;  5DEX A;  2QRY A;  1FMV A;  5I2N A;  2HAV A;  3B50 A;  4C7O A;  2H5Y A;  4MAG A;  2X26 A;  2XWI A;  3LLI A;  4R9G A;  2OU6 A;  4PBH A;  5L3V A;  2VT5 A;  4MQ9 F;  4PQJ A;  3H03 A;  1FBE A;  1LE2 A;  3IJX B;  5JTY A;  4QI2 A;  2XXT A;  1MPC A;  2Q4F A;  4E7S A;  1FFT C;  3IX1 A;  1HSE A;  3GEI A;  1LFG A;  2VCA A;  3D1R A;  4NWD A;  3MWB A;  1JR8 A;  1O5H A;  2ONR A;  3KOT A;  5DVJ A;  1T5O A;  3EKI A;  3RH3 A;  1A7E A;  4ECF A;  1WOL A;  1B4Z A;  3T9V A;  1MH4 A;  1LFI A;  1QW0 A;  3PUW E;  4NN3 A;  4I3Y A;  2QS1 A;  3ROJ A;  3PU5 A;  3E79 A;  5ET5 A;  3RUM A;  4LP2 B;  1Q0F A;  2XWK A;  5CM6 A;  5DS5 A;  3RW0 A;  2XXI A;  2KGO A;  4FJP A;  3ZSF A;  3RPL A;  2XX8 A;  3TTR A;  4Q0C A;  2RF1 A;  2V84 A;  4DCY A;  2XX9 A;  3ZKL A;  3BKI B;  1QVX A;  4N6H A;  2DWA A;  1Y3Q A;  2A6E F;  4Z9H A;  4GWY A;  3T9H B;  1OXK A;  2R7V A;  4NF8 B;  4YZZ A;  4FED A;  1XVX A;  2O84 X;  5IZ3 B;  1BK4 A;  3KOS A;  3SEY A;  2OCU A;  2CEX A;  5ITP A;  4PET A;  4GOT A;  1SMY F;  1LAH E;  4BDQ A;  5CIV A;  3TUS A;  4BPM A;  4FEC A;  4CDY A;  1P1Q A;  4QF9 A;  1ANF A;  3S9M C;  3CR9 A;  1BR2 A;  3HN0 A;  4MLV A;  4N13 A;  5TPA B;  1P1U A;  1YLM A;  2DYX A;  1LEV A;  1LS1 A;  4DDD A;  2JPU A;  2C04 A;  4N15 A;  1LBZ A;  2J0W A;  3SNH A; 
#chains in the Genus database with same CATH homology
 3T66 A;  3TCH A;  1CB6 A;  4UAC A;  2HFB A;  3M8U A;  1XT8 A;  2CZL A;  4H67 A;  4KYE A;  1RYO A;  1IXH A;  2D21 A;  1LCF A;  3VV5 A;  3G3I A;  3KN8 A;  4YB5 A;  1A99 A;  1FQF A;  2B3B A;  5K2Y A;  1NH7 A;  5CMM A;  1J1N A;  3RY3 A;  5ISU A;  3TPA A;  1MDQ A;  2I3V A;  1URD A;  4EQB A;  1M5F A;  4FAJ A;  2PYY A;  2Y7R A;  4F3B A;  3O2A A;  4OZ9 A;  3MVX A;  3N6U A;  3KFM A;  4ZEI A;  4PP0 A;  3K6X A;  4ZS9 A;  3HO7 A;  1JVX A;  1UQW A;  4G68 A;  1ZMG A;  5FHN A;  4U21 A;  1BKA A;  3G7W A;  2DWH A;  4HCY A;  4X1D A;  3QK6 A;  4RK2 A;  2AIX A;  4F3S A;  2HZ8 A;  3IOU A;  4JXI A;  3B6Q A;  3PPP A;  3IOV A;  3GLB A;  2I0C A;  5K2X A;  4U2R A;  3UK4 A;  4IGT A;  4OVJ A;  3MZ9 A;  3KGC A;  2V3Q A;  4G4P A;  4YKK A;  3IJO B;  3KSX A;  4R73 A;  4PFY A;  4P0G A;  4QFK A;  3CFZ A;  3N5L A;  4BDL A;  2HCA A;  3ECR A;  3PUV E;  3VLW A;  1R1N A;  1B0L A;  1DTG A;  4F39 A;  2H25 A;  3TTK A;  2XXY A;  2XXV A;  3KJT A;  3MC2 A;  4KI0 E;  1TFA A;  4TLM B;  4RJZ A;  1JW1 A;  4EQ7 A;  1YCJ A;  3GBA A;  2HZL A;  5H8H A;  1MXX A;  2P2A A;  4NTL A;  1P1O A;  4F19 A;  2WKY A;  3CVG A;  1BP5 A;  4U23 A;  5TP9 A;  5LOM A;  4FEB A;  2ZMB A;  2LFF A;  3TTM A;  3TTL A;  4OQO A;  1JET A;  1LAF E;  4R6Y A;  2F5X A;  4ISU A;  3DP6 A;  2XXW A;  3A3C A;  3EHT A;  1N3X A;  2W7Y A;  3MBP A;  1OLA A;  3IK6 B;  4YMA A;  3JV9 A;  4OET A;  3IOR A;  3A3U A;  2QMW A;  1B7Z A;  4ND9 A;  3VVD A;  2AL4 A;  3OD7 A;  1NMU A;  4IO4 A;  1B1X A;  3O6H A;  4F2Q A;  1B05 A;  1RKM A;  3HHG A;  3O66 A;  3G3H A;  4TLL B;  3B6T A;  2I3W A;  3E9X A;  4QHQ A;  5KDT B;  1YPN A;  3FXR A;  2XXX A;  4YIC A;  1D4N A;  1AL3 A;  2AL5 A;  3PPR A;  2RKM A;  5F7V A;  5DVI A;  3O28 A;  4ELQ A;  2UVH A;  3USD A;  5ITO A;  2CMO A;  5AA1 A;  3RT6 B;  3T9U A;  4ELP A;  3VXC A;  3KG2 A;  4ZEC A;  4L17 A;  2VP1 A;  3CG3 A;  2F6P A;  1NFT A;  3MVW A;  2OK2 A;  1SW1 A;  3R26 A;  1TWY A;  3UGW A;  1H3D A;  1ZIU A;  2VHA A;  1AOV A;  4DIG A;  3O29 A;  1Q35 A;  1MRP A;  1B5I A;  1DMB A;  1JVY A;  1XS5 A;  4EF2 A;  3QAX A;  2LAO A;  2XD3 A;  4NF6 B;  2RC8 A;  3MZ1 A;  1NNK A;  3U72 A;  5AA3 A;  4GL0 A;  3U94 A;  4F31 B;  2ALU A;  2OBG A;  5I57 B;  3OMB A;  5KCJ B;  4KQP A;  5M2V A;  4I9D A;  4JWX A;  1IIW A;  2O1M A;  4Q5T A;  3IAZ A;  1I6B A;  3DM0 A;  5FTI A;  3I5O A;  3M3F A;  4IO6 A;  2I4B A;  4M4G A;  3VVF A;  1B6H A;  3L6G A;  2I58 A;  4ZEK A;  1H43 A;  3LSW A;  2DE2 A;  2F35 A;  1L5T A;  5KZT A;  4XKR A;  4WKM A;  4GD5 A;  5CC2 A;  2O6A A;  4LQ2 A;  1GVC A;  3E4R A;  1YTV A;  3MVZ A;  3U92 A;  1QJM A;  1AH5 A;  3TCF A;  1OLC A;  1LGB C;  3VLU A;  4OFL A;  4IO7 A;  3RTF B;  1OVT A;  1A54 A;  3K02 A;  4BDM A;  1D9Y A;  4PE5 B;  4JBZ A;  1MPB A;  2NUV A;  4PFT A;  2BJJ X;  1ZTY A;  4LAT A;  3CSG A;  3Q27 A;  3G3J A;  3IB0 A;  2I0B A;  3K0V A;  4YB6 A;  4G8H A;  1A40 A;  4THI A;  4P0I A;  4GIZ A;  3MZB A;  3KJ7 A;  1N76 A;  4QFL A;  2IEE A;  4U1Z A;  3V8X B;  1I69 A;  1CE2 A;  4OER A;  4NF8 A;  4MF3 A;  1FTK A;  3EHS A;  3SES A;  2PBW A;  3M3L A;  1MQH A;  4GXS B;  2XD2 A;  3CFX A;  2GHB A;  4IO3 A;  5TPA A;  3FZV A;  1MY1 A;  2QL3 A;  4OXV A;  4MH5 A;  1DTZ A;  2XXR A;  1MXY A;  1ZJL A;  1SVX B;  3MP6 A;  3V89 B;  3PUY E;  2XXP A;  3FV1 A;  4KFQ A;  3RNN A;  2B65 A;  1B7H A;  4I1D A;  3IO4 A;  4IY5 A;  4OHN A;  1US4 A;  2P1S A;  1UTB B;  3PD8 A;  1OQG A;  4QFO A;  2ZNT A;  3HHF A;  4IO2 A;  4LON B;  2AYS A;  1R9Q A;  4QSE A;  1IUD A;  3OO9 A;  3TZA A;  1M5B A;  3EN3 A;  4ZEF A;  1I6A A;  2YJP A;  4OFO A;  3IOW A;  5CMK A;  4OTE A;  3OEN A;  2DQV A;  1VFE A;  2LFD A;  5CMB A;  3C35 A;  4EUO A;  3GXA A;  4BLA A;  5A5X A;  4XXU A;  1Z7N E;  5JEI A;  4RXL A;  4OEV A;  1S50 A;  3MPL A;  4P11 A;  1B51 A;  2PMS A;  4OEN A;  4OFJ A;  1H44 A;  3GZG A;  1GV8 A;  3EF7 A;  1QUI A;  4ZEB A;  3FVK A;  2RC9 A;  3PMW A;  2HXW A;  1SW4 A;  2HQ0 A;  2GFE A;  2PX1 A;  2ESN A;  1LB9 A;  1ZBM A;  2Z23 A;  1B3L A;  1USY H;  3FXU A;  2DWI A;  1ZU0 A;  1M5C A;  4I62 A;  3VFJ A;  2V93 A;  4H8I A;  4FIM A;  1O64 A;  3LSL A;  3MVY A;  4OEU A;  4OES A;  4YMB A;  5I58 B;  5FTH A;  3TQW A;  3SEX A;  3IO6 A;  1S9T A;  4O3C A;  4H65 A;  2RC7 A;  5AA2 D;  3TEP A;  4G2Z A;  2H4I A;  2QSX A;  2ZNU A;  1Z7M E;  2VOZ A;  1EZ9 A;  4DXC A;  2HAU A;  2REG A;  4GF8 A;  3R6U A;  1B9J A;  2NVU B;  1XHY A;  3H6W A;  4Q8R A;  1BLF A;  1PBP A;  4EF1 A;  4X1B A;  1OQH A;  2REJ A;  1MQI A;  2XHD A;  3IR1 A;  1FQA A;  3MAM A;  3QYT A;  3BFU A;  1MM7 A;  1POY 1;  4C0R A;  1Y4T A;  2F78 A;  1B0H A;  1Y1M A;  4U4S A;  3TOD A;  5I56 B;  2F6G A;  4H8J A;  5CMC A;  1MG1 A;  3RGY A;  4HS7 A;  3D4G A;  2UYF A;  4F2O A;  4GQO A;  3MP8 A;  4G77 A;  1PB7 A;  4GLI A;  3T93 B;  2D3I A;  3C32 A;  2OLB A;  3SEV A;  1KWH A;  3FD3 A;  1II5 A;  3ZKK A;  3M3K A;  2UYE A;  1SW5 A;  4LUB A;  3LBS A;  1B46 A;  3H6V A;  1LFH A;  1S7Y A;  2XXQ A;  4O3B A;  5KDT A;  1OVB A;  1MY3 A;  3OEM A;  4ZDM A;  3UOR A;  4LQ5 A;  1LAG E;  4G8M A;  1LCT A;  2O1L A;  5H8Q B;  4GXA A;  3C36 A;  1B3E A;  1JNF A;  4NMY A;  1IIT A;  3LUY A;  1LST A;  2I49 A;  3MUQ A;  1FW0 A;  1EH3 A;  1T0K A;  4KYS A;  1JEV A;  5I59 B;  4NF4 B;  4EDP A;  2ONK E;  3PMX A;  4AQ4 A;  2ANJ A;  3C34 A;  4QRZ A;  1MPD A;  1B40 A;  2DXR A;  2HEU A;  4NF6 A;  3KZG A;  1IXC A;  3ODB A;  1D3K A;  3U8V A;  2QPQ A;  1DPE A;  5I57 A;  5KCJ A;  4H0W A;  2QS2 A;  1Y1Z A;  1UTH B;  1YAE A;  1MXU A;  5AA2 B;  4F3G A;  1SYI A;  3DP8 A;  2DS9 A;  3MQ9 A;  3UIF A;  2XXU A;  3MPK A;  1HSL A;  5CI5 A;  4RPO A;  4X9T A;  1AMF A;  2A5S A;  4BDO A;  2PT1 A;  5I2K B;  3S9L C;  5H8S A;  2UVI A;  1JW4 A;  1P99 A;  4ELO A;  2H99 A;  1IQ7 A;  1DPP A;  1EZP A;  5H8N B;  1ELJ A;  1R9L A;  1NNP A;  2DXY A;  2O7U A;  4AB6 A;  1US5 A;  1VR5 A;  4BDN A;  1NNT A;  1NNF A;  2P0S A;  4ZZE A;  3Q25 A;  1IXI A;  3OO7 A;  1PB8 A;  4TOZ A;  2UVJ A;  1VE4 A;  4E0W A;  3CIJ A;  4R72 A;  4YB7 A;  3K6V A;  4U4X A;  3WAF A;  2UVG A;  1O7T A;  3OSQ A;  2V25 A;  3PUZ E;  3PPQ A;  4R74 A;  4RK9 A;  3QIM A;  4DZ1 A;  4Z0I A;  4LA9 A;  1MQD A;  4IGR A;  1IZ1 A;  4ELR A;  4C1U A;  2OZZ A;  3OO6 A;  3K01 A;  2A5T B;  2ZNS A;  2GH9 A;  3TKD A;  5J1D A;  1EU8 A;  1R6Z A;  2F7A A;  2ZXT A;  3H7M A;  2ABH A;  3LC8 A;  1MXV A;  3T9X B;  3C33 A;  1URG A;  2OWS A;  1FQD A;  2RCB A;  2PVU A;  1N7X A;  4LVQ A;  3S2V A;  3O6I A;  4F1U A;  3OOA A;  4BDR A;  1GR2 A;  3THI A;  2R71 A;  3QSL A;  4NF5 B;  3FGS A;  1WOD A;  3GBB A;  4EXL A;  4XKP A;  4RPN A;  3QUJ A;  3L6H A;  2ONS A;  1QKB A;  4FOR A;  1B3G A;  5ELV A;  1Y4C A;  2Y7W A;  1SI1 A;  3PGF A;  2NWJ A;  3G3K A;  4NE4 A;  1UTB A;  1B32 A;  4N07 A;  1WDN A;  3SER A;  1JW5 A;  4U22 A;  1EZO A;  4ESX A;  2Z22 A;  4RA1 A;  2F97 A;  4TQU Q;  3VLV A;  2DE4 A;  1AIV A;  3N6T A;  3K6W A;  3CRB A;  1N04 A;  2FYI A;  3DLN A;  3FV2 A;  3H4Z A;  3DEL B;  4ZZA A;  4WED A;  4ZE9 A;  4OMB A;  4I8C A;  4XTC Q;  5HM4 B;  4AB5 A;  4H6D A;  3VVE A;  4Z7E A;  4RY1 A;  3WAE A;  3U93 A;  2O69 A;  4KR5 A;  4WXJ A;  5CBR A;  1SD3 A;  5L8D A;  1XC1 A;  1HSJ A;  1Y3N A;  1F9B A;  3C31 A;  4YKJ A;  3SEW A;  1ZLQ A;  2DOJ A;  3SET A;  5H8F B;  3G3F A;  3RTW B;  3TTN A;  1UIV A;  4XIG Q;  4ESW A;  3FAS A;  3D4C A;  2DWJ A;  3VXB A;  2H98 A;  4OYV A;  1QKA A;  2QS4 A;  5JK4 A;  2Q88 A;  3FJM A;  3S9E A;  4R9F A;  3RT8 A;  4JSO A;  1FTL A;  3TDJ A;  2DVZ A;  5I58 A;  1MXZ A;  1NL5 A;  1B52 A;  4QFP A;  2PT2 A;  2G93 A;  3B7D A;  3E13 X;  3OSR A;  4F3P A;  1USY E;  1MS7 A;  1TFD A;  1Y9U A;  2F34 A;  4H5F A;  2QMX A;  1XVY A;  3DP4 A;  3K1M A;  1JEU A;  1D9V A;  2KLF A;  1PC3 A;  4C1T A;  3RPW A;  2E0S A;  1H76 A;  4LZ5 A;  2NXO A;  5I56 A;  4F1Y A;  3TMG A;  3BFT A;  3K00 A;  1QVS A;  2DP8 A;  2Q8J A;  5IAI A;  3HST A;  2D5W A;  3K4U A;  3IB1 A;  2F8D A;  2Z8E A;  3CI8 A;  2O51 A;  3CFL A;  4GWO A;  2O68 A;  3PMV A;  3KN3 A;  3KBR A;  3UA8 A;  1MQG A;  3Q28 A;  3TYH A;  5AA4 B;  4G68 C;  4HCW A;  1LB8 A;  1IXG A;  1QUL A;  2E1S A;  3OO8 A;  1FQE A;  4JB7 A;  1A8F A;  4DE8 A;  2DE3 A;  3EQ1 A;  3FJ7 A;  2FNC A;  5DEX B;  3R7X A;  5I2N B;  4R6H A;  1MQJ A;  3T22 A;  5H8Q A;  4YKP A;  3V83 A;  3FVN A;  3P7I A;  1A8E A;  3SKP A;  1PEB A;  5JTY B;  2V3U A;  5HBC A;  5I59 A;  4NF4 A;  3C9H A;  3KEI A;  1GGG A;  5HPQ A;  3ILU B;  5TU0 A;  2GHA A;  2RIN A;  2X7Q A;  1SW2 A;  2YPN A;  1MY2 A;  4QFN A;  5ICQ A;  4JSD A;  1SDX A;  3TQL A;  4R6K A;  4YAH X;  3T96 B;  4RNS A;  2GRV A;  1FQC A;  1SYH A;  1B5J A;  3K1P A;  3O97 A;  2QS3 A;  4QSC A;  2V3T A;  4JWY A;  3UP9 A;  1N0T A;  1FTJ A;  4R2F A;  5A5X B;  2Y7P A;  5DYH A;  4F1V A;  4MBP A;  2OJT A;  4F18 A;  2R6G E;  3K6U A;  1UTH A;  1PBQ A;  4YU0 A;  3F11 A;  1B7U A;  5FHO A;  5AA2 A;  5ICT A;  2DSF A;  4UA8 A;  2Q89 A;  4DXB A;  3CSB A;  3EPE A;  3SDF A;  3FIR A;  1A7L A;  3S9N C;  1O63 A;  1B3F A;  3TFL A;  2O7I A;  2ZYM A;  3O6G A;  3EHU A;  4IB2 A;  3O9P A;  5I2K A;  5FHM A;  4K3F A;  5DT6 A;  3MW0 A;  3I3V A;  4JDF A;  3JZJ A;  5CRY A;  3QUF A;  3HCQ A;  3FVO A;  4MLQ A;  2ZYK A;  1MY4 A;  5H8N A;  4WEP A;  4IY6 A;  4E0X A;  1PB9 A;  4GVO A;  3BBR A;  5AE4 A;  3W9V A;  3IOT A;  4YKI A;  3ZS6 A;  4XKQ A;  1NKX A;  2YLN A;  2Z8F A;  5IKB A;  4HW8 A;  3LR1 A;  1MXW A;  4GRK A;  1N3W A;  5L9M A;  4NWC A;  5CBS A;  1TT1 A;  4G68 B;  5EHM A;  2X7P A;  3IL1 B;  2G29 A;  3S4U A;  3U1O A;  1ZKB A;  3I6V A;  4ONY A;  2M8C A;  3PD9 A;  2Q2C A;  2ZYN A;  3MP1 A;  1N7W A;  3FXQ A;  1P1W A;  3H6T A;  2A5T A;  1M5D A;  1MH3 A;  4RYA A;  1VFD A;  3H3G A;  1DSN A;  4R75 A;  4KCD A;  2Y7K A;  2THI A;  1POT A;  4ZED A;  4NF5 A;  1UIU A;  1VSO A;  3UN6 A;  1BIY A;  2H9B A;  1OMP A;  3PPO A;  4GL8 A;  5I84 A;  3PV0 E;  2FA7 A;  3G3G A;  4KCC A;  4EXK A;  1GTK A;  1IEJ A;  3TEL A;  1H45 A;  2RCA A;  1URS A;  1LBC A;  4Q30 B;  3Q29 A;  4FAT A;  1JQF A;  3B6W A;  3KSJ A;  1ATG A;  5H8H B;  4GFR A;  2F7B A;  3A09 A;  4IO5 A;  3N26 A;  3FJG A;  4N6P A;  3JYR A;  5BUU A;  3RQT A;  1B2H A;  1B58 A;  3KN7 A;  2IA4 A;  5L9O A;  5TP9 B;  3TAJ A;  1Q1K A;  2I4C A;  3HV1 A;  2VD2 A;  4LZ7 A;  3IB2 A;  1NH8 A;  4OWD A;  1MY0 A;  3W15 C;  5EYF A;  4QSD A;  5BWJ A;  4DLD A;  4KPT A;  1A55 A;  1SQY A;  1Y20 A;  3OEL A;  5L9S A;  3QXM A;  1LBB A;  3CG1 A;  1P1N A;  1BTJ A;  3OXN A;  4PFU A;  3PPN A;  4LZ8 A;  1TXF A;  3H6U A;  1QUK A;  4O3A A;  3LSX A;  1MDP 1;  4XKN A;  3K2D A;  3K1N A;  1FTO A;  5H8F A;  3E3K A;  3N94 A;  2VGQ A;  1B3H A;  1M5E A;  2QJE A;  1RYX A;  4F22 A;  4H1X A;  5B7D A;  1B4H A;  3Q26 A;  2Q2A A;  1OIB A;  2Q9T A;  1LAX A;  3VDF A;  3MJN A;  4FE8 A;  4HTG A;  2UXA A;  3RLF E;  2OWT A;  1FCK A;  5DVF A;  2DVC A;  4KHZ E;  2Z8D A;  1SBP A;  2Y7I A;  3ONM A;  4EQ9 A;  3HPI A;  3LSF B;  4U1O A;  2VD3 A;  1I6Q A;  3H06 B;  3FUZ A;  1QUJ A;  4M1V A;  3FVG A;  4KYD A;  1SI0 A;  4DCX A;  1FQB A;  1WVJ A;  3AXF A;  4X48 A;  2R9J A;  5EHS A;  4F29 A;  3OEK A;  3C4M A;  2XX7 A;  4ZE8 A;  3ILT B;  4JWO A;  2NOO A;  1Y3P A;  1LLS A;  4POX A;  3RN8 A;  4MFI A;  2I6E A;  4POW A;  5DTB A;  3TCG A;  3FAT A;  1PDA A;  3SEU A;  2ZYO A;  2I48 A;  5F1Q A;  4R2B A;  2F36 A;  1XOC A;  4DXU A;  4G8N A;  2XXH A;  1FTM A;  3VE1 B;  5AA4 A;  1B1H A;  4H5G A;  1MM6 A;  2Y84 A;  3U8Q A;  2HZK A;  2B3F A;  1N84 A;  4KD5 A;  5B70 A;  3PUX E;  4NED A;  1B5H A;  3V5A A;  2F7C A;  3W9W A;  1DOT A;  5DEX A;  2QRY A;  5I2N A;  2HAV A;  2H5Y A;  2X26 A;  4R9G A;  4PQJ A;  3H03 A;  5JTY A;  3IJX B;  2XXT A;  1MPC A;  3IX1 A;  1HSE A;  1LFG A;  4NWD A;  3MWB A;  2ONR A;  3KOT A;  5DVJ A;  4ECF A;  1B4Z A;  3T9V A;  1MH4 A;  1LFI A;  1QW0 A;  3PUW E;  2QS1 A;  3PU5 A;  3RUM A;  4LP2 B;  5CM6 A;  2XXI A;  4FJP A;  3ZSF A;  2XX8 A;  3TTR A;  4Q0C A;  2RF1 A;  2V84 A;  4DCY A;  2XX9 A;  3ZKL A;  3BKI B;  2DWA A;  1Y3Q A;  3T9H B;  4NF8 B;  4YZZ A;  4FED A;  1XVX A;  2O84 X;  3KOS A;  3SEY A;  2OCU A;  5ITP A;  4PET A;  4GOT A;  1LAH E;  4BDQ A;  3TUS A;  4FEC A;  1P1Q A;  4QF9 A;  1ANF A;  3S9M C;  3CR9 A;  3HN0 A;  4MLV A;  4N13 A;  5TPA B;  1P1U A;  2DYX A;  4DDD A;  4PFW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...