1Y4CA

Designed helical protein fusion mbp
Total Genus 166
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
166
sequence length
490
structure length
480
Chain Sequence
EGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDEALKDAQTNSSSLGIEGRSSEELLKIALQEAQKTLQQAQELAKKGGGEEQLKRALKRADRNLWAAQELAKKGGGGEELLKQALQQAQQLLRQAQELAKKGGGEELLKQALQQAQQLLQQAQELAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags De novo protein
molecule keywords Maltose binding protein fused with designed helical protein
publication title De novo design of an IL-4 antagonist and its structure at 1.9 A.
pubmed doi rcsb
source organism Escherichia coli
total genus 166
structure length 480
sequence length 490
ec nomenclature
pdb deposition date 2004-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.660 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) IL-4 antagonist (De novo design) like domain 1y4cA03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1y4cA02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1y4cA01
3MC2A 2HEUA 3G3JA 3TUSA 1UTHA 1IUDA 2XXQA 3PUZE 4F1VA 1FQCA 4IY6A 3GZGA 4PETA 3USDA 3MUQA 5ICTA 3FV2A 3DP4A 5L9SA 3K1MA 1Z7NE 4H8IA 4WEPA 4YKKA 2Y7WA 3UGWA 4WKMA 1LB8A 4BDRA 3S9MC 2PT1A 1Y1ZA 1NH7A 4E0XA 3MPKA 1B5IA 3DM0A 4ZECA 3RPWA 3H6UA 4F2OA 2ONKE 3PUYE 4FIMA 2QS2A 2PMSA 2DSFA 3RY3A 3C35A 2DWJA 2DE2A 2X7QA 1MH4A 3ZSFA 1ELJA 4GLIA 1LSTA 2VHAA 3R26A 1OQHA 2Y7IA 4LZ8A 4R6HA 4X48A 2O7UA 4AB6A 3O2AA 1Y4CA 3G3IA 1HSJA 4KI0E 1SYIA 3RQTA 1FTLA 1PC3A 2XX7A 2KLFA 4GXSB 1IITA 1FTKA 3IL1B 4R73A 1EH3A 5CMKA 3K00A 4EQBA 3KG2A 4G77A 4QSCA 3OENA 3O6IA 4F39A 3HN0A 1OVTA 3AXFA 1USYE 5DVIA 1LAGE 3HO7A 1GVCA 4ZEDA 1A8FA 3JYRA 2NWJA 3OO7A 1QJMA 5EHMA 2ONRA 2Q2CA 3B6TA 1IXGA 1SDXA 3C31A 2PYYA 3MVXA 1MH3A 5HBCA 3M3LA 4HCWA 1EZOA 1N3XA 1DPEA 2OWSA 3M8UA 4BDQA 3FUZA 1A40A 4LP2B 4U1ZA 1MS7A 4NF4A 3RTFB 2I0BA 5TU0A 4LONB 4OWDA 3RLFE 5IKBA 2V3TA 1B40A 4IO4A 1IQ7A 4OZ9A 2Y84A 1JQFA 1S7YA 4PFWA 1Y3QA 4DE8A 4EQ9A 3FV1A 5H8QB 3LSXA 4IGRA 3OEMA 4ZZAA 3TMGA 1FTOA 1B3LA 3CG1A 1XOCA 4GQOA 3PPRA 3SEXA 4ESXA 3N5LA 1SW2A 1NKXA 2GHAA 2QS3A 5AE4A 3TEPA 4YB7A 3QAXA 4EDPA 1QUKA 4NTLA 3K1NA 1B7ZA 3PUVE 3IJXB 1B4HA 4U4XA 2XXVA 3N6UA 3W9WA 5I2NB 3GXAA 3V5AA 3T9VA 3KFMA 2PVUA 2OBGA 5CMBA 3OMBA 3A09A 4H65A 3PU5A 1LCTA 1OQGA 2A5TB 3IOUA 2R6GE 1MDQA 2OJTA 2VD2A 2DP8A 4BDMA 3KSJA 3IR1A 5I2KA 2DWHA 2FYIA 1UQWA 3THIA 1B05A 5ICQA 3S9LC 3TCFA 3IJOB 4IO7A 1Q35A 1SW1A 4BDNA 4ELOA 4OEVA 1RYOA 3L6HA 4F31B 3T66A 1PBQA 3HPIA 1NH8A 4XKQA 2XX9A 5TP9A 4FEDA 5CBRA 1URGA 3H6VA 4NF5A 4NF6B 4OYVA 1N84A 4THIA 4X1DA 5H8SA 2OZZA 5AA4B 1MPDA 1UTHB 4C1TA 3V89B 3FVGA 2I49A 3H6WA 1M5CA 3MJNA 2XX8A 4H5FA 4O3BA 1MXWA 2QSXA 3I3VA 4GF8A 3K6XA 4H67A 2H5YA 4KFQA 4OERA 4NMYA 2NOOA 5BWJA 4LZ5A 1MPBA 4DXBA 3O6HA 1GR2A 3MP6A 1XHYA 2RC8A 4OTEA 5ITOA 2Q88A 1NNTA 3CFLA 2ABHA 4ONYA 4KCCA 1LCFA 2F8DA 1O63A 1JNFA 5BUUA 4JSOA 3PUXE 2ANJA 3VVFA 3TPAA 4YMBA 1H43A 1H45A 4KCDA 3VDFA 3FD3A 4GIZA 4UA8A 3G7WA 3G3FA 2I3VA 2GHBA 2HAVA 4JB7A 3PMVA 3LSFB 4K3FA 3U8QA 2PBWA 1UIUA 3OO9A 5DT6A 1B1HA 3UORA 4X9TA 1NNFA 3QIMA 3LSLA 5LOMA 2UVHA 3KGCA 3IORA 3CSGA 4R72A 3QK6A 1VSOA 4G8HA 4ZE8A 5AA2A 2F78A 4F3GA 3KOTA 1B0LA 4DIGA 3K6UA 1B1XA 3DP6A 1B0HA 1JW4A 1NL5A 3DELB 3K1PA 1BP5A 3O97A 2RCBA 3Q29A 5DVJA 2DXYA 4UACA 4XXUA 3H03A 4R2FA 4GD5A 4XKPA 3KJ7A 2ZYNA 4F3SA 2RKMA 1B3EA 1MXXA 3IB1A 4IY5A 2X7PA 4NF4B 1IZ1A 2Q8JA 1POTA 3PD8A 2OWTA 1P99A 3H4ZA 1Z7ME 3FXRA 1A7LA 2NVUB 2QMWA 1MPCA 3SERA 3KZGA 3T9XB 4NF8A 3IO4A 4ELRA 1QULA 2XXIA 4OFOA 4N07A 3VE1B 4RXLA 1US4A 4O3AA 5H8HA 5IAIA 3MP1A 1JEVA 4IO6A 2R71A 4RPNA 1B4ZA 4I62A 2O68A 4P0IA 5I57A 4OVJA 3FJ7A 1USYH 5I58A 1OLCA 1MY0A 2CZLA 4I9DA 1A8EA 2ZYKA 4U2RA 2I6EA 2DE4A 4YAHX 4OMBA 3E4RA 1SD3A 1AMFA 4ZE9A 3H6TA 4H1XA 1OMPA 5H8NA 2I4BA 4HCYA 4IB2A 1MXVA 1M5BA 3VVEA 1EZ9A 3HCQA 2AIXA 3VXCA 3M3KA 4GL8A 4H8JA 5I2KB 3VVDA 3A3CA 4KYSA 3WAFA 3OO8A 2Y7KA 2F6PA 1IXHA 5CBSA 4R75A 1FQEA 4R6KA 2F6GA 4F3PA 4RYAA 2F7BA 5AA3A 3GLBA 3E13X 2DVZA 3BKIB 2FNCA 1P1OA 3TTKA 1KWHA 4I1DA 3R7XA 5TP9B 2VOZA 3QYTA 3RT8A 4HW8A 4PFYA 4OFJA 4NF5B 2XXUA 3FVOA 4PE5B 4BDLA 2I3WA 4NE4A 4FORA 4R74A 1N0TA 3WAEA 3EHTA 2XXPA 3HSTA 1DPPA 4OETA 3TZAA 1LFGA 4ELPA 5CM6A 3EF7A 4DLDA 4LQ2A 1CB6A 1GGGA 3H06B 3KBRA 1B9JA 5ELVA 2QMXA 3G3HA 3MQ9A 5H8FA 3FVKA 4ZEIA 5CRYA 4NEDA 1IIWA 3N26A 4ZDMA 3R6UA 3CI8A 1ZU0A 3OOAA 3H3GA 4XKNA 4MBPA 2THIA 3OO6A 3LSWA 3K0VA 4F29A 3O29A 2RF1A 2RC9A 1B51A 4YICA 1NNPA 1GV8A 2XD2A 1ZLQA 4QRZA 2QL3A 2OCUA 3BFTA 1M5DA 3SEVA 1N7XA 2XXWA 1MXUA 1PDAA 3LC8A 4ZEKA 5CMCA 4PQJA 1ZKBA 4I8CA 4OQOA 2B65A 3MWBA 3FVNA 5FTHA 4N13A 1IEJA 2FA7A 3RGYA 1TWYA 3UIFA 2F34A 2GFEA 4XKRA 4KYEA 3PUWE 1MY1A 3MW0A 4OXVA 1FQBA 4YKJA 1QW0A 3B6QA 4M4GA 3RT6B 1FQFA 3B6WA 1ZMGA 1CE2A 3K6VA 1AL3A 3OEKA 1A55A 4YKPA 5AA2B 1TFAA 1XVXA 4KYDA 5L9MA 4C1UA 1N3WA 3PPOA 3OSQA 2O7IA 1Q1KA 3Q25A 1MQHA 3PGFA 2PT2A 3CVGA 1MQIA 3MZ1A 3O6GA 1PB8A 5AA1A 1MM7A 1ATGA 1WDNA 1B6HA 4P11A 3OXNA 1UIVA 2DXRA 4LA9A 1B46A 3KJTA 1PBPA 2BJJX 4XIGQ 2HFBA 3ZKKA 1AIVA 1XS5A 4IO2A 2O84X 3MVWA 2IEEA 1BKAA 4QF9A 4QFNA 1SI1A 2QRYA 1S9TA 4RK2A 3U92A 4F2QA 3S9NC 4R9GA 3TTRA 3VXBA 5I56A 1QKBA 1LB9A 4NF8B 2UVJA 1SI0A 2DYXA 2AYSA 3D4CA 2F7AA 5ISUA 2Q9TA 1HSEA 5H8HB 1PB7A 1EZPA 1MQDA 4QFPA 3CR9A 2HAUA 4Q30B 5I57B 1JETA 4KD5A 3TQWA 2QS4A 2ESNA 3VLUA 4YMAA 5I58B 3H7MA 3CIJA 5CI5A 1DTGA 3BFUA 3MVZA 4LVQA 4U4SA 3IOVA 5K2XA 3G3GA 1M5EA 1PB9A 4QHQA 1I6BA 5H8NB 2O69A 4RA1A 2LAOA 4GRKA 3EHSA 1TT1A 5FHNA 3PMXA 1ZJLA 3QSLA 3TTMA 2H25A 1POY1 4FJPA 3PPQA 1MY4A 1L5TA 5JTYA 4IO5A 5DYHA 3D4GA 2DWAA 3A3UA 2UYEA 1WVJA 4WXJA 3LR1A 1SW5A 1P1UA 1B32A 2QPQA 4POWA 1Y20A 3HHGA 3Q26A 3UP9A 1FTJA 4G8MA 4RNSA 3Q28A 5A5XA 3VV5A 2YPNA 5JK4A 3BBRA 2H99A 1FTMA 3N94A 4Z0IA 4YKIA 3IX1A 3OELA 3UA8A 5DEXA 1B5JA 1FCKA 3C32A 2F97A 2XXRA 4DCXA 3V8XB 2D3IA 3I6VA 3E9XA 1R1NA 3LUYA 5DTBA 1S50A 4PP0A 2O1LA 3TAJA 3OD7A 1H44A 1TXFA 2B3FA 1B52A 2D21A 1I69A 5AA2D 4GWOA 3VFJA 1MY2A 2ALUA 1LFHA 2F7CA 3G3KA 4YB5A 5H8FB 2B3BA 3O9PA 2CMOA 3EQ1A 2VGQA 1HSLA 1R9QA 4LZ7A 4KPTA 1ANFA 3RUMA 2UVIA 2G29A 2V3UA 3PPPA 5F1QA 4LUBA 4MFIA 4DCYA 4MLQA 4U1OA 3S9EA 5B70A 2G93A 1D4NA 2NUVA 1B3FA 5B7DA 4ZEBA 5FHOA 3Q27A 2O1MA 2W7YA 3PMWA 1VFEA 2DS9A 1RKMA 1LBCA 3SETA 1SQYA 2P2AA 2I4CA 4F1UA 1MXYA 3TCHA 5TPAA 3C34A 1FQDA 3FASA 2R9JA 2XHDA 4R9FA 1O64A 4QFOA 5I84A 5CC2A 1SBPA 2Z8DA 1B7HA 2DQVA 1XVYA 1A54A 1LAHE 3K4UA 2LFFA 1B2HA 4O3CA 3RNNA 2D5WA 3MAMA 3ONMA 3FXUA 4MF3A 3MZBA 4ELQA 3TELA 5KZTA 2QJEA 1R6ZA 4G8NA 1URSA 5J1DA 3MP8A 3FJGA 2UYFA 1II5A 4DXUA 4ISUA 3JV9A 4ZS9A 2DWIA 1QVSA 3T9HB 3T96B 1MQJA 1O7TA 3DP8A 1YPNA 1JW5A 2REGA 3U8VA 1MRPA 3JZJA 3QUFA 4OENA 4EUOA 3TKDA 1P1WA 1DOTA 1IXCA 3P7IA 1UTBA 3IOWA 2V93A 4Q0CA 3KOSA 1MDP1 1RYXA 1OVBA 1TFDA 2HCAA 2X26A 4ND9A 2ZNUA 5I56B 2PX1A 4ZEFA 1MY3A 3GBBA 3W15C 5FHMA 4MLVA 4POXA 3MPLA 1OLAA 4U23A 4G68A 5EYFA 2LFDA 3UN6A 1XT8A 4QFLA 4E0WA 4F22A 4F18A 1MQGA 2H4IA 2RCAA 3CFXA 3FZVA 1JEUA 3TTNA 1NFTA 2VP1A 1Y9UA 4JWXA 1R9LA 1F9BA 4KHZE 2Z8EA 4R6YA 4TLMB 5FTIA 3KN3A 3VLWA 2UXAA 3SEYA 1EU8A 1MG1A 3RTWB 4FECA 2H9BA 1MXZA 3M3FA 4TOZA 3MVYA 1JW1A 1ZBMA 3GBAA 4G2ZA 4JWYA 4EXLA 3TDJA 3U72A 4DXCA 3IB2A 3U1OA 2Z23A 3KSXA 3U93A 4TLLB 3FIRA 3ODBA 1GTKA 4XTCQ 2Z8FA 1VE4A 3ECRA 4R2BA 5KCJA 5JTYB 4AB5A 2I48A 2ZMBA 5I59A 3K2DA 2DE3A 4H0WA 2F5XA 1LLSA 4RK9A 3FXQA 3SEWA 1N04A 3S4UA 1A99A 2F36A 2P1SA 3ILUB 4HS7A 4KR5A 2F35A 5A5XB 2Q89A 3HV1A 4OHNA 1VR5A 4ECFA 1NMUA 3SDFA 1LAXA 4DDDA 2I0CA 5DEXB 1M5FA 3I5OA 1AH5A 2Y7RA 2VD3A 4H6DA 4BLAA 1LAFE 1N76A 3TQLA 1B5HA 2YLNA 5KDTA 1I6QA 3TYHA 4AQ4A 2NXOA 3S2VA 3EN3A 1LGBC 4RJZA 1LFIA 1YTVA 2QS1A 4OEUA 1IXIA 3E3KA 2P0SA 3FGSA 3O66A 4C0RA 3IOTA 1Y1MA 3SESA 3CFZA 1I6AA 4OFLA 2V84A 4H5GA 2YJPA 4GOTA 1URDA 1SVXB 3IK6B 2GRVA 2HXWA 1D9VA 1OIBA 5JEIA 1B3HA 3MZ9A 3SEUA 5L8DA 2I58A 4MH5A 2XXHA 3T9UA 4ESWA 1B58A 3ILTB 3FATA 2E1SA 3V83A 3PD9A 4PFTA 3IO6A 4PFUA 1P1QA 5K2YA 3IAZA 4X1BA 5ITPA 2ZXTA 1H3DA 4U22A 4QFKA 3O28A 1ZTYA 5L9OA 5TPAB 1YAEA 4JSDA 2WKYA 3MBPA 3QXMA 4JXIA 4KQPA 1BLFA 5M2VA 4YB6A 1LBBA 2HZLA 2DVCA 4EF1A 1ZIUA 3LBSA 5HM4B 4EQ7A 1QUJA 4JWOA 4RPOA 3N6TA 3TTLA 3K01A 1N7WA 2O51A 1QUIA 2XXTA 3C4MA 1VFDA 1BTJA 4EF2A 3T22A 5EHSA 4N6PA 3C33A 4HTGA 4IO3A 3RN8A 3SKPA 4QSEA 3K6WA 1BIYA 3KEIA 4WEDA 4F3BA 3W9VA 1SW4A 4GXAA 4QSDA 2GH9A 4F1YA 1B3GA 2Q2AA 4ZZEA 3UK4A 1US5A 3PV0E 4LQ5A 4TQUQ 4BDOA 1XC1A 3PPNA 1UTBB 4OESA 3QUJA 3K02A 1NNKA 2O6AA 3CG3A 2OLBA 1JVYA 2ONSA 1B7UA 1WODA 2Z22A 4IGTA 4YU0A 1P1NA 3CRBA 1SYHA 4G68B 3DLNA 1MM6A 5H8QA 4JBZA 1Y4TA 2ZNTA 4GVOA 4GFRA 2AL5A 1Y3PA 2UVGA 3B7DA 2V25A 3CSBA 2OK2A 1D9YA 2AL4A 1JVXA 4LATA 2ZNSA 1Y3NA 2HZKA 3C36A 1QKAA 2XD3A 3T93B 3VLVA 4U21A 4FAJA 2XXYA 4Q8RA 5I2NA 1PEBA 4FEBA 2ZYOA 4YZZA 4NWCA 4GL0A 2A5SA 3U94A 4Z7EA 3KN8A 2RINA 3TFLA 1J1NA 4EXKA 3ZS6A 3HHFA 2DOJA 2A5TA 3C9HA 3EHUA 4G4PA 5KCJB 4M1VA 3KN7A 5F7VA 2REJA 3FJMA 5I59B 3IB0A 3OSRA 1D3KA 1FW0A 1AOVA 1T0KA 2HQ0A 3TODA 2XXXA 2E0SA 3EPEA 2V3QA 4G68C 2ZYMA 3TCGA 1FQAA 4Q5TA 3ZKLA 3L6GA 1DTZA 3F11A 1DSNA 4NWDA 2HZ8A 1YCJA 2RC7A 5CMMA 4FATA 4P0GA 4L17A 2H98A 4NF6A 2Y7PA 2IA4A 4RY1A 1DMBA 5DVFA 4JDFA 4F19A 4FE8A 4DZ1A 5HPQA 2M8CA 5KDTB 5AA4A 1H76A
chains in the Genus database with same CATH superfamily
3Q7LA 3MC2A 3B71A 4CX9A 2HEUA 3TOMA 3G3JA 4OINF 1UTHA 3TUSA 1IUDA 1W2WA 2LSEA 1VYIA 2XXQA 3PUZE 4F1VA 1FQCA 3RPLA 5TJ5E 4IY6A 2G3KA 3GZGA 1ORSC 1OR3A 4PETA 3MUQA 3USDA 5ICTA 1VLSA 3S29A 4E0HA 3FV2A 3DP4A 5L9SA 3K1MA 1G8XA 2HV6A 4PJMA 1Z7NE 3QZCA 4H8IA 3CAXA 4WEPA 5E2QA 3KYIA 1YARO 2V26A 1PD1A 2Y7WA 4NQ8A 4YKKA 3UGWA 4PJLA 1LBYA 1LEVA 4WKMA 4PFBA 1EA8A 3DM5A 5EHHA 1LB8A 4BDRA 1FAPB 3S9MC 4LDKA 3PDMP 1JPJA 2PT1A 1Y1ZA 1NH7A 2HMQA 2Z15A 4NQFA 4E0XA 2XLWA 1WATA 2A69F 3JSEO 2X0CA 3U0CA 4W8PA 3MPKA 1ZU5A 1B5IA 3DM0A 1TQGA 1NV3A 1VOMA 2OWZA 2ZZXA 4ZECA 2ZXOA 3U9JA 2P0NA 3RPWA 2X51A 3RH3A 4B6IA 3NYJA 3H6UA 4F2OA 2KJGA 2ZD9A 2ONKE 1D1AA 3CEXA 5JLIA 5L3QA 1KA1A 3PUYE 2XL6A 4O6NA 4FIMA 2QS2A 3V5ZA 2PMSA 2VPNA 2DSFA 1LE4A 1NFOA 1U89A 3RY3A 3C35A 2DWJA 2DE2A 4XFEA 3EKIA 1C02A 1SYQA 3U9MA 2C03A 3SZRA 4ULVA 3IEEA 2X7QA 2CGEA 1T5OA 4G7OF 5EYGA 1MH4A 3ZSFA 1ELJA 1OKKA 1ZVZA 4GLIA 1LSTA 3C8GA 5GPGB 2VHAA 2XL8A 2ICWG 3R26A 1OQHA 2Y7IA 4LZ8A 1QZXA 4R6HA 4X48A 2O7UA 1T9KA 4AB6A 2LD6A 3O2AA 1Y4CA 3G3IA 1HSJA 2KQZA 4KI0E 1Z23A 2CZKA 1SYIA 2UUIA 3RQTA 1DK4A 2R02A 3SXMA 3ABMC 4YT2A 4OIPF 1FTLA 1PC3A 2XX7A 2IBFA 2KLFA 3U3FA 2WVNA 4GXSB 4MVZA 1IITA 1FBCA 1FTKA 3IL1B 4R73A 1EH3A 3NG1A 5CMKA 3K00A 4EQBA 4H46A 2B0JA 2Q4FA 3KG2A 4G77A 4QSCA 5DVWA 3OENA 2BJIA 3O6IA 4OANA 4F39A 3UMHA 4BPMA 3HN0A 1OVTA 3AXFA 1FJ6A 1USYE 1YZ0A 4XEVA 5DVIA 4YT5A 4I44A 4ZLCA 1LAGE 3HO7A 1GVCA 1FNTc 4ZEDA 1IMEA 1A8FA 3JYRA 2NWJA 3ISPA 3OO7A 1ORYA 1BR4A 5KYYB 1QJMA 5EHMA 2ONRA 1OR2A 2Q2CA 3B6TA 1IXGA 3SP1A 1ZHXA 2R7VA 1IMFA 1SDXA 2ZPAA 3C31A 2PYYA 3MVXA 1MH3A 5HBCA 2YHSA 3M3LA 2QNLA 4HCWA 1Q0KA 1EZOA 4IARA 1N3XA 1DPEA 2OWSA 3M8UA 4BDQA 2VASA 3FUZA 4WGYA 3NDBB 4PJNA 4CS8A 3T6JA 1A40A 3ITFA 3KH2A 4DXWA 4LP2B 2B0HA 4U1ZA 2XLEA 1MS7A 3LUZA 1NSGB 4NF4A 3RTFB 2I0BA 5TU0A 4LONB 3TULA 3H65A 3JTLO 1Q9DA 4OWDA 3RLFE 1S05A 5IKBA 2V3TA 1B40A 4IO4A 4G7ZF 1IQ7A 4OZ9A 5A6JA 2Y84A 1QGXA 3DI5A 1JQFA 1S7YA 4PFWA 2J9VA 2AWCA 3KMIA 4JZAA 1Y3QA 1E85A 4DE8A 1WGWA 1GGQA 3AG2C 4CIPA 4EQ9A 3FV1A 1UG7A 5H8QB 3LSXA 5A6BD 4HE2A 4IGRA 3OEMA 4ZZAA 3TMGA 4OD4A 1FPDA 2WL8A 2ZZVA 1FTOA 1LBVA 4HFFB 1B3LA 3CG1A 1XOCA 4GQOA 3PPRA 5B3SC 3SEXA 4ESXA 1TWCA 3N5LA 1SW2A 1NKXA 4JKVA 4GWZA 2GHAA 1QVXA 2QS3A 5AE4A 3TEPA 4HE1A 4N6HA 1RKCA 4YB7A 3QAXA 3EHNA 2XLHA 3LJBA 1OCRC 5IM2A 4EDPA 1Z63A 1NV4A 1QUKA 4NTLA 5KYUA 2OX3A 3K1NA 1B7ZA 3PUVE 1HMDA 4MVUA 3IJXB 4OVRA 1B4HA 5A69A 1Z6AA 4U4XA 2XXVA 3N6UA 3JCUQ 5JVEA 5KYXA 2VT5A 3W9WA 4GWSA 4JVDA 1QQ3A 4U5HA 3E79A 3U8PA 5I2NB 3GXAA 3V5AA 4GYTA 4XLNF 3T9VA 5DS5A 3KFMA 2MKZA 2VPOA 1LKXA 2LCHA 3KC1A 4O79A 4CSAC 1EYKA 2PVUA 2DB4A 2OBGA 5CMBA 1FPIA 3OMBA 3A09A 4H65A 1ZW3A 2YLIA 3EH2A 4P9TA 2HPGA 3PU5A 4G61A 1LCTA 5JP7A 1K04A 1OQGA 2A5TB 3IOUA 1RDZA 2R6GE 2FBPA 1MDQA 2OJTA 2VD2A 2L6GA 2DP8A 4BDMA 2AVKA 4YWQA 3KSJA 3V5XA 1K40A 3IR1A 1V55C 5I2KA 1MMAA 2DWHA 3BIGA 4A4AA 1QSPA 3POVA 2FYIA 1UQWA 2CDQA 4N91A 4MAGA 1S7ZA 3THIA 2DI3A 4OVSA 2FIXA 1B05A 1TFOB 1WOLA 2P7VA 5JUAA 3DWWA 5ICQA 3RYLA 2PX0A 3S9LC 3IFCA 2OQMA 3TCFA 3IJOB 5F28E 4RDAA 1Q35A 4IO7A 2XXAA 2W4MA 1SW1A 3FHDA 4QI2A 3S84A 4BDNA 2EIJC 4ELOA 4OEVA 1JMWA 3JRMO 1M57C 1RYOA 3L6HA 4JC7A 4F31B 4R32A 5F5FA 3T66A 4XPWA 1PBQA 3QMFA 2XS8A 3HPIA 4PF8A 1NH8A 4XKQA 2XX9A 5TP9A 4DOZA 4FEDA 5CBRA 3EGXA 1YYXA 1URGA 3H6VA 2PBEA 4GBVA 4NF5A 1LS4A 4MW3A 2CYDA 4WGZA 3SNHA 1V74B 4NF6B 4OYVA 1GS9A 1A0BA 5L0GA 1N84A 4N06A 4THIA 4X1DA 4AS4A 5H8SA 5B3IA 2OZZA 5B1BC 5AA4B 2IOQA 4FX5A 1Y6DA 4CJOA 2P1AA 1DCUA 1MPDA 1UTHB 4C1TA 3V89B 3FVGA 2I49A 3H6WA 4XTKA 3RPLB 1M5CA 4J30B 1TFKB 3MJNA 3UR3C 2XX8A 3L1MA 4K0DA 4YK5A 4H5FA 1MXWA 4BEMJ 4O3BA 2QSXA 3I3VA 4GF8A 5IGAA 3K6XA 5IZZA 4H67A 3C63A 4P6IC 2H5YA 4KFQA 4OERA 1M2VA 4NMYA 2NOOA 5BWJA 4KI2A 4LZ5A 1MPBA 1R5ID 4DXBA 1OXBA 1MQVA 4DJ9A 4JVIA 3AQCA 3O6HA 1T6QA 1GR2A 3MP6A 1XHYA 2HV7A 1LBZA 2RC8A 2YL0A 4OTEA 5ITOA 2EPNA 3LEOA 1APCA 3ZC4A 2Q88A 1NNTA 3S0XA 3CFLA 2ABHA 4C3BA 4JVSA 4ONYA 4KCCA 1LCFA 3TQOA 2F8DA 1O63A 4K1OA 1JNFA 1ZHYA 3KC0A 5BUUA 4JSOA 2Q9BA 2Q00A 3I4UA 4CBEA 4OVTA 3PUXE 2EPMX 2ANJA 3VVFA 1HE9A 3V5YA 3TPAA 3C18A 5I3SA 2Y3GA 4YMBA 1H43A 1H45A 4KCDA 1NFNA 3AGUA 3VDFA 2YLGA 3FD3A 4GIZA 3WHNA 1LBWA 2H7VC 3DJUB 3M4BA 4UA8A 4RD9A 3G7WA 2P6VA 3G3FA 5J16A 2I3VA 3R7CA 2GHBA 5BUOA 2HAVA 1NU7D 4JB7A 3PMVA 2GAQA 4BJ1A 3LSFB 4K3FA 3EZIA 3U8QA 3K7DA 3TK0A 2PBWA 3H2VA 4AS5A 1MMDA 2IYLD 2KNHA 3LAYA 1UIUA 2Y5KA 2EINC 3OO9A 1T01A 5DT6A 1B1HA 4KBLA 3UORA 4X9TA 2XXKA 1NNFA 2HKVA 3QIMA 1NZEA 1AWBA 4G78A 3LSLA 5LOMA 1SF8A 2UVHA 3KGCA 4KC9A 3IORA 3CSGA 4DRJB 4R72A 3QK6A 3B9QA 1VSOA 4G8HA 3ZQVA 4ZE8A 5BQIA 5AA2A 2F78A 2CEXA 4F3GA 3KOTA 1FMWA 1B0LA 1CPQA 2P3VA 3T1BA 4DIGA 3K6UA 1B1XA 3DP6A 1B0HA 1JW4A 1NL5A 1H7IA 3VF0A 4MVQA 4PFPA 5I5PA 5L0FA 3QW1A 3DELB 3K1PA 1BP5A 3UGOA 3O97A 2RCBA 3ABLC 3TD7A 3IFAA 3Q29A 1LVKA 5DVJA 2DXYA 4UACA 4XXUA 2D4UA 4JTAB 4MTOA 2J7PD 1NV2A 3H03A 1LIHA 4R2FA 5JRAA 4GD5A 2WB7A 3C8ZA 4XKPA 4MNIA 3KJ7A 2XLVA 2ZYNA 3UMKA 1BR2A 4F3SA 2QE9A 4XWJA 3GYYA 3J06A 2HSBA 2W4BA 4AE4B 2WYKA 5JT4A 1NV7A 3WODF 4C3EA 4MVRA 1F1MA 2RKMA 2ZZWA 2J9WA 2OU6A 3RIPA 1D1CA 1B3EA 4DVZA 2B4LA 1MXXA 3IB1A 4IY5A 1R4TA 2X7PA 1RDXA 1L7CA 1CGOA 4U5BE 4IRUA 2YQYA 4YT4A 4E7SA 3K33A 5COFA 4P1EA 2L7AA 1FPEA 3Q6NA 4NTBA 4NF4B 3E9VA 4IJJA 1IZ1A 3NMIA 1MNDA 2Q8JA 2P3NA 1POTA 3PD8A 2OWTA 1VK5A 3T9OA 1P99A 1IMBA 3H4ZA 1Z7ME 4I1OB 1A7LA 3IQCA 3FXRA 2NVUB 2QMWA 1MPCA 3SERA 3KZGA 3T9XB 3AJMA 2EILC 4NF8A 3IO4A 4ELRA 3OWTA 3K1IC 1QULA 2XXIA 4OFOA 4N07A 4J7YA 4N6DA 3LLKA 3M1CB 4F4BA 1DOVA 3VE1B 3TJ5A 4RXLA 1AEPA 2M64A 1US4A 4O3AA 5H8HA 5FBPA 5IAIA 3MP1A 1JEVA 1XI6A 4IO6A 2R71A 4RPNA 1B4ZA 2HJMA 3A11A 4I62A 4XEKA 2O68A 4P0IA 5I57A 3QVYA 2LQGA 4OVJA 3FJ7A 1EQ1A 1OW7A 1USYH 1RJ9A 4JJFA 4BG0A 5I58A 1OLCA 2MWQA 2JPUA 4U9DA 1MY0A 5JS5A 4XPXA 5A6KA 2CZLA 4GEHA 4LLEA 4I9DA 5KYUB 3B0VC 1A8EA 2ZYKA 1C17M 2I6EA 2DE4A 4U2RA 4YAHX 4OMBA 3E4RA 1SD3A 3RVZA 1AMFA 4ZE9A 3H6TA 4H1XA 5KYXB 1OMPA 3KYJA 2PF4E 5H8NA 1O3UA 3NYLA 1OQCA 2I4BA 4HCYA 4IB4A 1MXVA 4IB2A 1M5BA 3GEIA 4G7HF 4DRHB 1PD0A 3VVEA 1FBFA 4BJTA 3FAJA 3IQ6A 3B0UX 2GDCA 1EZ9A 2PFZA 3RQEA 3HCQA 1YJGA 2AIXA 3VXCA 3DE8A 3M3KA 4PE3A 4GL8A 4PC9A 4H8JA 1BDJB 4P3LA 5I2KB 3VVDA 3A3CA 4KYSA 3WAFA 1O5HA 1DOWA 3OO8A 2Y7KA 2FGYA 3AGTA 2F6PA 1IXHA 5CBSA 1YVIA 4R75A 3EQLF 1FQEA 3IQ5A 2F6GA 3DAGA 4R6KA 3ZSUA 2YRFA 4F3PA 2NPUA 1SZIA 4RYAA 2F7BA 1G4US 5AA3A 2F3DA 2W9YA 3GLBA 3E13X 2DVZA 3BKIB 1D0ZA 2XXAB 3LESA 1J8MF 2FNCA 1OCCC 1P1OA 2UUHA 3TTKA 1KWHA 2H7BA 4HE0A 4I1DA 3R7XA 3M79A 5TP9B 2I15A 2L6FA 2VOZA 5ET6A 3EGXB 4ER9A 4O7MA 3QYTA 1EI7A 5BQHA 1VDWA 3RT8A 3HKKA 1OKKD 4HW8A 4PFYA 4OFJA 4NF5B 2XXUA 3FVOA 4PE5B 4BDLA 3T0JA 2I3WA 2A6EF 3T6GB 4U5CE 3EG9A 1ST6A 4NE4A 4FORA 4R74A 1N0TA 3WAEA 5EQ7A 3EHTA 2XXPA 4I3EA 3FMSA 3HSTA 1CPRA 1DPPA 4OETA 2LIGA 2J9BA 3TZAA 3AOUA 2KW3C 1LFGA 4ELPA 1TWAA 5CM6A 3EF7A 5EYHA 4DLDA 4LQ2A 1G4WR 1CB6A 3A9CA 1GGGA 3H06B 3KBRA 4CS9C 1B9JA 4OIRF 3GM2A 2Y3HA 5ELVA 4PFIA 5A6AA 2QMXA 3G3HA 3MQ9A 5H8FA 3FVKA 4ZEIA 3OA1A 5CRYA 3FBPA 4NEDA 1IIWA 3N26A 4ZDMA 3R6UA 4G0HA 1M2VB 3CI8A 2QVVA 1ZU0A 3FDQA 3OOAA 2OCCC 1I5NA 3K66A 4ONSA 2XLMA 3H3GA 4P9FA 4XKNA 4C7OA 2WZLA 4MBPA 2THIA 3OO6A 5COGA 3K0VA 3LSWA 4F29A 3O29A 1HW2A 2RF1A 2RC9A 1B51A 3EJNA 4YICA 1NNPA 1GV8A 2XD2A 2XWOA 1ZLQA 2NUTA 2AWYA 4QRZA 3QTHA 2QL3A 3T6BA 4PDHA 2OCUA 3BFTA 1M5DA 5L0IA 2XWVA 3SEVA 2WBDA 1N7XA 2HSQA 2R03A 2XXWA 3FVYA 1MXUA 1D0YA 1PDAA 3B0PA 3LC8A 4ZEKA 5AC4A 2YKZA 3DXJF 1Z5ZA 5COMA 5L0DA 2A6HF 5CMCA 4PQJA 1ZKBA 2KC3A 4I8CA 4OQOA 2KGOA 2B65A 1E2XA 1N1CA 3MWBA 3FVNA 2PFDA 4QXDA 5FTHA 4N13A 3LNMB 1IEJA 1GM5A 4EKWA 1PV3A 3Q6MA 5EGYA 2FA7A 1OXKA 3RGYA 1TWYA 3UIFA 2F34A 2GFEA 2W45A 4XKRA 5L0JA 4KYEA 3PUWE 1V54C 1MY1A 3MW0A 4J32B 4OXVA 1NV6A 3DD7A 1FQBA 4YKJA 1NU9C 1QW0A 3B6QA 1QKRA 1E83A 4M4GA 3RT6B 1FQFA 3B6WA 3RQFA 1ZMGA 1CE2A 3KL4A 3K6VA 3U2MA 1SR2A 1AL3A 2XLDA 1FPLA 3OEKA 3M15A 4MNPA 1A55A 4YKPA 2Y5LA 5AA2B 3H2UA 1TFAA 1XVXA 4KYDA 1GQAA 4X04A 5L9MA 5F5HA 1NV5A 4C1UA 4MJOA 1N3WA 4BJ6C 3PPOA 1FPJA 2M4EA 4OVPA 1YZCA 2KR0A 2O7IA 3OSQA 1Q1KA 4MNCA 3Q25A 3S27A 4WJ0A 4JRZA 4O6MA 4XLPF 1MQHA 2DDKA 3EHMA 3PGFA 2A0BA 3GORA 4BJ5C 1FPGA 2PT2A 4I1MA 5EQ9A 3CVGA 1MQIA 2J45A 3MZ1A 3O6GA 2R7OA 4EHPA 1PB8A 3EGDA 5AA1A 4XEQA 1MM7A 1ATGA 1WDNA 1B6HA 4P11A 2GWWA 1G5ZA 3OXNA 4GX6A 1OCZC 1Q0FA 1UIVA 5F24A 3NYMA 2DXRA 3HTKC 4LA9A 1B46A 2JJKA 3N0TA 4K7BA 3KJTA 4N17A 1PBPA 2YL1A 2BJJX 4XIGQ 5L0HA 2HFBA 3ZKKA 1AIVA 4QI0A 2OOCA 1XS5A 4IO2A 1JR8A 2O84X 5JSLA 3MVWA 1IMAA 2IEEA 2A1DD 1BKAA 4QF9A 4QFNA 1H6GA 1SI1A 2QRYA 3O39A 2EPLX 4NCQA 3ZQYA 1S9TA 4RK2A 4GWXA 1M6TA 2NSGA 3U92A 5AC5A 2JD3A 4F2QA 5DLJA 3S9NC 2QUPA 4R9GA 3TTRA 1JRAA 1AUEA 3VXBA 5I56A 1QKBA 1H9TA 3LS0A 1A7EA 1OCOC 1LB9A 3VRCA 4MNDA 2FHYA 4HFKB 4NF8B 1C03A 2BL2A 4MVOA 2WZGA 2UVJA 1SI0A 2DYXA 1DBZA 2VH3A 2EPKX 1TWGA 2AYSA 3D4CA 2F7AA 1RMVA 5ISUA 2Q9TA 3AG4C 1HSEA 2RSEB 5H8HB 1NLXA 3RKOF 1PB7A 1EZPA 1MQDA 4QFPA 3CSKA 3CR9A 2HAUA 4Q30B 4LACB 2CZHA 2R7WA 2XWIA 1JETA 3BIHA 5I57B 4KD5A 3TQWA 2QS4A 3EFOA 2ESNA 3VLUA 1NBBA 4YMAA 1RJ9B 5I58B 1O87A 3H7MA 3CIJA 2R7QA 5CI5A 3ABKC 5EQAA 1DTGA 3BFUA 3MVZA 1ZU4A 4KNWA 5D91A 4LVQA 4U4SA 3TOLA 3IOVA 1IW7F 5K2XA 3G3GA 3VYWA 2MYSA 1M5EA 1A7DA 1PB9A 1Z3IX 1RKEA 1FBPA 4PGNA 4QHQA 1I6BA 5H8NB 2O69A 4RA1A 3SXYA 1MMGA 1LBXA 4NTFA 2LAOA 1MMNA 3NRHA 4GRKA 3EHSA 4IWBA 1NG1A 2XL4A 1TT1A 3PTYA 2WVQA 2B4MA 4NG7A 5FHNA 3PMXA 4IR8A 1ZJLA 3QSLA 3TTMA 2H25A 1POY1 2CNWA 4FJPA 3PPQA 1FJ9A 1FPBA 1MY4A 1L5TA 4AX2A 5JTYA 2VB6A 4IO5A 1E84A 5DYHA 3D4GA 4NGUA 4D4XA 1LPEA 4FBPA 2DWAA 3A3UA 2UYEA 5CI9A 4AK9A 4CSAA 2Y39A 1WVJA 4WXJA 3S28A 1FR0A 3D1RA 2ZXRA 4DVYP 3SXKA 3LR1A 2PX3A 1SW5A 1P1UA 2WX9A 3MFNA 5E33A 1B32A 2QPQA 4POWA 1Y20A 3HHGA 3UNGC 3Q26A 2QY9A 3U3BA 4N8YA 3M4CA 3UP9A 1FTJA 3I5PA 3U65A 2TMVP 4G8MA 4RNSA 3Q28A 2AP3A 5A5XA 3VV5A 4PACA 4YL3A 2YPNA 5JK4A 3BBRA 2H99A 1FTMA 4JJGA 3N94A 4Z0IA 4YKIA 3K1HA 3IX1A 1QLEC 1Q0DA 4EUKB 3OELA 3C8GB 1VMAA 4PGPA 5DEXA 3UA8A 1ZHTA 1B5JA 1FCKA 1A41A 2GA0A 3C32A 2F97A 2L6HA 4OA4A 4RBNA 4AL0A 2XXRA 2XWKA 2R7TA 4DCXA 3V8XB 2D3IA 3EG9B 1D9QA 3O10A 3I6VA 3E9XA 3HNJA 4N15A 1R1NA 4MHFA 2KYHA 3LUYA 3C62A 1S50A 5DTBA 4PP0A 4LN5A 2O1LA 3TAJA 3OD7A 4X0RA 3G4ZA 1H44A 1TXFA 2B3FA 2Q3TA 1B52A 2D21A 1I69A 5T1DB 4GWOA 5AA2D 4NY3A 3KKBA 5IY5C 3VFJA 1MY2A 2ALUA 1LFHA 2F7CA 4MQ9F 3SXZA 1BR1A 5IZ1A 3G3KA 2XM4A 5LDZA 3SEOA 4YB5A 2QVRA 3T4RA 5H8FB 4JEAA 2B3BA 3MX3A 3O9PA 4PFOA 4QDLA 1ZHZA 3AG1C 2Q9CA 1FRPA 2CMOA 3EQ1A 4GX3A 4NN3A 2VGQA 2J7PA 2J9UA 3HNIA 1CGME 4MTGA 1HSLA 1R9QA 4YT8A 4JURI 4LZ7A 4C7OB 4KPTA 1ANFA 1WTYA 3RUMA 1TR2A 2FAPB 3DMDA 2UVIA 2HFIA 2FIEA 3ZVRA 2G29A 4DBQA 2V3UA 3PPPA 5F1QA 4EIYA 2XA5A 4LUBA 4KNVA 2OEXA 4U5EE 4MFIA 2NUTB 4DCYA 4MLQA 4U1OA 2XRHA 3S9EA 5IZ3A 5B70A 2OG2A 2G93A 4OVQA 4UDVA 1D4NA 2NUVA 1B3FA 5B7DA 4ZEBA 3FAPB 2IXMA 5FHOA 3UMIA 3E70C 1NV0A 4DBRA 3Q27A 2YVKA 2O1MA 3KBZA 2W7YA 3GODA 3PMWA 1VFEA 2WEFA 2DS9A 2E87A 1RKMA 3I5QA 2OJQA 1LBCA 4U5DE 3SETA 1SQYA 3EH1A 2P2AA 1M2OA 2I4CA 4F1UA 1MXYA 4NX1A 3TCHA 5TPAA 2IXOA 3C34A 2Q7RA 1FQDA 3FASA 5A5LA 2R9JA 2XHDA 4R9FA 2QLAA 1O64A 4CS7A 4QFOA 5I84A 3GM1A 1KTMA 5CC2A 1SBPA 2Z8DA 3GANA 4CDAA 1B7HA 2DQVA 1YA7O 1EYJA 1XVYA 3B8BA 4M63A 1A54A 2VCCA 3V7OA 5T3WA 4FESA 4H45A 2AU5A 4N8GA 4PBHA 1LAHE 1K9YA 2G3VA 3K4UA 1NUXA 2L81A 3W2VA 3SZPA 2LFFA 4N81A 1B2HA 4O3CA 2L9JA 3RNNA 3BEHA 2D5WA 3Q7GA 4E7ZA 3MAMA 4MX6A 3ONMA 3FXUA 4MF3A 3MZBA 4ELQA 1FBDA 3TELA 2EIMC 5KZTA 3NKDA 2R25A 2QJEA 2H7OA 4H4KC 1R6ZA 1URSA 4G8NA 5J1DA 3MP8A 2V3CC 4U5GA 1T6UA 4H54A 5K0IA 4PTKA 1VB5A 3FJGA 3IPMO 2NUPA 2UYFA 3O55A 3U5SA 5DS4A 1II5A 3E78A 1HW1A 3FXHA 3RYDA 4DXUA 2HUJA 1JP4A 2ASRA 3EGDB 3JV9A 4ISUA 4QBAA 4ZS9A 5AGFA 4CDYA 4BEJA 4YJWA 1JPNA 3MYUA 2DWIA 1QVSA 3T9HB 4CS8C 3T96B 1MQJA 3HJCA 1FPFA 1O7TA 3CHGA 3DP8A 1FBHA 1YPNA 1OW8A 1JW5A 5FCLA 2REGA 4P1LA 3U8VA 1MRPA 3IQTA 3JZJA 3ZWIA 3K6BA 3QUFA 3KPHA 4OENA 4EUOA 3TKDA 1P1WA 1DOTA 2IXPA 1IXCA 4HEAJ 3P7IA 4CJGA 3DAFA 1LI7A 1FBEA 1UTBA 3IOWA 2IM8A 4FWVA 2V93A 4Q0CA 3LLIA 3KOSA 4CDVA 2D5RB 5B1AC 1FBGA 1MDP1 2A68F 1B68A 1RYXA 3ASOC 1OVBA 1TFDA 2HCAA 2X26A 4ND9A 4JVCA 1FTSA 2ZNUA 5I56B 2PX1A 4ZEFA 1MY3A 3GBBA 3W15C 3G4XA 1WN0A 5FHMA 3CZ6A 4MLVA 4POXA 1NUYA 1LS1A 3HFUA 4LLCA 2NSFA 3MPLA 1OLAA 4U23A 3S9OA 4JEBA 2R9RB 4G68A 5EYFA 4I3YA 2LFDA 1EKYA 5KYWA 4PFRA 3UN6A 1XT8A 4EBJA 4QFLA 4E0WA 3C8GD 4F22A 4O7IA 3ROJA 4F18A 1MQGA 2GFHA 2H4IA 2RCAA 1KZ8A 3RFYA 3CFXA 3JYYA 3FZVA 1JEUA 3TTNA 3JYHA 1NFTA 2VP1A 4E0IA 4XQ1A 2EIKC 1Y9UA 4JWXA 1R9LA 1LI5A 3K1IA 1F9BA 1VYKA 3EFOB 4KHZE 2Z8EA 4R6YA 4TLMB 5FTIA 3KN3A 3VLWA 2UXAA 3SEYA 1EU8A 2YZSA 1MG1A 1Q0MA 4O94A 3RTWB 2A0UA 4FECA 3QMKA 5ESYA 2H9BA 1MXZA 4JW1A 4WABA 1YYZA 3DZAA 3M3FA 2P61A 1RKEB 1BZ4A 4TOZA 3MVYA 1JW1A 1ZBMA 4W8KA 3GBAA 1D0XA 4G2ZA 1BK4A 4P47A 4JWYA 4EXLA 1ZHWA 3TDJA 4OIOF 1XZPA 3U72A 3QVZA 4DXCA 2V4CA 3IB2A 1IMCA 3GEHA 3U1OA 4P8BA 2Z23A 3KSXA 3U93A 4TLLB 4Q7CA 3FIRA 4JTCB 1GTKA 3ODBA 4XTCQ 2Z8FA 1VE4A 3ECRA 4GWUA 4R2BA 1J8YF 5KCJA 2LK4A 5JTYB 4AB5A 4XEFA 2I48A 2ZMBA 5I59A 4AE4A 1NUWA 3K2DA 2OJED 2DGJA 1FMVA 2DE3A 4H0WA 4XF5A 2KQ9A 2HMZA 3VAYA 2F5XA 1LLSA 4RK9A 1YA9A 3FXQA 2F22A 3HNLA 3O6XA 3SEWA 4U5FE 2Q74A 1N04A 4I40A 5I7IA 3S4UA 3S90A 4OD5A 1A99A 3ECSA 1IMDA 2F36A 2P1SA 3ILUB 3DM9B 4NF0A 1VLTA 4HS7A 4KR5A 2F35A 3L34A 3DJNB 1D1BA 5A5XB 4Q4ZF 4IGGA 1I4ZA 5E3CA 3ZTZA 4EWCA 3RVYA 5D92A 2Q89A 3W4YA 3HV1A 1Q0GA 4C3DA 4OHNA 1KU2A 1VR5A 4ECFA 1NMUA 2OKUA 3SDFA 1LAXA 2Q8MA 4DDDA 2I0CA 5A6BA 4JTDB 3F47A 5DEXB 1M5FA 3I5OA 4PR9A 1AH5A 2ZXWC 3A29A 2PCRA 4KXPA 3JSZA 2VD3A 2Y7RA 2CCYA 2YWAA 2R7SA 4NTAA 4H6DA 4BLAA 1LAFE 1YDIA 2FVZA 1L3PA 3UGPA 4MVSA 1N76A 3TQLA 2HHMA 3TJ6A 1B5HA 3B29A 2YLNA 4EBKA 2MHRA 2KSFA 3LUTB 1BBHA 2J0WA 2R7XA 5KDTA 1I6QA 3TYHA 2XS1A 1H9GA 4XPYA 4O8MA 4AQ4A 2WYPA 1ZW2A 1UFBA 2ETSA 3GEEA 2NXOA 4X8RA 3S2VA 2NG1A 3EN3A 2BE5F 2WZFA 1LGBC 5KYNA 1Z7Qc 3L8JA 4RJZA 1LFIA 5FZTA 4D4NA 2CEYA 1YTVA 4NHBA 2QS1A 4OEUA 1IXIA 2GQ1A 2WVOA 4PK4A 2PP4A 3E3KA 2P0SA 3FGSA 3O66A 4C0RA 3IOTA 2Y69C 5ET7A 1WASA 1K05A 3NMJA 4MW8A 1Y1MA 3SESA 3CFZA 1I6AA 4YN0B 4OFLA 4CS9A 5DS6A 3B50A 3HNKA 2V84A 4H5GA 2YJPA 1FFHA 4GOTA 1M56C 1XZQA 3AQBA 3CQZA 4N4UA 1URDA 1SVXB 3DE9A 2GRVA 3IK6B 2HXWA 1D9VA 1OIBA 5JEIA 3X1OA 1NI9A 1B3HA 2R8TA 1YLMA 3MZ9A 4JIOA 2H8AA 3SEUA 1NV1A 3JRTA 4PJJA 2XM0A 5L8DA 4LDRA 4GX4A 5IZ3B 2I58A 4MH5A 2XXHA 3T9UA 4ESWA 3U2LA 4P9KA 1B58A 3ILTB 3FATA 2ZXPA 2L5VA 2E1SA 4NAPA 3V83A 3BRJA 1RXQA 3PD9A 4PFTA 3IO6A 2KK1A 3WAQA 5BQGA 1HMOA 3MLGA 4LDQA 4PFUA 1P1QA 5K2YA 1LM3B 5L0CA 3IAZA 4X1BA 5ITPA 1RDYA 2ZXTA 4Z9IA 1H3DA 3IHUA 3ATPA 4U22A 4QFKA 3O28A 1ZTYA 5L9OA 4YL0A 5TPAB 4PDDA 4YL1A 1FPKA 1YAEA 3LV0A 1A7VA 3GM3A 4JSDA 3W8HA 2WKYA 4N6KA 3MBPA 3QXMA 1PCXA 5CI8A 4JXIA 4PCDA 4KQPA 4MVMA 1BLFA 2VCBA 5M2VA 2HJ3A 4YB6A 3FXBA 1LBBA 2G62A 2HZLA 2DVCA 3FOOA 4DI4B 1KA0A 4EF1A 1ZIUA 3LBSA 3PHF2 5HM4B 2HS5A 5DQTA 3QW0A 4EQ7A 4ZLDA 3ASNC 1QUJA 4HXVA 1ZZPA 3FOPA 4JWOA 4RPOA 3N6TA 3W8IA 1YYJA 5E3AA 4MCOA 2YL3A 4NC3A 2LP4A 2CZIA 4PAKA 4N6CA 3MBGA 1U0BB 3K01A 3TTLA 4Z9HA 3GWLA 3LEVA 1N7WA 2O51A 1QUIA 2R7UA 2XXTA 1VFDA 3C4MA 1HE1A 2NUPB 4GBWA 1BTJA 4EF2A 3T22A 2J46A 3ZTMA 5EQ8A 1MNEA 5EHSA 4N6PA 3MYIA 1SPIA 2O9XA 3C33A 4BJ6A 5T3JA 4HTGA 5KYYA 4IO3A 3RN8A 3SKPA 2YLDA 4QSEA 1JAFA 3K6WA 1BIYA 1CGNA 4FAPB 3ZG1A 3N2ZB 2IXNA 3KEIA 3W2WA 3RF3A 4WEDA 4F3BA 3W9VA 1SW4A 4BJ5A 2CNWD 2QFLA 4GXAA 4QSDA 4AL1A 2DYRC 2GH9A 4GWYA 4F1YA 5DQZA 5CIVA 1B3GA 4ULWA 3G50A 2R05A 3EPVA 2Q2AA 4ZZEA 3UK4A 1HY5A 4CIHA 1US5A 4IAQA 4A2NB 2XSEA 3PV0E 4LQ5A 4TQUQ 1EYIA 5L3VA 4BDOA 1E86A 1XC1A 3PPNA 1UTBB 4OESA 3QUJA 4MMPA 1KNYA 3K02A 1NNKA 2O6AA 3WG7C 3PMRA 3CG3A 5LTCA 4PF6A 1ZYRF 5HSWA 2OLBA 1JVYA 2Q9AA 1B7UA 2ONSA 4L6RA 1WODA 2Z22A 3HLZA 3AG3C 4EBBA 4PBQA 4IGTA 4YU0A 1TKNA 1P1NA 3CRBA 2Y3DA 3US6A 2JX0A 3NOHA 1SYHA 1FSAA 2OEVA 4GWWA 1OW6A 4G68B 2C04A 5KYWB 3DLNA 1MM6A 5H8QA 4JBZA 1Y4TA 2ZNTA 4MTFA 3LNRA 1QPUA 4LERA 4GQHA 3ZIBA 2DYSC 4HE8D 4E17A 3PCVA 2WBBA 4GVOA 4GFRA 2AL5A 2PNOA 4JCZA 5HV9A 1Y3PA 2UVGA 5ET5A 3B7DA 3L8IA 2CW0F 2V25A 3C7JA 3CSBA 2PFYA 2EPOA 2OK2A 1D9YA 1JOGA 2AL4A 3EZHA 4MS2A 1JVXA 1LE2A 3N24A 4LATA 3X2QC 1Y3NA 2HZKA 2ZNSA 3C36A 2VCAA 1QKAA 2XD3A 2BC5A 4ANJA 1YXIA 2YL7A 3JT1A 4P56A 1WWPA 1T6IA 4MIJA 3T93B 3VLVA 2J0XA 3DKAA 4Q5SF 4U21A 4FAJA 2XXYA 1CNQA 4Q8RA 5I2NA 1PEBA 4FEBA 4N4WA 2ZYOA 4O7GA 3RW0A 5T3TA 1INPA 4YZZA 4NWCA 1VTMP 4GL0A 2A5SA 3ZDLA 1G0IA 3U94A 4E18A 4Z7EA 3KN8A 3MSTA 4PAFA 2RINA 3TFLA 1J1NA 4EXKA 3MYFA 3ZS6A 3HHFA 2DOJA 2A5TA 2QTVA 3C9HA 3R2PA 3EHUA 4G4PA 1RCPA 3GWNA 2FFHA 5KCJB 4M1VA 3RQGA 3KN7A 5F7VA 2REJA 3FJMA 5I59B 3IB0A 5DW8A 3SYNA 3NKEA 5EK0A 3OSRA 2YEVA 1ORJA 2QVUA 1D3KA 3LS1A 1FW0A 4J7TA 4OIQF 2J8WA 2XLOA 5ET8A 1AOVA 1U6HA 1FFTC 2HXRA 1V4AA 4DI3D 1T0KA 4JCHA 3VM6A 2HQ0A 4DRIB 2I8BA 1I4YA 256BA 1SMYF 3JZ0A 4UABA 3TODA 2XXXA 4PAIA 2E0SA 3EPEA 1TWHA 1XWJA 1FTAA 3OEOA 2V3QA 1K9ZA 4G68C 2ZYMA 1YZAA 3F46A 4IAOA 3TCGA 1G0HA 2VC9A 1FQAA 4Q5TA 3ZKLA 2RD9A 3L6GA 1IZMA 1DTZA 3F11A 4U9EA 1DSNA 4NWDA 3NMKA 2HZ8A 2Y3BA 1NUZA 4O6YA 1YCJA 2RC7A 5CMMA 4FATA 4P0GA 4MEVA 4Z9JA 4L17A 2H98A 4NF6A 2Y7PA 2IA4A 4RY1A 1DMBA 2R7RA 2F3BA 4I3MA 5DVFA 1AVOB 4JDFA 4F19A 3L0IA 4FE8A 4DZ1A 5HPQA 1YAUO 2M8CA 5KDTB 5AA4A 4JE9A 1H76A
chains in the Genus database with same CATH topology
3MC2A 2HEUA 3G3JA 3TUSA 1UTHA 1IUDA 2XXQA 3PUZE 4F1VA 1FQCA 4IY6A 3GZGA 4PETA 3USDA 3MUQA 5ICTA 3FV2A 3DP4A 5L9SA 3K1MA 1Z7NE 4H8IA 4WEPA 4YKKA 2Y7WA 3UGWA 4WKMA 1LB8A 4BDRA 3S9MC 2PT1A 1Y1ZA 1NH7A 4E0XA 3MPKA 1B5IA 3DM0A 4ZECA 3RPWA 3H6UA 4F2OA 2ONKE 3PUYE 4FIMA 2QS2A 2PMSA 2DSFA 3RY3A 3C35A 2DWJA 2DE2A 2X7QA 1MH4A 3ZSFA 1ELJA 4GLIA 1LSTA 2VHAA 3R26A 1OQHA 2Y7IA 4LZ8A 4R6HA 4X48A 2O7UA 4AB6A 3O2AA 1Y4CA 3G3IA 1HSJA 4KI0E 1SYIA 3RQTA 1FTLA 1PC3A 2XX7A 2KLFA 4GXSB 1IITA 1FTKA 3IL1B 4R73A 1EH3A 5CMKA 3K00A 4EQBA 3KG2A 4G77A 4QSCA 3OENA 3O6IA 4F39A 3HN0A 1OVTA 3AXFA 1USYE 5DVIA 1LAGE 3HO7A 1GVCA 4ZEDA 1A8FA 3JYRA 2NWJA 3OO7A 1QJMA 5EHMA 2ONRA 2Q2CA 3B6TA 1IXGA 1SDXA 3C31A 2PYYA 3MVXA 1MH3A 5HBCA 3M3LA 4HCWA 1EZOA 1N3XA 1DPEA 2OWSA 3M8UA 4BDQA 3FUZA 1A40A 4LP2B 4U1ZA 1MS7A 4NF4A 3RTFB 2I0BA 5TU0A 4LONB 4OWDA 3RLFE 5IKBA 2V3TA 1B40A 4IO4A 1IQ7A 4OZ9A 2Y84A 1JQFA 1S7YA 4PFWA 1Y3QA 4DE8A 4EQ9A 3FV1A 5H8QB 3LSXA 4IGRA 3OEMA 4ZZAA 3TMGA 1FTOA 1B3LA 3CG1A 1XOCA 4GQOA 3PPRA 3SEXA 4ESXA 3N5LA 1SW2A 1NKXA 2GHAA 2QS3A 5AE4A 3TEPA 4YB7A 3QAXA 4EDPA 1QUKA 4NTLA 3K1NA 1B7ZA 3PUVE 3IJXB 1B4HA 4U4XA 2XXVA 3N6UA 3W9WA 5I2NB 3GXAA 3V5AA 3T9VA 3KFMA 2PVUA 2OBGA 5CMBA 3OMBA 3A09A 4H65A 3PU5A 1LCTA 1OQGA 2A5TB 3IOUA 2R6GE 1MDQA 2OJTA 2VD2A 2DP8A 4BDMA 3KSJA 3IR1A 5I2KA 2DWHA 2FYIA 1UQWA 3THIA 1B05A 5ICQA 3S9LC 3TCFA 3IJOB 4IO7A 1Q35A 1SW1A 4BDNA 4ELOA 4OEVA 1RYOA 3L6HA 4F31B 3T66A 1PBQA 3HPIA 1NH8A 4XKQA 2XX9A 5TP9A 4FEDA 5CBRA 1URGA 3H6VA 4NF5A 4NF6B 4OYVA 1N84A 4THIA 4X1DA 5H8SA 2OZZA 5AA4B 1MPDA 1UTHB 4C1TA 3V89B 3FVGA 2I49A 3H6WA 1M5CA 3MJNA 2XX8A 4H5FA 4O3BA 1MXWA 2QSXA 3I3VA 4GF8A 3K6XA 4H67A 2H5YA 4KFQA 4OERA 4NMYA 2NOOA 5BWJA 4LZ5A 1MPBA 4DXBA 3O6HA 1GR2A 3MP6A 1XHYA 2RC8A 4OTEA 5ITOA 2Q88A 1NNTA 3CFLA 2ABHA 4ONYA 4KCCA 1LCFA 2F8DA 1O63A 1JNFA 5BUUA 4JSOA 3PUXE 2ANJA 3VVFA 3TPAA 4YMBA 1H43A 1H45A 4KCDA 3VDFA 3FD3A 4GIZA 4UA8A 3G7WA 3G3FA 2I3VA 2GHBA 2HAVA 4JB7A 3PMVA 3LSFB 4K3FA 3U8QA 2PBWA 1UIUA 3OO9A 5DT6A 1B1HA 3UORA 4X9TA 1NNFA 3QIMA 3LSLA 5LOMA 2UVHA 3KGCA 3IORA 3CSGA 4R72A 3QK6A 1VSOA 4G8HA 4ZE8A 5AA2A 2F78A 4F3GA 3KOTA 1B0LA 4DIGA 3K6UA 1B1XA 3DP6A 1B0HA 1JW4A 1NL5A 3DELB 3K1PA 1BP5A 3O97A 2RCBA 3Q29A 5DVJA 2DXYA 4UACA 4XXUA 3H03A 4R2FA 4GD5A 4XKPA 3KJ7A 2ZYNA 4F3SA 2RKMA 1B3EA 1MXXA 3IB1A 4IY5A 2X7PA 4NF4B 1IZ1A 2Q8JA 1POTA 3PD8A 2OWTA 1P99A 3H4ZA 1Z7ME 3FXRA 1A7LA 2NVUB 2QMWA 1MPCA 3SERA 3KZGA 3T9XB 4NF8A 3IO4A 4ELRA 1QULA 2XXIA 4OFOA 4N07A 3VE1B 4RXLA 1US4A 4O3AA 5H8HA 5IAIA 3MP1A 1JEVA 4IO6A 2R71A 4RPNA 1B4ZA 4I62A 2O68A 4P0IA 5I57A 4OVJA 3FJ7A 1USYH 5I58A 1OLCA 1MY0A 2CZLA 4I9DA 1A8EA 2ZYKA 4U2RA 2I6EA 2DE4A 4YAHX 4OMBA 3E4RA 1SD3A 1AMFA 4ZE9A 3H6TA 4H1XA 1OMPA 5H8NA 2I4BA 4HCYA 4IB2A 1MXVA 1M5BA 3VVEA 1EZ9A 3HCQA 2AIXA 3VXCA 3M3KA 4GL8A 4H8JA 5I2KB 3VVDA 3A3CA 4KYSA 3WAFA 3OO8A 2Y7KA 2F6PA 1IXHA 5CBSA 4R75A 1FQEA 4R6KA 2F6GA 4F3PA 4RYAA 2F7BA 5AA3A 3GLBA 3E13X 2DVZA 3BKIB 2FNCA 1P1OA 3TTKA 1KWHA 4I1DA 3R7XA 5TP9B 2VOZA 3QYTA 3RT8A 4HW8A 4PFYA 4OFJA 4NF5B 2XXUA 3FVOA 4PE5B 4BDLA 2I3WA 4NE4A 4FORA 4R74A 1N0TA 3WAEA 3EHTA 2XXPA 3HSTA 1DPPA 4OETA 3TZAA 1LFGA 4ELPA 5CM6A 3EF7A 4DLDA 4LQ2A 1CB6A 1GGGA 3H06B 3KBRA 1B9JA 5ELVA 2QMXA 3G3HA 3MQ9A 5H8FA 3FVKA 4ZEIA 5CRYA 4NEDA 1IIWA 3N26A 4ZDMA 3R6UA 3CI8A 1ZU0A 3OOAA 3H3GA 4XKNA 4MBPA 2THIA 3OO6A 3LSWA 3K0VA 4F29A 3O29A 2RF1A 2RC9A 1B51A 4YICA 1NNPA 1GV8A 2XD2A 1ZLQA 4QRZA 2QL3A 2OCUA 3BFTA 1M5DA 3SEVA 1N7XA 2XXWA 1MXUA 1PDAA 3LC8A 4ZEKA 5CMCA 4PQJA 1ZKBA 4I8CA 4OQOA 2B65A 3MWBA 3FVNA 5FTHA 4N13A 1IEJA 2FA7A 3RGYA 1TWYA 3UIFA 2F34A 2GFEA 4XKRA 4KYEA 3PUWE 1MY1A 3MW0A 4OXVA 1FQBA 4YKJA 1QW0A 3B6QA 4M4GA 3RT6B 1FQFA 3B6WA 1ZMGA 1CE2A 3K6VA 1AL3A 3OEKA 1A55A 4YKPA 5AA2B 1TFAA 1XVXA 4KYDA 5L9MA 4C1UA 1N3WA 3PPOA 3OSQA 2O7IA 1Q1KA 3Q25A 1MQHA 3PGFA 2PT2A 3CVGA 1MQIA 3MZ1A 3O6GA 1PB8A 5AA1A 1MM7A 1ATGA 1WDNA 1B6HA 4P11A 3OXNA 1UIVA 2DXRA 4LA9A 1B46A 3KJTA 1PBPA 2BJJX 4XIGQ 2HFBA 3ZKKA 1AIVA 1XS5A 4IO2A 2O84X 3MVWA 2IEEA 1BKAA 4QF9A 4QFNA 1SI1A 2QRYA 1S9TA 4RK2A 3U92A 4F2QA 3S9NC 4R9GA 3TTRA 3VXBA 5I56A 1QKBA 1LB9A 4NF8B 2UVJA 1SI0A 2DYXA 2AYSA 3D4CA 2F7AA 5ISUA 2Q9TA 1HSEA 5H8HB 1PB7A 1EZPA 1MQDA 4QFPA 3CR9A 2HAUA 4Q30B 5I57B 1JETA 4KD5A 3TQWA 2QS4A 2ESNA 3VLUA 4YMAA 5I58B 3H7MA 3CIJA 5CI5A 1DTGA 3BFUA 3MVZA 4LVQA 4U4SA 3IOVA 5K2XA 3G3GA 1M5EA 1PB9A 4QHQA 1I6BA 5H8NB 2O69A 4RA1A 2LAOA 4GRKA 3EHSA 1TT1A 5FHNA 3PMXA 1ZJLA 3QSLA 3TTMA 2H25A 1POY1 4FJPA 3PPQA 1MY4A 1L5TA 5JTYA 4IO5A 5DYHA 3D4GA 2DWAA 3A3UA 2UYEA 1WVJA 4WXJA 3LR1A 1SW5A 1P1UA 1B32A 2QPQA 4POWA 1Y20A 3HHGA 3Q26A 3UP9A 1FTJA 4G8MA 4RNSA 3Q28A 5A5XA 3VV5A 2YPNA 5JK4A 3BBRA 2H99A 1FTMA 3N94A 4Z0IA 4YKIA 3IX1A 3OELA 3UA8A 5DEXA 1B5JA 1FCKA 3C32A 2F97A 2XXRA 4DCXA 3V8XB 2D3IA 3I6VA 3E9XA 1R1NA 3LUYA 5DTBA 1S50A 4PP0A 2O1LA 3TAJA 3OD7A 1H44A 1TXFA 2B3FA 1B52A 2D21A 1I69A 5AA2D 4GWOA 3VFJA 1MY2A 2ALUA 1LFHA 2F7CA 3G3KA 4YB5A 5H8FB 2B3BA 3O9PA 2CMOA 3EQ1A 2VGQA 1HSLA 1R9QA 4LZ7A 4KPTA 1ANFA 3RUMA 2UVIA 2G29A 2V3UA 3PPPA 5F1QA 4LUBA 4MFIA 4DCYA 4MLQA 4U1OA 3S9EA 5B70A 2G93A 1D4NA 2NUVA 1B3FA 5B7DA 4ZEBA 5FHOA 3Q27A 2O1MA 2W7YA 3PMWA 1VFEA 2DS9A 1RKMA 1LBCA 3SETA 1SQYA 2P2AA 2I4CA 4F1UA 1MXYA 3TCHA 5TPAA 3C34A 1FQDA 3FASA 2R9JA 2XHDA 4R9FA 1O64A 4QFOA 5I84A 5CC2A 1SBPA 2Z8DA 1B7HA 2DQVA 1XVYA 1A54A 1LAHE 3K4UA 2LFFA 1B2HA 4O3CA 3RNNA 2D5WA 3MAMA 3ONMA 3FXUA 4MF3A 3MZBA 4ELQA 3TELA 5KZTA 2QJEA 1R6ZA 4G8NA 1URSA 5J1DA 3MP8A 3FJGA 2UYFA 1II5A 4DXUA 4ISUA 3JV9A 4ZS9A 2DWIA 1QVSA 3T9HB 3T96B 1MQJA 1O7TA 3DP8A 1YPNA 1JW5A 2REGA 3U8VA 1MRPA 3JZJA 3QUFA 4OENA 4EUOA 3TKDA 1P1WA 1DOTA 1IXCA 3P7IA 1UTBA 3IOWA 2V93A 4Q0CA 3KOSA 1MDP1 1RYXA 1OVBA 1TFDA 2HCAA 2X26A 4ND9A 2ZNUA 5I56B 2PX1A 4ZEFA 1MY3A 3GBBA 3W15C 5FHMA 4MLVA 4POXA 3MPLA 1OLAA 4U23A 4G68A 5EYFA 2LFDA 3UN6A 1XT8A 4QFLA 4E0WA 4F22A 4F18A 1MQGA 2H4IA 2RCAA 3CFXA 3FZVA 1JEUA 3TTNA 1NFTA 2VP1A 1Y9UA 4JWXA 1R9LA 1F9BA 4KHZE 2Z8EA 4R6YA 4TLMB 5FTIA 3KN3A 3VLWA 2UXAA 3SEYA 1EU8A 1MG1A 3RTWB 4FECA 2H9BA 1MXZA 3M3FA 4TOZA 3MVYA 1JW1A 1ZBMA 3GBAA 4G2ZA 4JWYA 4EXLA 3TDJA 3U72A 4DXCA 3IB2A 3U1OA 2Z23A 3KSXA 3U93A 4TLLB 3FIRA 3ODBA 1GTKA 4XTCQ 2Z8FA 1VE4A 3ECRA 4R2BA 5KCJA 5JTYB 4AB5A 2I48A 2ZMBA 5I59A 3K2DA 2DE3A 4H0WA 2F5XA 1LLSA 4RK9A 3FXQA 3SEWA 1N04A 3S4UA 1A99A 2F36A 2P1SA 3ILUB 4HS7A 4KR5A 2F35A 5A5XB 2Q89A 3HV1A 4OHNA 1VR5A 4ECFA 1NMUA 3SDFA 1LAXA 4DDDA 2I0CA 5DEXB 1M5FA 3I5OA 1AH5A 2Y7RA 2VD3A 4H6DA 4BLAA 1LAFE 1N76A 3TQLA 1B5HA 2YLNA 5KDTA 1I6QA 3TYHA 4AQ4A 2NXOA 3S2VA 3EN3A 1LGBC 4RJZA 1LFIA 1YTVA 2QS1A 4OEUA 1IXIA 3E3KA 2P0SA 3FGSA 3O66A 4C0RA 3IOTA 1Y1MA 3SESA 3CFZA 1I6AA 4OFLA 2V84A 4H5GA 2YJPA 4GOTA 1URDA 1SVXB 3IK6B 2GRVA 2HXWA 1D9VA 1OIBA 5JEIA 1B3HA 3MZ9A 3SEUA 5L8DA 2I58A 4MH5A 2XXHA 3T9UA 4ESWA 1B58A 3ILTB 3FATA 2E1SA 3V83A 3PD9A 4PFTA 3IO6A 4PFUA 1P1QA 5K2YA 3IAZA 4X1BA 5ITPA 2ZXTA 1H3DA 4U22A 4QFKA 3O28A 1ZTYA 5L9OA 5TPAB 1YAEA 4JSDA 2WKYA 3MBPA 3QXMA 4JXIA 4KQPA 1BLFA 5M2VA 4YB6A 1LBBA 2HZLA 2DVCA 4EF1A 1ZIUA 3LBSA 5HM4B 4EQ7A 1QUJA 4JWOA 4RPOA 3N6TA 3TTLA 3K01A 1N7WA 2O51A 1QUIA 2XXTA 3C4MA 1VFDA 1BTJA 4EF2A 3T22A 5EHSA 4N6PA 3C33A 4HTGA 4IO3A 3RN8A 3SKPA 4QSEA 3K6WA 1BIYA 3KEIA 4WEDA 4F3BA 3W9VA 1SW4A 4GXAA 4QSDA 2GH9A 4F1YA 1B3GA 2Q2AA 4ZZEA 3UK4A 1US5A 3PV0E 4LQ5A 4TQUQ 4BDOA 1XC1A 3PPNA 1UTBB 4OESA 3QUJA 3K02A 1NNKA 2O6AA 3CG3A 2OLBA 1JVYA 2ONSA 1B7UA 1WODA 2Z22A 4IGTA 4YU0A 1P1NA 3CRBA 1SYHA 4G68B 3DLNA 1MM6A 5H8QA 4JBZA 1Y4TA 2ZNTA 4GVOA 4GFRA 2AL5A 1Y3PA 2UVGA 3B7DA 2V25A 3CSBA 2OK2A 1D9YA 2AL4A 1JVXA 4LATA 2ZNSA 1Y3NA 2HZKA 3C36A 1QKAA 2XD3A 3T93B 3VLVA 4U21A 4FAJA 2XXYA 4Q8RA 5I2NA 1PEBA 4FEBA 2ZYOA 4YZZA 4NWCA 4GL0A 2A5SA 3U94A 4Z7EA 3KN8A 2RINA 3TFLA 1J1NA 4EXKA 3ZS6A 3HHFA 2DOJA 2A5TA 3C9HA 3EHUA 4G4PA 5KCJB 4M1VA 3KN7A 5F7VA 2REJA 3FJMA 5I59B 3IB0A 3OSRA 1D3KA 1FW0A 1AOVA 1T0KA 2HQ0A 3TODA 2XXXA 2E0SA 3EPEA 2V3QA 4G68C 2ZYMA 3TCGA 1FQAA 4Q5TA 3ZKLA 3L6GA 1DTZA 3F11A 1DSNA 4NWDA 2HZ8A 1YCJA 2RC7A 5CMMA 4FATA 4P0GA 4L17A 2H98A 4NF6A 2Y7PA 2IA4A 4RY1A 1DMBA 5DVFA 4JDFA 4F19A 4FE8A 4DZ1A 5HPQA 2M8CA 5KDTB 5AA4A 1H76A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MC2 A;  2HEU A;  3G3J A;  3TUS A;  1UTH A;  1IUD A;  2XXQ A;  3PUZ E;  4F1V A;  1FQC A;  4IY6 A;  3GZG A;  4PET A;  3USD A;  3MUQ A;  5ICT A;  3FV2 A;  3DP4 A;  5L9S A;  3K1M A;  1Z7N E;  4H8I A;  4WEP A;  4YKK A;  2Y7W A;  3UGW A;  4WKM A;  1LB8 A;  4BDR A;  3S9M C;  2PT1 A;  1Y1Z A;  1NH7 A;  4E0X A;  3MPK A;  1B5I A;  3DM0 A;  4ZEC A;  3RPW A;  3H6U A;  4F2O A;  2ONK E;  3PUY E;  4FIM A;  2QS2 A;  2PMS A;  2DSF A;  3RY3 A;  3C35 A;  2DWJ A;  2DE2 A;  2X7Q A;  1MH4 A;  3ZSF A;  1ELJ A;  4GLI A;  1LST A;  2VHA A;  3R26 A;  1OQH A;  2Y7I A;  4LZ8 A;  4R6H A;  4X48 A;  2O7U A;  4AB6 A;  3O2A A;  1Y4C A;  3G3I A;  1HSJ A;  4KI0 E;  1SYI A;  3RQT A;  1FTL A;  1PC3 A;  2XX7 A;  2KLF A;  4GXS B;  1IIT A;  1FTK A;  3IL1 B;  4R73 A;  1EH3 A;  5CMK A;  3K00 A;  4EQB A;  3KG2 A;  4G77 A;  4QSC A;  3OEN A;  3O6I A;  4F39 A;  3HN0 A;  1OVT A;  3AXF A;  1USY E;  5DVI A;  1LAG E;  3HO7 A;  1GVC A;  4ZED A;  1A8F A;  3JYR A;  2NWJ A;  3OO7 A;  1QJM A;  5EHM A;  2ONR A;  2Q2C A;  3B6T A;  1IXG A;  1SDX A;  3C31 A;  2PYY A;  3MVX A;  1MH3 A;  5HBC A;  3M3L A;  4HCW A;  1EZO A;  1N3X A;  1DPE A;  2OWS A;  3M8U A;  4BDQ A;  3FUZ A;  1A40 A;  4LP2 B;  4U1Z A;  1MS7 A;  4NF4 A;  3RTF B;  2I0B A;  5TU0 A;  4LON B;  4OWD A;  3RLF E;  5IKB A;  2V3T A;  1B40 A;  4IO4 A;  1IQ7 A;  4OZ9 A;  2Y84 A;  1JQF A;  1S7Y A;  4PFW A;  1Y3Q A;  4DE8 A;  4EQ9 A;  3FV1 A;  5H8Q B;  3LSX A;  4IGR A;  3OEM A;  4ZZA A;  3TMG A;  1FTO A;  1B3L A;  3CG1 A;  1XOC A;  4GQO A;  3PPR A;  3SEX A;  4ESX A;  3N5L A;  1SW2 A;  1NKX A;  2GHA A;  2QS3 A;  5AE4 A;  3TEP A;  4YB7 A;  3QAX A;  4EDP A;  1QUK A;  4NTL A;  3K1N A;  1B7Z A;  3PUV E;  3IJX B;  1B4H A;  4U4X A;  2XXV A;  3N6U A;  3W9W A;  5I2N B;  3GXA A;  3V5A A;  3T9V A;  3KFM A;  2PVU A;  2OBG A;  5CMB A;  3OMB A;  3A09 A;  4H65 A;  3PU5 A;  1LCT A;  1OQG A;  2A5T B;  3IOU A;  2R6G E;  1MDQ A;  2OJT A;  2VD2 A;  2DP8 A;  4BDM A;  3KSJ A;  3IR1 A;  5I2K A;  2DWH A;  2FYI A;  1UQW A;  3THI A;  1B05 A;  5ICQ A;  3S9L C;  3TCF A;  3IJO B;  4IO7 A;  1Q35 A;  1SW1 A;  4BDN A;  4ELO A;  4OEV A;  1RYO A;  3L6H A;  4F31 B;  3T66 A;  1PBQ A;  3HPI A;  1NH8 A;  4XKQ A;  2XX9 A;  5TP9 A;  4FED A;  5CBR A;  1URG A;  3H6V A;  4NF5 A;  4NF6 B;  4OYV A;  1N84 A;  4THI A;  4X1D A;  5H8S A;  2OZZ A;  5AA4 B;  1MPD A;  1UTH B;  4C1T A;  3V89 B;  3FVG A;  2I49 A;  3H6W A;  1M5C A;  3MJN A;  2XX8 A;  4H5F A;  4O3B A;  1MXW A;  2QSX A;  3I3V A;  4GF8 A;  3K6X A;  4H67 A;  2H5Y A;  4KFQ A;  4OER A;  4NMY A;  2NOO A;  5BWJ A;  4LZ5 A;  1MPB A;  4DXB A;  3O6H A;  1GR2 A;  3MP6 A;  1XHY A;  2RC8 A;  4OTE A;  5ITO A;  2Q88 A;  1NNT A;  3CFL A;  2ABH A;  4ONY A;  4KCC A;  1LCF A;  2F8D A;  1O63 A;  1JNF A;  5BUU A;  4JSO A;  3PUX E;  2ANJ A;  3VVF A;  3TPA A;  4YMB A;  1H43 A;  1H45 A;  4KCD A;  3VDF A;  3FD3 A;  4GIZ A;  4UA8 A;  3G7W A;  3G3F A;  2I3V A;  2GHB A;  2HAV A;  4JB7 A;  3PMV A;  3LSF B;  4K3F A;  3U8Q A;  2PBW A;  1UIU A;  3OO9 A;  5DT6 A;  1B1H A;  3UOR A;  4X9T A;  1NNF A;  3QIM A;  3LSL A;  5LOM A;  2UVH A;  3KGC A;  3IOR A;  3CSG A;  4R72 A;  3QK6 A;  1VSO A;  4G8H A;  4ZE8 A;  5AA2 A;  2F78 A;  4F3G A;  3KOT A;  1B0L A;  4DIG A;  3K6U A;  1B1X A;  3DP6 A;  1B0H A;  1JW4 A;  1NL5 A;  3DEL B;  3K1P A;  1BP5 A;  3O97 A;  2RCB A;  3Q29 A;  5DVJ A;  2DXY A;  4UAC A;  4XXU A;  3H03 A;  4R2F A;  4GD5 A;  4XKP A;  3KJ7 A;  2ZYN A;  4F3S A;  2RKM A;  1B3E A;  1MXX A;  3IB1 A;  4IY5 A;  2X7P A;  4NF4 B;  1IZ1 A;  2Q8J A;  1POT A;  3PD8 A;  2OWT A;  1P99 A;  3H4Z A;  1Z7M E;  3FXR A;  1A7L A;  2NVU B;  2QMW A;  1MPC A;  3SER A;  3KZG A;  3T9X B;  4NF8 A;  3IO4 A;  4ELR A;  1QUL A;  2XXI A;  4OFO A;  4N07 A;  3VE1 B;  4RXL A;  1US4 A;  4O3A A;  5H8H A;  5IAI A;  3MP1 A;  1JEV A;  4IO6 A;  2R71 A;  4RPN A;  1B4Z A;  4I62 A;  2O68 A;  4P0I A;  5I57 A;  4OVJ A;  3FJ7 A;  1USY H;  5I58 A;  1OLC A;  1MY0 A;  2CZL A;  4I9D A;  1A8E A;  2ZYK A;  4U2R A;  2I6E A;  2DE4 A;  4YAH X;  4OMB A;  3E4R A;  1SD3 A;  1AMF A;  4ZE9 A;  3H6T A;  4H1X A;  1OMP A;  5H8N A;  2I4B A;  4HCY A;  4IB2 A;  1MXV A;  1M5B A;  3VVE A;  1EZ9 A;  3HCQ A;  2AIX A;  3VXC A;  3M3K A;  4GL8 A;  4H8J A;  5I2K B;  3VVD A;  3A3C A;  4KYS A;  3WAF A;  3OO8 A;  2Y7K A;  2F6P A;  1IXH A;  5CBS A;  4R75 A;  1FQE A;  4R6K A;  2F6G A;  4F3P A;  4RYA A;  2F7B A;  5AA3 A;  3GLB A;  3E13 X;  2DVZ A;  3BKI B;  2FNC A;  1P1O A;  3TTK A;  1KWH A;  4I1D A;  3R7X A;  5TP9 B;  2VOZ A;  3QYT A;  3RT8 A;  4HW8 A;  4PFY A;  4OFJ A;  4NF5 B;  2XXU A;  3FVO A;  4PE5 B;  4BDL A;  2I3W A;  4NE4 A;  4FOR A;  4R74 A;  1N0T A;  3WAE A;  3EHT A;  2XXP A;  3HST A;  1DPP A;  4OET A;  3TZA A;  1LFG A;  4ELP A;  5CM6 A;  3EF7 A;  4DLD A;  4LQ2 A;  1CB6 A;  1GGG A;  3H06 B;  3KBR A;  1B9J A;  5ELV A;  2QMX A;  3G3H A;  3MQ9 A;  5H8F A;  3FVK A;  4ZEI A;  5CRY A;  4NED A;  1IIW A;  3N26 A;  4ZDM A;  3R6U A;  3CI8 A;  1ZU0 A;  3OOA A;  3H3G A;  4XKN A;  4MBP A;  2THI A;  3OO6 A;  3LSW A;  3K0V A;  4F29 A;  3O29 A;  2RF1 A;  2RC9 A;  1B51 A;  4YIC A;  1NNP A;  1GV8 A;  2XD2 A;  1ZLQ A;  4QRZ A;  2QL3 A;  2OCU A;  3BFT A;  1M5D A;  3SEV A;  1N7X A;  2XXW A;  1MXU A;  1PDA A;  3LC8 A;  4ZEK A;  5CMC A;  4PQJ A;  1ZKB A;  4I8C A;  4OQO A;  2B65 A;  3MWB A;  3FVN A;  5FTH A;  4N13 A;  1IEJ A;  2FA7 A;  3RGY A;  1TWY A;  3UIF A;  2F34 A;  2GFE A;  4XKR A;  4KYE A;  3PUW E;  1MY1 A;  3MW0 A;  4OXV A;  1FQB A;  4YKJ A;  1QW0 A;  3B6Q A;  4M4G A;  3RT6 B;  1FQF A;  3B6W A;  1ZMG A;  1CE2 A;  3K6V A;  1AL3 A;  3OEK A;  1A55 A;  4YKP A;  5AA2 B;  1TFA A;  1XVX A;  4KYD A;  5L9M A;  4C1U A;  1N3W A;  3PPO A;  3OSQ A;  2O7I A;  1Q1K A;  3Q25 A;  1MQH A;  3PGF A;  2PT2 A;  3CVG A;  1MQI A;  3MZ1 A;  3O6G A;  1PB8 A;  5AA1 A;  1MM7 A;  1ATG A;  1WDN A;  1B6H A;  4P11 A;  3OXN A;  1UIV A;  2DXR A;  4LA9 A;  1B46 A;  3KJT A;  1PBP A;  2BJJ X;  4XIG Q;  2HFB A;  3ZKK A;  1AIV A;  1XS5 A;  4IO2 A;  2O84 X;  3MVW A;  2IEE A;  1BKA A;  4QF9 A;  4QFN A;  1SI1 A;  2QRY A;  1S9T A;  4RK2 A;  3U92 A;  4F2Q A;  3S9N C;  4R9G A;  3TTR A;  3VXB A;  5I56 A;  1QKB A;  1LB9 A;  4NF8 B;  2UVJ A;  1SI0 A;  2DYX A;  2AYS A;  3D4C A;  2F7A A;  5ISU A;  2Q9T A;  1HSE A;  5H8H B;  1PB7 A;  1EZP A;  1MQD A;  4QFP A;  3CR9 A;  2HAU A;  4Q30 B;  5I57 B;  1JET A;  4KD5 A;  3TQW A;  2QS4 A;  2ESN A;  3VLU A;  4YMA A;  5I58 B;  3H7M A;  3CIJ A;  5CI5 A;  1DTG A;  3BFU A;  3MVZ A;  4LVQ A;  4U4S A;  3IOV A;  5K2X A;  3G3G A;  1M5E A;  1PB9 A;  4QHQ A;  1I6B A;  5H8N B;  2O69 A;  4RA1 A;  2LAO A;  4GRK A;  3EHS A;  1TT1 A;  5FHN A;  3PMX A;  1ZJL A;  3QSL A;  3TTM A;  2H25 A;  1POY 1;  4FJP A;  3PPQ A;  1MY4 A;  1L5T A;  5JTY A;  4IO5 A;  5DYH A;  3D4G A;  2DWA A;  3A3U A;  2UYE A;  1WVJ A;  4WXJ A;  3LR1 A;  1SW5 A;  1P1U A;  1B32 A;  2QPQ A;  4POW A;  1Y20 A;  3HHG A;  3Q26 A;  3UP9 A;  1FTJ A;  4G8M A;  4RNS A;  3Q28 A;  5A5X A;  3VV5 A;  2YPN A;  5JK4 A;  3BBR A;  2H99 A;  1FTM A;  3N94 A;  4Z0I A;  4YKI A;  3IX1 A;  3OEL A;  3UA8 A;  5DEX A;  1B5J A;  1FCK A;  3C32 A;  2F97 A;  2XXR A;  4DCX A;  3V8X B;  2D3I A;  3I6V A;  3E9X A;  1R1N A;  3LUY A;  5DTB A;  1S50 A;  4PP0 A;  2O1L A;  3TAJ A;  3OD7 A;  1H44 A;  1TXF A;  2B3F A;  1B52 A;  2D21 A;  1I69 A;  5AA2 D;  4GWO A;  3VFJ A;  1MY2 A;  2ALU A;  1LFH A;  2F7C A;  3G3K A;  4YB5 A;  5H8F B;  2B3B A;  3O9P A;  2CMO A;  3EQ1 A;  2VGQ A;  1HSL A;  1R9Q A;  4LZ7 A;  4KPT A;  1ANF A;  3RUM A;  2UVI A;  2G29 A;  2V3U A;  3PPP A;  5F1Q A;  4LUB A;  4MFI A;  4DCY A;  4MLQ A;  4U1O A;  3S9E A;  5B70 A;  2G93 A;  1D4N A;  2NUV A;  1B3F A;  5B7D A;  4ZEB A;  5FHO A;  3Q27 A;  2O1M A;  2W7Y A;  3PMW A;  1VFE A;  2DS9 A;  1RKM A;  1LBC A;  3SET A;  1SQY A;  2P2A A;  2I4C A;  4F1U A;  1MXY A;  3TCH A;  5TPA A;  3C34 A;  1FQD A;  3FAS A;  2R9J A;  2XHD A;  4R9F A;  1O64 A;  4QFO A;  5I84 A;  5CC2 A;  1SBP A;  2Z8D A;  1B7H A;  2DQV A;  1XVY A;  1A54 A;  1LAH E;  3K4U A;  2LFF A;  1B2H A;  4O3C A;  3RNN A;  2D5W A;  3MAM A;  3ONM A;  3FXU A;  4MF3 A;  3MZB A;  4ELQ A;  3TEL A;  5KZT A;  2QJE A;  1R6Z A;  4G8N A;  1URS A;  5J1D A;  3MP8 A;  3FJG A;  2UYF A;  1II5 A;  4DXU A;  4ISU A;  3JV9 A;  4ZS9 A;  2DWI A;  1QVS A;  3T9H B;  3T96 B;  1MQJ A;  1O7T A;  3DP8 A;  1YPN A;  1JW5 A;  2REG A;  3U8V A;  1MRP A;  3JZJ A;  3QUF A;  4OEN A;  4EUO A;  3TKD A;  1P1W A;  1DOT A;  1IXC A;  3P7I A;  1UTB A;  3IOW A;  2V93 A;  4Q0C A;  3KOS A;  1MDP 1;  1RYX A;  1OVB A;  1TFD A;  2HCA A;  2X26 A;  4ND9 A;  2ZNU A;  5I56 B;  2PX1 A;  4ZEF A;  1MY3 A;  3GBB A;  3W15 C;  5FHM A;  4MLV A;  4POX A;  3MPL A;  1OLA A;  4U23 A;  4G68 A;  5EYF A;  2LFD A;  3UN6 A;  1XT8 A;  4QFL A;  4E0W A;  4F22 A;  4F18 A;  1MQG A;  2H4I A;  2RCA A;  3CFX A;  3FZV A;  1JEU A;  3TTN A;  1NFT A;  2VP1 A;  1Y9U A;  4JWX A;  1R9L A;  1F9B A;  4KHZ E;  2Z8E A;  4R6Y A;  4TLM B;  5FTI A;  3KN3 A;  3VLW A;  2UXA A;  3SEY A;  1EU8 A;  1MG1 A;  3RTW B;  4FEC A;  2H9B A;  1MXZ A;  3M3F A;  4TOZ A;  3MVY A;  1JW1 A;  1ZBM A;  3GBA A;  4G2Z A;  4JWY A;  4EXL A;  3TDJ A;  3U72 A;  4DXC A;  3IB2 A;  3U1O A;  2Z23 A;  3KSX A;  3U93 A;  4TLL B;  3FIR A;  3ODB A;  1GTK A;  4XTC Q;  2Z8F A;  1VE4 A;  3ECR A;  4R2B A;  5KCJ A;  5JTY B;  4AB5 A;  2I48 A;  2ZMB A;  5I59 A;  3K2D A;  2DE3 A;  4H0W A;  2F5X A;  1LLS A;  4RK9 A;  3FXQ A;  3SEW A;  1N04 A;  3S4U A;  1A99 A;  2F36 A;  2P1S A;  3ILU B;  4HS7 A;  4KR5 A;  2F35 A;  5A5X B;  2Q89 A;  3HV1 A;  4OHN A;  1VR5 A;  4ECF A;  1NMU A;  3SDF A;  1LAX A;  4DDD A;  2I0C A;  5DEX B;  1M5F A;  3I5O A;  1AH5 A;  2Y7R A;  2VD3 A;  4H6D A;  4BLA A;  1LAF E;  1N76 A;  3TQL A;  1B5H A;  2YLN A;  5KDT A;  1I6Q A;  3TYH A;  4AQ4 A;  2NXO A;  3S2V A;  3EN3 A;  1LGB C;  4RJZ A;  1LFI A;  1YTV A;  2QS1 A;  4OEU A;  1IXI A;  3E3K A;  2P0S A;  3FGS A;  3O66 A;  4C0R A;  3IOT A;  1Y1M A;  3SES A;  3CFZ A;  1I6A A;  4OFL A;  2V84 A;  4H5G A;  2YJP A;  4GOT A;  1URD A;  1SVX B;  3IK6 B;  2GRV A;  2HXW A;  1D9V A;  1OIB A;  5JEI A;  1B3H A;  3MZ9 A;  3SEU A;  5L8D A;  2I58 A;  4MH5 A;  2XXH A;  3T9U A;  4ESW A;  1B58 A;  3ILT B;  3FAT A;  2E1S A;  3V83 A;  3PD9 A;  4PFT A;  3IO6 A;  4PFU A;  1P1Q A;  5K2Y A;  3IAZ A;  4X1B A;  5ITP A;  2ZXT A;  1H3D A;  4U22 A;  4QFK A;  3O28 A;  1ZTY A;  5L9O A;  5TPA B;  1YAE A;  4JSD A;  2WKY A;  3MBP A;  3QXM A;  4JXI A;  4KQP A;  1BLF A;  5M2V A;  4YB6 A;  1LBB A;  2HZL A;  2DVC A;  4EF1 A;  1ZIU A;  3LBS A;  5HM4 B;  4EQ7 A;  1QUJ A;  4JWO A;  4RPO A;  3N6T A;  3TTL A;  3K01 A;  1N7W A;  2O51 A;  1QUI A;  2XXT A;  3C4M A;  1VFD A;  1BTJ A;  4EF2 A;  3T22 A;  5EHS A;  4N6P A;  3C33 A;  4HTG A;  4IO3 A;  3RN8 A;  3SKP A;  4QSE A;  3K6W A;  1BIY A;  3KEI A;  4WED A;  4F3B A;  3W9V A;  1SW4 A;  4GXA A;  4QSD A;  2GH9 A;  4F1Y A;  1B3G A;  2Q2A A;  4ZZE A;  3UK4 A;  1US5 A;  3PV0 E;  4LQ5 A;  4TQU Q;  4BDO A;  1XC1 A;  3PPN A;  1UTB B;  4OES A;  3QUJ A;  3K02 A;  1NNK A;  2O6A A;  3CG3 A;  2OLB A;  1JVY A;  2ONS A;  1B7U A;  1WOD A;  2Z22 A;  4IGT A;  4YU0 A;  1P1N A;  3CRB A;  1SYH A;  4G68 B;  3DLN A;  1MM6 A;  5H8Q A;  4JBZ A;  1Y4T A;  2ZNT A;  4GVO A;  4GFR A;  2AL5 A;  1Y3P A;  2UVG A;  3B7D A;  2V25 A;  3CSB A;  2OK2 A;  1D9Y A;  2AL4 A;  1JVX A;  4LAT A;  2ZNS A;  1Y3N A;  2HZK A;  3C36 A;  1QKA A;  2XD3 A;  3T93 B;  3VLV A;  4U21 A;  4FAJ A;  2XXY A;  4Q8R A;  5I2N A;  1PEB A;  4FEB A;  2ZYO A;  4YZZ A;  4NWC A;  4GL0 A;  2A5S A;  3U94 A;  4Z7E A;  3KN8 A;  2RIN A;  3TFL A;  1J1N A;  4EXK A;  3ZS6 A;  3HHF A;  2DOJ A;  2A5T A;  3C9H A;  3EHU A;  4G4P A;  5KCJ B;  4M1V A;  3KN7 A;  5F7V A;  2REJ A;  3FJM A;  5I59 B;  3IB0 A;  3OSR A;  1D3K A;  1FW0 A;  1AOV A;  1T0K A;  2HQ0 A;  3TOD A;  2XXX A;  2E0S A;  3EPE A;  2V3Q A;  4G68 C;  2ZYM A;  3TCG A;  1FQA A;  4Q5T A;  3ZKL A;  3L6G A;  1DTZ A;  3F11 A;  1DSN A;  4NWD A;  2HZ8 A;  1YCJ A;  2RC7 A;  5CMM A;  4FAT A;  4P0G A;  4L17 A;  2H98 A;  4NF6 A;  2Y7P A;  2IA4 A;  4RY1 A;  1DMB A;  5DVF A;  4JDF A;  4F19 A;  4FE8 A;  4DZ1 A;  5HPQ A;  2M8C A;  5KDT B;  5AA4 A;  1H76 A; 
#chains in the Genus database with same CATH topology
 3Q7L A;  3MC2 A;  3B71 A;  4CX9 A;  2HEU A;  3TOM A;  3G3J A;  4OIN F;  1UTH A;  3TUS A;  1IUD A;  1W2W A;  2LSE A;  1VYI A;  2XXQ A;  3PUZ E;  4F1V A;  1FQC A;  3RPL A;  5TJ5 E;  4IY6 A;  2G3K A;  3GZG A;  1ORS C;  1OR3 A;  4PET A;  3MUQ A;  3USD A;  5ICT A;  1VLS A;  3S29 A;  4E0H A;  3FV2 A;  3DP4 A;  5L9S A;  3K1M A;  1G8X A;  2HV6 A;  4PJM A;  1Z7N E;  3QZC A;  4H8I A;  3CAX A;  4WEP A;  5E2Q A;  3KYI A;  1YAR O;  2V26 A;  1PD1 A;  2Y7W A;  4NQ8 A;  4YKK A;  3UGW A;  4PJL A;  1LBY A;  1LEV A;  4WKM A;  4PFB A;  1EA8 A;  3DM5 A;  5EHH A;  1LB8 A;  4BDR A;  1FAP B;  3S9M C;  4LDK A;  3PDM P;  1JPJ A;  2PT1 A;  1Y1Z A;  1NH7 A;  2HMQ A;  2Z15 A;  4NQF A;  4E0X A;  2XLW A;  1WAT A;  2A69 F;  3JSE O;  2X0C A;  3U0C A;  4W8P A;  3MPK A;  1ZU5 A;  1B5I A;  3DM0 A;  1TQG A;  1NV3 A;  1VOM A;  2OWZ A;  2ZZX A;  4ZEC A;  2ZXO A;  3U9J A;  2P0N A;  3RPW A;  2X51 A;  3RH3 A;  4B6I A;  3NYJ A;  3H6U A;  4F2O A;  2KJG A;  2ZD9 A;  2ONK E;  1D1A A;  3CEX A;  5JLI A;  5L3Q A;  1KA1 A;  3PUY E;  2XL6 A;  4O6N A;  4FIM A;  2QS2 A;  3V5Z A;  2PMS A;  2VPN A;  2DSF A;  1LE4 A;  1NFO A;  1U89 A;  3RY3 A;  3C35 A;  2DWJ A;  2DE2 A;  4XFE A;  3EKI A;  1C02 A;  1SYQ A;  3U9M A;  2C03 A;  3SZR A;  4ULV A;  3IEE A;  2X7Q A;  2CGE A;  1T5O A;  4G7O F;  5EYG A;  1MH4 A;  3ZSF A;  1ELJ A;  1OKK A;  1ZVZ A;  4GLI A;  1LST A;  3C8G A;  5GPG B;  2VHA A;  2XL8 A;  2ICW G;  3R26 A;  1OQH A;  2Y7I A;  4LZ8 A;  1QZX A;  4R6H A;  4X48 A;  2O7U A;  1T9K A;  4AB6 A;  2LD6 A;  3O2A A;  1Y4C A;  3G3I A;  1HSJ A;  2KQZ A;  4KI0 E;  1Z23 A;  2CZK A;  1SYI A;  2UUI A;  3RQT A;  1DK4 A;  2R02 A;  3SXM A;  3ABM C;  4YT2 A;  4OIP F;  1FTL A;  1PC3 A;  2XX7 A;  2IBF A;  2KLF A;  3U3F A;  2WVN A;  4GXS B;  4MVZ A;  1IIT A;  1FBC A;  1FTK A;  3IL1 B;  4R73 A;  1EH3 A;  3NG1 A;  5CMK A;  3K00 A;  4EQB A;  4H46 A;  2B0J A;  2Q4F A;  3KG2 A;  4G77 A;  4QSC A;  5DVW A;  3OEN A;  2BJI A;  3O6I A;  4OAN A;  4F39 A;  3UMH A;  4BPM A;  3HN0 A;  1OVT A;  3AXF A;  1FJ6 A;  1USY E;  1YZ0 A;  4XEV A;  5DVI A;  4YT5 A;  4I44 A;  4ZLC A;  1LAG E;  3HO7 A;  1GVC A;  1FNT c;  4ZED A;  1IME A;  1A8F A;  3JYR A;  2NWJ A;  3ISP A;  3OO7 A;  1ORY A;  1BR4 A;  5KYY B;  1QJM A;  5EHM A;  2ONR A;  1OR2 A;  2Q2C A;  3B6T A;  1IXG A;  3SP1 A;  1ZHX A;  2R7V A;  1IMF A;  1SDX A;  2ZPA A;  3C31 A;  2PYY A;  3MVX A;  1MH3 A;  5HBC A;  2YHS A;  3M3L A;  2QNL A;  4HCW A;  1Q0K A;  1EZO A;  4IAR A;  1N3X A;  1DPE A;  2OWS A;  3M8U A;  4BDQ A;  2VAS A;  3FUZ A;  4WGY A;  3NDB B;  4PJN A;  4CS8 A;  3T6J A;  1A40 A;  3ITF A;  3KH2 A;  4DXW A;  4LP2 B;  2B0H A;  4U1Z A;  2XLE A;  1MS7 A;  3LUZ A;  1NSG B;  4NF4 A;  3RTF B;  2I0B A;  5TU0 A;  4LON B;  3TUL A;  3H65 A;  3JTL O;  1Q9D A;  4OWD A;  3RLF E;  1S05 A;  5IKB A;  2V3T A;  1B40 A;  4IO4 A;  4G7Z F;  1IQ7 A;  4OZ9 A;  5A6J A;  2Y84 A;  1QGX A;  3DI5 A;  1JQF A;  1S7Y A;  4PFW A;  2J9V A;  2AWC A;  3KMI A;  4JZA A;  1Y3Q A;  1E85 A;  4DE8 A;  1WGW A;  1GGQ A;  3AG2 C;  4CIP A;  4EQ9 A;  3FV1 A;  1UG7 A;  5H8Q B;  3LSX A;  5A6B D;  4HE2 A;  4IGR A;  3OEM A;  4ZZA A;  3TMG A;  4OD4 A;  1FPD A;  2WL8 A;  2ZZV A;  1FTO A;  1LBV A;  4HFF B;  1B3L A;  3CG1 A;  1XOC A;  4GQO A;  3PPR A;  5B3S C;  3SEX A;  4ESX A;  1TWC A;  3N5L A;  1SW2 A;  1NKX A;  4JKV A;  4GWZ A;  2GHA A;  1QVX A;  2QS3 A;  5AE4 A;  3TEP A;  4HE1 A;  4N6H A;  1RKC A;  4YB7 A;  3QAX A;  3EHN A;  2XLH A;  3LJB A;  1OCR C;  5IM2 A;  4EDP A;  1Z63 A;  1NV4 A;  1QUK A;  4NTL A;  5KYU A;  2OX3 A;  3K1N A;  1B7Z A;  3PUV E;  1HMD A;  4MVU A;  3IJX B;  4OVR A;  1B4H A;  5A69 A;  1Z6A A;  4U4X A;  2XXV A;  3N6U A;  3JCU Q;  5JVE A;  5KYX A;  2VT5 A;  3W9W A;  4GWS A;  4JVD A;  1QQ3 A;  4U5H A;  3E79 A;  3U8P A;  5I2N B;  3GXA A;  3V5A A;  4GYT A;  4XLN F;  3T9V A;  5DS5 A;  3KFM A;  2MKZ A;  2VPO A;  1LKX A;  2LCH A;  3KC1 A;  4O79 A;  4CSA C;  1EYK A;  2PVU A;  2DB4 A;  2OBG A;  5CMB A;  1FPI A;  3OMB A;  3A09 A;  4H65 A;  1ZW3 A;  2YLI A;  3EH2 A;  4P9T A;  2HPG A;  3PU5 A;  4G61 A;  1LCT A;  5JP7 A;  1K04 A;  1OQG A;  2A5T B;  3IOU A;  1RDZ A;  2R6G E;  2FBP A;  1MDQ A;  2OJT A;  2VD2 A;  2L6G A;  2DP8 A;  4BDM A;  2AVK A;  4YWQ A;  3KSJ A;  3V5X A;  1K40 A;  3IR1 A;  1V55 C;  5I2K A;  1MMA A;  2DWH A;  3BIG A;  4A4A A;  1QSP A;  3POV A;  2FYI A;  1UQW A;  2CDQ A;  4N91 A;  4MAG A;  1S7Z A;  3THI A;  2DI3 A;  4OVS A;  2FIX A;  1B05 A;  1TFO B;  1WOL A;  2P7V A;  5JUA A;  3DWW A;  5ICQ A;  3RYL A;  2PX0 A;  3S9L C;  3IFC A;  2OQM A;  3TCF A;  3IJO B;  5F28 E;  4RDA A;  1Q35 A;  4IO7 A;  2XXA A;  2W4M A;  1SW1 A;  3FHD A;  4QI2 A;  3S84 A;  4BDN A;  2EIJ C;  4ELO A;  4OEV A;  1JMW A;  3JRM O;  1M57 C;  1RYO A;  3L6H A;  4JC7 A;  4F31 B;  4R32 A;  5F5F A;  3T66 A;  4XPW A;  1PBQ A;  3QMF A;  2XS8 A;  3HPI A;  4PF8 A;  1NH8 A;  4XKQ A;  2XX9 A;  5TP9 A;  4DOZ A;  4FED A;  5CBR A;  3EGX A;  1YYX A;  1URG A;  3H6V A;  2PBE A;  4GBV A;  4NF5 A;  1LS4 A;  4MW3 A;  2CYD A;  4WGZ A;  3SNH A;  1V74 B;  4NF6 B;  4OYV A;  1GS9 A;  1A0B A;  5L0G A;  1N84 A;  4N06 A;  4THI A;  4X1D A;  4AS4 A;  5H8S A;  5B3I A;  2OZZ A;  5B1B C;  5AA4 B;  2IOQ A;  4FX5 A;  1Y6D A;  4CJO A;  2P1A A;  1DCU A;  1MPD A;  1UTH B;  4C1T A;  3V89 B;  3FVG A;  2I49 A;  3H6W A;  4XTK A;  3RPL B;  1M5C A;  4J30 B;  1TFK B;  3MJN A;  3UR3 C;  2XX8 A;  3L1M A;  4K0D A;  4YK5 A;  4H5F A;  1MXW A;  4BEM J;  4O3B A;  2QSX A;  3I3V A;  4GF8 A;  5IGA A;  3K6X A;  5IZZ A;  4H67 A;  3C63 A;  4P6I C;  2H5Y A;  4KFQ A;  4OER A;  1M2V A;  4NMY A;  2NOO A;  5BWJ A;  4KI2 A;  4LZ5 A;  1MPB A;  1R5I D;  4DXB A;  1OXB A;  1MQV A;  4DJ9 A;  4JVI A;  3AQC A;  3O6H A;  1T6Q A;  1GR2 A;  3MP6 A;  1XHY A;  2HV7 A;  1LBZ A;  2RC8 A;  2YL0 A;  4OTE A;  5ITO A;  2EPN A;  3LEO A;  1APC A;  3ZC4 A;  2Q88 A;  1NNT A;  3S0X A;  3CFL A;  2ABH A;  4C3B A;  4JVS A;  4ONY A;  4KCC A;  1LCF A;  3TQO A;  2F8D A;  1O63 A;  4K1O A;  1JNF A;  1ZHY A;  3KC0 A;  5BUU A;  4JSO A;  2Q9B A;  2Q00 A;  3I4U A;  4CBE A;  4OVT A;  3PUX E;  2EPM X;  2ANJ A;  3VVF A;  1HE9 A;  3V5Y A;  3TPA A;  3C18 A;  5I3S A;  2Y3G A;  4YMB A;  1H43 A;  1H45 A;  4KCD A;  1NFN A;  3AGU A;  3VDF A;  2YLG A;  3FD3 A;  4GIZ A;  3WHN A;  1LBW A;  2H7V C;  3DJU B;  3M4B A;  4UA8 A;  4RD9 A;  3G7W A;  2P6V A;  3G3F A;  5J16 A;  2I3V A;  3R7C A;  2GHB A;  5BUO A;  2HAV A;  1NU7 D;  4JB7 A;  3PMV A;  2GAQ A;  4BJ1 A;  3LSF B;  4K3F A;  3EZI A;  3U8Q A;  3K7D A;  3TK0 A;  2PBW A;  3H2V A;  4AS5 A;  1MMD A;  2IYL D;  2KNH A;  3LAY A;  1UIU A;  2Y5K A;  2EIN C;  3OO9 A;  1T01 A;  5DT6 A;  1B1H A;  4KBL A;  3UOR A;  4X9T A;  2XXK A;  1NNF A;  2HKV A;  3QIM A;  1NZE A;  1AWB A;  4G78 A;  3LSL A;  5LOM A;  1SF8 A;  2UVH A;  3KGC A;  4KC9 A;  3IOR A;  3CSG A;  4DRJ B;  4R72 A;  3QK6 A;  3B9Q A;  1VSO A;  4G8H A;  3ZQV A;  4ZE8 A;  5BQI A;  5AA2 A;  2F78 A;  2CEX A;  4F3G A;  3KOT A;  1FMW A;  1B0L A;  1CPQ A;  2P3V A;  3T1B A;  4DIG A;  3K6U A;  1B1X A;  3DP6 A;  1B0H A;  1JW4 A;  1NL5 A;  1H7I A;  3VF0 A;  4MVQ A;  4PFP A;  5I5P A;  5L0F A;  3QW1 A;  3DEL B;  3K1P A;  1BP5 A;  3UGO A;  3O97 A;  2RCB A;  3ABL C;  3TD7 A;  3IFA A;  3Q29 A;  1LVK A;  5DVJ A;  2DXY A;  4UAC A;  4XXU A;  2D4U A;  4JTA B;  4MTO A;  2J7P D;  1NV2 A;  3H03 A;  1LIH A;  4R2F A;  5JRA A;  4GD5 A;  2WB7 A;  3C8Z A;  4XKP A;  4MNI A;  3KJ7 A;  2XLV A;  2ZYN A;  3UMK A;  1BR2 A;  4F3S A;  2QE9 A;  4XWJ A;  3GYY A;  3J06 A;  2HSB A;  2W4B A;  4AE4 B;  2WYK A;  5JT4 A;  1NV7 A;  3WOD F;  4C3E A;  4MVR A;  1F1M A;  2RKM A;  2ZZW A;  2J9W A;  2OU6 A;  3RIP A;  1D1C A;  1B3E A;  4DVZ A;  2B4L A;  1MXX A;  3IB1 A;  4IY5 A;  1R4T A;  2X7P A;  1RDX A;  1L7C A;  1CGO A;  4U5B E;  4IRU A;  2YQY A;  4YT4 A;  4E7S A;  3K33 A;  5COF A;  4P1E A;  2L7A A;  1FPE A;  3Q6N A;  4NTB A;  4NF4 B;  3E9V A;  4IJJ A;  1IZ1 A;  3NMI A;  1MND A;  2Q8J A;  2P3N A;  1POT A;  3PD8 A;  2OWT A;  1VK5 A;  3T9O A;  1P99 A;  1IMB A;  3H4Z A;  1Z7M E;  4I1O B;  1A7L A;  3IQC A;  3FXR A;  2NVU B;  2QMW A;  1MPC A;  3SER A;  3KZG A;  3T9X B;  3AJM A;  2EIL C;  4NF8 A;  3IO4 A;  4ELR A;  3OWT A;  3K1I C;  1QUL A;  2XXI A;  4OFO A;  4N07 A;  4J7Y A;  4N6D A;  3LLK A;  3M1C B;  4F4B A;  1DOV A;  3VE1 B;  3TJ5 A;  4RXL A;  1AEP A;  2M64 A;  1US4 A;  4O3A A;  5H8H A;  5FBP A;  5IAI A;  3MP1 A;  1JEV A;  1XI6 A;  4IO6 A;  2R71 A;  4RPN A;  1B4Z A;  2HJM A;  3A11 A;  4I62 A;  4XEK A;  2O68 A;  4P0I A;  5I57 A;  3QVY A;  2LQG A;  4OVJ A;  3FJ7 A;  1EQ1 A;  1OW7 A;  1USY H;  1RJ9 A;  4JJF A;  4BG0 A;  5I58 A;  1OLC A;  2MWQ A;  2JPU A;  4U9D A;  1MY0 A;  5JS5 A;  4XPX A;  5A6K A;  2CZL A;  4GEH A;  4LLE A;  4I9D A;  5KYU B;  3B0V C;  1A8E A;  2ZYK A;  1C17 M;  2I6E A;  2DE4 A;  4U2R A;  4YAH X;  4OMB A;  3E4R A;  1SD3 A;  3RVZ A;  1AMF A;  4ZE9 A;  3H6T A;  4H1X A;  5KYX B;  1OMP A;  3KYJ A;  2PF4 E;  5H8N A;  1O3U A;  3NYL A;  1OQC A;  2I4B A;  4HCY A;  4IB4 A;  1MXV A;  4IB2 A;  1M5B A;  3GEI A;  4G7H F;  4DRH B;  1PD0 A;  3VVE A;  1FBF A;  4BJT A;  3FAJ A;  3IQ6 A;  3B0U X;  2GDC A;  1EZ9 A;  2PFZ A;  3RQE A;  3HCQ A;  1YJG A;  2AIX A;  3VXC A;  3DE8 A;  3M3K A;  4PE3 A;  4GL8 A;  4PC9 A;  4H8J A;  1BDJ B;  4P3L A;  5I2K B;  3VVD A;  3A3C A;  4KYS A;  3WAF A;  1O5H A;  1DOW A;  3OO8 A;  2Y7K A;  2FGY A;  3AGT A;  2F6P A;  1IXH A;  5CBS A;  1YVI A;  4R75 A;  3EQL F;  1FQE A;  3IQ5 A;  2F6G A;  3DAG A;  4R6K A;  3ZSU A;  2YRF A;  4F3P A;  2NPU A;  1SZI A;  4RYA A;  2F7B A;  1G4U S;  5AA3 A;  2F3D A;  2W9Y A;  3GLB A;  3E13 X;  2DVZ A;  3BKI B;  1D0Z A;  2XXA B;  3LES A;  1J8M F;  2FNC A;  1OCC C;  1P1O A;  2UUH A;  3TTK A;  1KWH A;  2H7B A;  4HE0 A;  4I1D A;  3R7X A;  3M79 A;  5TP9 B;  2I15 A;  2L6F A;  2VOZ A;  5ET6 A;  3EGX B;  4ER9 A;  4O7M A;  3QYT A;  1EI7 A;  5BQH A;  1VDW A;  3RT8 A;  3HKK A;  1OKK D;  4HW8 A;  4PFY A;  4OFJ A;  4NF5 B;  2XXU A;  3FVO A;  4PE5 B;  4BDL A;  3T0J A;  2I3W A;  2A6E F;  3T6G B;  4U5C E;  3EG9 A;  1ST6 A;  4NE4 A;  4FOR A;  4R74 A;  1N0T A;  3WAE A;  5EQ7 A;  3EHT A;  2XXP A;  4I3E A;  3FMS A;  3HST A;  1CPR A;  1DPP A;  4OET A;  2LIG A;  2J9B A;  3TZA A;  3AOU A;  2KW3 C;  1LFG A;  4ELP A;  1TWA A;  5CM6 A;  3EF7 A;  5EYH A;  4DLD A;  4LQ2 A;  1G4W R;  1CB6 A;  3A9C A;  1GGG A;  3H06 B;  3KBR A;  4CS9 C;  1B9J A;  4OIR F;  3GM2 A;  2Y3H A;  5ELV A;  4PFI A;  5A6A A;  2QMX A;  3G3H A;  3MQ9 A;  5H8F A;  3FVK A;  4ZEI A;  3OA1 A;  5CRY A;  3FBP A;  4NED A;  1IIW A;  3N26 A;  4ZDM A;  3R6U A;  4G0H A;  1M2V B;  3CI8 A;  2QVV A;  1ZU0 A;  3FDQ A;  3OOA A;  2OCC C;  1I5N A;  3K66 A;  4ONS A;  2XLM A;  3H3G A;  4P9F A;  4XKN A;  4C7O A;  2WZL A;  4MBP A;  2THI A;  3OO6 A;  5COG A;  3K0V A;  3LSW A;  4F29 A;  3O29 A;  1HW2 A;  2RF1 A;  2RC9 A;  1B51 A;  3EJN A;  4YIC A;  1NNP A;  1GV8 A;  2XD2 A;  2XWO A;  1ZLQ A;  2NUT A;  2AWY A;  4QRZ A;  3QTH A;  2QL3 A;  3T6B A;  4PDH A;  2OCU A;  3BFT A;  1M5D A;  5L0I A;  2XWV A;  3SEV A;  2WBD A;  1N7X A;  2HSQ A;  2R03 A;  2XXW A;  3FVY A;  1MXU A;  1D0Y A;  1PDA A;  3B0P A;  3LC8 A;  4ZEK A;  5AC4 A;  2YKZ A;  3DXJ F;  1Z5Z A;  5COM A;  5L0D A;  2A6H F;  5CMC A;  4PQJ A;  1ZKB A;  2KC3 A;  4I8C A;  4OQO A;  2KGO A;  2B65 A;  1E2X A;  1N1C A;  3MWB A;  3FVN A;  2PFD A;  4QXD A;  5FTH A;  4N13 A;  3LNM B;  1IEJ A;  1GM5 A;  4EKW A;  1PV3 A;  3Q6M A;  5EGY A;  2FA7 A;  1OXK A;  3RGY A;  1TWY A;  3UIF A;  2F34 A;  2GFE A;  2W45 A;  4XKR A;  5L0J A;  4KYE A;  3PUW E;  1V54 C;  1MY1 A;  3MW0 A;  4J32 B;  4OXV A;  1NV6 A;  3DD7 A;  1FQB A;  4YKJ A;  1NU9 C;  1QW0 A;  3B6Q A;  1QKR A;  1E83 A;  4M4G A;  3RT6 B;  1FQF A;  3B6W A;  3RQF A;  1ZMG A;  1CE2 A;  3KL4 A;  3K6V A;  3U2M A;  1SR2 A;  1AL3 A;  2XLD A;  1FPL A;  3OEK A;  3M15 A;  4MNP A;  1A55 A;  4YKP A;  2Y5L A;  5AA2 B;  3H2U A;  1TFA A;  1XVX A;  4KYD A;  1GQA A;  4X04 A;  5L9M A;  5F5H A;  1NV5 A;  4C1U A;  4MJO A;  1N3W A;  4BJ6 C;  3PPO A;  1FPJ A;  2M4E A;  4OVP A;  1YZC A;  2KR0 A;  2O7I A;  3OSQ A;  1Q1K A;  4MNC A;  3Q25 A;  3S27 A;  4WJ0 A;  4JRZ A;  4O6M A;  4XLP F;  1MQH A;  2DDK A;  3EHM A;  3PGF A;  2A0B A;  3GOR A;  4BJ5 C;  1FPG A;  2PT2 A;  4I1M A;  5EQ9 A;  3CVG A;  1MQI A;  2J45 A;  3MZ1 A;  3O6G A;  2R7O A;  4EHP A;  1PB8 A;  3EGD A;  5AA1 A;  4XEQ A;  1MM7 A;  1ATG A;  1WDN A;  1B6H A;  4P11 A;  2GWW A;  1G5Z A;  3OXN A;  4GX6 A;  1OCZ C;  1Q0F A;  1UIV A;  5F24 A;  3NYM A;  2DXR A;  3HTK C;  4LA9 A;  1B46 A;  2JJK A;  3N0T A;  4K7B A;  3KJT A;  4N17 A;  1PBP A;  2YL1 A;  2BJJ X;  4XIG Q;  5L0H A;  2HFB A;  3ZKK A;  1AIV A;  4QI0 A;  2OOC A;  1XS5 A;  4IO2 A;  1JR8 A;  2O84 X;  5JSL A;  3MVW A;  1IMA A;  2IEE A;  2A1D D;  1BKA A;  4QF9 A;  4QFN A;  1H6G A;  1SI1 A;  2QRY A;  3O39 A;  2EPL X;  4NCQ A;  3ZQY A;  1S9T A;  4RK2 A;  4GWX A;  1M6T A;  2NSG A;  3U92 A;  5AC5 A;  2JD3 A;  4F2Q A;  5DLJ A;  3S9N C;  2QUP A;  4R9G A;  3TTR A;  1JRA A;  1AUE A;  3VXB A;  5I56 A;  1QKB A;  1H9T A;  3LS0 A;  1A7E A;  1OCO C;  1LB9 A;  3VRC A;  4MND A;  2FHY A;  4HFK B;  4NF8 B;  1C03 A;  2BL2 A;  4MVO A;  2WZG A;  2UVJ A;  1SI0 A;  2DYX A;  1DBZ A;  2VH3 A;  2EPK X;  1TWG A;  2AYS A;  3D4C A;  2F7A A;  1RMV A;  5ISU A;  2Q9T A;  3AG4 C;  1HSE A;  2RSE B;  5H8H B;  1NLX A;  3RKO F;  1PB7 A;  1EZP A;  1MQD A;  4QFP A;  3CSK A;  3CR9 A;  2HAU A;  4Q30 B;  4LAC B;  2CZH A;  2R7W A;  2XWI A;  1JET A;  3BIH A;  5I57 B;  4KD5 A;  3TQW A;  2QS4 A;  3EFO A;  2ESN A;  3VLU A;  1NBB A;  4YMA A;  1RJ9 B;  5I58 B;  1O87 A;  3H7M A;  3CIJ A;  2R7Q A;  5CI5 A;  3ABK C;  5EQA A;  1DTG A;  3BFU A;  3MVZ A;  1ZU4 A;  4KNW A;  5D91 A;  4LVQ A;  4U4S A;  3TOL A;  3IOV A;  1IW7 F;  5K2X A;  3G3G A;  3VYW A;  2MYS A;  1M5E A;  1A7D A;  1PB9 A;  1Z3I X;  1RKE A;  1FBP A;  4PGN A;  4QHQ A;  1I6B A;  5H8N B;  2O69 A;  4RA1 A;  3SXY A;  1MMG A;  1LBX A;  4NTF A;  2LAO A;  1MMN A;  3NRH A;  4GRK A;  3EHS A;  4IWB A;  1NG1 A;  2XL4 A;  1TT1 A;  3PTY A;  2WVQ A;  2B4M A;  4NG7 A;  5FHN A;  3PMX A;  4IR8 A;  1ZJL A;  3QSL A;  3TTM A;  2H25 A;  1POY 1;  2CNW A;  4FJP A;  3PPQ A;  1FJ9 A;  1FPB A;  1MY4 A;  1L5T A;  4AX2 A;  5JTY A;  2VB6 A;  4IO5 A;  1E84 A;  5DYH A;  3D4G A;  4NGU A;  4D4X A;  1LPE A;  4FBP A;  2DWA A;  3A3U A;  2UYE A;  5CI9 A;  4AK9 A;  4CSA A;  2Y39 A;  1WVJ A;  4WXJ A;  3S28 A;  1FR0 A;  3D1R A;  2ZXR A;  4DVY P;  3SXK A;  3LR1 A;  2PX3 A;  1SW5 A;  1P1U A;  2WX9 A;  3MFN A;  5E33 A;  1B32 A;  2QPQ A;  4POW A;  1Y20 A;  3HHG A;  3UNG C;  3Q26 A;  2QY9 A;  3U3B A;  4N8Y A;  3M4C A;  3UP9 A;  1FTJ A;  3I5P A;  3U65 A;  2TMV P;  4G8M A;  4RNS A;  3Q28 A;  2AP3 A;  5A5X A;  3VV5 A;  4PAC A;  4YL3 A;  2YPN A;  5JK4 A;  3BBR A;  2H99 A;  1FTM A;  4JJG A;  3N94 A;  4Z0I A;  4YKI A;  3K1H A;  3IX1 A;  1QLE C;  1Q0D A;  4EUK B;  3OEL A;  3C8G B;  1VMA A;  4PGP A;  5DEX A;  3UA8 A;  1ZHT A;  1B5J A;  1FCK A;  1A41 A;  2GA0 A;  3C32 A;  2F97 A;  2L6H A;  4OA4 A;  4RBN A;  4AL0 A;  2XXR A;  2XWK A;  2R7T A;  4DCX A;  3V8X B;  2D3I A;  3EG9 B;  1D9Q A;  3O10 A;  3I6V A;  3E9X A;  3HNJ A;  4N15 A;  1R1N A;  4MHF A;  2KYH A;  3LUY A;  3C62 A;  1S50 A;  5DTB A;  4PP0 A;  4LN5 A;  2O1L A;  3TAJ A;  3OD7 A;  4X0R A;  3G4Z A;  1H44 A;  1TXF A;  2B3F A;  2Q3T A;  1B52 A;  2D21 A;  1I69 A;  5T1D B;  4GWO A;  5AA2 D;  4NY3 A;  3KKB A;  5IY5 C;  3VFJ A;  1MY2 A;  2ALU A;  1LFH A;  2F7C A;  4MQ9 F;  3SXZ A;  1BR1 A;  5IZ1 A;  3G3K A;  2XM4 A;  5LDZ A;  3SEO A;  4YB5 A;  2QVR A;  3T4R A;  5H8F B;  4JEA A;  2B3B A;  3MX3 A;  3O9P A;  4PFO A;  4QDL A;  1ZHZ A;  3AG1 C;  2Q9C A;  1FRP A;  2CMO A;  3EQ1 A;  4GX3 A;  4NN3 A;  2VGQ A;  2J7P A;  2J9U A;  3HNI A;  1CGM E;  4MTG A;  1HSL A;  1R9Q A;  4YT8 A;  4JUR I;  4LZ7 A;  4C7O B;  4KPT A;  1ANF A;  1WTY A;  3RUM A;  1TR2 A;  2FAP B;  3DMD A;  2UVI A;  2HFI A;  2FIE A;  3ZVR A;  2G29 A;  4DBQ A;  2V3U A;  3PPP A;  5F1Q A;  4EIY A;  2XA5 A;  4LUB A;  4KNV A;  2OEX A;  4U5E E;  4MFI A;  2NUT B;  4DCY A;  4MLQ A;  4U1O A;  2XRH A;  3S9E A;  5IZ3 A;  5B70 A;  2OG2 A;  2G93 A;  4OVQ A;  4UDV A;  1D4N A;  2NUV A;  1B3F A;  5B7D A;  4ZEB A;  3FAP B;  2IXM A;  5FHO A;  3UMI A;  3E70 C;  1NV0 A;  4DBR A;  3Q27 A;  2YVK A;  2O1M A;  3KBZ A;  2W7Y A;  3GOD A;  3PMW A;  1VFE A;  2WEF A;  2DS9 A;  2E87 A;  1RKM A;  3I5Q A;  2OJQ A;  1LBC A;  4U5D E;  3SET A;  1SQY A;  3EH1 A;  2P2A A;  1M2O A;  2I4C A;  4F1U A;  1MXY A;  4NX1 A;  3TCH A;  5TPA A;  2IXO A;  3C34 A;  2Q7R A;  1FQD A;  3FAS A;  5A5L A;  2R9J A;  2XHD A;  4R9F A;  2QLA A;  1O64 A;  4CS7 A;  4QFO A;  5I84 A;  3GM1 A;  1KTM A;  5CC2 A;  1SBP A;  2Z8D A;  3GAN A;  4CDA A;  1B7H A;  2DQV A;  1YA7 O;  1EYJ A;  1XVY A;  3B8B A;  4M63 A;  1A54 A;  2VCC A;  3V7O A;  5T3W A;  4FES A;  4H45 A;  2AU5 A;  4N8G A;  4PBH A;  1LAH E;  1K9Y A;  2G3V A;  3K4U A;  1NUX A;  2L81 A;  3W2V A;  3SZP A;  2LFF A;  4N81 A;  1B2H A;  4O3C A;  2L9J A;  3RNN A;  3BEH A;  2D5W A;  3Q7G A;  4E7Z A;  3MAM A;  4MX6 A;  3ONM A;  3FXU A;  4MF3 A;  3MZB A;  4ELQ A;  1FBD A;  3TEL A;  2EIM C;  5KZT A;  3NKD A;  2R25 A;  2QJE A;  2H7O A;  4H4K C;  1R6Z A;  1URS A;  4G8N A;  5J1D A;  3MP8 A;  2V3C C;  4U5G A;  1T6U A;  4H54 A;  5K0I A;  4PTK A;  1VB5 A;  3FJG A;  3IPM O;  2NUP A;  2UYF A;  3O55 A;  3U5S A;  5DS4 A;  1II5 A;  3E78 A;  1HW1 A;  3FXH A;  3RYD A;  4DXU A;  2HUJ A;  1JP4 A;  2ASR A;  3EGD B;  3JV9 A;  4ISU A;  4QBA A;  4ZS9 A;  5AGF A;  4CDY A;  4BEJ A;  4YJW A;  1JPN A;  3MYU A;  2DWI A;  1QVS A;  3T9H B;  4CS8 C;  3T96 B;  1MQJ A;  3HJC A;  1FPF A;  1O7T A;  3CHG A;  3DP8 A;  1FBH A;  1YPN A;  1OW8 A;  1JW5 A;  5FCL A;  2REG A;  4P1L A;  3U8V A;  1MRP A;  3IQT A;  3JZJ A;  3ZWI A;  3K6B A;  3QUF A;  3KPH A;  4OEN A;  4EUO A;  3TKD A;  1P1W A;  1DOT A;  2IXP A;  1IXC A;  4HEA J;  3P7I A;  4CJG A;  3DAF A;  1LI7 A;  1FBE A;  1UTB A;  3IOW A;  2IM8 A;  4FWV A;  2V93 A;  4Q0C A;  3LLI A;  3KOS A;  4CDV A;  2D5R B;  5B1A C;  1FBG A;  1MDP 1;  2A68 F;  1B68 A;  1RYX A;  3ASO C;  1OVB A;  1TFD A;  2HCA A;  2X26 A;  4ND9 A;  4JVC A;  1FTS A;  2ZNU A;  5I56 B;  2PX1 A;  4ZEF A;  1MY3 A;  3GBB A;  3W15 C;  3G4X A;  1WN0 A;  5FHM A;  3CZ6 A;  4MLV A;  4POX A;  1NUY A;  1LS1 A;  3HFU A;  4LLC A;  2NSF A;  3MPL A;  1OLA A;  4U23 A;  3S9O A;  4JEB A;  2R9R B;  4G68 A;  5EYF A;  4I3Y A;  2LFD A;  1EKY A;  5KYW A;  4PFR A;  3UN6 A;  1XT8 A;  4EBJ A;  4QFL A;  4E0W A;  3C8G D;  4F22 A;  4O7I A;  3ROJ A;  4F18 A;  1MQG A;  2GFH A;  2H4I A;  2RCA A;  1KZ8 A;  3RFY A;  3CFX A;  3JYY A;  3FZV A;  1JEU A;  3TTN A;  3JYH A;  1NFT A;  2VP1 A;  4E0I A;  4XQ1 A;  2EIK C;  1Y9U A;  4JWX A;  1R9L A;  1LI5 A;  3K1I A;  1F9B A;  1VYK A;  3EFO B;  4KHZ E;  2Z8E A;  4R6Y A;  4TLM B;  5FTI A;  3KN3 A;  3VLW A;  2UXA A;  3SEY A;  1EU8 A;  2YZS A;  1MG1 A;  1Q0M A;  4O94 A;  3RTW B;  2A0U A;  4FEC A;  3QMK A;  5ESY A;  2H9B A;  1MXZ A;  4JW1 A;  4WAB A;  1YYZ A;  3DZA A;  3M3F A;  2P61 A;  1RKE B;  1BZ4 A;  4TOZ A;  3MVY A;  1JW1 A;  1ZBM A;  4W8K A;  3GBA A;  1D0X A;  4G2Z A;  1BK4 A;  4P47 A;  4JWY A;  4EXL A;  1ZHW A;  3TDJ A;  4OIO F;  1XZP A;  3U72 A;  3QVZ A;  4DXC A;  2V4C A;  3IB2 A;  1IMC A;  3GEH A;  3U1O A;  4P8B A;  2Z23 A;  3KSX A;  3U93 A;  4TLL B;  4Q7C A;  3FIR A;  4JTC B;  1GTK A;  3ODB A;  4XTC Q;  2Z8F A;  1VE4 A;  3ECR A;  4GWU A;  4R2B A;  1J8Y F;  5KCJ A;  2LK4 A;  5JTY B;  4AB5 A;  4XEF A;  2I48 A;  2ZMB A;  5I59 A;  4AE4 A;  1NUW A;  3K2D A;  2OJE D;  2DGJ A;  1FMV A;  2DE3 A;  4H0W A;  4XF5 A;  2KQ9 A;  2HMZ A;  3VAY A;  2F5X A;  1LLS A;  4RK9 A;  1YA9 A;  3FXQ A;  2F22 A;  3HNL A;  3O6X A;  3SEW A;  4U5F E;  2Q74 A;  1N04 A;  4I40 A;  5I7I A;  3S4U A;  3S90 A;  4OD5 A;  1A99 A;  3ECS A;  1IMD A;  2F36 A;  2P1S A;  3ILU B;  3DM9 B;  4NF0 A;  1VLT A;  4HS7 A;  4KR5 A;  2F35 A;  3L34 A;  3DJN B;  1D1B A;  5A5X B;  4Q4Z F;  4IGG A;  1I4Z A;  5E3C A;  3ZTZ A;  4EWC A;  3RVY A;  5D92 A;  2Q89 A;  3W4Y A;  3HV1 A;  1Q0G A;  4C3D A;  4OHN A;  1KU2 A;  1VR5 A;  4ECF A;  1NMU A;  2OKU A;  3SDF A;  1LAX A;  2Q8M A;  4DDD A;  2I0C A;  5A6B A;  4JTD B;  3F47 A;  5DEX B;  1M5F A;  3I5O A;  4PR9 A;  1AH5 A;  2ZXW C;  3A29 A;  2PCR A;  4KXP A;  3JSZ A;  2VD3 A;  2Y7R A;  2CCY A;  2YWA A;  2R7S A;  4NTA A;  4H6D A;  4BLA A;  1LAF E;  1YDI A;  2FVZ A;  1L3P A;  3UGP A;  4MVS A;  1N76 A;  3TQL A;  2HHM A;  3TJ6 A;  1B5H A;  3B29 A;  2YLN A;  4EBK A;  2MHR A;  2KSF A;  3LUT B;  1BBH A;  2J0W A;  2R7X A;  5KDT A;  1I6Q A;  3TYH A;  2XS1 A;  1H9G A;  4XPY A;  4O8M A;  4AQ4 A;  2WYP A;  1ZW2 A;  1UFB A;  2ETS A;  3GEE A;  2NXO A;  4X8R A;  3S2V A;  2NG1 A;  3EN3 A;  2BE5 F;  2WZF A;  1LGB C;  5KYN A;  1Z7Q c;  3L8J A;  4RJZ A;  1LFI A;  5FZT A;  4D4N A;  2CEY A;  1YTV A;  4NHB A;  2QS1 A;  4OEU A;  1IXI A;  2GQ1 A;  2WVO A;  4PK4 A;  2PP4 A;  3E3K A;  2P0S A;  3FGS A;  3O66 A;  4C0R A;  3IOT A;  2Y69 C;  5ET7 A;  1WAS A;  1K05 A;  3NMJ A;  4MW8 A;  1Y1M A;  3SES A;  3CFZ A;  1I6A A;  4YN0 B;  4OFL A;  4CS9 A;  5DS6 A;  3B50 A;  3HNK A;  2V84 A;  4H5G A;  2YJP A;  1FFH A;  4GOT A;  1M56 C;  1XZQ A;  3AQB A;  3CQZ A;  4N4U A;  1URD A;  1SVX B;  3DE9 A;  2GRV A;  3IK6 B;  2HXW A;  1D9V A;  1OIB A;  5JEI A;  3X1O A;  1NI9 A;  1B3H A;  2R8T A;  1YLM A;  3MZ9 A;  4JIO A;  2H8A A;  3SEU A;  1NV1 A;  3JRT A;  4PJJ A;  2XM0 A;  5L8D A;  4LDR A;  4GX4 A;  5IZ3 B;  2I58 A;  4MH5 A;  2XXH A;  3T9U A;  4ESW A;  3U2L A;  4P9K A;  1B58 A;  3ILT B;  3FAT A;  2ZXP A;  2L5V A;  2E1S A;  4NAP A;  3V83 A;  3BRJ A;  1RXQ A;  3PD9 A;  4PFT A;  3IO6 A;  2KK1 A;  3WAQ A;  5BQG A;  1HMO A;  3MLG A;  4LDQ A;  4PFU A;  1P1Q A;  5K2Y A;  1LM3 B;  5L0C A;  3IAZ A;  4X1B A;  5ITP A;  1RDY A;  2ZXT A;  4Z9I A;  1H3D A;  3IHU A;  3ATP A;  4U22 A;  4QFK A;  3O28 A;  1ZTY A;  5L9O A;  4YL0 A;  5TPA B;  4PDD A;  4YL1 A;  1FPK A;  1YAE A;  3LV0 A;  1A7V A;  3GM3 A;  4JSD A;  3W8H A;  2WKY A;  4N6K A;  3MBP A;  3QXM A;  1PCX A;  5CI8 A;  4JXI A;  4PCD A;  4KQP A;  4MVM A;  1BLF A;  2VCB A;  5M2V A;  2HJ3 A;  4YB6 A;  3FXB A;  1LBB A;  2G62 A;  2HZL A;  2DVC A;  3FOO A;  4DI4 B;  1KA0 A;  4EF1 A;  1ZIU A;  3LBS A;  3PHF 2;  5HM4 B;  2HS5 A;  5DQT A;  3QW0 A;  4EQ7 A;  4ZLD A;  3ASN C;  1QUJ A;  4HXV A;  1ZZP A;  3FOP A;  4JWO A;  4RPO A;  3N6T A;  3W8I A;  1YYJ A;  5E3A A;  4MCO A;  2YL3 A;  4NC3 A;  2LP4 A;  2CZI A;  4PAK A;  4N6C A;  3MBG A;  1U0B B;  3K01 A;  3TTL A;  4Z9H A;  3GWL A;  3LEV A;  1N7W A;  2O51 A;  1QUI A;  2R7U A;  2XXT A;  1VFD A;  3C4M A;  1HE1 A;  2NUP B;  4GBW A;  1BTJ A;  4EF2 A;  3T22 A;  2J46 A;  3ZTM A;  5EQ8 A;  1MNE A;  5EHS A;  4N6P A;  3MYI A;  1SPI A;  2O9X A;  3C33 A;  4BJ6 A;  5T3J A;  4HTG A;  5KYY A;  4IO3 A;  3RN8 A;  3SKP A;  2YLD A;  4QSE A;  1JAF A;  3K6W A;  1BIY A;  1CGN A;  4FAP B;  3ZG1 A;  3N2Z B;  2IXN A;  3KEI A;  3W2W A;  3RF3 A;  4WED A;  4F3B A;  3W9V A;  1SW4 A;  4BJ5 A;  2CNW D;  2QFL A;  4GXA A;  4QSD A;  4AL1 A;  2DYR C;  2GH9 A;  4GWY A;  4F1Y A;  5DQZ A;  5CIV A;  1B3G A;  4ULW A;  3G50 A;  2R05 A;  3EPV A;  2Q2A A;  4ZZE A;  3UK4 A;  1HY5 A;  4CIH A;  1US5 A;  4IAQ A;  4A2N B;  2XSE A;  3PV0 E;  4LQ5 A;  4TQU Q;  1EYI A;  5L3V A;  4BDO A;  1E86 A;  1XC1 A;  3PPN A;  1UTB B;  4OES A;  3QUJ A;  4MMP A;  1KNY A;  3K02 A;  1NNK A;  2O6A A;  3WG7 C;  3PMR A;  3CG3 A;  5LTC A;  4PF6 A;  1ZYR F;  5HSW A;  2OLB A;  1JVY A;  2Q9A A;  1B7U A;  2ONS A;  4L6R A;  1WOD A;  2Z22 A;  3HLZ A;  3AG3 C;  4EBB A;  4PBQ A;  4IGT A;  4YU0 A;  1TKN A;  1P1N A;  3CRB A;  2Y3D A;  3US6 A;  2JX0 A;  3NOH A;  1SYH A;  1FSA A;  2OEV A;  4GWW A;  1OW6 A;  4G68 B;  2C04 A;  5KYW B;  3DLN A;  1MM6 A;  5H8Q A;  4JBZ A;  1Y4T A;  2ZNT A;  4MTF A;  3LNR A;  1QPU A;  4LER A;  4GQH A;  3ZIB A;  2DYS C;  4HE8 D;  4E17 A;  3PCV A;  2WBB A;  4GVO A;  4GFR A;  2AL5 A;  2PNO A;  4JCZ A;  5HV9 A;  1Y3P A;  2UVG A;  5ET5 A;  3B7D A;  3L8I A;  2CW0 F;  2V25 A;  3C7J A;  3CSB A;  2PFY A;  2EPO A;  2OK2 A;  1D9Y A;  1JOG A;  2AL4 A;  3EZH A;  4MS2 A;  1JVX A;  1LE2 A;  3N24 A;  4LAT A;  3X2Q C;  1Y3N A;  2HZK A;  2ZNS A;  3C36 A;  2VCA A;  1QKA A;  2XD3 A;  2BC5 A;  4ANJ A;  1YXI A;  2YL7 A;  3JT1 A;  4P56 A;  1WWP A;  1T6I A;  4MIJ A;  3T93 B;  3VLV A;  2J0X A;  3DKA A;  4Q5S F;  4U21 A;  4FAJ A;  2XXY A;  1CNQ A;  4Q8R A;  5I2N A;  1PEB A;  4FEB A;  4N4W A;  2ZYO A;  4O7G A;  3RW0 A;  5T3T A;  1INP A;  4YZZ A;  4NWC A;  1VTM P;  4GL0 A;  2A5S A;  3ZDL A;  1G0I A;  3U94 A;  4E18 A;  4Z7E A;  3KN8 A;  3MST A;  4PAF A;  2RIN A;  3TFL A;  1J1N A;  4EXK A;  3MYF A;  3ZS6 A;  3HHF A;  2DOJ A;  2A5T A;  2QTV A;  3C9H A;  3R2P A;  3EHU A;  4G4P A;  1RCP A;  3GWN A;  2FFH A;  5KCJ B;  4M1V A;  3RQG A;  3KN7 A;  5F7V A;  2REJ A;  3FJM A;  5I59 B;  3IB0 A;  5DW8 A;  3SYN A;  3NKE A;  5EK0 A;  3OSR A;  2YEV A;  1ORJ A;  2QVU A;  1D3K A;  3LS1 A;  1FW0 A;  4J7T A;  4OIQ F;  2J8W A;  2XLO A;  5ET8 A;  1AOV A;  1U6H A;  1FFT C;  2HXR A;  1V4A A;  4DI3 D;  1T0K A;  4JCH A;  3VM6 A;  2HQ0 A;  4DRI B;  2I8B A;  1I4Y A;  256B A;  1SMY F;  3JZ0 A;  4UAB A;  3TOD A;  2XXX A;  4PAI A;  2E0S A;  3EPE A;  1TWH A;  1XWJ A;  1FTA A;  3OEO A;  2V3Q A;  1K9Z A;  4G68 C;  2ZYM A;  1YZA A;  3F46 A;  4IAO A;  3TCG A;  1G0H A;  2VC9 A;  1FQA A;  4Q5T A;  3ZKL A;  2RD9 A;  3L6G A;  1IZM A;  1DTZ A;  3F11 A;  4U9E A;  1DSN A;  4NWD A;  3NMK A;  2HZ8 A;  2Y3B A;  1NUZ A;  4O6Y A;  1YCJ A;  2RC7 A;  5CMM A;  4FAT A;  4P0G A;  4MEV A;  4Z9J A;  4L17 A;  2H98 A;  4NF6 A;  2Y7P A;  2IA4 A;  4RY1 A;  1DMB A;  2R7R A;  2F3B A;  4I3M A;  5DVF A;  1AVO B;  4JDF A;  4F19 A;  3L0I A;  4FE8 A;  4DZ1 A;  5HPQ A;  1YAU O;  2M8C A;  5KDT B;  5AA4 A;  4JE9 A;  1H76 A; 
#chains in the Genus database with same CATH homology
 3MC2 A;  2HEU A;  3G3J A;  3TUS A;  1UTH A;  1IUD A;  2XXQ A;  3PUZ E;  4F1V A;  1FQC A;  4IY6 A;  3GZG A;  4PET A;  3USD A;  3MUQ A;  5ICT A;  3FV2 A;  3DP4 A;  5L9S A;  3K1M A;  1Z7N E;  4H8I A;  4WEP A;  4YKK A;  2Y7W A;  3UGW A;  4WKM A;  1LB8 A;  4BDR A;  3S9M C;  2PT1 A;  1Y1Z A;  1NH7 A;  4E0X A;  3MPK A;  1B5I A;  3DM0 A;  4ZEC A;  3RPW A;  3H6U A;  4F2O A;  2ONK E;  3PUY E;  4FIM A;  2QS2 A;  2PMS A;  2DSF A;  3RY3 A;  3C35 A;  2DWJ A;  2DE2 A;  2X7Q A;  1MH4 A;  3ZSF A;  1ELJ A;  4GLI A;  1LST A;  2VHA A;  3R26 A;  1OQH A;  2Y7I A;  4LZ8 A;  4R6H A;  4X48 A;  2O7U A;  4AB6 A;  3O2A A;  1Y4C A;  3G3I A;  1HSJ A;  4KI0 E;  1SYI A;  3RQT A;  1FTL A;  1PC3 A;  2XX7 A;  2KLF A;  4GXS B;  1IIT A;  1FTK A;  3IL1 B;  4R73 A;  1EH3 A;  5CMK A;  3K00 A;  4EQB A;  3KG2 A;  4G77 A;  4QSC A;  3OEN A;  3O6I A;  4F39 A;  3HN0 A;  1OVT A;  3AXF A;  1USY E;  5DVI A;  1LAG E;  3HO7 A;  1GVC A;  4ZED A;  1A8F A;  3JYR A;  2NWJ A;  3OO7 A;  1QJM A;  5EHM A;  2ONR A;  2Q2C A;  3B6T A;  1IXG A;  1SDX A;  3C31 A;  2PYY A;  3MVX A;  1MH3 A;  5HBC A;  3M3L A;  4HCW A;  1EZO A;  1N3X A;  1DPE A;  2OWS A;  3M8U A;  4BDQ A;  3FUZ A;  1A40 A;  4LP2 B;  4U1Z A;  1MS7 A;  4NF4 A;  3RTF B;  2I0B A;  5TU0 A;  4LON B;  4OWD A;  3RLF E;  5IKB A;  2V3T A;  1B40 A;  4IO4 A;  1IQ7 A;  4OZ9 A;  2Y84 A;  1JQF A;  1S7Y A;  4PFW A;  1Y3Q A;  4DE8 A;  4EQ9 A;  3FV1 A;  5H8Q B;  3LSX A;  4IGR A;  3OEM A;  4ZZA A;  3TMG A;  1FTO A;  1B3L A;  3CG1 A;  1XOC A;  4GQO A;  3PPR A;  3SEX A;  4ESX A;  3N5L A;  1SW2 A;  1NKX A;  2GHA A;  2QS3 A;  5AE4 A;  3TEP A;  4YB7 A;  3QAX A;  4EDP A;  1QUK A;  4NTL A;  3K1N A;  1B7Z A;  3PUV E;  3IJX B;  1B4H A;  4U4X A;  2XXV A;  3N6U A;  3W9W A;  5I2N B;  3GXA A;  3V5A A;  3T9V A;  3KFM A;  2PVU A;  2OBG A;  5CMB A;  3OMB A;  3A09 A;  4H65 A;  3PU5 A;  1LCT A;  1OQG A;  2A5T B;  3IOU A;  2R6G E;  1MDQ A;  2OJT A;  2VD2 A;  2DP8 A;  4BDM A;  3KSJ A;  3IR1 A;  5I2K A;  2DWH A;  2FYI A;  1UQW A;  3THI A;  1B05 A;  5ICQ A;  3S9L C;  3TCF A;  3IJO B;  4IO7 A;  1Q35 A;  1SW1 A;  4BDN A;  4ELO A;  4OEV A;  1RYO A;  3L6H A;  4F31 B;  3T66 A;  1PBQ A;  3HPI A;  1NH8 A;  4XKQ A;  2XX9 A;  5TP9 A;  4FED A;  5CBR A;  1URG A;  3H6V A;  4NF5 A;  4NF6 B;  4OYV A;  1N84 A;  4THI A;  4X1D A;  5H8S A;  2OZZ A;  5AA4 B;  1MPD A;  1UTH B;  4C1T A;  3V89 B;  3FVG A;  2I49 A;  3H6W A;  1M5C A;  3MJN A;  2XX8 A;  4H5F A;  4O3B A;  1MXW A;  2QSX A;  3I3V A;  4GF8 A;  3K6X A;  4H67 A;  2H5Y A;  4KFQ A;  4OER A;  4NMY A;  2NOO A;  5BWJ A;  4LZ5 A;  1MPB A;  4DXB A;  3O6H A;  1GR2 A;  3MP6 A;  1XHY A;  2RC8 A;  4OTE A;  5ITO A;  2Q88 A;  1NNT A;  3CFL A;  2ABH A;  4ONY A;  4KCC A;  1LCF A;  2F8D A;  1O63 A;  1JNF A;  5BUU A;  4JSO A;  3PUX E;  2ANJ A;  3VVF A;  3TPA A;  4YMB A;  1H43 A;  1H45 A;  4KCD A;  3VDF A;  3FD3 A;  4GIZ A;  4UA8 A;  3G7W A;  3G3F A;  2I3V A;  2GHB A;  2HAV A;  4JB7 A;  3PMV A;  3LSF B;  4K3F A;  3U8Q A;  2PBW A;  1UIU A;  3OO9 A;  5DT6 A;  1B1H A;  3UOR A;  4X9T A;  1NNF A;  3QIM A;  3LSL A;  5LOM A;  2UVH A;  3KGC A;  3IOR A;  3CSG A;  4R72 A;  3QK6 A;  1VSO A;  4G8H A;  4ZE8 A;  5AA2 A;  2F78 A;  4F3G A;  3KOT A;  1B0L A;  4DIG A;  3K6U A;  1B1X A;  3DP6 A;  1B0H A;  1JW4 A;  1NL5 A;  3DEL B;  3K1P A;  1BP5 A;  3O97 A;  2RCB A;  3Q29 A;  5DVJ A;  2DXY A;  4UAC A;  4XXU A;  3H03 A;  4R2F A;  4GD5 A;  4XKP A;  3KJ7 A;  2ZYN A;  4F3S A;  2RKM A;  1B3E A;  1MXX A;  3IB1 A;  4IY5 A;  2X7P A;  4NF4 B;  1IZ1 A;  2Q8J A;  1POT A;  3PD8 A;  2OWT A;  1P99 A;  3H4Z A;  1Z7M E;  3FXR A;  1A7L A;  2NVU B;  2QMW A;  1MPC A;  3SER A;  3KZG A;  3T9X B;  4NF8 A;  3IO4 A;  4ELR A;  1QUL A;  2XXI A;  4OFO A;  4N07 A;  3VE1 B;  4RXL A;  1US4 A;  4O3A A;  5H8H A;  5IAI A;  3MP1 A;  1JEV A;  4IO6 A;  2R71 A;  4RPN A;  1B4Z A;  4I62 A;  2O68 A;  4P0I A;  5I57 A;  4OVJ A;  3FJ7 A;  1USY H;  5I58 A;  1OLC A;  1MY0 A;  2CZL A;  4I9D A;  1A8E A;  2ZYK A;  4U2R A;  2I6E A;  2DE4 A;  4YAH X;  4OMB A;  3E4R A;  1SD3 A;  1AMF A;  4ZE9 A;  3H6T A;  4H1X A;  1OMP A;  5H8N A;  2I4B A;  4HCY A;  4IB2 A;  1MXV A;  1M5B A;  3VVE A;  1EZ9 A;  3HCQ A;  2AIX A;  3VXC A;  3M3K A;  4GL8 A;  4H8J A;  5I2K B;  3VVD A;  3A3C A;  4KYS A;  3WAF A;  3OO8 A;  2Y7K A;  2F6P A;  1IXH A;  5CBS A;  4R75 A;  1FQE A;  4R6K A;  2F6G A;  4F3P A;  4RYA A;  2F7B A;  5AA3 A;  3GLB A;  3E13 X;  2DVZ A;  3BKI B;  2FNC A;  1P1O A;  3TTK A;  1KWH A;  4I1D A;  3R7X A;  5TP9 B;  2VOZ A;  3QYT A;  3RT8 A;  4HW8 A;  4PFY A;  4OFJ A;  4NF5 B;  2XXU A;  3FVO A;  4PE5 B;  4BDL A;  2I3W A;  4NE4 A;  4FOR A;  4R74 A;  1N0T A;  3WAE A;  3EHT A;  2XXP A;  3HST A;  1DPP A;  4OET A;  3TZA A;  1LFG A;  4ELP A;  5CM6 A;  3EF7 A;  4DLD A;  4LQ2 A;  1CB6 A;  1GGG A;  3H06 B;  3KBR A;  1B9J A;  5ELV A;  2QMX A;  3G3H A;  3MQ9 A;  5H8F A;  3FVK A;  4ZEI A;  5CRY A;  4NED A;  1IIW A;  3N26 A;  4ZDM A;  3R6U A;  3CI8 A;  1ZU0 A;  3OOA A;  3H3G A;  4XKN A;  4MBP A;  2THI A;  3OO6 A;  3LSW A;  3K0V A;  4F29 A;  3O29 A;  2RF1 A;  2RC9 A;  1B51 A;  4YIC A;  1NNP A;  1GV8 A;  2XD2 A;  1ZLQ A;  4QRZ A;  2QL3 A;  2OCU A;  3BFT A;  1M5D A;  3SEV A;  1N7X A;  2XXW A;  1MXU A;  1PDA A;  3LC8 A;  4ZEK A;  5CMC A;  4PQJ A;  1ZKB A;  4I8C A;  4OQO A;  2B65 A;  3MWB A;  3FVN A;  5FTH A;  4N13 A;  1IEJ A;  2FA7 A;  3RGY A;  1TWY A;  3UIF A;  2F34 A;  2GFE A;  4XKR A;  4KYE A;  3PUW E;  1MY1 A;  3MW0 A;  4OXV A;  1FQB A;  4YKJ A;  1QW0 A;  3B6Q A;  4M4G A;  3RT6 B;  1FQF A;  3B6W A;  1ZMG A;  1CE2 A;  3K6V A;  1AL3 A;  3OEK A;  1A55 A;  4YKP A;  5AA2 B;  1TFA A;  1XVX A;  4KYD A;  5L9M A;  4C1U A;  1N3W A;  3PPO A;  3OSQ A;  2O7I A;  1Q1K A;  3Q25 A;  1MQH A;  3PGF A;  2PT2 A;  3CVG A;  1MQI A;  3MZ1 A;  3O6G A;  1PB8 A;  5AA1 A;  1MM7 A;  1ATG A;  1WDN A;  1B6H A;  4P11 A;  3OXN A;  1UIV A;  2DXR A;  4LA9 A;  1B46 A;  3KJT A;  1PBP A;  2BJJ X;  4XIG Q;  2HFB A;  3ZKK A;  1AIV A;  1XS5 A;  4IO2 A;  2O84 X;  3MVW A;  2IEE A;  1BKA A;  4QF9 A;  4QFN A;  1SI1 A;  2QRY A;  1S9T A;  4RK2 A;  3U92 A;  4F2Q A;  3S9N C;  4R9G A;  3TTR A;  3VXB A;  5I56 A;  1QKB A;  1LB9 A;  4NF8 B;  2UVJ A;  1SI0 A;  2DYX A;  2AYS A;  3D4C A;  2F7A A;  5ISU A;  2Q9T A;  1HSE A;  5H8H B;  1PB7 A;  1EZP A;  1MQD A;  4QFP A;  3CR9 A;  2HAU A;  4Q30 B;  5I57 B;  1JET A;  4KD5 A;  3TQW A;  2QS4 A;  2ESN A;  3VLU A;  4YMA A;  5I58 B;  3H7M A;  3CIJ A;  5CI5 A;  1DTG A;  3BFU A;  3MVZ A;  4LVQ A;  4U4S A;  3IOV A;  5K2X A;  3G3G A;  1M5E A;  1PB9 A;  4QHQ A;  1I6B A;  5H8N B;  2O69 A;  4RA1 A;  2LAO A;  4GRK A;  3EHS A;  1TT1 A;  5FHN A;  3PMX A;  1ZJL A;  3QSL A;  3TTM A;  2H25 A;  1POY 1;  4FJP A;  3PPQ A;  1MY4 A;  1L5T A;  5JTY A;  4IO5 A;  5DYH A;  3D4G A;  2DWA A;  3A3U A;  2UYE A;  1WVJ A;  4WXJ A;  3LR1 A;  1SW5 A;  1P1U A;  1B32 A;  2QPQ A;  4POW A;  1Y20 A;  3HHG A;  3Q26 A;  3UP9 A;  1FTJ A;  4G8M A;  4RNS A;  3Q28 A;  5A5X A;  3VV5 A;  2YPN A;  5JK4 A;  3BBR A;  2H99 A;  1FTM A;  3N94 A;  4Z0I A;  4YKI A;  3IX1 A;  3OEL A;  3UA8 A;  5DEX A;  1B5J A;  1FCK A;  3C32 A;  2F97 A;  2XXR A;  4DCX A;  3V8X B;  2D3I A;  3I6V A;  3E9X A;  1R1N A;  3LUY A;  5DTB A;  1S50 A;  4PP0 A;  2O1L A;  3TAJ A;  3OD7 A;  1H44 A;  1TXF A;  2B3F A;  1B52 A;  2D21 A;  1I69 A;  5AA2 D;  4GWO A;  3VFJ A;  1MY2 A;  2ALU A;  1LFH A;  2F7C A;  3G3K A;  4YB5 A;  5H8F B;  2B3B A;  3O9P A;  2CMO A;  3EQ1 A;  2VGQ A;  1HSL A;  1R9Q A;  4LZ7 A;  4KPT A;  1ANF A;  3RUM A;  2UVI A;  2G29 A;  2V3U A;  3PPP A;  5F1Q A;  4LUB A;  4MFI A;  4DCY A;  4MLQ A;  4U1O A;  3S9E A;  5B70 A;  2G93 A;  1D4N A;  2NUV A;  1B3F A;  5B7D A;  4ZEB A;  5FHO A;  3Q27 A;  2O1M A;  2W7Y A;  3PMW A;  1VFE A;  2DS9 A;  1RKM A;  1LBC A;  3SET A;  1SQY A;  2P2A A;  2I4C A;  4F1U A;  1MXY A;  3TCH A;  5TPA A;  3C34 A;  1FQD A;  3FAS A;  2R9J A;  2XHD A;  4R9F A;  1O64 A;  4QFO A;  5I84 A;  5CC2 A;  1SBP A;  2Z8D A;  1B7H A;  2DQV A;  1XVY A;  1A54 A;  1LAH E;  3K4U A;  2LFF A;  1B2H A;  4O3C A;  3RNN A;  2D5W A;  3MAM A;  3ONM A;  3FXU A;  4MF3 A;  3MZB A;  4ELQ A;  3TEL A;  5KZT A;  2QJE A;  1R6Z A;  4G8N A;  1URS A;  5J1D A;  3MP8 A;  3FJG A;  2UYF A;  1II5 A;  4DXU A;  4ISU A;  3JV9 A;  4ZS9 A;  2DWI A;  1QVS A;  3T9H B;  3T96 B;  1MQJ A;  1O7T A;  3DP8 A;  1YPN A;  1JW5 A;  2REG A;  3U8V A;  1MRP A;  3JZJ A;  3QUF A;  4OEN A;  4EUO A;  3TKD A;  1P1W A;  1DOT A;  1IXC A;  3P7I A;  1UTB A;  3IOW A;  2V93 A;  4Q0C A;  3KOS A;  1MDP 1;  1RYX A;  1OVB A;  1TFD A;  2HCA A;  2X26 A;  4ND9 A;  2ZNU A;  5I56 B;  2PX1 A;  4ZEF A;  1MY3 A;  3GBB A;  3W15 C;  5FHM A;  4MLV A;  4POX A;  3MPL A;  1OLA A;  4U23 A;  4G68 A;  5EYF A;  2LFD A;  3UN6 A;  1XT8 A;  4QFL A;  4E0W A;  4F22 A;  4F18 A;  1MQG A;  2H4I A;  2RCA A;  3CFX A;  3FZV A;  1JEU A;  3TTN A;  1NFT A;  2VP1 A;  1Y9U A;  4JWX A;  1R9L A;  1F9B A;  4KHZ E;  2Z8E A;  4R6Y A;  4TLM B;  5FTI A;  3KN3 A;  3VLW A;  2UXA A;  3SEY A;  1EU8 A;  1MG1 A;  3RTW B;  4FEC A;  2H9B A;  1MXZ A;  3M3F A;  4TOZ A;  3MVY A;  1JW1 A;  1ZBM A;  3GBA A;  4G2Z A;  4JWY A;  4EXL A;  3TDJ A;  3U72 A;  4DXC A;  3IB2 A;  3U1O A;  2Z23 A;  3KSX A;  3U93 A;  4TLL B;  3FIR A;  3ODB A;  1GTK A;  4XTC Q;  2Z8F A;  1VE4 A;  3ECR A;  4R2B A;  5KCJ A;  5JTY B;  4AB5 A;  2I48 A;  2ZMB A;  5I59 A;  3K2D A;  2DE3 A;  4H0W A;  2F5X A;  1LLS A;  4RK9 A;  3FXQ A;  3SEW A;  1N04 A;  3S4U A;  1A99 A;  2F36 A;  2P1S A;  3ILU B;  4HS7 A;  4KR5 A;  2F35 A;  5A5X B;  2Q89 A;  3HV1 A;  4OHN A;  1VR5 A;  4ECF A;  1NMU A;  3SDF A;  1LAX A;  4DDD A;  2I0C A;  5DEX B;  1M5F A;  3I5O A;  1AH5 A;  2Y7R A;  2VD3 A;  4H6D A;  4BLA A;  1LAF E;  1N76 A;  3TQL A;  1B5H A;  2YLN A;  5KDT A;  1I6Q A;  3TYH A;  4AQ4 A;  2NXO A;  3S2V A;  3EN3 A;  1LGB C;  4RJZ A;  1LFI A;  1YTV A;  2QS1 A;  4OEU A;  1IXI A;  3E3K A;  2P0S A;  3FGS A;  3O66 A;  4C0R A;  3IOT A;  1Y1M A;  3SES A;  3CFZ A;  1I6A A;  4OFL A;  2V84 A;  4H5G A;  2YJP A;  4GOT A;  1URD A;  1SVX B;  3IK6 B;  2GRV A;  2HXW A;  1D9V A;  1OIB A;  5JEI A;  1B3H A;  3MZ9 A;  3SEU A;  5L8D A;  2I58 A;  4MH5 A;  2XXH A;  3T9U A;  4ESW A;  1B58 A;  3ILT B;  3FAT A;  2E1S A;  3V83 A;  3PD9 A;  4PFT A;  3IO6 A;  4PFU A;  1P1Q A;  5K2Y A;  3IAZ A;  4X1B A;  5ITP A;  2ZXT A;  1H3D A;  4U22 A;  4QFK A;  3O28 A;  1ZTY A;  5L9O A;  5TPA B;  1YAE A;  4JSD A;  2WKY A;  3MBP A;  3QXM A;  4JXI A;  4KQP A;  1BLF A;  5M2V A;  4YB6 A;  1LBB A;  2HZL A;  2DVC A;  4EF1 A;  1ZIU A;  3LBS A;  5HM4 B;  4EQ7 A;  1QUJ A;  4JWO A;  4RPO A;  3N6T A;  3TTL A;  3K01 A;  1N7W A;  2O51 A;  1QUI A;  2XXT A;  3C4M A;  1VFD A;  1BTJ A;  4EF2 A;  3T22 A;  5EHS A;  4N6P A;  3C33 A;  4HTG A;  4IO3 A;  3RN8 A;  3SKP A;  4QSE A;  3K6W A;  1BIY A;  3KEI A;  4WED A;  4F3B A;  3W9V A;  1SW4 A;  4GXA A;  4QSD A;  2GH9 A;  4F1Y A;  1B3G A;  2Q2A A;  4ZZE A;  3UK4 A;  1US5 A;  3PV0 E;  4LQ5 A;  4TQU Q;  4BDO A;  1XC1 A;  3PPN A;  1UTB B;  4OES A;  3QUJ A;  3K02 A;  1NNK A;  2O6A A;  3CG3 A;  2OLB A;  1JVY A;  2ONS A;  1B7U A;  1WOD A;  2Z22 A;  4IGT A;  4YU0 A;  1P1N A;  3CRB A;  1SYH A;  4G68 B;  3DLN A;  1MM6 A;  5H8Q A;  4JBZ A;  1Y4T A;  2ZNT A;  4GVO A;  4GFR A;  2AL5 A;  1Y3P A;  2UVG A;  3B7D A;  2V25 A;  3CSB A;  2OK2 A;  1D9Y A;  2AL4 A;  1JVX A;  4LAT A;  2ZNS A;  1Y3N A;  2HZK A;  3C36 A;  1QKA A;  2XD3 A;  3T93 B;  3VLV A;  4U21 A;  4FAJ A;  2XXY A;  4Q8R A;  5I2N A;  1PEB A;  4FEB A;  2ZYO A;  4YZZ A;  4NWC A;  4GL0 A;  2A5S A;  3U94 A;  4Z7E A;  3KN8 A;  2RIN A;  3TFL A;  1J1N A;  4EXK A;  3ZS6 A;  3HHF A;  2DOJ A;  2A5T A;  3C9H A;  3EHU A;  4G4P A;  5KCJ B;  4M1V A;  3KN7 A;  5F7V A;  2REJ A;  3FJM A;  5I59 B;  3IB0 A;  3OSR A;  1D3K A;  1FW0 A;  1AOV A;  1T0K A;  2HQ0 A;  3TOD A;  2XXX A;  2E0S A;  3EPE A;  2V3Q A;  4G68 C;  2ZYM A;  3TCG A;  1FQA A;  4Q5T A;  3ZKL A;  3L6G A;  1DTZ A;  3F11 A;  1DSN A;  4NWD A;  2HZ8 A;  1YCJ A;  2RC7 A;  5CMM A;  4FAT A;  4P0G A;  4L17 A;  2H98 A;  4NF6 A;  2Y7P A;  2IA4 A;  4RY1 A;  1DMB A;  5DVF A;  4JDF A;  4F19 A;  4FE8 A;  4DZ1 A;  5HPQ A;  2M8C A;  5KDT B;  5AA4 A;  1H76 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...