1Y4CA

Designed helical protein fusion mbp
Total Genus 166
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
166
sequence length
490
structure length
480
Chain Sequence
EGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDEALKDAQTNSSSLGIEGRSSEELLKIALQEAQKTLQQAQELAKKGGGEEQLKRALKRADRNLWAAQELAKKGGGGEELLKQALQQAQQLLRQAQELAKKGGGEELLKQALQQAQQLLQQAQELAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title De novo design of an IL-4 antagonist and its structure at 1.9 A.
pubmed doi rcsb
source organism Escherichia coli
molecule tags De novo protein
molecule keywords Maltose binding protein fused with designed helical protein
total genus 166
structure length 480
sequence length 490
ec nomenclature
pdb deposition date 2004-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.660 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) IL-4 antagonist (De novo design) like domain 1y4cA03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1y4cA02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1y4cA01
4I8CA 5DVJA 4ELRA 3TTMA 3QUJA 1DOTA 3EHUA 3B6QA 1Q1KA 3H3GA 4JWYA 5I2NB 1JW4A 3PPOA 4HW8A 4F31B 1ZU0A 4YU0A 1USYH 3BFUA 3TQWA 1XC1A 5AA2B 4ZECA 1P99A 3G3KA 5AA2D 2P2AA 4QSCA 1ZLQA 1USYE 3E4RA 4LZ5A 5ICQA 4QSEA 1B1HA 3SEUA 2I49A 3GXAA 4P0GA 4X1BA 1B51A 4G77A 3TTNA 3UN6A 2HZLA 1B32A 3O6IA 2Q9TA 3T96B 3QIMA 3G7WA 1ELJA 4N6PA 3FVKA 3GBAA 4G4PA 2RINA 4KYDA 4OERA 5CMCA 3VLWA 4FIMA 2V84A 4ONYA 1AIVA 2Y7KA 1NMUA 2XXWA 1NNPA 1D4NA 1YCJA 2H25A 1MXUA 3RLFE 1SW4A 4WXJA 1Y4CA 4TOZA 1P1OA 5L9MA 5DTBA 1QULA 1LAHE 3T9HB 4O3CA 1FQFA 2GHAA 1ZJLA 3KGCA 4U4SA 3UK4A 1RKMA 4YKIA 2Z8EA 3G3GA 1GVCA 2NVUB 3TDJA 4X9TA 3H7MA 5EHMA 4EXLA 5H8NB 1XHYA 1B6HA 1H44A 3R26A 4OFOA 4BDOA 3RTFB 3S9NC 4POXA 5AA2A 2XX8A 4U21A 3K02A 1LCTA 1IXGA 4C1UA 4EQ9A 2XXRA 4G2ZA 4PQJA 2ESNA 2O1MA 2VD2A 3C32A 2AIXA 3K00A 1O7TA 1OQGA 2LFDA 5F1QA 2Z8DA 1IEJA 1OIBA 5CMMA 5CMBA 1L5TA 1TXFA 3HHGA 4NEDA 3O29A 1QUJA 1JVYA 1UTBB 2I4CA 1MM7A 2NUVA 3O9PA 1B7ZA 1B5JA 2I48A 3IOTA 3FXRA 2E1SA 1JEUA 4GXAA 3DM0A 1ZKBA 3U92A 1MDQA 5KCJA 2QL3A 4IB2A 3V89B 4G8HA 4H1XA 4XIGQ 2R9JA 1MS7A 4IY5A 3OELA 4RXLA 2Y7IA 3CI8A 4GRKA 3TPAA 1HSEA 3A3CA 5H8SA 4F2QA 5TPAA 2OCUA 2REGA 4R9FA 1Y3PA 5KZTA 1A40A 1OVBA 3I5OA 2I4BA 2I3WA 3IAZA 4ND9A 5ICTA 2F6PA 3OD7A 1B9JA 3ZS6A 3T66A 3IORA 1A8EA 3WAFA 4PETA 1MH4A 2HQ0A 4WEDA 3L6HA 4EXKA 3BKIB 1H3DA 4MBPA 1B7UA 3IB1A 3T9UA 4ELPA 2Y7PA 1JW1A 3RY3A 1LB8A 3IX1A 3K2DA 1I6BA 4JSOA 1B2HA 4GL8A 3LSWA 3K6WA 4ZEKA 3EPEA 2UVIA 4G8MA 1N0TA 4U1OA 3R6UA 4QRZA 3OO6A 4NF6B 2RC7A 4OHNA 4F1YA 2F78A 1H45A 1MPCA 1BTJA 4OQOA 4R2FA 3UA8A 4YICA 2O51A 3H03A 1B5HA 1NNTA 3IJOB 5KCJB 2RCAA 3OO9A 2RKMA 3KN7A 5KDTA 4LATA 3FIRA 2XXUA 5CM6A 4GXSB 3DP6A 4PFWA 2NWJA 4EQBA 1EZ9A 4IGTA 1ZMGA 3S9EA 3H6WA 4OMBA 2M8CA 3RT6B 4Q30B 3N26A 3H4ZA 3TTRA 5B70A 5IKBA 4RPNA 4QSDA 3G3FA 4JBZA 4R6HA 3MVYA 5ITPA 1POTA 3N6UA 2ZYOA 3JV9A 3OMBA 3PMWA 4JSDA 5CC2A 4WEPA 1AMFA 1I69A 3U1OA 1OVTA 4M4GA 4BDNA 5JEIA 2FA7A 3SERA 4KI0E 2R71A 3HSTA 5DYHA 3B7DA 4LP2B 3MZBA 4G68B 4FEBA 1MM6A 5TU0A 5I2NA 1OMPA 2QPQA 1B7HA 4I1DA 5JK4A 2DP8A 3QSLA 1MXXA 1SBPA 2KLFA 3ILUB 3WAEA 1M5BA 4FECA 3SEWA 1Y3QA 2NOOA 3EHTA 3ILTB 3IL1B 3KJTA 3PPNA 3O66A 3PV0E 4F3SA 3C33A 4NTLA 1LCFA 5DEXA 3RN8A 1TFDA 2Z8FA 3IOWA 3FV1A 5LOMA 1T0KA 2WKYA 1D3KA 1YPNA 2DWAA 3OEKA 4JWOA 4UACA 2YLNA 3C36A 4POWA 3UGWA 1MDP1 3E13X 3JYRA 2THIA 3K6XA 3VLVA 4GFRA 3VE1B 2DXYA 4MFIA 5IAIA 1BLFA 1VFEA 1FTMA 3TFLA 3RNNA 2V3QA 4KCDA 4GD5A 3V8XB 4ESWA 1O64A 4R74A 3VDFA 1VSOA 5I56B 3ONMA 3H6VA 2H5YA 3IOVA 4IO4A 4ZS9A 3KFMA 1XVXA 4HCWA 4JXIA 1H43A 1A55A 1UQWA 5TP9B 2DVZA 3T9VA 2ZYKA 3FJGA 3U94A 2QS4A 3MVWA 4GIZA 4ELOA 4F29A 3I6VA 4Q8RA 2XXYA 4YKJA 1POY1 1ANFA 3MPKA 3QXMA 3U93A 1Y3NA 3K0VA 1ZIUA 1XOCA 3MP6A 4IO3A 3EHSA 3TODA 2OLBA 3MW0A 5KDTB 4GLIA 1URDA 1UTHA 3TQLA 4KPTA 3C31A 2O7IA 2LFFA 2X7PA 4BLAA 1JW5A 1RYOA 4Q5TA 4YMAA 3TKDA 4RYAA 1Y1ZA 2W7YA 3OSRA 4ZDMA 2HCAA 4Z7EA 5ISUA 3HPIA 1S7YA 3IB0A 4TQUQ 4XXUA 3HV1A 1I6QA 1LAFE 4GWOA 2ABHA 4KHZE 2FNCA 4PP0A 3KN8A 5L9SA 1FTLA 2ZNSA 4U4XA 5DVIA 1MXZA 3TAJA 1EU8A 1TFAA 3MAMA 2VOZA 1PB8A 3PD9A 4YB6A 3O6GA 2O68A 3KG2A 4OFJA 5CBRA 4ISUA 1GGGA 3FUZA 5CBSA 2XXVA 4NF5A 2AL4A 4OTEA 4IO5A 4XKQA 4X1DA 2IEEA 2P0SA 3TTKA 2VHAA 3U72A 3ZKLA 2UYFA 3Q27A 2BJJX 3M8UA 3ZKKA 4KYEA 1IXHA 4OEVA 4LUBA 4UA8A 1O63A 2ZYMA 2XD3A 4OETA 3LBSA 1WODA 1JVXA 1B4ZA 2DE3A 1B3LA 1HSJA 2Q2CA 3FD3A 2ONSA 3KOSA 3PMXA 4QFKA 3BBRA 3OO7A 5H8NA 2HZ8A 2V25A 3GLBA 4LVQA 4ZEIA 2XXHA 1EH3A 4OZ9A 5K2YA 3H06B 4DXUA 1Z7ME 1VE4A 1CE2A 2PX1A 4AB5A 3QK6A 4DIGA 5I84A 3G3HA 4I9DA 2O84X 1SD3A 2QS1A 4PE5B 5I2KA 1OLAA 4IO2A 4GQOA 3RGYA 3MVZA 3QYTA 1Q35A 1R9LA 4KCCA 3S9MC 4QFPA 3PGFA 1JNFA 1NFTA 1Y4TA 2V3TA 1SVXB 4O3AA 3IB2A 1PB9A 4KR5A 3RUMA 3S2VA 4ZEBA 3Q28A 1MPBA 3B6WA 3FVNA 5DVFA 2R6GE 3Q29A 4OEUA 1XS5A 4H0WA 1VFDA 3BFTA 3LSLA 4FORA 4R2BA 4YKPA 1NL5A 3FJ7A 5A5XB 1US4A 1SI0A 1SDXA 1XVYA 1TWYA 1GTKA 4EDPA 3PUZE 5H8HA 4ELQA 5ITOA 2G93A 2I6EA 2ZNUA 3KJ7A 2D21A 1MY0A 2Z23A 4OENA 1LBBA 1LB9A 4U1ZA 1N04A 1B4HA 3C4MA 2Y84A 1NNKA 3MWBA 4NF4B 4X48A 3KN3A 3MQ9A 4KD5A 3MP1A 1PBPA 3FVGA 1LFIA 3H6TA 4K3FA 5JTYA 2A5TB 5I58A 4I62A 4RK9A 2RC9A 3SEVA 3VLUA 4F3PA 2GH9A 2GRVA 3D4CA 3C35A 3PPRA 1Y1MA 4NF8A 1B05A 1BKAA 1NKXA 1QUIA 2OWTA 3OOAA 4N13A 4QFNA 5DEXB 3UP9A 3W9VA 3CSBA 3PUXE 4R9GA 1NH7A 3KEIA 4PFUA 4ZEFA 1IXIA 3Q26A 2DWHA 2O7UA 4P11A 5H8QB 1N3WA 3DELB 3DP8A 4N07A 3CFZA 5FHOA 4AB6A 2B65A 1LBCA 2VGQA 5I59A 2GHBA 2VD3A 3TCGA 3K6VA 4G68C 4XKRA 4F22A 3AXFA 4F18A 2HZKA 3A09A 2I0BA 3G3IA 3JZJA 4R73A 3RTWB 1B52A 1FTKA 3C9HA 4FJPA 4OWDA 3W15C 5CMKA 2FYIA 1UIUA 4U2RA 2PT2A 5EYFA 3IJXB 4H6DA 1MXYA 2H99A 1A7LA 5FTIA 1AH5A 3K1MA 2DWIA 4DCYA 3FV2A 4FAJA 5J1DA 3CG1A 1BP5A 4EUOA 3FXUA 1NH8A 4EF2A 1JQFA 2ALUA 2YJPA 2ZNTA 5M2VA 2D3IA 4QFLA 3TZAA 2B3BA 4Q0CA 3SEYA 4QF9A 3UORA 1B3FA 2F97A 1MY2A 1QKBA 3KSJA 3VFJA 5AA3A 1URGA 4TLMB 2OWSA 2Y7RA 2AYSA 5DT6A 4BDMA 4P0IA 1MXVA 1B1XA 1P1WA 2IA4A 3GZGA 1FQCA 1Z7NE 3KBRA 3PUYE 2H4IA 3QAXA 3N6TA 1BIYA 1US5A 1MQJA 2OK2A 4NF8B 4PFYA 5FTHA 4AQ4A 5I57B 3KOTA 2O69A 3CIJA 4ECFA 4PFTA 1UTHB 2XXXA 3FGSA 2PYYA 3PD8A 1QUKA 1A54A 4OVJA 1LLSA 3T93B 4BDRA 1M5DA 2OBGA 4TLLB 2DXRA 4F1VA 1FCKA 4KFQA 5EHSA 1FQAA 1Y20A 4H67A 3MUQA 4RY1A 2PVUA 4YB5A 1WDNA 4OFLA 3VVEA 1LFHA 2V3UA 1N76A 3FATA 3DP4A 1MQDA 4G68A 2O6AA 4LQ5A 4DZ1A 4LZ7A 4R6KA 1LSTA 3TEPA 1B46A 2A5SA 1EZOA 3CR9A 3FXQA 1J1NA 2F36A 2F35A 1FQBA 1MQGA 4G8NA 5FHMA 4OXVA 2E0SA 4F1UA 3Q25A 4F3GA 1B0LA 3LUYA 4O3BA 4C1TA 5HPQA 3MBPA 3OO8A 1GR2A 1N7WA 1ZTYA 5ELVA 3VVDA 4LZ8A 3S4UA 1M5CA 1FW0A 1ATGA 2QMXA 2QS3A 3TUSA 2Z22A 1LAGE 4F19A 2Y7WA 2DVCA 4GVOA 4OYVA 1RYXA 2CZLA 2HAVA 1DPEA 1TT1A 2QJEA 4RPOA 4U22A 4DCXA 2B3FA 2QRYA 3USDA 2O1LA 2PBWA 2UXAA 5I57A 1LGBC 1NNFA 3IO4A 5BWJA 4E0XA 1MY4A 2HFBA 2XXIA 2H98A 1MG1A 1YAEA 3RPWA 3CSGA 1OQHA 3SKPA 2V93A 2Q2AA 3M3FA 3A3UA 3H6UA 1IXCA 1KWHA 2F7AA 2QMWA 3MP8A 3PUVE 1XT8A 4MH5A 3TTLA 1MY3A 3EF7A 1MQHA 1UIVA 2HAUA 1WVJA 2ONKE 5H8HB 2RF1A 5HBCA 1PEBA 5JTYB 4JB7A 2Q8JA 4ZE8A 2XD2A 2HEUA 5L8DA 4JWXA 4DE8A 4RJZA 3S9LC 3FZVA 4HTGA 1B3HA 4MF3A 4Z0IA 3PMVA 5AA1A 3ZSFA 3SETA 1Y9UA 3MVXA 4GOTA 3ECRA 2HXWA 3T9XB 4ESXA 2F7BA 5I56A 1YTVA 3VVFA 1AOVA 3C34A 4F39A 3FVOA 4NF5B 4RNSA 1M5EA 2LAOA 3SEXA 4IY6A 5L9OA 1N3XA 2DQVA 2XX7A 3N94A 4R6YA 2F34A 2UVGA 5A5XA 2UVJA 4XKNA 3TELA 4EF1A 5FHNA 1B3EA 5AE4A 1MPDA 1VR5A 3ODBA 2QS2A 1IIWA 2X26A 2VP1A 1DPPA 2XX9A 3GBBA 4NMYA 4XTCQ 5B7DA 4KQPA 2QSXA 2PMSA 3TYHA 2I58A 1B5IA 3B6TA 4R72A 2YPNA 1EZPA 3O6HA 2XXTA 4NF4A 2NXOA 1GV8A 2DYXA 1B58A 1SYHA 2Q89A 2DS9A 1DTZA 2F7CA 3FASA 3OEMA 3SDFA 1S9TA 4QHQA 1MXWA 1R1NA 1SW2A 4FE8A 3G3JA 1DMBA 1F9BA 1JETA 1PC3A 3IK6B 1FQEA 3I3VA 3O28A 5HM4B 3EN3A 1IITA 2RCBA 3LSFB 3TMGA 1QW0A 5BUUA 1QJMA 2ONRA 1SW5A 2RC8A 1HSLA 2GFEA 3K6UA 3LSXA 3MC2A 3LR1A 1IUDA 5H8FA 4DLDA 1P1QA 4IO7A 5H8QA 1MRPA 4QFOA 4F2OA 1R9QA 3VXBA 3TCFA 3RT8A 3K1NA 4NWDA 4OESA 3UIFA 3HCQA 3PUWE 2F5XA 1LAXA 1D9VA 2ZYNA 1B0HA 2F6GA 1S50A 3LC8A 3M3LA 3PPPA 5CI5A 5H8FB 2XHDA 3V83A 4YB7A 4HCYA 4RA1A 1MY1A 4NE4A 1II5A 2DSFA 4KYSA 1B40A 1IZ1A 4MLQA 1UTBA 4XKPA 4LA9A 2DE4A 1JEVA 1D9YA 2ANJA 4U23A 1FQDA 5CRYA 2ZXTA 2ZMBA 3HO7A 1SW1A 4YKKA 5AA4B 3FJMA 1LFGA 3SESA 2REJA 3U8VA 3HN0A 4H5GA 4C0RA 1M5FA 1N84A 1R6ZA 1I6AA 2X7QA 2XXPA 3IR1A 4LQ2A 2A5TA 3VV5A 4E0WA 4YMBA 2DWJA 1SQYA 4IO6A 5I2KB 1SYIA 1A99A 3R7XA 1N7XA 5AA4A 1MH3A 3CG3A 3M3KA 3MJNA 3O97A 4M1VA 3QUFA 2I0CA 4FEDA 3IOUA 4H65A 4RK2A 1ZBMA 3K4UA 3KSXA 3K01A 4L17A 3L6GA 3EQ1A 4BDQA 4H8IA 4YZZA 4EQ7A 4BDLA 1OLCA 2H9BA 1PB7A 4R75A 3K1PA 3RQTA 1P1UA 4F3BA 4ZE9A 5I59B 5TPAB 3IO6A 4YAHX 5TP9A 3KZGA 4ZZAA 1SI1A 3CFXA 4GF8A 2AL5A 4DXCA 1DSNA 1QKAA 2UYEA 1IQ7A 1FTJA 2D5WA 3CRBA 3E3KA 3E9XA 4H5FA 3DLNA 4NWCA 3TCHA 3U8QA 3OXNA 3PU5A 1A8FA 3T22A 1URSA 2I3VA 1CB6A 2P1SA 4ZEDA 4THIA 4LONB 2CMOA 1P1NA 4H8JA 4GL0A 2PT1A 4DDDA 5I58B 2XXQA 3THIA 4IGRA 3CFLA 2OZZA 3O2AA 4DXBA 1DTGA 1B3GA 2DOJA 3V5AA 3W9WA 3OSQA 4HS7A 5F7VA 2DE2A 4MLVA 2Q88A 4JDFA 2G29A 3VXCA 3HHFA 3N5LA 4NF6A 4ZZEA 3MZ9A 1H76A 1PDAA 1MQIA 3MPLA 1FTOA 3PPQA 5K2XA 1QVSA 3CVGA 4WKMA 2F8DA 2OJTA 2UVHA 1AL3A 3MZ1A 3OENA 3D4GA 1PBQA 4FATA 3F11A 3P7IA
chains in the Genus database with same CATH superfamily
4OVSA 1HMDA 1JW4A 4F31B 3L8IA 1ZU0A 1USYH 3M15A 4QSCA 1D0ZA 3E4RA 4LZ5A 5ICQA 3SEUA 4G77A 4XLNF 1OKKA 3FVKA 1NG1A 4G0HA 3KC0A 5B3IA 3VLWA 4FIMA 1AIVA 3POVA 1NMUA 4U5EE 1D4NA 3O6XA 3JRTA 3T9HB 2QVVA 4K0DA 1FQFA 3KGCA 4U9DA 1RKMA 1OCOC 2Z8EA 2NVUB 5EHMA 5L0DA 1H44A 3R26A 1LI5A 2Y3GA 3HLZA 3SEOA 3T6BA 2HV6A 4OIQF 3BIGA 1QLEC 2AWYA 4C1UA 4EQ9A 2KK1A 1LBZA 3C8GD 4N17A 4PQJA 2O1MA 5IY5C 3K00A 1O7TA 1OQGA 5F1QA 2Z8DA 1IEJA 1OIBA 4OD5A 2AWCA 1D0YA 1QUJA 3K1HA 1EYKA 1MM7A 2I4CA 3O9PA 5JSLA 4LVQA 3S28A 1YZCA 4MEVA 4XQ1A 1ZU5A 2XM4A 4RXLA 2D4UA 5H8SA 4XTKA 3FMSA 5L0JA 2XLMA 2I3WA 3IAZA 5ICTA 2VC9A 3VYWA 3WG7C 4BJ1A 3T66A 1NFOA 3AQBA 2HQ0A 1H3DA 3QZCA 1B7UA 4NHBA 2FAPB 1O87A 2J45A 4JC7A 1B2HA 2JX0A 1I4ZA 3EPEA 1A41A 3OO6A 1FPDA 4F1YA 1TFKB 1KNYA 4NY3A 5EYGA 4G7HF 3N0TA 2H7OA 1VB5A 1AVOB 3OO9A 5KDTA 1T9KA 3DP6A 1ZMGA 3S9EA 2A68F 3C18A 2RSEB 3RVZA 3S29A 3ZVRA 1IMAA 5KYYB 4QSDA 5ITPA 1LE2A 5DS5A 2ZYOA 4P9TA 1AWBA 5CC2A 1WTYA 2Q74A 3U1OA 4Z9JA 2R71A 3MZBA 5FBPA 5TU0A 1LE4A 3HTKC 2R7SA 5I2NA 3T9OA 1SBPA 1E2XA 2OU6A 3ILUB 1M5BA 4LERA 3EZHA 4M63A 5DW8A 2EPMX 3PV0E 3C33A 3RN8A 5DEXA 2O9XA 1TFDA 5LOMA 3FV1A 3EPVA 1ZHZA 1ORYA 1SZIA 4PGPA 2YLNA 3FHDA 5JVEA 2Y3BA 1EYIA 1APCA 1I5NA 2THIA 2Y5KA 4GFRA 5IAIA 1MNDA 3ZQVA 1FTMA 3RNNA 4FBPA 4WJ0A 5ESYA 1M56C 3U3FA 2Q00A 5JUAA 1XVXA 2BE5F 4F29A 1YA9A 3M4CA 3QVYA 1NUWA 1Q0GA 3I6VA 1POY1 3MPKA 2QE9A 1ZIUA 5BQGA 2EIJC 4GLIA 2AVKA 4GWWA 3AQCA 1FBEA 4BLAA 1RYOA 5ET5A 3TKDA 2M4EA 3GM2A 3CQZA 4EBJA 2WYKA 4GWOA 1NUXA 3ZSUA 5COMA 4U4XA 5DVIA 4PBHA 4MW3A 4AK9A 4L6RA 4OFJA 4DI3D 4XEVA 3SP1A 3DJNB 4OTEA 4XKQA 3B0UX 3IQ6A 2OX3A 2UYFA 3Q27A 3GM1A 1MMDA 3W2WA 4LUBA 4UA8A 1O63A 4MTOA 1B3LA 3KOSA 1H7IA 1S05A 3LNMB 3BBRA 4XEQA 2V25A 1UG7A 2CCYA 5K2YA 3LLKA 3D1RA 3ZTMA 1Z7ME 3KYIA 4AB5A 1SR2A 3G3HA 3OA1A 4I9DA 2O84X 1B68A 5AGFA 2QS1A 1VK5A 4PE5B 4GX4A 3CEXA 3AOUA 1R9LA 2KGOA 4LLEA 4QFPA 3PGFA 4O3AA 2MHRA 3RUMA 3GEEA 4C3DA 3Q28A 3IPMO 3FVNA 5DVFA 1ZHWA 3C7JA 4U5FE 2J0XA 4IARA 1VFDA 1XS5A 3BFTA 3LSLA 4O7GA 4H0WA 4YKPA 5F24A 5A69A 1ZVZA 1SDXA 1SI0A 1FRPA 1TWYA 3PUZE 4ELQA 2G93A 2QUPA 2I8BA 2G3VA 3SYNA 4YL3A 2YL7A 2Y84A 1NNKA 5K0IA 4ER9A 3ASNC 3KN3A 3AG4C 2F22A 3MQ9A 3MP1A 1LFIA 3HKKA 2GH9A 3HNLA 3C35A 1INPA 4QFNA 1LS1A 5I57A 5A6BA 3W9VA 4ZEFA 3DAFA 4PF8A 2R03A 5CIVA 5H8QB 5FHOA 1HE9A 3CFZA 4AB6A 2B65A 4NN3A 5I59A 2GHBA 2GDCA 3LEVA 4XKRA 1FR0A 2HZKA 5L0FA 1OR3A 3JZJA 3C9HA 4OWDA 2WX9A 2VCBA 4IJJA 2PT2A 4H6DA 1MXYA 4JVSA 3SXYA 1A7LA 4PCDA 3K1MA 4DCYA 3FDQA 4N06A 4CSAC 3LUTB 4FAJA 3FXUA 3NDBB 2DYSC 2ALUA 4MVRA 5EGYA 1QKBA 1LBWA 1Z5ZA 4WGYA 2GQ1A 4QI0A 4YL1A 2AP3A 5EQAA 4P0IA 1FMVA 1B1XA 2XRHA 3V89B 1FQCA 1MMGA 4AQ4A 1MQJA 1FBFA 2OK2A 5I57B 5T1DB 4MNIA 1TWGA 3CIJA 1FTAA 4PFTA 3RYDA 4ECFA 3PD8A 5D92A 4OVJA 3L8JA 1YAUO 1RDZA 4N4UA 1M5DA 2LIGA 4N81A 4BDRA 1FQAA 1C03A 1QZXA 3CZ6A 3X1OA 3ZG1A 1Y20A 3MUQA 4H67A 1WDNA 3VVEA 1Z63A 1JMWA 2V3UA 1N76A 3FATA 1EZOA 2WVOA 1DOWA 3CR9A 4I3EA 2QLAA 1FPBA 5FHMA 4NQ8A 4F3GA 4F1UA 5F5FA 1N7WA 5IZZA 5E2QA 3EJNA 4NX1A 2Z22A 2HUJA 1RYXA 4U22A 1M2OA 1TT1A 4RPOA 4DCXA 4HE8D 2QRYA 3HFUA 3A29A 2XXIA 5EQ9A 4DOZA 3O39A 2CEXA 4CDYA 3CSGA 2IXOA 4CX9A 2V93A 3ATPA 4C3EA 2AU5A 2Q2AA 4YB5A 5BQIA 2Y39A 4BEJA 3EF7A 1MQHA 2ONKE 2XLEA 1GVCA 5H8HB 2RF1A 5JTYB 4GWZA 3S9LC 4MVOA 2HEUA 4O79A 4MF3A 1B3HA 3NYLA 4Z0IA 3FVYA 3ZDLA 1OW7A 3MYFA 3MVXA 4DI4B 3ECRA 4AS5A 4F39A 2A6HF 4P1EA 3FXHA 4CJOA 3FVOA 1NBBA 2XX7A 2F34A 2UVGA 3TELA 3TOMA 1B3EA 3EZIA 4OVPA 5FHNA 1TKNA 3A11A 3ODBA 2GA0A 2X26A 2VP1A 4MVSA 4XTCQ 2PMSA 2I58A 1CPRA 2E87A 1Q0KA 2CZHA 4BJ5A 4PFRA 3FASA 3U93A 1SYHA 3ROJA 1R1NA 1SW2A 1PC3A 1JETA 2ZZWA 2OKUA 1IITA 2L9JA 2IOQA 5BQHA 3MC2A 1SW5A 2GFEA 2ZXOA 1P1QA 5H8QA 4KBLA 4I3YA 4NWDA 4IGGA 1CGOA 3UIFA 4KQPA 3AG1C 1LAXA 1QSPA 4O8MA 5H8FB 4ELPA 2XHDA 5A6AA 3EKIA 1II5A 2YLIA 3IQCA 4CIPA 1ZZPA 1IZ1A 2DE4A 1D9YA 5CRYA 3K6BA 4I44A 5DS6A 1SW1A 4YKKA 5AA4B 2D5RB 4K7BA 3SESA 4GYTA 3U8VA 2X7QA 3IR1A 1I6AA 2A5TA 5I2KB 1SYIA 2YL0A 3RQFA 5I3SA 3R7XA 3CG3A 4JVIA 4BDQA 4LDQA 4H65A 3KSXA 4W8KA 3L6GA 1PCXA 5BUOA 4MAGA 4YZZA 1PB7A 4BJ6A 1P1UA 1RJ9B 4F3BA 3SXKA 4ZZAA 2OCCC 2C04A 1DSNA 1IQ7A 1FTJA 2D5WA 3EH2A 4F4BA 3JZ0A 3L1MA 4H54A 3DLNA 3OXNA 3TCHA 1R4TA 1A8FA 3T22A 2P1SA 4ZEDA 2FIXA 1RXQA 1P1NA 1KA0A 2IXNA 2QY9A 4DDDA 4WABA 3CFLA 1E83A 3MFNA 1DTGA 1B3GA 3OSQA 5COFA 2DE2A 4MLVA 2ETSA 2YVKA 2G29A 3HHFA 1TWCA 4NF6A 4PBQA 4NC3A 3MPLA 5K2XA 2IM8A 1QVSA 3EG9A 3MZ1A 1H9TA 1AOVA 4RNSA 3F11A 2R05A 1GM5A 5DVJA 3TTMA 3QUJA 3EHUA 3B6QA 3H3GA 1LIHA 4GBVA 4O6NA 3O55A 1HMOA 1FBPA 1SMYF 3UMIA 1XC1A 5AA2B 2VH3A 1ZLQA 3U65A 3US6A 2NG1A 4MNDA 4QSEA 4X0RA 3GXAA 3TTNA 3T96B 2Q9TA 3QIMA 3G7WA 3GBAA 4XLPF 4G4PA 4OIOF 3ABMC 4MIJA 4BEMJ 4JCZA 4OD4A 2JJKA 1J8MF 3LNRA 1YYZA 2KR0A 4QBAA 1C17M 1P1OA 5DTBA 4NAPA 4GQHA 5B1AC 4O3CA 2IBFA 1I4YA 4U4SA 4OVQA 4N6KA 1YDIA 4X9TA 3DJUB 1D9QA 3JRMO 4EXLA 4OFOA 3NYMA 4BDOA 3S9NC 4B6IA 2XX8A 4HFFB 1LCTA 3UMHA 2L5VA 2XXRA 4G2ZA 3C32A 1OCZC 2LFDA 2EIKC 5CMMA 2HFIA 3PTYA 3O29A 1UTBB 256BA 2MYSA 2I48A 5AC5A 3DKAA 4GXAA 4P56A 1YYXA 1ZKBA 4IB2A 3ZWIA 4XPYA 4G8HA 4XIGQ 2R9JA 1MS7A 4GRKA 4O94A 3TPAA 4F2QA 5TPAA 2OCUA 4JURI 2REGA 3U9MA 2Z15A 2I4BA 4PF6A 2KC3A 1JRAA 5ET7A 3IORA 1A8EA 3WAFA 4EXKA 3IB1A 1CNQA 2VT5A 1XZQA 1NV3A 2Y7PA 5E33A 3EQLF 2MKZA 3K2DA 4G61A 3F47A 4JSOA 4OANA 3K6WA 5A6KA 4J7TA 2RC7A 1H45A 1MPCA 3UA8A 4AE4B 1LBYA 1B5HA 3TJ6A 3IJOB 2RCAA 2RD9A 3KN7A 1V74B 1JOGA 4C3BA 3FIRA 5KYWA 3FOPA 2HXRA 4PFWA 2NWJA 4EQBA 2KJGA 2YZSA 2LK4A 4Q30B 3N26A 3LS1A 4PGNA 2PNOA 3OMBA 3PMWA 4JSDA 4U9EA 4BDNA 5JEIA 3SERA 1ZW3A 1FBHA 5DYHA 2DI3A 5TJ5E 4GWYA 1Q0MA 4G68B 2QPQA 1NU7D 5JK4A 2Y3DA 2KLFA 1GS9A 5E3CA 3EHTA 4A2NB 1FPLA 3KJTA 1WASA 1T6IA 2HJMA 2R7XA 2Z8FA 2TMVP 3IOWA 2R7UA 5IZ3B 5I5PA 3W4YA 1YPNA 4UACA 2KW3C 3C36A 2HKVA 3K6XA 4Q5SF 1Z6AA 3TFLA 3IEEA 4JW1A 1PD0A 4IB4A 4GD5A 3VDFA 3H6VA 4IO4A 4DXWA 1H43A 3ZTZA 2ZYKA 2HHMA 2YWAA 3QVZA 4FX5A 2XXYA 4YKJA 4Q8RA 3R2PA 3QXMA 1Y3NA 3K0VA 3TODA 4IO3A 4U5BE 1O3UA 3B8BA 3HNJA 3ITFA 4KPTA 3RPLA 4MNPA 3K1IA 1ZHYA 2LFFA 2X7PA 4Q5TA 4YMAA 3TD7A 1SF8A 1KTMA 2EPLX 4BJTA 4YN0B 3OSRA 2XSEA 2HCAA 4Z7EA 4TQUQ 3IB0A 2X0CA 1LAFE 2ABHA 5L9SA 2FNCA 4PP0A 1G8XA 2ZNSA 3TAJA 1EU8A 1TFAA 3MAMA 2VOZA 3PD9A 3KG2A 4U5DE 1GGGA 5CBSA 2AL4A 1OQCA 2IEEA 2PFYA 3U72A 2WZLA 3ZKKA 4YT5A 4MHFA 4OETA 2ZYMA 3PMXA 1HSJA 4QFKA 1L5TA 1FBDA 2FFHA 4OZ9A 1CE2A 1ZU4A 3QK6A 3VRCA 5I84A 4JTCB 2P3VA 1SD3A 1H9GA 4DVZA 1OLAA 5IZ1A 4GQOA 2HV7A 5KYXA 3MVZA 4QXDA 3QYTA 4KCCA 1JNFA 1NFTA 1SVXB 3IB2A 1PB9A 4KR5A 4ZEBA 3Q6MA 1YXIA 2VASA 3ABKC 1RDYA 3B6WA 2R6GE 1K9ZA 3TK0A 1FFTC 4OEUA 4P8BA 1CGME 4FORA 3RVYA 1US4A 2XLWA 1GTKA 2OOCA 4HE0A 2FVZA 3KJ7A 3G50A 5KYUA 4XPWA 3EHMA 3SNHA 2F3BA 3DWWA 1OR2A 2R7RA 2BL2A 3MWBA 1EKYA 1IMCA 1J8YF 1YLMA 4X48A 3DD7A 4CS9A 4GWUA 2CZKA 3RKOF 2RC9A 3SEVA 4KNVA 2YLDA 4H45A 2HSQA 3PPRA 4NF8A 4KXPA 5DEXB 2OWTA 4JEAA 4PFIA 4HE2A 2HS5A 2J7PD 4BJ5C 1NH7A 3KEIA 3Q26A 4P11A 1N3WA 2J7PA 3DP8A 4N07A 2A0UA 2ZXWC 3RYLA 3T6GB 3K6VA 4N15A 4F18A 1JP4A 3W2VA 4GBWA 3L0IA 5CMKA 5F5HA 1UIUA 1HY5A 4DBRA 2Y69C 2DWIA 3FV2A 4EHPA 2VPNA 1U0BB 1NH8A 1JQFA 2YJPA 2OEVA 2B3BA 4Q0CA 4QF9A 2F97A 1MY2A 3KSJA 2Y5LA 1VYKA 4TLMB 2OWSA 1T6QA 3DE9A 4I3MA 2XWVA 1Z7NE 2H4IA 3N6TA 1U6HA 3FBPA 4NF8B 4KI2A 4E0IA 1NLXA 4EKWA 3DMDA 1OXBA 3U2MA 1E86A 2DXRA 4PTKA 3NOHA 4RY1A 3LEOA 3HJCA 4GX6A 5GPGB 4OFLA 4PJLA 2O6AA 1LSTA 4X04A 3FXQA 1FQBA 4OVRA 4OXVA 5AC4A 3Q25A 4OA4A 4O3BA 5HPQA 5ELVA 2PP4A 1KZ8A 1FW0A 1HE1A 3JYYA 1ATGA 2QMXA 1K04A 3B50A 3KPHA 5I7IA 1LAGE 4MVMA 2DVCA 1PD1A 4GVOA 2HAVA 4KC9A 2ICWG 1LBXA 2XXAB 4MX6A 1LGBC 3IO4A 4XFEA 1MG1A 3RFYA 1VDWA 4C1TA 2C03A 3PUVE 3TQOA 3A3UA 1IXCA 3H6UA 1M6TA 4GWXA 1UIVA 1WVJA 4JCHA 2YKZA 5HBCA 4XWJA 1LBVA 4ZE8A 5LTCA 4JWXA 3B29A 3J06A 3ZSFA 3PMVA 4GOTA 1LS4A 2F7BA 3BRJA 4MVUA 3C34A 4NF5B 1IMFA 1M5EA 1NV4A 2R7QA 4JZAA 3N94A 3FAPB 1OCCC 5F28E 4GEHA 5AE4A 1MPDA 1IIWA 3GBBA 4NMYA 3ZC4A 1DPPA 1R5ID 2B4LA 5B7DA 2QSXA 5L0IA 2Q9AA 3TYHA 3DM9B 1DBZA 1B58A 3SDFA 1S9TA 2YEVA 1MXWA 4QHQA 4I1OB 3G3JA 3T1BA 3IK6B 1FQEA 3O28A 4MCOA 5HM4B 5H8NB 5BUUA 3LSXA 3AGTA 3K6UA 3LR1A 1IUDA 4DLDA 2DGJA 1MRPA 4F2OA 3VXBA 3UNGC 3RT8A 3K1NA 3TCFA 2ZYNA 4U5GA 1B0HA 2F6GA 1VLTA 3T0JA 4OINF 1MY1A 4KYSA 3MYIA 4MLQA 3AGUA 1RDXA 4XKPA 4MVQA 3W8HA 1JEVA 1CPQA 4GWSA 3CSKA 4GX3A 1MQVA 3FJMA 3H65A 3HN0A 1O5HA 2P61A 4R32A 4IR8A 4LQ2A 3VV5A 4E0WA 1SQYA 1NV2A 3WODF 1SYQA 1A99A 4JTDB 3M3KA 3MJNA 2XL6A 4M1VA 4H46A 3QUFA 4FEDA 4RK2A 3SZPA 3QTHA 3K4UA 4YT8A 4PDDA 3T4RA 4NQFA 2ZXPA 4EQ7A 2ZZXA 1IMEA 1MMAA 4J32B 4BDLA 3GANA 4IRUA 3RF3A 3ZQYA 3V7OA 3RQTA 3IO6A 1KA1A 3KZGA 4GF8A 4DXCA 1QKAA 3CRBA 4N6DA 4NWCA 1NV6A 2DYRC 3LJBA 5DLJA 2CMOA 4LONB 4THIA 3UGOA 2PT1A 3H2VA 2XXQA 5JLIA 4IGRA 2OZZA 1JPJA 3VXCA 3N5LA 3EGDB 1U89A 4RDAA 3CVGA 2B4MA 3GORA 2EPOA 2UVHA 3OENA 2I15A 4TOZA 1LEVA 4ELRA 5DQTA 4E7ZA 3G4ZA 3PPOA 2IYLD 3BFUA 3LUZA 1P99A 3CAXA 2W4MA 2XWOA 3GODA 4PJJA 5JRAA 3KC1A 2J9UA 3K1IC 1EI7A 4JJFA 4P0GA 1B51A 2HZLA 1B32A 1CGNA 3O6IA 2W9YA 1ELJA 3K7DA 4OERA 5CMCA 2NUPA 2R9RB 5FCLA 4ONYA 2Y7KA 2CGEA 3BEHA 2XXWA 1YCJA 1SW4A 5L9MA 1LVKA 1ZHXA 1LAHE 3MX3A 2GHAA 3C8ZA 2R7OA 3G3GA 2Q9CA 4PACA 2Y3HA 3RTFB 5AA2A 2LP4A 4JE9A 4LLCA 4U21A 3KKBA 4UABA 1IXGA 2WBBA 1OW8A 4I40A 1NUYA 1ST6A 5CMBA 4NEDA 2L7AA 4UDVA 2NUVA 1ZHTA 1B7ZA 1B5JA 3OWTA 1FBCA 4PE3A 3FXRA 1MDQA 2QL3A 2LQGA 4H1XA 2WYPA 1MNEA 4IWBA 3B0PA 3OELA 4IY5A 4MS2A 4YT2A 2Y7IA 4LN5A 2XS1A 1Q0DA 4R9FA 1OVBA 3U9JA 2KQ9A 3I5OA 4ND9A 2F6PA 3ZS6A 3DE8A 3UGPA 1MH4A 1JR8A 3L6HA 4MBPA 1M2VB 1JW1A 4G78A 3IX1A 2R7WA 4E18A 4YT4A 1N0TA 5JT4A 1JPNA 4PFOA 4JRZA 4NF6B 4OHNA 4N8YA 1BTJA 4OQOA 4R2FA 4BPMA 4YICA 3H03A 3IQ5A 1RMVA 1DK4A 1NNTA 2RKMA 1G0HA 2XLOA 1FPIA 1EZ9A 4IGTA 2V4CA 4PJMA 3H6WA 2UUIA 4OMBA 2M8CA 1VOMA 3TTRA 2V26A 5L3QA 4JBZA 3MVYA 2H7BA 4WEPA 1OVTA 4XEKA 4M4GA 2FA7A 4KI0E 2IXMA 3HSTA 3RQEA 1N1CA 1MM6A 3G4XA 1OMPA 1B7HA 2DP8A 1E85A 3WAQA 3SEWA 2NOOA 2L6GA 3PPNA 3O66A 2V3CC 2J46A 2P1AA 3NKEA 1LCFA 4ANJA 2WKYA 1D3KA 2DWAA 4JWOA 1FBGA 5L0HA 4OVTA 3UGWA 3JYRA 3B0VC 3VE1B 4CJGA 4PAIA 2KNHA 3IHUA 2FBPA 4KCDA 2Q8MA 1NFNA 4HEAJ 3V8XB 1O64A 5B1BC 5I56B 3ONMA 1LPEA 2LCHA 3IOVA 2P3NA 2PF4E 4HCWA 4JXIA 1HW1A 1UQWA 5TP9B 3T9VA 3FJGA 2QS4A 1YZAA 4GIZA 2R7TA 4J30B 1NI9A 2OLBA 3MW0A 3S0XA 1UTHA 3TQLA 1NV0A 1NU9C 3C31A 2O7IA 4WGZA 3KL4A 1FAPB 3NYJA 2GFHA 4DBQA 2W7YA 1V55C 5ISUA 4XXUA 1S7YA 1NV1A 2FIEA 3KN8A 2WZGA 1HW2A 1PB8A 4YB6A 3O6GA 2O68A 2L81A 5CBRA 2GAQA 1TWAA 4ISUA 4IO5A 3ASOC 3TTKA 3U0CA 1T6UA 1G5ZA 5KYNA 2R8TA 3M8UA 2OWZA 4KYEA 2UUHA 2YL3A 1IXHA 4OEVA 1C02A 2XD3A 2VPOA 1WODA 2Q2CA 4ULWA 3FD3A 3NMJA 2HZ8A 1EH3A 3VAYA 2XLDA 3H2UA 4CS8C 2PX1A 2W45A 1WOLA 4E7SA 1VMAA 1BK4A 4IO2A 1Q35A 2HMQA 3S9MC 4NTBA 1Y4TA 1RKCA 3TJ5A 3DZAA 2CNWD 1L7CA 3S2VA 1EYJA 3Q29A 4R2BA 2ASRA 1XVYA 4EDPA 5IZ3A 1RKEA 2F3DA 3M4BA 2D21A 2Z23A 1PV3A 4NF4B 4MJOA 1PBPA 3FVGA 3K33A 4JIOA 2A5TB 1BDJB 5I58A 2FGYA 4LDRA 4RK9A 3VLUA 3TULA 1BZ4A 1NKXA 3UP9A 3QMKA 3PUXE 4PR9A 2Q3TA 2DWHA 3MSTA 5JP7A 3JSEO 4KNWA 3KMIA 2P0NA 2VD3A 3RPLB 4G68C 4F22A 2J9WA 1M57C 2QFLA 3A09A 3G3IA 3RTWB 1FPEA 2FYIA 2J8WA 4CS9C 1WATA 2H99A 5FTIA 1AH5A 4EF2A 2ZNTA 3V5YA 1T5OA 2D3IA 3SEYA 1RKEB 3UORA 3VFJA 5EYHA 2Y7RA 1MXVA 1P1WA 5L3VA 2QNLA 3GZGA 3PUYE 5I2NB 1US5A 4PFBA 5EQ7A 1D1AA 2CNWA 3I5PA 5DVWA 1UTHB 4NTAA 1QUKA 1LLSA 5JS5A 2CDQA 1FCKA 4KFQA 1M2VA 2X51A 3V5ZA 1ZYRF 2PFDA 3DI5A 1LFHA 4DZ1A 2CYDA 2EPKX 4JTAB 4P47A 1B46A 2A5SA 4R6KA 1NZEA 2F36A 3EGXA 4G8NA 4N8GA 1B0LA 4U5CE 3OO8A 3IFCA 3RH3A 4LZ8A 4RBNA 4MW8A 4F19A 2NUTB 5M2VA 2WVQA 3T6JA 1DPEA 2B3FA 2O1LA 2VCCA 2UXAA 4I1MA 1NNFA 5BWJA 4E0XA 3I4UA 1YAEA 2R7VA 4O6MA 3OEOA 3SKPA 2XLHA 2YL1A 2QMWA 2F7AA 3MP8A 4PC9A 3M79A 5ET6A 2HAUA 1PEBA 4JB7A 2Q8JA 2XD2A 1S7ZA 1EZPA 3FZVA 1Y9UA 1NUZA 3V5XA 1BR1A 4G7OF 3FOOA 3JTLO 2HXWA 3Q6NA 3T9XB 4ESXA 3VF0A 1YTVA 3FXBA 2OQMA 3JT1A 1N3XA 2DQVA 4XKNA 2XXAA 3EGXB 1VR5A 2ZZVA 3EFOA 4YWQA 3LV0A 2EINC 3SXMA 3B6TA 4R72A 4BJ6C 2P6VA 2YPNA 4JVDA 3O6HA 4NF4A 2NXOA 1GV8A 4K1OA 2DYXA 4IAOA 1NV7A 2Q89A 3W8IA 2XWKA 1OKKD 4U5HA 1IMDA 1F9BA 3I3VA 4NTFA 3EN3A 5L0GA 4CIHA 4A4AA 2RCBA 3LSFB 1K05A 3TMGA 2ONRA 1HSLA 2OJQA 4PAFA 5H8FA 3N24A 1Z7Qc 1XWJA 4IO7A 1IW7F 4QFOA 1R9QA 2DB4A 3HCQA 3EFOB 3JCUQ 1D9VA 2F5XA 3LC8A 3V83A 1S50A 5CI5A 4YB7A 4HCYA 2ZPAA 4RA1A 5HV9A 4D4XA 2Q9BA 2ANJA 1FQDA 1Q9DA 2ZMBA 3HO7A 3IQTA 4C0RA 2REJA 1ZW2A 4F3SA 1Q0FA 1N84A 1R6ZA 2H8AA 4JVCA 2L6FA 4YMBA 2DWJA 4IO6A 4MNCA 5AA4A 2I0CA 1ZBMA 4ZLCA 3K01A 1BBHA 4J7YA 2VB6A 5D91A 5I59B 4YAHX 4X1BA 2UYEA 3E3KA 1FPFA 3U8QA 5T3JA 3PU5A 2JPUA 3N2ZB 5A6JA 3QMFA 1RJ9A 2I3VA 2WB7A 4JKVA 4Z9IA 2BJIA 4GL0A 3SXZA 2HPGA 4PK4A 3KBZA 5I58B 3THIA 3O2AA 5DQZA 3Q7GA 3W9WA 2DOJA 5F7VA 2YLGA 3C63A 3GM3A 4ZZEA 3E78A 4HE1A 3MZ9A 3K66A 5T3WA 1MQIA 2XM0A 2DDKA 2OJTA 1AL3A 3AG2C 1PBQA 4H8JA 3MP6A 3P7IA 4I8CA 1DOTA 4JWYA 3C8GA 1Q1KA 4HW8A 4YU0A 4LACB 3EHNA 5IGAA 3E70C 3TQWA 2EILC 4ZECA 5AA2D 3G3KA 1WWPA 2P2AA 1USYE 3JSZA 1XI6A 4MQ9F 1B1HA 2NSFA 2I49A 4N6CA 3UN6A 1QVXA 4N6PA 1FNTc 2RINA 4KYDA 3S84A 3I5QA 2V84A 2PCRA 5ET8A 4Q4ZF 1NNPA 2H25A 1MXUA 3RLFE 4WXJA 1Y4CA 2OG2A 1QULA 3NG1A 1A7EA 2WL8A 1ZJLA 4NGUA 3UK4A 3TDJA 4YKIA 2PX0A 3H7MA 4DRIB 1B6HA 1FPJA 1XHYA 2A69F 4POXA 4P9KA 1W2WA 2J9BA 3K02A 2LD6A 5KYUB 1OXKA 4PFPA 1G4WR 3E79A 2ESNA 2VD2A 1K9YA 2AIXA 4YL0A 1ORJA 2A1DD 1YJGA 3S9OA 1TXFA 3HHGA 1JVYA 4N91A 5E3AA 4EBBA 2E1SA 1JEUA 5KCJA 3DM0A 1YVIA 1Y6DA 1Z23A 4P1LA 5CI8A 2CZIA 3EH1A 4D4NA 1LI7A 2QVUA 3GYYA 4ZLDA 3CI8A 3ISPA 1HSEA 3A3CA 2XLVA 1Y3PA 5KZTA 3SZRA 1A40A 1LKXA 3PCVA 3OD7A 1B9JA 5EHHA 4CS8A 4PETA 4WEDA 2OEXA 3BKIB 3T9UA 3ABLC 3ZIBA 5B3SC 3RY3A 1LB8A 1I6BA 4GL8A 3LSWA 4ZEKA 4CS7A 2UVIA 4G8MA 3L34A 4U1OA 3R6UA 4QRZA 3RW0A 3EGDA 2F78A 3LLIA 2O51A 1NSGB 3U3BA 5KCJB 3HNKA 3LESA 4H4KC 4LATA 1QKRA 2XXUA 3WHNA 4GXSB 5CM6A 2ZD9A 4AE4A 4HXVA 2A0BA 3RT6B 4AS4A 3H4ZA 5IKBA 4RPNA 3G3FA 4R6HA 1POTA 3N6UA 3JV9A 4E17A 1AMFA 1VYIA 4HFKB 5CI9A 4P6IC 1I69A 1YARO 1TFOB 2EIMC 2R25A 5COGA 3B7DA 4LP2B 4N6HA 4EUKB 4FWVA 4IAQA 4FEBA 1L3PA 4I1DA 5J16A 2KSFA 2MWQA 3QSLA 1MXXA 3WAEA 2ZXRA 4FECA 1Y3QA 3ILTB 3IL1B 3QW1A 4NTLA 4AL0A 2M64A 2HSBA 1T0KA 3OEKA 1MMNA 4POWA 3C8GB 1MDP1 3E13X 2NPUA 3VLVA 2DXYA 4MFIA 1BLFA 1NV5A 1VFEA 4DRHB 2NUPB 2V3QA 5A5LA 2CW0F 5LDZA 4R74A 1VSOA 2H5YA 3U8PA 4ZS9A 3NMIA 3KFMA 1A55A 2DVZA 3PDMP 3U94A 4ELOA 4CSAA 3MVWA 1ANFA 5EQ8A 1XOCA 1H6GA 3EHSA 5KDTB 4DJ9A 1URDA 4DVYP 4QDLA 1GQAA 4YJWA 2P7VA 1JW5A 3EG9B 4MVZA 4RYAA 1Y1ZA 3X2QC 2WEFA 4ZDMA 1V4AA 4N4WA 3HPIA 3HV1A 1I6QA 3JYHA 4KHZE 4PJNA 2LSEA 1FTLA 2QVRA 4NF0A 4EBKA 1MXZA 4PAKA 2WZFA 3MYUA 3FUZA 3F46A 5T3TA 3AG3C 2XXVA 4NF5A 4O6YA 3PMRA 4MTFA 4X1DA 2P0SA 1WN0A 2VHAA 3ZKLA 2BJJX 3GWNA 4Z9HA 3U2LA 1TQGA 1VLSA 2A6EF 3LBSA 1JVXA 1B4ZA 2DE3A 2W4BA 2ONSA 3OO7A 1Z3IX 2KQZA 5H8NA 3GLBA 4ZEIA 2XXHA 3H06B 4DXUA 3KH2A 1VE4A 2HJ3A 2J9VA 3B71A 1SPIA 4DIGA 4X8RA 5I2KA 3RGYA 4P9FA 4LDKA 3DAGA 1RCPA 3O10A 1VTMP 2B0HA 2V3TA 3FAJA 3NKDA 5A6BD 4O7IA 2XXKA 1MPBA 5KYXB 1G0IA 4Q7CA 3AJMA 1A7VA 5A5XB 1NL5A 3FJ7A 1D1CA 4FAPB 3DM5A 3GWLA 5H8HA 5ITOA 2I6EA 2ZNUA 3LAYA 4OIPF 1MY0A 4OENA 3CHGA 1LBBA 2G3KA 1LB9A 2EPNA 4U1ZA 1N04A 1B4HA 3C4MA 4YK5A 4CDVA 4KD5A 3UR3C 3H6TA 4K3FA 5JTYA 2Q7RA 4I62A 4F3PA 2GRVA 3D4CA 1Y1MA 1B05A 1BKAA 1QUIA 3OOAA 4N13A 3CSBA 4R9GA 4PFUA 1AUEA 1IXIA 2O7UA 3DELB 1FJ9A 1LBCA 2VGQA 1T01A 3TCGA 3AXFA 4MTGA 2I0BA 4R73A 3GEHA 1FFHA 4XPXA 1B52A 1FTKA 4FJPA 4AL1A 3W15C 4U2RA 3BIHA 5EYFA 3IJXB 2WVNA 2PX3A 5J1DA 3CG1A 1BP5A 4EUOA 4EIYA 4QFLA 3TZAA 1QPUA 1B3FA 2BC5A 5AA3A 1URGA 2AYSA 5DT6A 4JJGA 4BDMA 2IA4A 3KBRA 3V5AA 3QAXA 1BIYA 4PFYA 5FTHA 1UFBA 4G7ZF 5KYWB 3KOTA 3S27A 1EQ1A 2O69A 4AX2A 4ULVA 2XXXA 4O7MA 4DRJB 3FGSA 3Q7LA 2PYYA 3T93B 1A54A 2OBGA 4TLLB 4F1VA 2GWWA 5EHSA 4C7OB 1FPKA 2PVUA 1QQ3A 4RD9A 4LQ5A 3RQGA 1MQDA 3DP4A 4G68A 3HNIA 4LZ7A 3TEPA 2B0JA 3KYJA 1J1NA 3U5SA 2F35A 1MQGA 2E0SA 2R02A 3LUYA 3MBPA 1TR2A 5FZTA 1GR2A 1ZTYA 3VVDA 2KYHA 3S4UA 1M5CA 2QS3A 3TUSA 1GGQA 4MMPA 2G62A 3NRHA 2Y7WA 4OYVA 1OW6A 4CBEA 4W8PA 5L0CA 4BG0A 4NCQA 2CZLA 2QJEA 4E0HA 3USDA 2PBWA 1MY4A 1WGWA 2HFBA 2H98A 1A7DA 3M1CB 3RPWA 5IM2A 1OQHA 1BR4A 3NMKA 3M3FA 1V54C 4QI2A 2XS8A 1KWHA 3TTLA 1XT8A 4MH5A 1MY3A 5L8DA 1KU2A 4OIRF 4C7OA 4DE8A 4RJZA 3MLGA 4ONSA 4HTGA 1FSAA 3S90A 2XWIA 5AA1A 3SETA 5KYYA 5I56A 3VVFA 3A9CA 1DCUA 1FPGA 3LS0A 3VM6A 2LAOA 1TWHA 3IFAA 3SEXA 4IY6A 5L9OA 4R6YA 1K40A 5A5XA 2UVJA 4EF1A 2QS2A 2XX9A 1FTSA 1D0XA 4PDHA 3PHF2 1ORSC 1BR2A 1B5IA 2QTVA 2XXTA 3MBGA 2PBEA 2XL8A 1DTZA 2DS9A 2F7CA 3B9QA 1D1BA 3OEMA 4ESWA 2VCAA 4FE8A 4FESA 1DMBA 1XZPA 3DXJF 1A0BA 1LM3B 2H7VC 1QW0A 1QJMA 2RC8A 4JEBA 5HSWA 1E84A 2JD3A 2YRFA 4EWCA 2OJED 4OESA 3PUWE 3M3LA 3PPPA 1YA7O 3TOLA 4NE4A 3E9VA 2DSFA 1B40A 1UTBA 4XF5A 2NSGA 1FMWA 1IMBA 2YHSA 4U23A 2ZXTA 2L6HA 1LFGA 4H5GA 1M5FA 2FHYA 2XXPA 1IZMA 1EA8A 3RIPA 3GEIA 3QW0A 1N7XA 1MH3A 3ECSA 3O97A 3IOUA 4L17A 4P3LA 2XL4A 5EK0A 2XA5A 3EQ1A 4H8IA 1OLCA 1AEPA 2H9BA 4R75A 3K1PA 4ZE9A 3R7CA 2CEYA 5TPAB 1YYJA 5TP9A 1SI1A 3CFXA 2AL5A 1FJ6A 4H5FA 5DS4A 1F1MA 3E9XA 2NUTA 1URSA 2Q4FA 1CB6A 1OCRC 2YQYA 3UMKA 4NG7A 4XEFA 4DXBA 2IXPA 2HMZA 2J0WA 2WBDA 1YZ0A 4HS7A 2Q88A 4JDFA 4CDAA 1G4US 1JAFA 1H76A 1PDAA 1QGXA 1FTOA 2PFZA 1DOVA 3PPQA 3C62A 4WKMA 2F8DA 4FATA 5B70A 3D4GA 3IOTA 3U92A 4LA9A
chains in the Genus database with same CATH topology
4I8CA 5DVJA 4ELRA 3TTMA 3QUJA 1DOTA 3EHUA 3B6QA 1Q1KA 3H3GA 4JWYA 5I2NB 1JW4A 3PPOA 4HW8A 4F31B 1ZU0A 4YU0A 1USYH 3BFUA 3TQWA 1XC1A 5AA2B 4ZECA 1P99A 3G3KA 5AA2D 2P2AA 4QSCA 1ZLQA 1USYE 3E4RA 4LZ5A 5ICQA 4QSEA 1B1HA 3SEUA 2I49A 3GXAA 4P0GA 4X1BA 1B51A 4G77A 3TTNA 3UN6A 2HZLA 1B32A 3O6IA 2Q9TA 3T96B 3QIMA 3G7WA 1ELJA 4N6PA 3FVKA 3GBAA 4G4PA 2RINA 4KYDA 4OERA 5CMCA 3VLWA 4FIMA 2V84A 4ONYA 1AIVA 2Y7KA 1NMUA 2XXWA 1NNPA 1D4NA 1YCJA 2H25A 1MXUA 3RLFE 1SW4A 4WXJA 1Y4CA 4TOZA 1P1OA 5L9MA 5DTBA 1QULA 1LAHE 3T9HB 4O3CA 1FQFA 2GHAA 1ZJLA 3KGCA 4U4SA 3UK4A 1RKMA 4YKIA 2Z8EA 3G3GA 1GVCA 2NVUB 3TDJA 4X9TA 3H7MA 5EHMA 4EXLA 5H8NB 1XHYA 1B6HA 1H44A 3R26A 4OFOA 4BDOA 3RTFB 3S9NC 4POXA 5AA2A 2XX8A 4U21A 3K02A 1LCTA 1IXGA 4C1UA 4EQ9A 2XXRA 4G2ZA 4PQJA 2ESNA 2O1MA 2VD2A 3C32A 2AIXA 3K00A 1O7TA 1OQGA 2LFDA 5F1QA 2Z8DA 1IEJA 1OIBA 5CMMA 5CMBA 1L5TA 1TXFA 3HHGA 4NEDA 3O29A 1QUJA 1JVYA 1UTBB 2I4CA 1MM7A 2NUVA 3O9PA 1B7ZA 1B5JA 2I48A 3IOTA 3FXRA 2E1SA 1JEUA 4GXAA 3DM0A 1ZKBA 3U92A 1MDQA 5KCJA 2QL3A 4IB2A 3V89B 4G8HA 4H1XA 4XIGQ 2R9JA 1MS7A 4IY5A 3OELA 4RXLA 2Y7IA 3CI8A 4GRKA 3TPAA 1HSEA 3A3CA 5H8SA 4F2QA 5TPAA 2OCUA 2REGA 4R9FA 1Y3PA 5KZTA 1A40A 1OVBA 3I5OA 2I4BA 2I3WA 3IAZA 4ND9A 5ICTA 2F6PA 3OD7A 1B9JA 3ZS6A 3T66A 3IORA 1A8EA 3WAFA 4PETA 1MH4A 2HQ0A 4WEDA 3L6HA 4EXKA 3BKIB 1H3DA 4MBPA 1B7UA 3IB1A 3T9UA 4ELPA 2Y7PA 1JW1A 3RY3A 1LB8A 3IX1A 3K2DA 1I6BA 4JSOA 1B2HA 4GL8A 3LSWA 3K6WA 4ZEKA 3EPEA 2UVIA 4G8MA 1N0TA 4U1OA 3R6UA 4QRZA 3OO6A 4NF6B 2RC7A 4OHNA 4F1YA 2F78A 1H45A 1MPCA 1BTJA 4OQOA 4R2FA 3UA8A 4YICA 2O51A 3H03A 1B5HA 1NNTA 3IJOB 5KCJB 2RCAA 3OO9A 2RKMA 3KN7A 5KDTA 4LATA 3FIRA 2XXUA 5CM6A 4GXSB 3DP6A 4PFWA 2NWJA 4EQBA 1EZ9A 4IGTA 1ZMGA 3S9EA 3H6WA 4OMBA 2M8CA 3RT6B 4Q30B 3N26A 3H4ZA 3TTRA 5B70A 5IKBA 4RPNA 4QSDA 3G3FA 4JBZA 4R6HA 3MVYA 5ITPA 1POTA 3N6UA 2ZYOA 3JV9A 3OMBA 3PMWA 4JSDA 5CC2A 4WEPA 1AMFA 1I69A 3U1OA 1OVTA 4M4GA 4BDNA 5JEIA 2FA7A 3SERA 4KI0E 2R71A 3HSTA 5DYHA 3B7DA 4LP2B 3MZBA 4G68B 4FEBA 1MM6A 5TU0A 5I2NA 1OMPA 2QPQA 1B7HA 4I1DA 5JK4A 2DP8A 3QSLA 1MXXA 1SBPA 2KLFA 3ILUB 3WAEA 1M5BA 4FECA 3SEWA 1Y3QA 2NOOA 3EHTA 3ILTB 3IL1B 3KJTA 3PPNA 3O66A 3PV0E 4F3SA 3C33A 4NTLA 1LCFA 5DEXA 3RN8A 1TFDA 2Z8FA 3IOWA 3FV1A 5LOMA 1T0KA 2WKYA 1D3KA 1YPNA 2DWAA 3OEKA 4JWOA 4UACA 2YLNA 3C36A 4POWA 3UGWA 1MDP1 3E13X 3JYRA 2THIA 3K6XA 3VLVA 4GFRA 3VE1B 2DXYA 4MFIA 5IAIA 1BLFA 1VFEA 1FTMA 3TFLA 3RNNA 2V3QA 4KCDA 4GD5A 3V8XB 4ESWA 1O64A 4R74A 3VDFA 1VSOA 5I56B 3ONMA 3H6VA 2H5YA 3IOVA 4IO4A 4ZS9A 3KFMA 1XVXA 4HCWA 4JXIA 1H43A 1A55A 1UQWA 5TP9B 2DVZA 3T9VA 2ZYKA 3FJGA 3U94A 2QS4A 3MVWA 4GIZA 4ELOA 4F29A 3I6VA 4Q8RA 2XXYA 4YKJA 1POY1 1ANFA 3MPKA 3QXMA 3U93A 1Y3NA 3K0VA 1ZIUA 1XOCA 3MP6A 4IO3A 3EHSA 3TODA 2OLBA 3MW0A 5KDTB 4GLIA 1URDA 1UTHA 3TQLA 4KPTA 3C31A 2O7IA 2LFFA 2X7PA 4BLAA 1JW5A 1RYOA 4Q5TA 4YMAA 3TKDA 4RYAA 1Y1ZA 2W7YA 3OSRA 4ZDMA 2HCAA 4Z7EA 5ISUA 3HPIA 1S7YA 3IB0A 4TQUQ 4XXUA 3HV1A 1I6QA 1LAFE 4GWOA 2ABHA 4KHZE 2FNCA 4PP0A 3KN8A 5L9SA 1FTLA 2ZNSA 4U4XA 5DVIA 1MXZA 3TAJA 1EU8A 1TFAA 3MAMA 2VOZA 1PB8A 3PD9A 4YB6A 3O6GA 2O68A 3KG2A 4OFJA 5CBRA 4ISUA 1GGGA 3FUZA 5CBSA 2XXVA 4NF5A 2AL4A 4OTEA 4IO5A 4XKQA 4X1DA 2IEEA 2P0SA 3TTKA 2VHAA 3U72A 3ZKLA 2UYFA 3Q27A 2BJJX 3M8UA 3ZKKA 4KYEA 1IXHA 4OEVA 4LUBA 4UA8A 1O63A 2ZYMA 2XD3A 4OETA 3LBSA 1WODA 1JVXA 1B4ZA 2DE3A 1B3LA 1HSJA 2Q2CA 3FD3A 2ONSA 3KOSA 3PMXA 4QFKA 3BBRA 3OO7A 5H8NA 2HZ8A 2V25A 3GLBA 4LVQA 4ZEIA 2XXHA 1EH3A 4OZ9A 5K2YA 3H06B 4DXUA 1Z7ME 1VE4A 1CE2A 2PX1A 4AB5A 3QK6A 4DIGA 5I84A 3G3HA 4I9DA 2O84X 1SD3A 2QS1A 4PE5B 5I2KA 1OLAA 4IO2A 4GQOA 3RGYA 3MVZA 3QYTA 1Q35A 1R9LA 4KCCA 3S9MC 4QFPA 3PGFA 1JNFA 1NFTA 1Y4TA 2V3TA 1SVXB 4O3AA 3IB2A 1PB9A 4KR5A 3RUMA 3S2VA 4ZEBA 3Q28A 1MPBA 3B6WA 3FVNA 5DVFA 2R6GE 3Q29A 4OEUA 1XS5A 4H0WA 1VFDA 3BFTA 3LSLA 4FORA 4R2BA 4YKPA 1NL5A 3FJ7A 5A5XB 1US4A 1SI0A 1SDXA 1XVYA 1TWYA 1GTKA 4EDPA 3PUZE 5H8HA 4ELQA 5ITOA 2G93A 2I6EA 2ZNUA 3KJ7A 2D21A 1MY0A 2Z23A 4OENA 1LBBA 1LB9A 4U1ZA 1N04A 1B4HA 3C4MA 2Y84A 1NNKA 3MWBA 4NF4B 4X48A 3KN3A 3MQ9A 4KD5A 3MP1A 1PBPA 3FVGA 1LFIA 3H6TA 4K3FA 5JTYA 2A5TB 5I58A 4I62A 4RK9A 2RC9A 3SEVA 3VLUA 4F3PA 2GH9A 2GRVA 3D4CA 3C35A 3PPRA 1Y1MA 4NF8A 1B05A 1BKAA 1NKXA 1QUIA 2OWTA 3OOAA 4N13A 4QFNA 5DEXB 3UP9A 3W9VA 3CSBA 3PUXE 4R9GA 1NH7A 3KEIA 4PFUA 4ZEFA 1IXIA 3Q26A 2DWHA 2O7UA 4P11A 5H8QB 1N3WA 3DELB 3DP8A 4N07A 3CFZA 5FHOA 4AB6A 2B65A 1LBCA 2VGQA 5I59A 2GHBA 2VD3A 3TCGA 3K6VA 4G68C 4XKRA 4F22A 3AXFA 4F18A 2HZKA 3A09A 2I0BA 3G3IA 3JZJA 4R73A 3RTWB 1B52A 1FTKA 3C9HA 4FJPA 4OWDA 3W15C 5CMKA 2FYIA 1UIUA 4U2RA 2PT2A 5EYFA 3IJXB 4H6DA 1MXYA 2H99A 1A7LA 5FTIA 1AH5A 3K1MA 2DWIA 4DCYA 3FV2A 4FAJA 5J1DA 3CG1A 1BP5A 4EUOA 3FXUA 1NH8A 4EF2A 1JQFA 2ALUA 2YJPA 2ZNTA 5M2VA 2D3IA 4QFLA 3TZAA 2B3BA 4Q0CA 3SEYA 4QF9A 3UORA 1B3FA 2F97A 1MY2A 1QKBA 3KSJA 3VFJA 5AA3A 1URGA 4TLMB 2OWSA 2Y7RA 2AYSA 5DT6A 4BDMA 4P0IA 1MXVA 1B1XA 1P1WA 2IA4A 3GZGA 1FQCA 1Z7NE 3KBRA 3PUYE 2H4IA 3QAXA 3N6TA 1BIYA 1US5A 1MQJA 2OK2A 4NF8B 4PFYA 5FTHA 4AQ4A 5I57B 3KOTA 2O69A 3CIJA 4ECFA 4PFTA 1UTHB 2XXXA 3FGSA 2PYYA 3PD8A 1QUKA 1A54A 4OVJA 1LLSA 3T93B 4BDRA 1M5DA 2OBGA 4TLLB 2DXRA 4F1VA 1FCKA 4KFQA 5EHSA 1FQAA 1Y20A 4H67A 3MUQA 4RY1A 2PVUA 4YB5A 1WDNA 4OFLA 3VVEA 1LFHA 2V3UA 1N76A 3FATA 3DP4A 1MQDA 4G68A 2O6AA 4LQ5A 4DZ1A 4LZ7A 4R6KA 1LSTA 3TEPA 1B46A 2A5SA 1EZOA 3CR9A 3FXQA 1J1NA 2F36A 2F35A 1FQBA 1MQGA 4G8NA 5FHMA 4OXVA 2E0SA 4F1UA 3Q25A 4F3GA 1B0LA 3LUYA 4O3BA 4C1TA 5HPQA 3MBPA 3OO8A 1GR2A 1N7WA 1ZTYA 5ELVA 3VVDA 4LZ8A 3S4UA 1M5CA 1FW0A 1ATGA 2QMXA 2QS3A 3TUSA 2Z22A 1LAGE 4F19A 2Y7WA 2DVCA 4GVOA 4OYVA 1RYXA 2CZLA 2HAVA 1DPEA 1TT1A 2QJEA 4RPOA 4U22A 4DCXA 2B3FA 2QRYA 3USDA 2O1LA 2PBWA 2UXAA 5I57A 1LGBC 1NNFA 3IO4A 5BWJA 4E0XA 1MY4A 2HFBA 2XXIA 2H98A 1MG1A 1YAEA 3RPWA 3CSGA 1OQHA 3SKPA 2V93A 2Q2AA 3M3FA 3A3UA 3H6UA 1IXCA 1KWHA 2F7AA 2QMWA 3MP8A 3PUVE 1XT8A 4MH5A 3TTLA 1MY3A 3EF7A 1MQHA 1UIVA 2HAUA 1WVJA 2ONKE 5H8HB 2RF1A 5HBCA 1PEBA 5JTYB 4JB7A 2Q8JA 4ZE8A 2XD2A 2HEUA 5L8DA 4JWXA 4DE8A 4RJZA 3S9LC 3FZVA 4HTGA 1B3HA 4MF3A 4Z0IA 3PMVA 5AA1A 3ZSFA 3SETA 1Y9UA 3MVXA 4GOTA 3ECRA 2HXWA 3T9XB 4ESXA 2F7BA 5I56A 1YTVA 3VVFA 1AOVA 3C34A 4F39A 3FVOA 4NF5B 4RNSA 1M5EA 2LAOA 3SEXA 4IY6A 5L9OA 1N3XA 2DQVA 2XX7A 3N94A 4R6YA 2F34A 2UVGA 5A5XA 2UVJA 4XKNA 3TELA 4EF1A 5FHNA 1B3EA 5AE4A 1MPDA 1VR5A 3ODBA 2QS2A 1IIWA 2X26A 2VP1A 1DPPA 2XX9A 3GBBA 4NMYA 4XTCQ 5B7DA 4KQPA 2QSXA 2PMSA 3TYHA 2I58A 1B5IA 3B6TA 4R72A 2YPNA 1EZPA 3O6HA 2XXTA 4NF4A 2NXOA 1GV8A 2DYXA 1B58A 1SYHA 2Q89A 2DS9A 1DTZA 2F7CA 3FASA 3OEMA 3SDFA 1S9TA 4QHQA 1MXWA 1R1NA 1SW2A 4FE8A 3G3JA 1DMBA 1F9BA 1JETA 1PC3A 3IK6B 1FQEA 3I3VA 3O28A 5HM4B 3EN3A 1IITA 2RCBA 3LSFB 3TMGA 1QW0A 5BUUA 1QJMA 2ONRA 1SW5A 2RC8A 1HSLA 2GFEA 3K6UA 3LSXA 3MC2A 3LR1A 1IUDA 5H8FA 4DLDA 1P1QA 4IO7A 5H8QA 1MRPA 4QFOA 4F2OA 1R9QA 3VXBA 3TCFA 3RT8A 3K1NA 4NWDA 4OESA 3UIFA 3HCQA 3PUWE 2F5XA 1LAXA 1D9VA 2ZYNA 1B0HA 2F6GA 1S50A 3LC8A 3M3LA 3PPPA 5CI5A 5H8FB 2XHDA 3V83A 4YB7A 4HCYA 4RA1A 1MY1A 4NE4A 1II5A 2DSFA 4KYSA 1B40A 1IZ1A 4MLQA 1UTBA 4XKPA 4LA9A 2DE4A 1JEVA 1D9YA 2ANJA 4U23A 1FQDA 5CRYA 2ZXTA 2ZMBA 3HO7A 1SW1A 4YKKA 5AA4B 3FJMA 1LFGA 3SESA 2REJA 3U8VA 3HN0A 4H5GA 4C0RA 1M5FA 1N84A 1R6ZA 1I6AA 2X7QA 2XXPA 3IR1A 4LQ2A 2A5TA 3VV5A 4E0WA 4YMBA 2DWJA 1SQYA 4IO6A 5I2KB 1SYIA 1A99A 3R7XA 1N7XA 5AA4A 1MH3A 3CG3A 3M3KA 3MJNA 3O97A 4M1VA 3QUFA 2I0CA 4FEDA 3IOUA 4H65A 4RK2A 1ZBMA 3K4UA 3KSXA 3K01A 4L17A 3L6GA 3EQ1A 4BDQA 4H8IA 4YZZA 4EQ7A 4BDLA 1OLCA 2H9BA 1PB7A 4R75A 3K1PA 3RQTA 1P1UA 4F3BA 4ZE9A 5I59B 5TPAB 3IO6A 4YAHX 5TP9A 3KZGA 4ZZAA 1SI1A 3CFXA 4GF8A 2AL5A 4DXCA 1DSNA 1QKAA 2UYEA 1IQ7A 1FTJA 2D5WA 3CRBA 3E3KA 3E9XA 4H5FA 3DLNA 4NWCA 3TCHA 3U8QA 3OXNA 3PU5A 1A8FA 3T22A 1URSA 2I3VA 1CB6A 2P1SA 4ZEDA 4THIA 4LONB 2CMOA 1P1NA 4H8JA 4GL0A 2PT1A 4DDDA 5I58B 2XXQA 3THIA 4IGRA 3CFLA 2OZZA 3O2AA 4DXBA 1DTGA 1B3GA 2DOJA 3V5AA 3W9WA 3OSQA 4HS7A 5F7VA 2DE2A 4MLVA 2Q88A 4JDFA 2G29A 3VXCA 3HHFA 3N5LA 4NF6A 4ZZEA 3MZ9A 1H76A 1PDAA 1MQIA 3MPLA 1FTOA 3PPQA 5K2XA 1QVSA 3CVGA 4WKMA 2F8DA 2OJTA 2UVHA 1AL3A 3MZ1A 3OENA 3D4GA 1PBQA 4FATA 3F11A 3P7IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I8C A;  5DVJ A;  4ELR A;  3TTM A;  3QUJ A;  1DOT A;  3EHU A;  3B6Q A;  1Q1K A;  3H3G A;  4JWY A;  5I2N B;  1JW4 A;  3PPO A;  4HW8 A;  4F31 B;  1ZU0 A;  4YU0 A;  1USY H;  3BFU A;  3TQW A;  1XC1 A;  5AA2 B;  4ZEC A;  1P99 A;  3G3K A;  5AA2 D;  2P2A A;  4QSC A;  1ZLQ A;  1USY E;  3E4R A;  4LZ5 A;  5ICQ A;  4QSE A;  1B1H A;  3SEU A;  2I49 A;  3GXA A;  4P0G A;  4X1B A;  1B51 A;  4G77 A;  3TTN A;  3UN6 A;  2HZL A;  1B32 A;  3O6I A;  2Q9T A;  3T96 B;  3QIM A;  3G7W A;  1ELJ A;  4N6P A;  3FVK A;  3GBA A;  4G4P A;  2RIN A;  4KYD A;  4OER A;  5CMC A;  3VLW A;  4FIM A;  2V84 A;  4ONY A;  1AIV A;  2Y7K A;  1NMU A;  2XXW A;  1NNP A;  1D4N A;  1YCJ A;  2H25 A;  1MXU A;  3RLF E;  1SW4 A;  4WXJ A;  1Y4C A;  4TOZ A;  1P1O A;  5L9M A;  5DTB A;  1QUL A;  1LAH E;  3T9H B;  4O3C A;  1FQF A;  2GHA A;  1ZJL A;  3KGC A;  4U4S A;  3UK4 A;  1RKM A;  4YKI A;  2Z8E A;  3G3G A;  1GVC A;  2NVU B;  3TDJ A;  4X9T A;  3H7M A;  5EHM A;  4EXL A;  5H8N B;  1XHY A;  1B6H A;  1H44 A;  3R26 A;  4OFO A;  4BDO A;  3RTF B;  3S9N C;  4POX A;  5AA2 A;  2XX8 A;  4U21 A;  3K02 A;  1LCT A;  1IXG A;  4C1U A;  4EQ9 A;  2XXR A;  4G2Z A;  4PQJ A;  2ESN A;  2O1M A;  2VD2 A;  3C32 A;  2AIX A;  3K00 A;  1O7T A;  1OQG A;  2LFD A;  5F1Q A;  2Z8D A;  1IEJ A;  1OIB A;  5CMM A;  5CMB A;  1L5T A;  1TXF A;  3HHG A;  4NED A;  3O29 A;  1QUJ A;  1JVY A;  1UTB B;  2I4C A;  1MM7 A;  2NUV A;  3O9P A;  1B7Z A;  1B5J A;  2I48 A;  3IOT A;  3FXR A;  2E1S A;  1JEU A;  4GXA A;  3DM0 A;  1ZKB A;  3U92 A;  1MDQ A;  5KCJ A;  2QL3 A;  4IB2 A;  3V89 B;  4G8H A;  4H1X A;  4XIG Q;  2R9J A;  1MS7 A;  4IY5 A;  3OEL A;  4RXL A;  2Y7I A;  3CI8 A;  4GRK A;  3TPA A;  1HSE A;  3A3C A;  5H8S A;  4F2Q A;  5TPA A;  2OCU A;  2REG A;  4R9F A;  1Y3P A;  5KZT A;  1A40 A;  1OVB A;  3I5O A;  2I4B A;  2I3W A;  3IAZ A;  4ND9 A;  5ICT A;  2F6P A;  3OD7 A;  1B9J A;  3ZS6 A;  3T66 A;  3IOR A;  1A8E A;  3WAF A;  4PET A;  1MH4 A;  2HQ0 A;  4WED A;  3L6H A;  4EXK A;  3BKI B;  1H3D A;  4MBP A;  1B7U A;  3IB1 A;  3T9U A;  4ELP A;  2Y7P A;  1JW1 A;  3RY3 A;  1LB8 A;  3IX1 A;  3K2D A;  1I6B A;  4JSO A;  1B2H A;  4GL8 A;  3LSW A;  3K6W A;  4ZEK A;  3EPE A;  2UVI A;  4G8M A;  1N0T A;  4U1O A;  3R6U A;  4QRZ A;  3OO6 A;  4NF6 B;  2RC7 A;  4OHN A;  4F1Y A;  2F78 A;  1H45 A;  1MPC A;  1BTJ A;  4OQO A;  4R2F A;  3UA8 A;  4YIC A;  2O51 A;  3H03 A;  1B5H A;  1NNT A;  3IJO B;  5KCJ B;  2RCA A;  3OO9 A;  2RKM A;  3KN7 A;  5KDT A;  4LAT A;  3FIR A;  2XXU A;  5CM6 A;  4GXS B;  3DP6 A;  4PFW A;  2NWJ A;  4EQB A;  1EZ9 A;  4IGT A;  1ZMG A;  3S9E A;  3H6W A;  4OMB A;  2M8C A;  3RT6 B;  4Q30 B;  3N26 A;  3H4Z A;  3TTR A;  5B70 A;  5IKB A;  4RPN A;  4QSD A;  3G3F A;  4JBZ A;  4R6H A;  3MVY A;  5ITP A;  1POT A;  3N6U A;  2ZYO A;  3JV9 A;  3OMB A;  3PMW A;  4JSD A;  5CC2 A;  4WEP A;  1AMF A;  1I69 A;  3U1O A;  1OVT A;  4M4G A;  4BDN A;  5JEI A;  2FA7 A;  3SER A;  4KI0 E;  2R71 A;  3HST A;  5DYH A;  3B7D A;  4LP2 B;  3MZB A;  4G68 B;  4FEB A;  1MM6 A;  5TU0 A;  5I2N A;  1OMP A;  2QPQ A;  1B7H A;  4I1D A;  5JK4 A;  2DP8 A;  3QSL A;  1MXX A;  1SBP A;  2KLF A;  3ILU B;  3WAE A;  1M5B A;  4FEC A;  3SEW A;  1Y3Q A;  2NOO A;  3EHT A;  3ILT B;  3IL1 B;  3KJT A;  3PPN A;  3O66 A;  3PV0 E;  4F3S A;  3C33 A;  4NTL A;  1LCF A;  5DEX A;  3RN8 A;  1TFD A;  2Z8F A;  3IOW A;  3FV1 A;  5LOM A;  1T0K A;  2WKY A;  1D3K A;  1YPN A;  2DWA A;  3OEK A;  4JWO A;  4UAC A;  2YLN A;  3C36 A;  4POW A;  3UGW A;  1MDP 1;  3E13 X;  3JYR A;  2THI A;  3K6X A;  3VLV A;  4GFR A;  3VE1 B;  2DXY A;  4MFI A;  5IAI A;  1BLF A;  1VFE A;  1FTM A;  3TFL A;  3RNN A;  2V3Q A;  4KCD A;  4GD5 A;  3V8X B;  4ESW A;  1O64 A;  4R74 A;  3VDF A;  1VSO A;  5I56 B;  3ONM A;  3H6V A;  2H5Y A;  3IOV A;  4IO4 A;  4ZS9 A;  3KFM A;  1XVX A;  4HCW A;  4JXI A;  1H43 A;  1A55 A;  1UQW A;  5TP9 B;  2DVZ A;  3T9V A;  2ZYK A;  3FJG A;  3U94 A;  2QS4 A;  3MVW A;  4GIZ A;  4ELO A;  4F29 A;  3I6V A;  4Q8R A;  2XXY A;  4YKJ A;  1POY 1;  1ANF A;  3MPK A;  3QXM A;  3U93 A;  1Y3N A;  3K0V A;  1ZIU A;  1XOC A;  3MP6 A;  4IO3 A;  3EHS A;  3TOD A;  2OLB A;  3MW0 A;  5KDT B;  4GLI A;  1URD A;  1UTH A;  3TQL A;  4KPT A;  3C31 A;  2O7I A;  2LFF A;  2X7P A;  4BLA A;  1JW5 A;  1RYO A;  4Q5T A;  4YMA A;  3TKD A;  4RYA A;  1Y1Z A;  2W7Y A;  3OSR A;  4ZDM A;  2HCA A;  4Z7E A;  5ISU A;  3HPI A;  1S7Y A;  3IB0 A;  4TQU Q;  4XXU A;  3HV1 A;  1I6Q A;  1LAF E;  4GWO A;  2ABH A;  4KHZ E;  2FNC A;  4PP0 A;  3KN8 A;  5L9S A;  1FTL A;  2ZNS A;  4U4X A;  5DVI A;  1MXZ A;  3TAJ A;  1EU8 A;  1TFA A;  3MAM A;  2VOZ A;  1PB8 A;  3PD9 A;  4YB6 A;  3O6G A;  2O68 A;  3KG2 A;  4OFJ A;  5CBR A;  4ISU A;  1GGG A;  3FUZ A;  5CBS A;  2XXV A;  4NF5 A;  2AL4 A;  4OTE A;  4IO5 A;  4XKQ A;  4X1D A;  2IEE A;  2P0S A;  3TTK A;  2VHA A;  3U72 A;  3ZKL A;  2UYF A;  3Q27 A;  2BJJ X;  3M8U A;  3ZKK A;  4KYE A;  1IXH A;  4OEV A;  4LUB A;  4UA8 A;  1O63 A;  2ZYM A;  2XD3 A;  4OET A;  3LBS A;  1WOD A;  1JVX A;  1B4Z A;  2DE3 A;  1B3L A;  1HSJ A;  2Q2C A;  3FD3 A;  2ONS A;  3KOS A;  3PMX A;  4QFK A;  3BBR A;  3OO7 A;  5H8N A;  2HZ8 A;  2V25 A;  3GLB A;  4LVQ A;  4ZEI A;  2XXH A;  1EH3 A;  4OZ9 A;  5K2Y A;  3H06 B;  4DXU A;  1Z7M E;  1VE4 A;  1CE2 A;  2PX1 A;  4AB5 A;  3QK6 A;  4DIG A;  5I84 A;  3G3H A;  4I9D A;  2O84 X;  1SD3 A;  2QS1 A;  4PE5 B;  5I2K A;  1OLA A;  4IO2 A;  4GQO A;  3RGY A;  3MVZ A;  3QYT A;  1Q35 A;  1R9L A;  4KCC A;  3S9M C;  4QFP A;  3PGF A;  1JNF A;  1NFT A;  1Y4T A;  2V3T A;  1SVX B;  4O3A A;  3IB2 A;  1PB9 A;  4KR5 A;  3RUM A;  3S2V A;  4ZEB A;  3Q28 A;  1MPB A;  3B6W A;  3FVN A;  5DVF A;  2R6G E;  3Q29 A;  4OEU A;  1XS5 A;  4H0W A;  1VFD A;  3BFT A;  3LSL A;  4FOR A;  4R2B A;  4YKP A;  1NL5 A;  3FJ7 A;  5A5X B;  1US4 A;  1SI0 A;  1SDX A;  1XVY A;  1TWY A;  1GTK A;  4EDP A;  3PUZ E;  5H8H A;  4ELQ A;  5ITO A;  2G93 A;  2I6E A;  2ZNU A;  3KJ7 A;  2D21 A;  1MY0 A;  2Z23 A;  4OEN A;  1LBB A;  1LB9 A;  4U1Z A;  1N04 A;  1B4H A;  3C4M A;  2Y84 A;  1NNK A;  3MWB A;  4NF4 B;  4X48 A;  3KN3 A;  3MQ9 A;  4KD5 A;  3MP1 A;  1PBP A;  3FVG A;  1LFI A;  3H6T A;  4K3F A;  5JTY A;  2A5T B;  5I58 A;  4I62 A;  4RK9 A;  2RC9 A;  3SEV A;  3VLU A;  4F3P A;  2GH9 A;  2GRV A;  3D4C A;  3C35 A;  3PPR A;  1Y1M A;  4NF8 A;  1B05 A;  1BKA A;  1NKX A;  1QUI A;  2OWT A;  3OOA A;  4N13 A;  4QFN A;  5DEX B;  3UP9 A;  3W9V A;  3CSB A;  3PUX E;  4R9G A;  1NH7 A;  3KEI A;  4PFU A;  4ZEF A;  1IXI A;  3Q26 A;  2DWH A;  2O7U A;  4P11 A;  5H8Q B;  1N3W A;  3DEL B;  3DP8 A;  4N07 A;  3CFZ A;  5FHO A;  4AB6 A;  2B65 A;  1LBC A;  2VGQ A;  5I59 A;  2GHB A;  2VD3 A;  3TCG A;  3K6V A;  4G68 C;  4XKR A;  4F22 A;  3AXF A;  4F18 A;  2HZK A;  3A09 A;  2I0B A;  3G3I A;  3JZJ A;  4R73 A;  3RTW B;  1B52 A;  1FTK A;  3C9H A;  4FJP A;  4OWD A;  3W15 C;  5CMK A;  2FYI A;  1UIU A;  4U2R A;  2PT2 A;  5EYF A;  3IJX B;  4H6D A;  1MXY A;  2H99 A;  1A7L A;  5FTI A;  1AH5 A;  3K1M A;  2DWI A;  4DCY A;  3FV2 A;  4FAJ A;  5J1D A;  3CG1 A;  1BP5 A;  4EUO A;  3FXU A;  1NH8 A;  4EF2 A;  1JQF A;  2ALU A;  2YJP A;  2ZNT A;  5M2V A;  2D3I A;  4QFL A;  3TZA A;  2B3B A;  4Q0C A;  3SEY A;  4QF9 A;  3UOR A;  1B3F A;  2F97 A;  1MY2 A;  1QKB A;  3KSJ A;  3VFJ A;  5AA3 A;  1URG A;  4TLM B;  2OWS A;  2Y7R A;  2AYS A;  5DT6 A;  4BDM A;  4P0I A;  1MXV A;  1B1X A;  1P1W A;  2IA4 A;  3GZG A;  1FQC A;  1Z7N E;  3KBR A;  3PUY E;  2H4I A;  3QAX A;  3N6T A;  1BIY A;  1US5 A;  1MQJ A;  2OK2 A;  4NF8 B;  4PFY A;  5FTH A;  4AQ4 A;  5I57 B;  3KOT A;  2O69 A;  3CIJ A;  4ECF A;  4PFT A;  1UTH B;  2XXX A;  3FGS A;  2PYY A;  3PD8 A;  1QUK A;  1A54 A;  4OVJ A;  1LLS A;  3T93 B;  4BDR A;  1M5D A;  2OBG A;  4TLL B;  2DXR A;  4F1V A;  1FCK A;  4KFQ A;  5EHS A;  1FQA A;  1Y20 A;  4H67 A;  3MUQ A;  4RY1 A;  2PVU A;  4YB5 A;  1WDN A;  4OFL A;  3VVE A;  1LFH A;  2V3U A;  1N76 A;  3FAT A;  3DP4 A;  1MQD A;  4G68 A;  2O6A A;  4LQ5 A;  4DZ1 A;  4LZ7 A;  4R6K A;  1LST A;  3TEP A;  1B46 A;  2A5S A;  1EZO A;  3CR9 A;  3FXQ A;  1J1N A;  2F36 A;  2F35 A;  1FQB A;  1MQG A;  4G8N A;  5FHM A;  4OXV A;  2E0S A;  4F1U A;  3Q25 A;  4F3G A;  1B0L A;  3LUY A;  4O3B A;  4C1T A;  5HPQ A;  3MBP A;  3OO8 A;  1GR2 A;  1N7W A;  1ZTY A;  5ELV A;  3VVD A;  4LZ8 A;  3S4U A;  1M5C A;  1FW0 A;  1ATG A;  2QMX A;  2QS3 A;  3TUS A;  2Z22 A;  1LAG E;  4F19 A;  2Y7W A;  2DVC A;  4GVO A;  4OYV A;  1RYX A;  2CZL A;  2HAV A;  1DPE A;  1TT1 A;  2QJE A;  4RPO A;  4U22 A;  4DCX A;  2B3F A;  2QRY A;  3USD A;  2O1L A;  2PBW A;  2UXA A;  5I57 A;  1LGB C;  1NNF A;  3IO4 A;  5BWJ A;  4E0X A;  1MY4 A;  2HFB A;  2XXI A;  2H98 A;  1MG1 A;  1YAE A;  3RPW A;  3CSG A;  1OQH A;  3SKP A;  2V93 A;  2Q2A A;  3M3F A;  3A3U A;  3H6U A;  1IXC A;  1KWH A;  2F7A A;  2QMW A;  3MP8 A;  3PUV E;  1XT8 A;  4MH5 A;  3TTL A;  1MY3 A;  3EF7 A;  1MQH A;  1UIV A;  2HAU A;  1WVJ A;  2ONK E;  5H8H B;  2RF1 A;  5HBC A;  1PEB A;  5JTY B;  4JB7 A;  2Q8J A;  4ZE8 A;  2XD2 A;  2HEU A;  5L8D A;  4JWX A;  4DE8 A;  4RJZ A;  3S9L C;  3FZV A;  4HTG A;  1B3H A;  4MF3 A;  4Z0I A;  3PMV A;  5AA1 A;  3ZSF A;  3SET A;  1Y9U A;  3MVX A;  4GOT A;  3ECR A;  2HXW A;  3T9X B;  4ESX A;  2F7B A;  5I56 A;  1YTV A;  3VVF A;  1AOV A;  3C34 A;  4F39 A;  3FVO A;  4NF5 B;  4RNS A;  1M5E A;  2LAO A;  3SEX A;  4IY6 A;  5L9O A;  1N3X A;  2DQV A;  2XX7 A;  3N94 A;  4R6Y A;  2F34 A;  2UVG A;  5A5X A;  2UVJ A;  4XKN A;  3TEL A;  4EF1 A;  5FHN A;  1B3E A;  5AE4 A;  1MPD A;  1VR5 A;  3ODB A;  2QS2 A;  1IIW A;  2X26 A;  2VP1 A;  1DPP A;  2XX9 A;  3GBB A;  4NMY A;  4XTC Q;  5B7D A;  4KQP A;  2QSX A;  2PMS A;  3TYH A;  2I58 A;  1B5I A;  3B6T A;  4R72 A;  2YPN A;  1EZP A;  3O6H A;  2XXT A;  4NF4 A;  2NXO A;  1GV8 A;  2DYX A;  1B58 A;  1SYH A;  2Q89 A;  2DS9 A;  1DTZ A;  2F7C A;  3FAS A;  3OEM A;  3SDF A;  1S9T A;  4QHQ A;  1MXW A;  1R1N A;  1SW2 A;  4FE8 A;  3G3J A;  1DMB A;  1F9B A;  1JET A;  1PC3 A;  3IK6 B;  1FQE A;  3I3V A;  3O28 A;  5HM4 B;  3EN3 A;  1IIT A;  2RCB A;  3LSF B;  3TMG A;  1QW0 A;  5BUU A;  1QJM A;  2ONR A;  1SW5 A;  2RC8 A;  1HSL A;  2GFE A;  3K6U A;  3LSX A;  3MC2 A;  3LR1 A;  1IUD A;  5H8F A;  4DLD A;  1P1Q A;  4IO7 A;  5H8Q A;  1MRP A;  4QFO A;  4F2O A;  1R9Q A;  3VXB A;  3TCF A;  3RT8 A;  3K1N A;  4NWD A;  4OES A;  3UIF A;  3HCQ A;  3PUW E;  2F5X A;  1LAX A;  1D9V A;  2ZYN A;  1B0H A;  2F6G A;  1S50 A;  3LC8 A;  3M3L A;  3PPP A;  5CI5 A;  5H8F B;  2XHD A;  3V83 A;  4YB7 A;  4HCY A;  4RA1 A;  1MY1 A;  4NE4 A;  1II5 A;  2DSF A;  4KYS A;  1B40 A;  1IZ1 A;  4MLQ A;  1UTB A;  4XKP A;  4LA9 A;  2DE4 A;  1JEV A;  1D9Y A;  2ANJ A;  4U23 A;  1FQD A;  5CRY A;  2ZXT A;  2ZMB A;  3HO7 A;  1SW1 A;  4YKK A;  5AA4 B;  3FJM A;  1LFG A;  3SES A;  2REJ A;  3U8V A;  3HN0 A;  4H5G A;  4C0R A;  1M5F A;  1N84 A;  1R6Z A;  1I6A A;  2X7Q A;  2XXP A;  3IR1 A;  4LQ2 A;  2A5T A;  3VV5 A;  4E0W A;  4YMB A;  2DWJ A;  1SQY A;  4IO6 A;  5I2K B;  1SYI A;  1A99 A;  3R7X A;  1N7X A;  5AA4 A;  1MH3 A;  3CG3 A;  3M3K A;  3MJN A;  3O97 A;  4M1V A;  3QUF A;  2I0C A;  4FED A;  3IOU A;  4H65 A;  4RK2 A;  1ZBM A;  3K4U A;  3KSX A;  3K01 A;  4L17 A;  3L6G A;  3EQ1 A;  4BDQ A;  4H8I A;  4YZZ A;  4EQ7 A;  4BDL A;  1OLC A;  2H9B A;  1PB7 A;  4R75 A;  3K1P A;  3RQT A;  1P1U A;  4F3B A;  4ZE9 A;  5I59 B;  5TPA B;  3IO6 A;  4YAH X;  5TP9 A;  3KZG A;  4ZZA A;  1SI1 A;  3CFX A;  4GF8 A;  2AL5 A;  4DXC A;  1DSN A;  1QKA A;  2UYE A;  1IQ7 A;  1FTJ A;  2D5W A;  3CRB A;  3E3K A;  3E9X A;  4H5F A;  3DLN A;  4NWC A;  3TCH A;  3U8Q A;  3OXN A;  3PU5 A;  1A8F A;  3T22 A;  1URS A;  2I3V A;  1CB6 A;  2P1S A;  4ZED A;  4THI A;  4LON B;  2CMO A;  1P1N A;  4H8J A;  4GL0 A;  2PT1 A;  4DDD A;  5I58 B;  2XXQ A;  3THI A;  4IGR A;  3CFL A;  2OZZ A;  3O2A A;  4DXB A;  1DTG A;  1B3G A;  2DOJ A;  3V5A A;  3W9W A;  3OSQ A;  4HS7 A;  5F7V A;  2DE2 A;  4MLV A;  2Q88 A;  4JDF A;  2G29 A;  3VXC A;  3HHF A;  3N5L A;  4NF6 A;  4ZZE A;  3MZ9 A;  1H76 A;  1PDA A;  1MQI A;  3MPL A;  1FTO A;  3PPQ A;  5K2X A;  1QVS A;  3CVG A;  4WKM A;  2F8D A;  2OJT A;  2UVH A;  1AL3 A;  3MZ1 A;  3OEN A;  3D4G A;  1PBQ A;  4FAT A;  3F11 A;  3P7I A; 
#chains in the Genus database with same CATH topology
 4OVS A;  1HMD A;  1JW4 A;  4F31 B;  3L8I A;  1ZU0 A;  1USY H;  3M15 A;  4QSC A;  1D0Z A;  3E4R A;  4LZ5 A;  5ICQ A;  3SEU A;  4G77 A;  4XLN F;  1OKK A;  3FVK A;  1NG1 A;  4G0H A;  3KC0 A;  5B3I A;  3VLW A;  4FIM A;  1AIV A;  3POV A;  1NMU A;  4U5E E;  1D4N A;  3O6X A;  3JRT A;  3T9H B;  2QVV A;  4K0D A;  1FQF A;  3KGC A;  4U9D A;  1RKM A;  1OCO C;  2Z8E A;  2NVU B;  5EHM A;  5L0D A;  1H44 A;  3R26 A;  1LI5 A;  2Y3G A;  3HLZ A;  3SEO A;  3T6B A;  2HV6 A;  4OIQ F;  3BIG A;  1QLE C;  2AWY A;  4C1U A;  4EQ9 A;  2KK1 A;  1LBZ A;  3C8G D;  4N17 A;  4PQJ A;  2O1M A;  5IY5 C;  3K00 A;  1O7T A;  1OQG A;  5F1Q A;  2Z8D A;  1IEJ A;  1OIB A;  4OD5 A;  2AWC A;  1D0Y A;  1QUJ A;  3K1H A;  1EYK A;  1MM7 A;  2I4C A;  3O9P A;  5JSL A;  4LVQ A;  3S28 A;  1YZC A;  4MEV A;  4XQ1 A;  1ZU5 A;  2XM4 A;  4RXL A;  2D4U A;  5H8S A;  4XTK A;  3FMS A;  5L0J A;  2XLM A;  2I3W A;  3IAZ A;  5ICT A;  2VC9 A;  3VYW A;  3WG7 C;  4BJ1 A;  3T66 A;  1NFO A;  3AQB A;  2HQ0 A;  1H3D A;  3QZC A;  1B7U A;  4NHB A;  2FAP B;  1O87 A;  2J45 A;  4JC7 A;  1B2H A;  2JX0 A;  1I4Z A;  3EPE A;  1A41 A;  3OO6 A;  1FPD A;  4F1Y A;  1TFK B;  1KNY A;  4NY3 A;  5EYG A;  4G7H F;  3N0T A;  2H7O A;  1VB5 A;  1AVO B;  3OO9 A;  5KDT A;  1T9K A;  3DP6 A;  1ZMG A;  3S9E A;  2A68 F;  3C18 A;  2RSE B;  3RVZ A;  3S29 A;  3ZVR A;  1IMA A;  5KYY B;  4QSD A;  5ITP A;  1LE2 A;  5DS5 A;  2ZYO A;  4P9T A;  1AWB A;  5CC2 A;  1WTY A;  2Q74 A;  3U1O A;  4Z9J A;  2R71 A;  3MZB A;  5FBP A;  5TU0 A;  1LE4 A;  3HTK C;  2R7S A;  5I2N A;  3T9O A;  1SBP A;  1E2X A;  2OU6 A;  3ILU B;  1M5B A;  4LER A;  3EZH A;  4M63 A;  5DW8 A;  2EPM X;  3PV0 E;  3C33 A;  3RN8 A;  5DEX A;  2O9X A;  1TFD A;  5LOM A;  3FV1 A;  3EPV A;  1ZHZ A;  1ORY A;  1SZI A;  4PGP A;  2YLN A;  3FHD A;  5JVE A;  2Y3B A;  1EYI A;  1APC A;  1I5N A;  2THI A;  2Y5K A;  4GFR A;  5IAI A;  1MND A;  3ZQV A;  1FTM A;  3RNN A;  4FBP A;  4WJ0 A;  5ESY A;  1M56 C;  3U3F A;  2Q00 A;  5JUA A;  1XVX A;  2BE5 F;  4F29 A;  1YA9 A;  3M4C A;  3QVY A;  1NUW A;  1Q0G A;  3I6V A;  1POY 1;  3MPK A;  2QE9 A;  1ZIU A;  5BQG A;  2EIJ C;  4GLI A;  2AVK A;  4GWW A;  3AQC A;  1FBE A;  4BLA A;  1RYO A;  5ET5 A;  3TKD A;  2M4E A;  3GM2 A;  3CQZ A;  4EBJ A;  2WYK A;  4GWO A;  1NUX A;  3ZSU A;  5COM A;  4U4X A;  5DVI A;  4PBH A;  4MW3 A;  4AK9 A;  4L6R A;  4OFJ A;  4DI3 D;  4XEV A;  3SP1 A;  3DJN B;  4OTE A;  4XKQ A;  3B0U X;  3IQ6 A;  2OX3 A;  2UYF A;  3Q27 A;  3GM1 A;  1MMD A;  3W2W A;  4LUB A;  4UA8 A;  1O63 A;  4MTO A;  1B3L A;  3KOS A;  1H7I A;  1S05 A;  3LNM B;  3BBR A;  4XEQ A;  2V25 A;  1UG7 A;  2CCY A;  5K2Y A;  3LLK A;  3D1R A;  3ZTM A;  1Z7M E;  3KYI A;  4AB5 A;  1SR2 A;  3G3H A;  3OA1 A;  4I9D A;  2O84 X;  1B68 A;  5AGF A;  2QS1 A;  1VK5 A;  4PE5 B;  4GX4 A;  3CEX A;  3AOU A;  1R9L A;  2KGO A;  4LLE A;  4QFP A;  3PGF A;  4O3A A;  2MHR A;  3RUM A;  3GEE A;  4C3D A;  3Q28 A;  3IPM O;  3FVN A;  5DVF A;  1ZHW A;  3C7J A;  4U5F E;  2J0X A;  4IAR A;  1VFD A;  1XS5 A;  3BFT A;  3LSL A;  4O7G A;  4H0W A;  4YKP A;  5F24 A;  5A69 A;  1ZVZ A;  1SDX A;  1SI0 A;  1FRP A;  1TWY A;  3PUZ E;  4ELQ A;  2G93 A;  2QUP A;  2I8B A;  2G3V A;  3SYN A;  4YL3 A;  2YL7 A;  2Y84 A;  1NNK A;  5K0I A;  4ER9 A;  3ASN C;  3KN3 A;  3AG4 C;  2F22 A;  3MQ9 A;  3MP1 A;  1LFI A;  3HKK A;  2GH9 A;  3HNL A;  3C35 A;  1INP A;  4QFN A;  1LS1 A;  5I57 A;  5A6B A;  3W9V A;  4ZEF A;  3DAF A;  4PF8 A;  2R03 A;  5CIV A;  5H8Q B;  5FHO A;  1HE9 A;  3CFZ A;  4AB6 A;  2B65 A;  4NN3 A;  5I59 A;  2GHB A;  2GDC A;  3LEV A;  4XKR A;  1FR0 A;  2HZK A;  5L0F A;  1OR3 A;  3JZJ A;  3C9H A;  4OWD A;  2WX9 A;  2VCB A;  4IJJ A;  2PT2 A;  4H6D A;  1MXY A;  4JVS A;  3SXY A;  1A7L A;  4PCD A;  3K1M A;  4DCY A;  3FDQ A;  4N06 A;  4CSA C;  3LUT B;  4FAJ A;  3FXU A;  3NDB B;  2DYS C;  2ALU A;  4MVR A;  5EGY A;  1QKB A;  1LBW A;  1Z5Z A;  4WGY A;  2GQ1 A;  4QI0 A;  4YL1 A;  2AP3 A;  5EQA A;  4P0I A;  1FMV A;  1B1X A;  2XRH A;  3V89 B;  1FQC A;  1MMG A;  4AQ4 A;  1MQJ A;  1FBF A;  2OK2 A;  5I57 B;  5T1D B;  4MNI A;  1TWG A;  3CIJ A;  1FTA A;  4PFT A;  3RYD A;  4ECF A;  3PD8 A;  5D92 A;  4OVJ A;  3L8J A;  1YAU O;  1RDZ A;  4N4U A;  1M5D A;  2LIG A;  4N81 A;  4BDR A;  1FQA A;  1C03 A;  1QZX A;  3CZ6 A;  3X1O A;  3ZG1 A;  1Y20 A;  3MUQ A;  4H67 A;  1WDN A;  3VVE A;  1Z63 A;  1JMW A;  2V3U A;  1N76 A;  3FAT A;  1EZO A;  2WVO A;  1DOW A;  3CR9 A;  4I3E A;  2QLA A;  1FPB A;  5FHM A;  4NQ8 A;  4F3G A;  4F1U A;  5F5F A;  1N7W A;  5IZZ A;  5E2Q A;  3EJN A;  4NX1 A;  2Z22 A;  2HUJ A;  1RYX A;  4U22 A;  1M2O A;  1TT1 A;  4RPO A;  4DCX A;  4HE8 D;  2QRY A;  3HFU A;  3A29 A;  2XXI A;  5EQ9 A;  4DOZ A;  3O39 A;  2CEX A;  4CDY A;  3CSG A;  2IXO A;  4CX9 A;  2V93 A;  3ATP A;  4C3E A;  2AU5 A;  2Q2A A;  4YB5 A;  5BQI A;  2Y39 A;  4BEJ A;  3EF7 A;  1MQH A;  2ONK E;  2XLE A;  1GVC A;  5H8H B;  2RF1 A;  5JTY B;  4GWZ A;  3S9L C;  4MVO A;  2HEU A;  4O79 A;  4MF3 A;  1B3H A;  3NYL A;  4Z0I A;  3FVY A;  3ZDL A;  1OW7 A;  3MYF A;  3MVX A;  4DI4 B;  3ECR A;  4AS5 A;  4F39 A;  2A6H F;  4P1E A;  3FXH A;  4CJO A;  3FVO A;  1NBB A;  2XX7 A;  2F34 A;  2UVG A;  3TEL A;  3TOM A;  1B3E A;  3EZI A;  4OVP A;  5FHN A;  1TKN A;  3A11 A;  3ODB A;  2GA0 A;  2X26 A;  2VP1 A;  4MVS A;  4XTC Q;  2PMS A;  2I58 A;  1CPR A;  2E87 A;  1Q0K A;  2CZH A;  4BJ5 A;  4PFR A;  3FAS A;  3U93 A;  1SYH A;  3ROJ A;  1R1N A;  1SW2 A;  1PC3 A;  1JET A;  2ZZW A;  2OKU A;  1IIT A;  2L9J A;  2IOQ A;  5BQH A;  3MC2 A;  1SW5 A;  2GFE A;  2ZXO A;  1P1Q A;  5H8Q A;  4KBL A;  4I3Y A;  4NWD A;  4IGG A;  1CGO A;  3UIF A;  4KQP A;  3AG1 C;  1LAX A;  1QSP A;  4O8M A;  5H8F B;  4ELP A;  2XHD A;  5A6A A;  3EKI A;  1II5 A;  2YLI A;  3IQC A;  4CIP A;  1ZZP A;  1IZ1 A;  2DE4 A;  1D9Y A;  5CRY A;  3K6B A;  4I44 A;  5DS6 A;  1SW1 A;  4YKK A;  5AA4 B;  2D5R B;  4K7B A;  3SES A;  4GYT A;  3U8V A;  2X7Q A;  3IR1 A;  1I6A A;  2A5T A;  5I2K B;  1SYI A;  2YL0 A;  3RQF A;  5I3S A;  3R7X A;  3CG3 A;  4JVI A;  4BDQ A;  4LDQ A;  4H65 A;  3KSX A;  4W8K A;  3L6G A;  1PCX A;  5BUO A;  4MAG A;  4YZZ A;  1PB7 A;  4BJ6 A;  1P1U A;  1RJ9 B;  4F3B A;  3SXK A;  4ZZA A;  2OCC C;  2C04 A;  1DSN A;  1IQ7 A;  1FTJ A;  2D5W A;  3EH2 A;  4F4B A;  3JZ0 A;  3L1M A;  4H54 A;  3DLN A;  3OXN A;  3TCH A;  1R4T A;  1A8F A;  3T22 A;  2P1S A;  4ZED A;  2FIX A;  1RXQ A;  1P1N A;  1KA0 A;  2IXN A;  2QY9 A;  4DDD A;  4WAB A;  3CFL A;  1E83 A;  3MFN A;  1DTG A;  1B3G A;  3OSQ A;  5COF A;  2DE2 A;  4MLV A;  2ETS A;  2YVK A;  2G29 A;  3HHF A;  1TWC A;  4NF6 A;  4PBQ A;  4NC3 A;  3MPL A;  5K2X A;  2IM8 A;  1QVS A;  3EG9 A;  3MZ1 A;  1H9T A;  1AOV A;  4RNS A;  3F11 A;  2R05 A;  1GM5 A;  5DVJ A;  3TTM A;  3QUJ A;  3EHU A;  3B6Q A;  3H3G A;  1LIH A;  4GBV A;  4O6N A;  3O55 A;  1HMO A;  1FBP A;  1SMY F;  3UMI A;  1XC1 A;  5AA2 B;  2VH3 A;  1ZLQ A;  3U65 A;  3US6 A;  2NG1 A;  4MND A;  4QSE A;  4X0R A;  3GXA A;  3TTN A;  3T96 B;  2Q9T A;  3QIM A;  3G7W A;  3GBA A;  4XLP F;  4G4P A;  4OIO F;  3ABM C;  4MIJ A;  4BEM J;  4JCZ A;  4OD4 A;  2JJK A;  1J8M F;  3LNR A;  1YYZ A;  2KR0 A;  4QBA A;  1C17 M;  1P1O A;  5DTB A;  4NAP A;  4GQH A;  5B1A C;  4O3C A;  2IBF A;  1I4Y A;  4U4S A;  4OVQ A;  4N6K A;  1YDI A;  4X9T A;  3DJU B;  1D9Q A;  3JRM O;  4EXL A;  4OFO A;  3NYM A;  4BDO A;  3S9N C;  4B6I A;  2XX8 A;  4HFF B;  1LCT A;  3UMH A;  2L5V A;  2XXR A;  4G2Z A;  3C32 A;  1OCZ C;  2LFD A;  2EIK C;  5CMM A;  2HFI A;  3PTY A;  3O29 A;  1UTB B;  256B A;  2MYS A;  2I48 A;  5AC5 A;  3DKA A;  4GXA A;  4P56 A;  1YYX A;  1ZKB A;  4IB2 A;  3ZWI A;  4XPY A;  4G8H A;  4XIG Q;  2R9J A;  1MS7 A;  4GRK A;  4O94 A;  3TPA A;  4F2Q A;  5TPA A;  2OCU A;  4JUR I;  2REG A;  3U9M A;  2Z15 A;  2I4B A;  4PF6 A;  2KC3 A;  1JRA A;  5ET7 A;  3IOR A;  1A8E A;  3WAF A;  4EXK A;  3IB1 A;  1CNQ A;  2VT5 A;  1XZQ A;  1NV3 A;  2Y7P A;  5E33 A;  3EQL F;  2MKZ A;  3K2D A;  4G61 A;  3F47 A;  4JSO A;  4OAN A;  3K6W A;  5A6K A;  4J7T A;  2RC7 A;  1H45 A;  1MPC A;  3UA8 A;  4AE4 B;  1LBY A;  1B5H A;  3TJ6 A;  3IJO B;  2RCA A;  2RD9 A;  3KN7 A;  1V74 B;  1JOG A;  4C3B A;  3FIR A;  5KYW A;  3FOP A;  2HXR A;  4PFW A;  2NWJ A;  4EQB A;  2KJG A;  2YZS A;  2LK4 A;  4Q30 B;  3N26 A;  3LS1 A;  4PGN A;  2PNO A;  3OMB A;  3PMW A;  4JSD A;  4U9E A;  4BDN A;  5JEI A;  3SER A;  1ZW3 A;  1FBH A;  5DYH A;  2DI3 A;  5TJ5 E;  4GWY A;  1Q0M A;  4G68 B;  2QPQ A;  1NU7 D;  5JK4 A;  2Y3D A;  2KLF A;  1GS9 A;  5E3C A;  3EHT A;  4A2N B;  1FPL A;  3KJT A;  1WAS A;  1T6I A;  2HJM A;  2R7X A;  2Z8F A;  2TMV P;  3IOW A;  2R7U A;  5IZ3 B;  5I5P A;  3W4Y A;  1YPN A;  4UAC A;  2KW3 C;  3C36 A;  2HKV A;  3K6X A;  4Q5S F;  1Z6A A;  3TFL A;  3IEE A;  4JW1 A;  1PD0 A;  4IB4 A;  4GD5 A;  3VDF A;  3H6V A;  4IO4 A;  4DXW A;  1H43 A;  3ZTZ A;  2ZYK A;  2HHM A;  2YWA A;  3QVZ A;  4FX5 A;  2XXY A;  4YKJ A;  4Q8R A;  3R2P A;  3QXM A;  1Y3N A;  3K0V A;  3TOD A;  4IO3 A;  4U5B E;  1O3U A;  3B8B A;  3HNJ A;  3ITF A;  4KPT A;  3RPL A;  4MNP A;  3K1I A;  1ZHY A;  2LFF A;  2X7P A;  4Q5T A;  4YMA A;  3TD7 A;  1SF8 A;  1KTM A;  2EPL X;  4BJT A;  4YN0 B;  3OSR A;  2XSE A;  2HCA A;  4Z7E A;  4TQU Q;  3IB0 A;  2X0C A;  1LAF E;  2ABH A;  5L9S A;  2FNC A;  4PP0 A;  1G8X A;  2ZNS A;  3TAJ A;  1EU8 A;  1TFA A;  3MAM A;  2VOZ A;  3PD9 A;  3KG2 A;  4U5D E;  1GGG A;  5CBS A;  2AL4 A;  1OQC A;  2IEE A;  2PFY A;  3U72 A;  2WZL A;  3ZKK A;  4YT5 A;  4MHF A;  4OET A;  2ZYM A;  3PMX A;  1HSJ A;  4QFK A;  1L5T A;  1FBD A;  2FFH A;  4OZ9 A;  1CE2 A;  1ZU4 A;  3QK6 A;  3VRC A;  5I84 A;  4JTC B;  2P3V A;  1SD3 A;  1H9G A;  4DVZ A;  1OLA A;  5IZ1 A;  4GQO A;  2HV7 A;  5KYX A;  3MVZ A;  4QXD A;  3QYT A;  4KCC A;  1JNF A;  1NFT A;  1SVX B;  3IB2 A;  1PB9 A;  4KR5 A;  4ZEB A;  3Q6M A;  1YXI A;  2VAS A;  3ABK C;  1RDY A;  3B6W A;  2R6G E;  1K9Z A;  3TK0 A;  1FFT C;  4OEU A;  4P8B A;  1CGM E;  4FOR A;  3RVY A;  1US4 A;  2XLW A;  1GTK A;  2OOC A;  4HE0 A;  2FVZ A;  3KJ7 A;  3G50 A;  5KYU A;  4XPW A;  3EHM A;  3SNH A;  2F3B A;  3DWW A;  1OR2 A;  2R7R A;  2BL2 A;  3MWB A;  1EKY A;  1IMC A;  1J8Y F;  1YLM A;  4X48 A;  3DD7 A;  4CS9 A;  4GWU A;  2CZK A;  3RKO F;  2RC9 A;  3SEV A;  4KNV A;  2YLD A;  4H45 A;  2HSQ A;  3PPR A;  4NF8 A;  4KXP A;  5DEX B;  2OWT A;  4JEA A;  4PFI A;  4HE2 A;  2HS5 A;  2J7P D;  4BJ5 C;  1NH7 A;  3KEI A;  3Q26 A;  4P11 A;  1N3W A;  2J7P A;  3DP8 A;  4N07 A;  2A0U A;  2ZXW C;  3RYL A;  3T6G B;  3K6V A;  4N15 A;  4F18 A;  1JP4 A;  3W2V A;  4GBW A;  3L0I A;  5CMK A;  5F5H A;  1UIU A;  1HY5 A;  4DBR A;  2Y69 C;  2DWI A;  3FV2 A;  4EHP A;  2VPN A;  1U0B B;  1NH8 A;  1JQF A;  2YJP A;  2OEV A;  2B3B A;  4Q0C A;  4QF9 A;  2F97 A;  1MY2 A;  3KSJ A;  2Y5L A;  1VYK A;  4TLM B;  2OWS A;  1T6Q A;  3DE9 A;  4I3M A;  2XWV A;  1Z7N E;  2H4I A;  3N6T A;  1U6H A;  3FBP A;  4NF8 B;  4KI2 A;  4E0I A;  1NLX A;  4EKW A;  3DMD A;  1OXB A;  3U2M A;  1E86 A;  2DXR A;  4PTK A;  3NOH A;  4RY1 A;  3LEO A;  3HJC A;  4GX6 A;  5GPG B;  4OFL A;  4PJL A;  2O6A A;  1LST A;  4X04 A;  3FXQ A;  1FQB A;  4OVR A;  4OXV A;  5AC4 A;  3Q25 A;  4OA4 A;  4O3B A;  5HPQ A;  5ELV A;  2PP4 A;  1KZ8 A;  1FW0 A;  1HE1 A;  3JYY A;  1ATG A;  2QMX A;  1K04 A;  3B50 A;  3KPH A;  5I7I A;  1LAG E;  4MVM A;  2DVC A;  1PD1 A;  4GVO A;  2HAV A;  4KC9 A;  2ICW G;  1LBX A;  2XXA B;  4MX6 A;  1LGB C;  3IO4 A;  4XFE A;  1MG1 A;  3RFY A;  1VDW A;  4C1T A;  2C03 A;  3PUV E;  3TQO A;  3A3U A;  1IXC A;  3H6U A;  1M6T A;  4GWX A;  1UIV A;  1WVJ A;  4JCH A;  2YKZ A;  5HBC A;  4XWJ A;  1LBV A;  4ZE8 A;  5LTC A;  4JWX A;  3B29 A;  3J06 A;  3ZSF A;  3PMV A;  4GOT A;  1LS4 A;  2F7B A;  3BRJ A;  4MVU A;  3C34 A;  4NF5 B;  1IMF A;  1M5E A;  1NV4 A;  2R7Q A;  4JZA A;  3N94 A;  3FAP B;  1OCC C;  5F28 E;  4GEH A;  5AE4 A;  1MPD A;  1IIW A;  3GBB A;  4NMY A;  3ZC4 A;  1DPP A;  1R5I D;  2B4L A;  5B7D A;  2QSX A;  5L0I A;  2Q9A A;  3TYH A;  3DM9 B;  1DBZ A;  1B58 A;  3SDF A;  1S9T A;  2YEV A;  1MXW A;  4QHQ A;  4I1O B;  3G3J A;  3T1B A;  3IK6 B;  1FQE A;  3O28 A;  4MCO A;  5HM4 B;  5H8N B;  5BUU A;  3LSX A;  3AGT A;  3K6U A;  3LR1 A;  1IUD A;  4DLD A;  2DGJ A;  1MRP A;  4F2O A;  3VXB A;  3UNG C;  3RT8 A;  3K1N A;  3TCF A;  2ZYN A;  4U5G A;  1B0H A;  2F6G A;  1VLT A;  3T0J A;  4OIN F;  1MY1 A;  4KYS A;  3MYI A;  4MLQ A;  3AGU A;  1RDX A;  4XKP A;  4MVQ A;  3W8H A;  1JEV A;  1CPQ A;  4GWS A;  3CSK A;  4GX3 A;  1MQV A;  3FJM A;  3H65 A;  3HN0 A;  1O5H A;  2P61 A;  4R32 A;  4IR8 A;  4LQ2 A;  3VV5 A;  4E0W A;  1SQY A;  1NV2 A;  3WOD F;  1SYQ A;  1A99 A;  4JTD B;  3M3K A;  3MJN A;  2XL6 A;  4M1V A;  4H46 A;  3QUF A;  4FED A;  4RK2 A;  3SZP A;  3QTH A;  3K4U A;  4YT8 A;  4PDD A;  3T4R A;  4NQF A;  2ZXP A;  4EQ7 A;  2ZZX A;  1IME A;  1MMA A;  4J32 B;  4BDL A;  3GAN A;  4IRU A;  3RF3 A;  3ZQY A;  3V7O A;  3RQT A;  3IO6 A;  1KA1 A;  3KZG A;  4GF8 A;  4DXC A;  1QKA A;  3CRB A;  4N6D A;  4NWC A;  1NV6 A;  2DYR C;  3LJB A;  5DLJ A;  2CMO A;  4LON B;  4THI A;  3UGO A;  2PT1 A;  3H2V A;  2XXQ A;  5JLI A;  4IGR A;  2OZZ A;  1JPJ A;  3VXC A;  3N5L A;  3EGD B;  1U89 A;  4RDA A;  3CVG A;  2B4M A;  3GOR A;  2EPO A;  2UVH A;  3OEN A;  2I15 A;  4TOZ A;  1LEV A;  4ELR A;  5DQT A;  4E7Z A;  3G4Z A;  3PPO A;  2IYL D;  3BFU A;  3LUZ A;  1P99 A;  3CAX A;  2W4M A;  2XWO A;  3GOD A;  4PJJ A;  5JRA A;  3KC1 A;  2J9U A;  3K1I C;  1EI7 A;  4JJF A;  4P0G A;  1B51 A;  2HZL A;  1B32 A;  1CGN A;  3O6I A;  2W9Y A;  1ELJ A;  3K7D A;  4OER A;  5CMC A;  2NUP A;  2R9R B;  5FCL A;  4ONY A;  2Y7K A;  2CGE A;  3BEH A;  2XXW A;  1YCJ A;  1SW4 A;  5L9M A;  1LVK A;  1ZHX A;  1LAH E;  3MX3 A;  2GHA A;  3C8Z A;  2R7O A;  3G3G A;  2Q9C A;  4PAC A;  2Y3H A;  3RTF B;  5AA2 A;  2LP4 A;  4JE9 A;  4LLC A;  4U21 A;  3KKB A;  4UAB A;  1IXG A;  2WBB A;  1OW8 A;  4I40 A;  1NUY A;  1ST6 A;  5CMB A;  4NED A;  2L7A A;  4UDV A;  2NUV A;  1ZHT A;  1B7Z A;  1B5J A;  3OWT A;  1FBC A;  4PE3 A;  3FXR A;  1MDQ A;  2QL3 A;  2LQG A;  4H1X A;  2WYP A;  1MNE A;  4IWB A;  3B0P A;  3OEL A;  4IY5 A;  4MS2 A;  4YT2 A;  2Y7I A;  4LN5 A;  2XS1 A;  1Q0D A;  4R9F A;  1OVB A;  3U9J A;  2KQ9 A;  3I5O A;  4ND9 A;  2F6P A;  3ZS6 A;  3DE8 A;  3UGP A;  1MH4 A;  1JR8 A;  3L6H A;  4MBP A;  1M2V B;  1JW1 A;  4G78 A;  3IX1 A;  2R7W A;  4E18 A;  4YT4 A;  1N0T A;  5JT4 A;  1JPN A;  4PFO A;  4JRZ A;  4NF6 B;  4OHN A;  4N8Y A;  1BTJ A;  4OQO A;  4R2F A;  4BPM A;  4YIC A;  3H03 A;  3IQ5 A;  1RMV A;  1DK4 A;  1NNT A;  2RKM A;  1G0H A;  2XLO A;  1FPI A;  1EZ9 A;  4IGT A;  2V4C A;  4PJM A;  3H6W A;  2UUI A;  4OMB A;  2M8C A;  1VOM A;  3TTR A;  2V26 A;  5L3Q A;  4JBZ A;  3MVY A;  2H7B A;  4WEP A;  1OVT A;  4XEK A;  4M4G A;  2FA7 A;  4KI0 E;  2IXM A;  3HST A;  3RQE A;  1N1C A;  1MM6 A;  3G4X A;  1OMP A;  1B7H A;  2DP8 A;  1E85 A;  3WAQ A;  3SEW A;  2NOO A;  2L6G A;  3PPN A;  3O66 A;  2V3C C;  2J46 A;  2P1A A;  3NKE A;  1LCF A;  4ANJ A;  2WKY A;  1D3K A;  2DWA A;  4JWO A;  1FBG A;  5L0H A;  4OVT A;  3UGW A;  3JYR A;  3B0V C;  3VE1 B;  4CJG A;  4PAI A;  2KNH A;  3IHU A;  2FBP A;  4KCD A;  2Q8M A;  1NFN A;  4HEA J;  3V8X B;  1O64 A;  5B1B C;  5I56 B;  3ONM A;  1LPE A;  2LCH A;  3IOV A;  2P3N A;  2PF4 E;  4HCW A;  4JXI A;  1HW1 A;  1UQW A;  5TP9 B;  3T9V A;  3FJG A;  2QS4 A;  1YZA A;  4GIZ A;  2R7T A;  4J30 B;  1NI9 A;  2OLB A;  3MW0 A;  3S0X A;  1UTH A;  3TQL A;  1NV0 A;  1NU9 C;  3C31 A;  2O7I A;  4WGZ A;  3KL4 A;  1FAP B;  3NYJ A;  2GFH A;  4DBQ A;  2W7Y A;  1V55 C;  5ISU A;  4XXU A;  1S7Y A;  1NV1 A;  2FIE A;  3KN8 A;  2WZG A;  1HW2 A;  1PB8 A;  4YB6 A;  3O6G A;  2O68 A;  2L81 A;  5CBR A;  2GAQ A;  1TWA A;  4ISU A;  4IO5 A;  3ASO C;  3TTK A;  3U0C A;  1T6U A;  1G5Z A;  5KYN A;  2R8T A;  3M8U A;  2OWZ A;  4KYE A;  2UUH A;  2YL3 A;  1IXH A;  4OEV A;  1C02 A;  2XD3 A;  2VPO A;  1WOD A;  2Q2C A;  4ULW A;  3FD3 A;  3NMJ A;  2HZ8 A;  1EH3 A;  3VAY A;  2XLD A;  3H2U A;  4CS8 C;  2PX1 A;  2W45 A;  1WOL A;  4E7S A;  1VMA A;  1BK4 A;  4IO2 A;  1Q35 A;  2HMQ A;  3S9M C;  4NTB A;  1Y4T A;  1RKC A;  3TJ5 A;  3DZA A;  2CNW D;  1L7C A;  3S2V A;  1EYJ A;  3Q29 A;  4R2B A;  2ASR A;  1XVY A;  4EDP A;  5IZ3 A;  1RKE A;  2F3D A;  3M4B A;  2D21 A;  2Z23 A;  1PV3 A;  4NF4 B;  4MJO A;  1PBP A;  3FVG A;  3K33 A;  4JIO A;  2A5T B;  1BDJ B;  5I58 A;  2FGY A;  4LDR A;  4RK9 A;  3VLU A;  3TUL A;  1BZ4 A;  1NKX A;  3UP9 A;  3QMK A;  3PUX E;  4PR9 A;  2Q3T A;  2DWH A;  3MST A;  5JP7 A;  3JSE O;  4KNW A;  3KMI A;  2P0N A;  2VD3 A;  3RPL B;  4G68 C;  4F22 A;  2J9W A;  1M57 C;  2QFL A;  3A09 A;  3G3I A;  3RTW B;  1FPE A;  2FYI A;  2J8W A;  4CS9 C;  1WAT A;  2H99 A;  5FTI A;  1AH5 A;  4EF2 A;  2ZNT A;  3V5Y A;  1T5O A;  2D3I A;  3SEY A;  1RKE B;  3UOR A;  3VFJ A;  5EYH A;  2Y7R A;  1MXV A;  1P1W A;  5L3V A;  2QNL A;  3GZG A;  3PUY E;  5I2N B;  1US5 A;  4PFB A;  5EQ7 A;  1D1A A;  2CNW A;  3I5P A;  5DVW A;  1UTH B;  4NTA A;  1QUK A;  1LLS A;  5JS5 A;  2CDQ A;  1FCK A;  4KFQ A;  1M2V A;  2X51 A;  3V5Z A;  1ZYR F;  2PFD A;  3DI5 A;  1LFH A;  4DZ1 A;  2CYD A;  2EPK X;  4JTA B;  4P47 A;  1B46 A;  2A5S A;  4R6K A;  1NZE A;  2F36 A;  3EGX A;  4G8N A;  4N8G A;  1B0L A;  4U5C E;  3OO8 A;  3IFC A;  3RH3 A;  4LZ8 A;  4RBN A;  4MW8 A;  4F19 A;  2NUT B;  5M2V A;  2WVQ A;  3T6J A;  1DPE A;  2B3F A;  2O1L A;  2VCC A;  2UXA A;  4I1M A;  1NNF A;  5BWJ A;  4E0X A;  3I4U A;  1YAE A;  2R7V A;  4O6M A;  3OEO A;  3SKP A;  2XLH A;  2YL1 A;  2QMW A;  2F7A A;  3MP8 A;  4PC9 A;  3M79 A;  5ET6 A;  2HAU A;  1PEB A;  4JB7 A;  2Q8J A;  2XD2 A;  1S7Z A;  1EZP A;  3FZV A;  1Y9U A;  1NUZ A;  3V5X A;  1BR1 A;  4G7O F;  3FOO A;  3JTL O;  2HXW A;  3Q6N A;  3T9X B;  4ESX A;  3VF0 A;  1YTV A;  3FXB A;  2OQM A;  3JT1 A;  1N3X A;  2DQV A;  4XKN A;  2XXA A;  3EGX B;  1VR5 A;  2ZZV A;  3EFO A;  4YWQ A;  3LV0 A;  2EIN C;  3SXM A;  3B6T A;  4R72 A;  4BJ6 C;  2P6V A;  2YPN A;  4JVD A;  3O6H A;  4NF4 A;  2NXO A;  1GV8 A;  4K1O A;  2DYX A;  4IAO A;  1NV7 A;  2Q89 A;  3W8I A;  2XWK A;  1OKK D;  4U5H A;  1IMD A;  1F9B A;  3I3V A;  4NTF A;  3EN3 A;  5L0G A;  4CIH A;  4A4A A;  2RCB A;  3LSF B;  1K05 A;  3TMG A;  2ONR A;  1HSL A;  2OJQ A;  4PAF A;  5H8F A;  3N24 A;  1Z7Q c;  1XWJ A;  4IO7 A;  1IW7 F;  4QFO A;  1R9Q A;  2DB4 A;  3HCQ A;  3EFO B;  3JCU Q;  1D9V A;  2F5X A;  3LC8 A;  3V83 A;  1S50 A;  5CI5 A;  4YB7 A;  4HCY A;  2ZPA A;  4RA1 A;  5HV9 A;  4D4X A;  2Q9B A;  2ANJ A;  1FQD A;  1Q9D A;  2ZMB A;  3HO7 A;  3IQT A;  4C0R A;  2REJ A;  1ZW2 A;  4F3S A;  1Q0F A;  1N84 A;  1R6Z A;  2H8A A;  4JVC A;  2L6F A;  4YMB A;  2DWJ A;  4IO6 A;  4MNC A;  5AA4 A;  2I0C A;  1ZBM A;  4ZLC A;  3K01 A;  1BBH A;  4J7Y A;  2VB6 A;  5D91 A;  5I59 B;  4YAH X;  4X1B A;  2UYE A;  3E3K A;  1FPF A;  3U8Q A;  5T3J A;  3PU5 A;  2JPU A;  3N2Z B;  5A6J A;  3QMF A;  1RJ9 A;  2I3V A;  2WB7 A;  4JKV A;  4Z9I A;  2BJI A;  4GL0 A;  3SXZ A;  2HPG A;  4PK4 A;  3KBZ A;  5I58 B;  3THI A;  3O2A A;  5DQZ A;  3Q7G A;  3W9W A;  2DOJ A;  5F7V A;  2YLG A;  3C63 A;  3GM3 A;  4ZZE A;  3E78 A;  4HE1 A;  3MZ9 A;  3K66 A;  5T3W A;  1MQI A;  2XM0 A;  2DDK A;  2OJT A;  1AL3 A;  3AG2 C;  1PBQ A;  4H8J A;  3MP6 A;  3P7I A;  4I8C A;  1DOT A;  4JWY A;  3C8G A;  1Q1K A;  4HW8 A;  4YU0 A;  4LAC B;  3EHN A;  5IGA A;  3E70 C;  3TQW A;  2EIL C;  4ZEC A;  5AA2 D;  3G3K A;  1WWP A;  2P2A A;  1USY E;  3JSZ A;  1XI6 A;  4MQ9 F;  1B1H A;  2NSF A;  2I49 A;  4N6C A;  3UN6 A;  1QVX A;  4N6P A;  1FNT c;  2RIN A;  4KYD A;  3S84 A;  3I5Q A;  2V84 A;  2PCR A;  5ET8 A;  4Q4Z F;  1NNP A;  2H25 A;  1MXU A;  3RLF E;  4WXJ A;  1Y4C A;  2OG2 A;  1QUL A;  3NG1 A;  1A7E A;  2WL8 A;  1ZJL A;  4NGU A;  3UK4 A;  3TDJ A;  4YKI A;  2PX0 A;  3H7M A;  4DRI B;  1B6H A;  1FPJ A;  1XHY A;  2A69 F;  4POX A;  4P9K A;  1W2W A;  2J9B A;  3K02 A;  2LD6 A;  5KYU B;  1OXK A;  4PFP A;  1G4W R;  3E79 A;  2ESN A;  2VD2 A;  1K9Y A;  2AIX A;  4YL0 A;  1ORJ A;  2A1D D;  1YJG A;  3S9O A;  1TXF A;  3HHG A;  1JVY A;  4N91 A;  5E3A A;  4EBB A;  2E1S A;  1JEU A;  5KCJ A;  3DM0 A;  1YVI A;  1Y6D A;  1Z23 A;  4P1L A;  5CI8 A;  2CZI A;  3EH1 A;  4D4N A;  1LI7 A;  2QVU A;  3GYY A;  4ZLD A;  3CI8 A;  3ISP A;  1HSE A;  3A3C A;  2XLV A;  1Y3P A;  5KZT A;  3SZR A;  1A40 A;  1LKX A;  3PCV A;  3OD7 A;  1B9J A;  5EHH A;  4CS8 A;  4PET A;  4WED A;  2OEX A;  3BKI B;  3T9U A;  3ABL C;  3ZIB A;  5B3S C;  3RY3 A;  1LB8 A;  1I6B A;  4GL8 A;  3LSW A;  4ZEK A;  4CS7 A;  2UVI A;  4G8M A;  3L34 A;  4U1O A;  3R6U A;  4QRZ A;  3RW0 A;  3EGD A;  2F78 A;  3LLI A;  2O51 A;  1NSG B;  3U3B A;  5KCJ B;  3HNK A;  3LES A;  4H4K C;  4LAT A;  1QKR A;  2XXU A;  3WHN A;  4GXS B;  5CM6 A;  2ZD9 A;  4AE4 A;  4HXV A;  2A0B A;  3RT6 B;  4AS4 A;  3H4Z A;  5IKB A;  4RPN A;  3G3F A;  4R6H A;  1POT A;  3N6U A;  3JV9 A;  4E17 A;  1AMF A;  1VYI A;  4HFK B;  5CI9 A;  4P6I C;  1I69 A;  1YAR O;  1TFO B;  2EIM C;  2R25 A;  5COG A;  3B7D A;  4LP2 B;  4N6H A;  4EUK B;  4FWV A;  4IAQ A;  4FEB A;  1L3P A;  4I1D A;  5J16 A;  2KSF A;  2MWQ A;  3QSL A;  1MXX A;  3WAE A;  2ZXR A;  4FEC A;  1Y3Q A;  3ILT B;  3IL1 B;  3QW1 A;  4NTL A;  4AL0 A;  2M64 A;  2HSB A;  1T0K A;  3OEK A;  1MMN A;  4POW A;  3C8G B;  1MDP 1;  3E13 X;  2NPU A;  3VLV A;  2DXY A;  4MFI A;  1BLF A;  1NV5 A;  1VFE A;  4DRH B;  2NUP B;  2V3Q A;  5A5L A;  2CW0 F;  5LDZ A;  4R74 A;  1VSO A;  2H5Y A;  3U8P A;  4ZS9 A;  3NMI A;  3KFM A;  1A55 A;  2DVZ A;  3PDM P;  3U94 A;  4ELO A;  4CSA A;  3MVW A;  1ANF A;  5EQ8 A;  1XOC A;  1H6G A;  3EHS A;  5KDT B;  4DJ9 A;  1URD A;  4DVY P;  4QDL A;  1GQA A;  4YJW A;  2P7V A;  1JW5 A;  3EG9 B;  4MVZ A;  4RYA A;  1Y1Z A;  3X2Q C;  2WEF A;  4ZDM A;  1V4A A;  4N4W A;  3HPI A;  3HV1 A;  1I6Q A;  3JYH A;  4KHZ E;  4PJN A;  2LSE A;  1FTL A;  2QVR A;  4NF0 A;  4EBK A;  1MXZ A;  4PAK A;  2WZF A;  3MYU A;  3FUZ A;  3F46 A;  5T3T A;  3AG3 C;  2XXV A;  4NF5 A;  4O6Y A;  3PMR A;  4MTF A;  4X1D A;  2P0S A;  1WN0 A;  2VHA A;  3ZKL A;  2BJJ X;  3GWN A;  4Z9H A;  3U2L A;  1TQG A;  1VLS A;  2A6E F;  3LBS A;  1JVX A;  1B4Z A;  2DE3 A;  2W4B A;  2ONS A;  3OO7 A;  1Z3I X;  2KQZ A;  5H8N A;  3GLB A;  4ZEI A;  2XXH A;  3H06 B;  4DXU A;  3KH2 A;  1VE4 A;  2HJ3 A;  2J9V A;  3B71 A;  1SPI A;  4DIG A;  4X8R A;  5I2K A;  3RGY A;  4P9F A;  4LDK A;  3DAG A;  1RCP A;  3O10 A;  1VTM P;  2B0H A;  2V3T A;  3FAJ A;  3NKD A;  5A6B D;  4O7I A;  2XXK A;  1MPB A;  5KYX B;  1G0I A;  4Q7C A;  3AJM A;  1A7V A;  5A5X B;  1NL5 A;  3FJ7 A;  1D1C A;  4FAP B;  3DM5 A;  3GWL A;  5H8H A;  5ITO A;  2I6E A;  2ZNU A;  3LAY A;  4OIP F;  1MY0 A;  4OEN A;  3CHG A;  1LBB A;  2G3K A;  1LB9 A;  2EPN A;  4U1Z A;  1N04 A;  1B4H A;  3C4M A;  4YK5 A;  4CDV A;  4KD5 A;  3UR3 C;  3H6T A;  4K3F A;  5JTY A;  2Q7R A;  4I62 A;  4F3P A;  2GRV A;  3D4C A;  1Y1M A;  1B05 A;  1BKA A;  1QUI A;  3OOA A;  4N13 A;  3CSB A;  4R9G A;  4PFU A;  1AUE A;  1IXI A;  2O7U A;  3DEL B;  1FJ9 A;  1LBC A;  2VGQ A;  1T01 A;  3TCG A;  3AXF A;  4MTG A;  2I0B A;  4R73 A;  3GEH A;  1FFH A;  4XPX A;  1B52 A;  1FTK A;  4FJP A;  4AL1 A;  3W15 C;  4U2R A;  3BIH A;  5EYF A;  3IJX B;  2WVN A;  2PX3 A;  5J1D A;  3CG1 A;  1BP5 A;  4EUO A;  4EIY A;  4QFL A;  3TZA A;  1QPU A;  1B3F A;  2BC5 A;  5AA3 A;  1URG A;  2AYS A;  5DT6 A;  4JJG A;  4BDM A;  2IA4 A;  3KBR A;  3V5A A;  3QAX A;  1BIY A;  4PFY A;  5FTH A;  1UFB A;  4G7Z F;  5KYW B;  3KOT A;  3S27 A;  1EQ1 A;  2O69 A;  4AX2 A;  4ULV A;  2XXX A;  4O7M A;  4DRJ B;  3FGS A;  3Q7L A;  2PYY A;  3T93 B;  1A54 A;  2OBG A;  4TLL B;  4F1V A;  2GWW A;  5EHS A;  4C7O B;  1FPK A;  2PVU A;  1QQ3 A;  4RD9 A;  4LQ5 A;  3RQG A;  1MQD A;  3DP4 A;  4G68 A;  3HNI A;  4LZ7 A;  3TEP A;  2B0J A;  3KYJ A;  1J1N A;  3U5S A;  2F35 A;  1MQG A;  2E0S A;  2R02 A;  3LUY A;  3MBP A;  1TR2 A;  5FZT A;  1GR2 A;  1ZTY A;  3VVD A;  2KYH A;  3S4U A;  1M5C A;  2QS3 A;  3TUS A;  1GGQ A;  4MMP A;  2G62 A;  3NRH A;  2Y7W A;  4OYV A;  1OW6 A;  4CBE A;  4W8P A;  5L0C A;  4BG0 A;  4NCQ A;  2CZL A;  2QJE A;  4E0H A;  3USD A;  2PBW A;  1MY4 A;  1WGW A;  2HFB A;  2H98 A;  1A7D A;  3M1C B;  3RPW A;  5IM2 A;  1OQH A;  1BR4 A;  3NMK A;  3M3F A;  1V54 C;  4QI2 A;  2XS8 A;  1KWH A;  3TTL A;  1XT8 A;  4MH5 A;  1MY3 A;  5L8D A;  1KU2 A;  4OIR F;  4C7O A;  4DE8 A;  4RJZ A;  3MLG A;  4ONS A;  4HTG A;  1FSA A;  3S90 A;  2XWI A;  5AA1 A;  3SET A;  5KYY A;  5I56 A;  3VVF A;  3A9C A;  1DCU A;  1FPG A;  3LS0 A;  3VM6 A;  2LAO A;  1TWH A;  3IFA A;  3SEX A;  4IY6 A;  5L9O A;  4R6Y A;  1K40 A;  5A5X A;  2UVJ A;  4EF1 A;  2QS2 A;  2XX9 A;  1FTS A;  1D0X A;  4PDH A;  3PHF 2;  1ORS C;  1BR2 A;  1B5I A;  2QTV A;  2XXT A;  3MBG A;  2PBE A;  2XL8 A;  1DTZ A;  2DS9 A;  2F7C A;  3B9Q A;  1D1B A;  3OEM A;  4ESW A;  2VCA A;  4FE8 A;  4FES A;  1DMB A;  1XZP A;  3DXJ F;  1A0B A;  1LM3 B;  2H7V C;  1QW0 A;  1QJM A;  2RC8 A;  4JEB A;  5HSW A;  1E84 A;  2JD3 A;  2YRF A;  4EWC A;  2OJE D;  4OES A;  3PUW E;  3M3L A;  3PPP A;  1YA7 O;  3TOL A;  4NE4 A;  3E9V A;  2DSF A;  1B40 A;  1UTB A;  4XF5 A;  2NSG A;  1FMW A;  1IMB A;  2YHS A;  4U23 A;  2ZXT A;  2L6H A;  1LFG A;  4H5G A;  1M5F A;  2FHY A;  2XXP A;  1IZM A;  1EA8 A;  3RIP A;  3GEI A;  3QW0 A;  1N7X A;  1MH3 A;  3ECS A;  3O97 A;  3IOU A;  4L17 A;  4P3L A;  2XL4 A;  5EK0 A;  2XA5 A;  3EQ1 A;  4H8I A;  1OLC A;  1AEP A;  2H9B A;  4R75 A;  3K1P A;  4ZE9 A;  3R7C A;  2CEY A;  5TPA B;  1YYJ A;  5TP9 A;  1SI1 A;  3CFX A;  2AL5 A;  1FJ6 A;  4H5F A;  5DS4 A;  1F1M A;  3E9X A;  2NUT A;  1URS A;  2Q4F A;  1CB6 A;  1OCR C;  2YQY A;  3UMK A;  4NG7 A;  4XEF A;  4DXB A;  2IXP A;  2HMZ A;  2J0W A;  2WBD A;  1YZ0 A;  4HS7 A;  2Q88 A;  4JDF A;  4CDA A;  1G4U S;  1JAF A;  1H76 A;  1PDA A;  1QGX A;  1FTO A;  2PFZ A;  1DOV A;  3PPQ A;  3C62 A;  4WKM A;  2F8D A;  4FAT A;  5B70 A;  3D4G A;  3IOT A;  3U92 A;  4LA9 A; 
#chains in the Genus database with same CATH homology
 4I8C A;  5DVJ A;  4ELR A;  3TTM A;  3QUJ A;  1DOT A;  3EHU A;  3B6Q A;  1Q1K A;  3H3G A;  4JWY A;  5I2N B;  1JW4 A;  3PPO A;  4HW8 A;  4F31 B;  1ZU0 A;  4YU0 A;  1USY H;  3BFU A;  3TQW A;  1XC1 A;  5AA2 B;  4ZEC A;  1P99 A;  3G3K A;  5AA2 D;  2P2A A;  4QSC A;  1ZLQ A;  1USY E;  3E4R A;  4LZ5 A;  5ICQ A;  4QSE A;  1B1H A;  3SEU A;  2I49 A;  3GXA A;  4P0G A;  4X1B A;  1B51 A;  4G77 A;  3TTN A;  3UN6 A;  2HZL A;  1B32 A;  3O6I A;  2Q9T A;  3T96 B;  3QIM A;  3G7W A;  1ELJ A;  4N6P A;  3FVK A;  3GBA A;  4G4P A;  2RIN A;  4KYD A;  4OER A;  5CMC A;  3VLW A;  4FIM A;  2V84 A;  4ONY A;  1AIV A;  2Y7K A;  1NMU A;  2XXW A;  1NNP A;  1D4N A;  1YCJ A;  2H25 A;  1MXU A;  3RLF E;  1SW4 A;  4WXJ A;  1Y4C A;  4TOZ A;  1P1O A;  5L9M A;  5DTB A;  1QUL A;  1LAH E;  3T9H B;  4O3C A;  1FQF A;  2GHA A;  1ZJL A;  3KGC A;  4U4S A;  3UK4 A;  1RKM A;  4YKI A;  2Z8E A;  3G3G A;  1GVC A;  2NVU B;  3TDJ A;  4X9T A;  3H7M A;  5EHM A;  4EXL A;  5H8N B;  1XHY A;  1B6H A;  1H44 A;  3R26 A;  4OFO A;  4BDO A;  3RTF B;  3S9N C;  4POX A;  5AA2 A;  2XX8 A;  4U21 A;  3K02 A;  1LCT A;  1IXG A;  4C1U A;  4EQ9 A;  2XXR A;  4G2Z A;  4PQJ A;  2ESN A;  2O1M A;  2VD2 A;  3C32 A;  2AIX A;  3K00 A;  1O7T A;  1OQG A;  2LFD A;  5F1Q A;  2Z8D A;  1IEJ A;  1OIB A;  5CMM A;  5CMB A;  1L5T A;  1TXF A;  3HHG A;  4NED A;  3O29 A;  1QUJ A;  1JVY A;  1UTB B;  2I4C A;  1MM7 A;  2NUV A;  3O9P A;  1B7Z A;  1B5J A;  2I48 A;  3IOT A;  3FXR A;  2E1S A;  1JEU A;  4GXA A;  3DM0 A;  1ZKB A;  3U92 A;  1MDQ A;  5KCJ A;  2QL3 A;  4IB2 A;  3V89 B;  4G8H A;  4H1X A;  4XIG Q;  2R9J A;  1MS7 A;  4IY5 A;  3OEL A;  4RXL A;  2Y7I A;  3CI8 A;  4GRK A;  3TPA A;  1HSE A;  3A3C A;  5H8S A;  4F2Q A;  5TPA A;  2OCU A;  2REG A;  4R9F A;  1Y3P A;  5KZT A;  1A40 A;  1OVB A;  3I5O A;  2I4B A;  2I3W A;  3IAZ A;  4ND9 A;  5ICT A;  2F6P A;  3OD7 A;  1B9J A;  3ZS6 A;  3T66 A;  3IOR A;  1A8E A;  3WAF A;  4PET A;  1MH4 A;  2HQ0 A;  4WED A;  3L6H A;  4EXK A;  3BKI B;  1H3D A;  4MBP A;  1B7U A;  3IB1 A;  3T9U A;  4ELP A;  2Y7P A;  1JW1 A;  3RY3 A;  1LB8 A;  3IX1 A;  3K2D A;  1I6B A;  4JSO A;  1B2H A;  4GL8 A;  3LSW A;  3K6W A;  4ZEK A;  3EPE A;  2UVI A;  4G8M A;  1N0T A;  4U1O A;  3R6U A;  4QRZ A;  3OO6 A;  4NF6 B;  2RC7 A;  4OHN A;  4F1Y A;  2F78 A;  1H45 A;  1MPC A;  1BTJ A;  4OQO A;  4R2F A;  3UA8 A;  4YIC A;  2O51 A;  3H03 A;  1B5H A;  1NNT A;  3IJO B;  5KCJ B;  2RCA A;  3OO9 A;  2RKM A;  3KN7 A;  5KDT A;  4LAT A;  3FIR A;  2XXU A;  5CM6 A;  4GXS B;  3DP6 A;  4PFW A;  2NWJ A;  4EQB A;  1EZ9 A;  4IGT A;  1ZMG A;  3S9E A;  3H6W A;  4OMB A;  2M8C A;  3RT6 B;  4Q30 B;  3N26 A;  3H4Z A;  3TTR A;  5B70 A;  5IKB A;  4RPN A;  4QSD A;  3G3F A;  4JBZ A;  4R6H A;  3MVY A;  5ITP A;  1POT A;  3N6U A;  2ZYO A;  3JV9 A;  3OMB A;  3PMW A;  4JSD A;  5CC2 A;  4WEP A;  1AMF A;  1I69 A;  3U1O A;  1OVT A;  4M4G A;  4BDN A;  5JEI A;  2FA7 A;  3SER A;  4KI0 E;  2R71 A;  3HST A;  5DYH A;  3B7D A;  4LP2 B;  3MZB A;  4G68 B;  4FEB A;  1MM6 A;  5TU0 A;  5I2N A;  1OMP A;  2QPQ A;  1B7H A;  4I1D A;  5JK4 A;  2DP8 A;  3QSL A;  1MXX A;  1SBP A;  2KLF A;  3ILU B;  3WAE A;  1M5B A;  4FEC A;  3SEW A;  1Y3Q A;  2NOO A;  3EHT A;  3ILT B;  3IL1 B;  3KJT A;  3PPN A;  3O66 A;  3PV0 E;  4F3S A;  3C33 A;  4NTL A;  1LCF A;  5DEX A;  3RN8 A;  1TFD A;  2Z8F A;  3IOW A;  3FV1 A;  5LOM A;  1T0K A;  2WKY A;  1D3K A;  1YPN A;  2DWA A;  3OEK A;  4JWO A;  4UAC A;  2YLN A;  3C36 A;  4POW A;  3UGW A;  1MDP 1;  3E13 X;  3JYR A;  2THI A;  3K6X A;  3VLV A;  4GFR A;  3VE1 B;  2DXY A;  4MFI A;  5IAI A;  1BLF A;  1VFE A;  1FTM A;  3TFL A;  3RNN A;  2V3Q A;  4KCD A;  4GD5 A;  3V8X B;  4ESW A;  1O64 A;  4R74 A;  3VDF A;  1VSO A;  5I56 B;  3ONM A;  3H6V A;  2H5Y A;  3IOV A;  4IO4 A;  4ZS9 A;  3KFM A;  1XVX A;  4HCW A;  4JXI A;  1H43 A;  1A55 A;  1UQW A;  5TP9 B;  2DVZ A;  3T9V A;  2ZYK A;  3FJG A;  3U94 A;  2QS4 A;  3MVW A;  4GIZ A;  4ELO A;  4F29 A;  3I6V A;  4Q8R A;  2XXY A;  4YKJ A;  1POY 1;  1ANF A;  3MPK A;  3QXM A;  3U93 A;  1Y3N A;  3K0V A;  1ZIU A;  1XOC A;  3MP6 A;  4IO3 A;  3EHS A;  3TOD A;  2OLB A;  3MW0 A;  5KDT B;  4GLI A;  1URD A;  1UTH A;  3TQL A;  4KPT A;  3C31 A;  2O7I A;  2LFF A;  2X7P A;  4BLA A;  1JW5 A;  1RYO A;  4Q5T A;  4YMA A;  3TKD A;  4RYA A;  1Y1Z A;  2W7Y A;  3OSR A;  4ZDM A;  2HCA A;  4Z7E A;  5ISU A;  3HPI A;  1S7Y A;  3IB0 A;  4TQU Q;  4XXU A;  3HV1 A;  1I6Q A;  1LAF E;  4GWO A;  2ABH A;  4KHZ E;  2FNC A;  4PP0 A;  3KN8 A;  5L9S A;  1FTL A;  2ZNS A;  4U4X A;  5DVI A;  1MXZ A;  3TAJ A;  1EU8 A;  1TFA A;  3MAM A;  2VOZ A;  1PB8 A;  3PD9 A;  4YB6 A;  3O6G A;  2O68 A;  3KG2 A;  4OFJ A;  5CBR A;  4ISU A;  1GGG A;  3FUZ A;  5CBS A;  2XXV A;  4NF5 A;  2AL4 A;  4OTE A;  4IO5 A;  4XKQ A;  4X1D A;  2IEE A;  2P0S A;  3TTK A;  2VHA A;  3U72 A;  3ZKL A;  2UYF A;  3Q27 A;  2BJJ X;  3M8U A;  3ZKK A;  4KYE A;  1IXH A;  4OEV A;  4LUB A;  4UA8 A;  1O63 A;  2ZYM A;  2XD3 A;  4OET A;  3LBS A;  1WOD A;  1JVX A;  1B4Z A;  2DE3 A;  1B3L A;  1HSJ A;  2Q2C A;  3FD3 A;  2ONS A;  3KOS A;  3PMX A;  4QFK A;  3BBR A;  3OO7 A;  5H8N A;  2HZ8 A;  2V25 A;  3GLB A;  4LVQ A;  4ZEI A;  2XXH A;  1EH3 A;  4OZ9 A;  5K2Y A;  3H06 B;  4DXU A;  1Z7M E;  1VE4 A;  1CE2 A;  2PX1 A;  4AB5 A;  3QK6 A;  4DIG A;  5I84 A;  3G3H A;  4I9D A;  2O84 X;  1SD3 A;  2QS1 A;  4PE5 B;  5I2K A;  1OLA A;  4IO2 A;  4GQO A;  3RGY A;  3MVZ A;  3QYT A;  1Q35 A;  1R9L A;  4KCC A;  3S9M C;  4QFP A;  3PGF A;  1JNF A;  1NFT A;  1Y4T A;  2V3T A;  1SVX B;  4O3A A;  3IB2 A;  1PB9 A;  4KR5 A;  3RUM A;  3S2V A;  4ZEB A;  3Q28 A;  1MPB A;  3B6W A;  3FVN A;  5DVF A;  2R6G E;  3Q29 A;  4OEU A;  1XS5 A;  4H0W A;  1VFD A;  3BFT A;  3LSL A;  4FOR A;  4R2B A;  4YKP A;  1NL5 A;  3FJ7 A;  5A5X B;  1US4 A;  1SI0 A;  1SDX A;  1XVY A;  1TWY A;  1GTK A;  4EDP A;  3PUZ E;  5H8H A;  4ELQ A;  5ITO A;  2G93 A;  2I6E A;  2ZNU A;  3KJ7 A;  2D21 A;  1MY0 A;  2Z23 A;  4OEN A;  1LBB A;  1LB9 A;  4U1Z A;  1N04 A;  1B4H A;  3C4M A;  2Y84 A;  1NNK A;  3MWB A;  4NF4 B;  4X48 A;  3KN3 A;  3MQ9 A;  4KD5 A;  3MP1 A;  1PBP A;  3FVG A;  1LFI A;  3H6T A;  4K3F A;  5JTY A;  2A5T B;  5I58 A;  4I62 A;  4RK9 A;  2RC9 A;  3SEV A;  3VLU A;  4F3P A;  2GH9 A;  2GRV A;  3D4C A;  3C35 A;  3PPR A;  1Y1M A;  4NF8 A;  1B05 A;  1BKA A;  1NKX A;  1QUI A;  2OWT A;  3OOA A;  4N13 A;  4QFN A;  5DEX B;  3UP9 A;  3W9V A;  3CSB A;  3PUX E;  4R9G A;  1NH7 A;  3KEI A;  4PFU A;  4ZEF A;  1IXI A;  3Q26 A;  2DWH A;  2O7U A;  4P11 A;  5H8Q B;  1N3W A;  3DEL B;  3DP8 A;  4N07 A;  3CFZ A;  5FHO A;  4AB6 A;  2B65 A;  1LBC A;  2VGQ A;  5I59 A;  2GHB A;  2VD3 A;  3TCG A;  3K6V A;  4G68 C;  4XKR A;  4F22 A;  3AXF A;  4F18 A;  2HZK A;  3A09 A;  2I0B A;  3G3I A;  3JZJ A;  4R73 A;  3RTW B;  1B52 A;  1FTK A;  3C9H A;  4FJP A;  4OWD A;  3W15 C;  5CMK A;  2FYI A;  1UIU A;  4U2R A;  2PT2 A;  5EYF A;  3IJX B;  4H6D A;  1MXY A;  2H99 A;  1A7L A;  5FTI A;  1AH5 A;  3K1M A;  2DWI A;  4DCY A;  3FV2 A;  4FAJ A;  5J1D A;  3CG1 A;  1BP5 A;  4EUO A;  3FXU A;  1NH8 A;  4EF2 A;  1JQF A;  2ALU A;  2YJP A;  2ZNT A;  5M2V A;  2D3I A;  4QFL A;  3TZA A;  2B3B A;  4Q0C A;  3SEY A;  4QF9 A;  3UOR A;  1B3F A;  2F97 A;  1MY2 A;  1QKB A;  3KSJ A;  3VFJ A;  5AA3 A;  1URG A;  4TLM B;  2OWS A;  2Y7R A;  2AYS A;  5DT6 A;  4BDM A;  4P0I A;  1MXV A;  1B1X A;  1P1W A;  2IA4 A;  3GZG A;  1FQC A;  1Z7N E;  3KBR A;  3PUY E;  2H4I A;  3QAX A;  3N6T A;  1BIY A;  1US5 A;  1MQJ A;  2OK2 A;  4NF8 B;  4PFY A;  5FTH A;  4AQ4 A;  5I57 B;  3KOT A;  2O69 A;  3CIJ A;  4ECF A;  4PFT A;  1UTH B;  2XXX A;  3FGS A;  2PYY A;  3PD8 A;  1QUK A;  1A54 A;  4OVJ A;  1LLS A;  3T93 B;  4BDR A;  1M5D A;  2OBG A;  4TLL B;  2DXR A;  4F1V A;  1FCK A;  4KFQ A;  5EHS A;  1FQA A;  1Y20 A;  4H67 A;  3MUQ A;  4RY1 A;  2PVU A;  4YB5 A;  1WDN A;  4OFL A;  3VVE A;  1LFH A;  2V3U A;  1N76 A;  3FAT A;  3DP4 A;  1MQD A;  4G68 A;  2O6A A;  4LQ5 A;  4DZ1 A;  4LZ7 A;  4R6K A;  1LST A;  3TEP A;  1B46 A;  2A5S A;  1EZO A;  3CR9 A;  3FXQ A;  1J1N A;  2F36 A;  2F35 A;  1FQB A;  1MQG A;  4G8N A;  5FHM A;  4OXV A;  2E0S A;  4F1U A;  3Q25 A;  4F3G A;  1B0L A;  3LUY A;  4O3B A;  4C1T A;  5HPQ A;  3MBP A;  3OO8 A;  1GR2 A;  1N7W A;  1ZTY A;  5ELV A;  3VVD A;  4LZ8 A;  3S4U A;  1M5C A;  1FW0 A;  1ATG A;  2QMX A;  2QS3 A;  3TUS A;  2Z22 A;  1LAG E;  4F19 A;  2Y7W A;  2DVC A;  4GVO A;  4OYV A;  1RYX A;  2CZL A;  2HAV A;  1DPE A;  1TT1 A;  2QJE A;  4RPO A;  4U22 A;  4DCX A;  2B3F A;  2QRY A;  3USD A;  2O1L A;  2PBW A;  2UXA A;  5I57 A;  1LGB C;  1NNF A;  3IO4 A;  5BWJ A;  4E0X A;  1MY4 A;  2HFB A;  2XXI A;  2H98 A;  1MG1 A;  1YAE A;  3RPW A;  3CSG A;  1OQH A;  3SKP A;  2V93 A;  2Q2A A;  3M3F A;  3A3U A;  3H6U A;  1IXC A;  1KWH A;  2F7A A;  2QMW A;  3MP8 A;  3PUV E;  1XT8 A;  4MH5 A;  3TTL A;  1MY3 A;  3EF7 A;  1MQH A;  1UIV A;  2HAU A;  1WVJ A;  2ONK E;  5H8H B;  2RF1 A;  5HBC A;  1PEB A;  5JTY B;  4JB7 A;  2Q8J A;  4ZE8 A;  2XD2 A;  2HEU A;  5L8D A;  4JWX A;  4DE8 A;  4RJZ A;  3S9L C;  3FZV A;  4HTG A;  1B3H A;  4MF3 A;  4Z0I A;  3PMV A;  5AA1 A;  3ZSF A;  3SET A;  1Y9U A;  3MVX A;  4GOT A;  3ECR A;  2HXW A;  3T9X B;  4ESX A;  2F7B A;  5I56 A;  1YTV A;  3VVF A;  1AOV A;  3C34 A;  4F39 A;  3FVO A;  4NF5 B;  4RNS A;  1M5E A;  2LAO A;  3SEX A;  4IY6 A;  5L9O A;  1N3X A;  2DQV A;  2XX7 A;  3N94 A;  4R6Y A;  2F34 A;  2UVG A;  5A5X A;  2UVJ A;  4XKN A;  3TEL A;  4EF1 A;  5FHN A;  1B3E A;  5AE4 A;  1MPD A;  1VR5 A;  3ODB A;  2QS2 A;  1IIW A;  2X26 A;  2VP1 A;  1DPP A;  2XX9 A;  3GBB A;  4NMY A;  4XTC Q;  5B7D A;  4KQP A;  2QSX A;  2PMS A;  3TYH A;  2I58 A;  1B5I A;  3B6T A;  4R72 A;  2YPN A;  1EZP A;  3O6H A;  2XXT A;  4NF4 A;  2NXO A;  1GV8 A;  2DYX A;  1B58 A;  1SYH A;  2Q89 A;  2DS9 A;  1DTZ A;  2F7C A;  3FAS A;  3OEM A;  3SDF A;  1S9T A;  4QHQ A;  1MXW A;  1R1N A;  1SW2 A;  4FE8 A;  3G3J A;  1DMB A;  1F9B A;  1JET A;  1PC3 A;  3IK6 B;  1FQE A;  3I3V A;  3O28 A;  5HM4 B;  3EN3 A;  1IIT A;  2RCB A;  3LSF B;  3TMG A;  1QW0 A;  5BUU A;  1QJM A;  2ONR A;  1SW5 A;  2RC8 A;  1HSL A;  2GFE A;  3K6U A;  3LSX A;  3MC2 A;  3LR1 A;  1IUD A;  5H8F A;  4DLD A;  1P1Q A;  4IO7 A;  5H8Q A;  1MRP A;  4QFO A;  4F2O A;  1R9Q A;  3VXB A;  3TCF A;  3RT8 A;  3K1N A;  4NWD A;  4OES A;  3UIF A;  3HCQ A;  3PUW E;  2F5X A;  1LAX A;  1D9V A;  2ZYN A;  1B0H A;  2F6G A;  1S50 A;  3LC8 A;  3M3L A;  3PPP A;  5CI5 A;  5H8F B;  2XHD A;  3V83 A;  4YB7 A;  4HCY A;  4RA1 A;  1MY1 A;  4NE4 A;  1II5 A;  2DSF A;  4KYS A;  1B40 A;  1IZ1 A;  4MLQ A;  1UTB A;  4XKP A;  4LA9 A;  2DE4 A;  1JEV A;  1D9Y A;  2ANJ A;  4U23 A;  1FQD A;  5CRY A;  2ZXT A;  2ZMB A;  3HO7 A;  1SW1 A;  4YKK A;  5AA4 B;  3FJM A;  1LFG A;  3SES A;  2REJ A;  3U8V A;  3HN0 A;  4H5G A;  4C0R A;  1M5F A;  1N84 A;  1R6Z A;  1I6A A;  2X7Q A;  2XXP A;  3IR1 A;  4LQ2 A;  2A5T A;  3VV5 A;  4E0W A;  4YMB A;  2DWJ A;  1SQY A;  4IO6 A;  5I2K B;  1SYI A;  1A99 A;  3R7X A;  1N7X A;  5AA4 A;  1MH3 A;  3CG3 A;  3M3K A;  3MJN A;  3O97 A;  4M1V A;  3QUF A;  2I0C A;  4FED A;  3IOU A;  4H65 A;  4RK2 A;  1ZBM A;  3K4U A;  3KSX A;  3K01 A;  4L17 A;  3L6G A;  3EQ1 A;  4BDQ A;  4H8I A;  4YZZ A;  4EQ7 A;  4BDL A;  1OLC A;  2H9B A;  1PB7 A;  4R75 A;  3K1P A;  3RQT A;  1P1U A;  4F3B A;  4ZE9 A;  5I59 B;  5TPA B;  3IO6 A;  4YAH X;  5TP9 A;  3KZG A;  4ZZA A;  1SI1 A;  3CFX A;  4GF8 A;  2AL5 A;  4DXC A;  1DSN A;  1QKA A;  2UYE A;  1IQ7 A;  1FTJ A;  2D5W A;  3CRB A;  3E3K A;  3E9X A;  4H5F A;  3DLN A;  4NWC A;  3TCH A;  3U8Q A;  3OXN A;  3PU5 A;  1A8F A;  3T22 A;  1URS A;  2I3V A;  1CB6 A;  2P1S A;  4ZED A;  4THI A;  4LON B;  2CMO A;  1P1N A;  4H8J A;  4GL0 A;  2PT1 A;  4DDD A;  5I58 B;  2XXQ A;  3THI A;  4IGR A;  3CFL A;  2OZZ A;  3O2A A;  4DXB A;  1DTG A;  1B3G A;  2DOJ A;  3V5A A;  3W9W A;  3OSQ A;  4HS7 A;  5F7V A;  2DE2 A;  4MLV A;  2Q88 A;  4JDF A;  2G29 A;  3VXC A;  3HHF A;  3N5L A;  4NF6 A;  4ZZE A;  3MZ9 A;  1H76 A;  1PDA A;  1MQI A;  3MPL A;  1FTO A;  3PPQ A;  5K2X A;  1QVS A;  3CVG A;  4WKM A;  2F8D A;  2OJT A;  2UVH A;  1AL3 A;  3MZ1 A;  3OEN A;  3D4G A;  1PBQ A;  4FAT A;  3F11 A;  3P7I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...