1Y4CA

Designed helical protein fusion mbp
Total Genus 166
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
166
sequence length
490
structure length
480
Chain Sequence
EGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDEALKDAQTNSSSLGIEGRSSEELLKIALQEAQKTLQQAQELAKKGGGEEQLKRALKRADRNLWAAQELAKKGGGGEELLKQALQQAQQLLRQAQELAKKGGGEELLKQALQQAQQLLQQAQELAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title De novo design of an IL-4 antagonist and its structure at 1.9 A.
pubmed doi rcsb
source organism Escherichia coli
molecule tags De novo protein
molecule keywords Maltose binding protein fused with designed helical protein
total genus 166
structure length 480
sequence length 490
ec nomenclature
pdb deposition date 2004-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.660 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) IL-4 antagonist (De novo design) like domain 1y4cA03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1y4cA02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1y4cA01
3IAZA 3R7XA 1QW0A 1Z7NE 3S9EA 3FVGA 2I4BA 1RYXA 2XXRA 3O2AA 4GIZA 1JEVA 3UK4A 1B5JA 4Q8RA 4P0IA 3VLWA 3ZKKA 4ECFA 1FCKA 2HFBA 4R72A 2DP8A 3EHUA 5EYFA 3S4UA 2V84A 1ZKBA 2Z8FA 3LSFB 3OEMA 2DSFA 4NWCA 1YCJA 1MRPA 3LSXA 3RTWB 1R9QA 2R9JA 3CFZA 3VVEA 1MM7A 1URDA 1MDQA 1GGGA 2HZLA 1NL5A 3TMGA 3CIJA 2UXAA 3MPLA 2XXWA 3HSTA 3A3CA 1FTLA 3AXFA 4RPNA 3OSQA 1IITA 3B6QA 3PUVE 4GL0A 5K2XA 4G2ZA 1GVCA 3WAFA 4DXUA 4PE5B 1S9TA 1LFIA 1LGBC 1EZOA 4QHQA 1H43A 3RGYA 2QS1A 1NNFA 2Z8EA 5DEXA 1POY1 3T22A 4OQOA 3M3KA 2B3BA 3UIFA 5L9SA 4EDPA 3N5LA 3IR1A 4GXAA 2F7CA 4XXUA 1DTGA 3IOUA 4ZEIA 2O69A 3H6UA 4QRZA 2NVUB 4EXLA 4OERA 2B65A 3RT6B 4KI0E 1B52A 5B70A 1MXXA 1JEUA 3EPEA 4K3FA 1AMFA 3C33A 3KZGA 3QUJA 3E13X 1IXGA 2XXYA 2F35A 4FEDA 4YB7A 4IY6A 4F19A 1A54A 2ANJA 1YPNA 1NNPA 4OHNA 2ZNSA 4OESA 1B6HA 3HV1A 2I58A 3U8VA 4ZEKA 3RPWA 4ZECA 1IQ7A 3H7MA 5H8QB 4EQ9A 4XKNA 2Q89A 1B3GA 1BTJA 3M8UA 4QFKA 1QULA 2P2AA 4EUOA 3TYHA 4I8CA 5HBCA 3CSBA 3K1NA 3T9HB 3TTLA 2HAUA 2QL3A 3H4ZA 3IB1A 3L6GA 4QFOA 2DWIA 3T93B 2W7YA 1TXFA 3TDJA 1TT1A 4NEDA 3W9WA 4QFPA 3UA8A 1Y4CA 1VFDA 3C9HA 5CM6A 5CRYA 4AB5A 1AH5A 4H1XA 3TQWA 3HO7A 1N84A 1YTVA 2GHAA 2OJTA 1GTKA 2QS4A 2OBGA 4LONB 5HM4B 3V83A 4DIGA 1J1NA 1O64A 3EN3A 4F29A 4G8HA 3O6GA 1PBPA 1TWYA 4H5FA 2DQVA 2GFEA 2KLFA 1SW5A 2GH9A 1MXYA 3JYRA 4P11A 3MZBA 4LQ2A 2AL5A 3PUZE 1NH8A 1R6ZA 5TPAB 1FQBA 4U4XA 2VD3A 4FATA 1N7WA 2Y7KA 4F18A 4ZE9A 2REGA 3BFTA 4KYDA 1SW1A 3MUQA 2QRYA 2IEEA 2Y7WA 1S50A 4O3CA 4H6DA 4U1ZA 5H8HB 4EQBA 2XX7A 3ILTB 2DYXA 5FHOA 3C35A 3IO4A 3VDFA 1XC1A 4F22A 2VHAA 3RT8A 3T9UA 1M5FA 3PPOA 4X1BA 3CFLA 3VXBA 3FVKA 3I3VA 5H8FA 1FQDA 2F7BA 5CMMA 1MS7A 3CG3A 3RNNA 3PD9A 4YAHX 1XVXA 3VVDA 2AIXA 3C32A 3U92A 4ZEDA 5BWJA 5CBRA 4LZ8A 2UVJA 4IGTA 2H4IA 3B6TA 3L6HA 3Q29A 2O7UA 1FQAA 1FW0A 1JW1A 5CBSA 2ONKE 3K1MA 3OOAA 1WODA 4IO3A 4M1VA 1A40A 4O3AA 4PFUA 3BKIB 3FXRA 3DP6A 4OFOA 3RN8A 1JNFA 1URSA 4PFTA 4WEPA 5TP9B 1IXHA 2Z23A 3I6VA 3O6IA 2OK2A 5I59B 1B7UA 1LCTA 3V5AA 2Q88A 2E1SA 3BBRA 3FATA 1PB9A 2V3QA 3FXUA 1URGA 4G68C 3Q25A 3WAEA 3PD8A 5J1DA 3KG2A 3C34A 4ZDMA 4R73A 2RCAA 2ZYOA 1SYHA 1EU8A 3G3GA 3FV2A 4YKIA 1RYOA 3SDFA 5KDTB 1T0KA 4FECA 3G3JA 1S7YA 4OFJA 3QIMA 4DCYA 1MH3A 2R6GE 4YZZA 1MY3A 1OQGA 4FEBA 2GRVA 1JW5A 1CB6A 2V93A 3VXCA 5KZTA 4R9GA 1LLSA 4LZ7A 2F7AA 1B46A 3OXNA 3USDA 4YKPA 1PB8A 3JZJA 2AYSA 3MVZA 4JSDA 4L17A 1D9VA 5TPAA 2X7QA 3Q26A 2DOJA 4DCXA 2H9BA 3MZ1A 1FQCA 5DVJA 2LFFA 1H45A 1QVSA 1OVBA 2ALUA 1Y4TA 2QPQA 1NMUA 1UTHB 2XHDA 3PMVA 5DVFA 3QXMA 3Q28A 3A09A 2F36A 5I56A 5IKBA 1M5DA 4RPOA 3FIRA 1MXZA 3IORA 2O6AA 4GL8A 1B05A 3TCFA 4YMAA 2UVHA 4TLLB 1O7TA 4WEDA 3PPRA 4F1UA 3FZVA 4KFQA 1ZIUA 2CMOA 1IXCA 1JETA 2XX8A 5DTBA 4F3BA 4MFIA 4XIGQ 1QUJA 2I0CA 4JDFA 3K6XA 1B3LA 2Z8DA 1B0HA 4KQPA 4THIA 3GLBA 3N6TA 5H8SA 1I6AA 3KN7A 4KCCA 1I69A 4FE8A 2O7IA 1P1OA 2RKMA 2XXUA 3RUMA 1MQIA 1US4A 3VLVA 3IL1B 4Z0IA 1MY1A 2XXQA 3PPNA 4IO6A 4H65A 1Y1MA 3EHSA 1XT8A 3S9NC 4QFNA 4QF9A 1MY4A 3PMXA 2D5WA 4OVJA 3FVOA 5F1QA 1Q35A 4LVQA 1P1NA 3HHGA 3KN3A 1M5CA 3QSLA 3ZKLA 4C1UA 1LFHA 1QKAA 1DOTA 2O1MA 2ONRA 3KSXA 3PPPA 4KD5A 3UP9A 2Q2CA 3K00A 3MP6A 3B6WA 4FAJA 4BLAA 1KWHA 3OO7A 3VE1B 5H8NB 3CG1A 3N26A 2RCBA 3MP1A 2A5TB 2XX9A 3MW0A 1PC3A 1H44A 2QS3A 4UACA 4I9DA 2NUVA 3MWBA 2DXRA 1BKAA 4OEUA 3G3HA 4ZEBA 4DLDA 4GXSB 5AA4A 4IO2A 2LFDA 3TTNA 5M2VA 3OSRA 1FTOA 3TKDA 3KJ7A 2DE3A 5FHMA 2O1LA 3OELA 1XOCA 2V25A 5AA2B 1B9JA 3K2DA 3PPQA 3EQ1A 1R1NA 4ND9A 1P1UA 3U72A 3IOVA 3T9VA 1TFAA 2PBWA 1OQHA 3OMBA 4RA1A 1FTKA 2Y84A 4GWOA 2DVZA 1SVXB 2F6PA 2WKYA 2H5YA 1B7ZA 1M5EA 2QJEA 5FTIA 3LC8A 3SESA 4U23A 1FTMA 1MPCA 5AA3A 5ICTA 2F78A 5F7VA 3MPKA 2XXHA 4G8MA 4QSDA 4BDOA 2I4CA 4ELRA 3DLNA 4LQ5A 4M4GA 1XVYA 1DPEA 4E0WA 1H3DA 1YAEA 3I5OA 2UYFA 4NMYA 1B0LA 1OMPA 1P99A 3K4UA 3RTFB 1WVJA 2X26A 2I3WA 1MG1A 2HXWA 3LR1A 1VE4A 3QK6A 3D4CA 4OTEA 3TZAA 4C1TA 3PU5A 4U22A 3KOTA 4X9TA 5DYHA 4F3PA 4NF4A 1NH7A 4GD5A 5ISUA 2AL4A 3R6UA 1ZLQA 4RNSA 2VOZA 3O28A 2I49A 1UTBB 3IJOB 1P1QA 1FTJA 4YKJA 3SEUA 1A8FA 3MVXA 4EF2A 3OO9A 2DS9A 5CMKA 1ZBMA 1JVXA 1GV8A 4F31B 3MJNA 1MPDA 2RC9A 3G3KA 1B5IA 3OENA 1BIYA 2DWAA 3DP8A 1RKMA 4NF5A 2LAOA 5A5XA 2OLBA 1OVTA 5ITPA 2BJJX 1N7XA 1USYH 3U94A 1Y1ZA 1PB7A 2UYEA 4HTGA 3VFJA 4DXCA 3CSGA 1NNKA 4KYEA 1L5TA 1EZ9A 4GLIA 3O66A 2OWTA 3H06B 4POWA 2B3FA 2FYIA 5DT6A 5I57B 1IEJA 1QUKA 3S9LC 4YICA 3KGCA 3ODBA 1LCFA 5DEXB 1F9BA 3MVYA 1D4NA 1PBQA 2DVCA 3ONMA 3RLFE 2QSXA 1HSJA 1BP5A 1MXWA 1US5A 5L9MA 3T9XB 5IAIA 5DVIA 4N07A 1D9YA 1MY0A 1OLCA 5CMBA 3TTKA 2DE2A 1HSLA 2UVGA 3Q27A 1OLAA 4GRKA 4C0RA 1NFTA 4U2RA 2V3UA 1LB8A 1B2HA 3OEKA 4H8JA 3T66A 3CVGA 1B7HA 1VFEA 3CI8A 1LBCA 1LAHE 1LAXA 1Z7ME 2NXOA 3QUFA 2XXIA 2RINA 4Z7EA 3HHFA 2DXYA 4Q5TA 1BLFA 3DELB 1B4ZA 1N0TA 3K0VA 2HEUA 2XD2A 4NF6A 4OFLA 4QSCA 3SEXA 1AL3A 1DTZA 2F6GA 3E9XA 3K02A 4G68B 4NF4B 4PP0A 5CMCA 4ISUA 2O51A 3IX1A 5I2NB 4YMBA 3FUZA 3SEWA 4ZE8A 1SI0A 1B58A 1XHYA 2FA7A 4PETA 5AA2D 2ZNTA 3KN8A 1JVYA 3HCQA 4RY1A 4WXJA 3VVFA 4TQUQ 3U1OA 1HSEA 4JWYA 3ZS6A 3OD7A 3CFXA 5JTYB 4BDQA 3ZSFA 4U4SA 2REJA 3C4MA 3MQ9A 5AA4B 3FJ7A 3K01A 1H76A 5I2KB 5TP9A 3PUXE 4NWDA 1Q1KA 3GBAA 5H8NA 3DP4A 3H6VA 4MLVA 5AA1A 3W9VA 3EHTA 4OENA 4X1DA 5I2NA 3PV0E 3BFUA 3TAJA 4ONYA 1VR5A 2G29A 4MBPA 3KSJA 1P1WA 1LB9A 3C31A 4R9FA 5EHSA 3FD3A 1MXUA 3MVWA 2G93A 3H6TA 4LA9A 4ELOA 1FQFA 3K6WA 3TTRA 4NF5B 1SYIA 4IGRA 2QMWA 3VV5A 4IO5A 1VSOA 3JV9A 3GZGA 3K6UA 1LSTA 1MQDA 2QS2A 2ZNUA 3KEIA 3MC2A 4XKRA 4JSOA 3IOWA 3H3GA 4OYVA 3UGWA 3K6VA 3QAXA 1SW4A 1UQWA 5ICQA 2Y7PA 5H8HA 1Y3QA 1GR2A 4KPTA 1ZU0A 1B4HA 1WDNA 2CZLA 3KFMA 2Q2AA 4FJPA 4IO7A 4EXKA 2M8CA 2GHBA 3TFLA 4HW8A 5CC2A 5LOMA 5AE4A 4ESWA 1M5BA 3MZ9A 4PQJA 1MH4A 5KCJA 5AA2A 4R2BA 2NWJA 2RC8A 4R2FA 1D3KA 2XXPA 4XKQA 4ZZEA 3KBRA 4OEVA 4NF8A 1MQGA 3MP8A 3FV1A 3E4RA 3KOSA 1DMBA 5ELVA 2A5SA 4OETA 3P7IA 1N3WA 3A3UA 1PDAA 3M3FA 1MM6A 4H5GA 4RXLA 1JQFA 2XD3A 5H8FB 5TU0A 1N76A 2HZKA 4IO4A 2PX1A 2ZYKA 4U1OA 3U8QA 4DZ1A 3SERA 2PMSA 1SW2A 2HQ0A 1SI1A 4XKPA 4XTCQ 4BDMA 2Z22A 2X7PA 2RF1A 4BDLA 2VD2A 4E0XA 5FHNA 3N94A 3PMWA 3V8XB 1B40A 3KJTA 3TEPA 1Y3PA 3O9PA 4R6KA 2DWHA 4KHZE 3OO6A 2F34A 4RJZA 2F97A 5I59A 1B51A 5A5XB 3MBPA 2I6EA 5JTYA 1USYE 2A5TA 1EH3A 1Y3NA 2ZMBA 4IB2A 3CR9A 3GXAA 4HCWA 5FTHA 1UIUA 5L8DA 4R6HA 3O97A 5K2YA 5L9OA 1N04A 3TCGA 3FXQA 4H0WA 3OO8A 3IJXB 2UVIA 3LSWA 3H6WA 3PUYE 1LAFE 4JB7A 2ONSA 2F8DA 4GFRA 2VGQA 1B3FA 1MXVA 3IK6B 4WKMA 3TQLA 1FQEA 1NKXA 1N3XA 2D21A 3V89B 5I56B 2ZXTA 1LBBA 4U21A 4TLMB 4G77A 1QUIA 4I62A 1A55A 1MDP1 4N6PA 4MF3A 4POXA 4RK9A 3W15C 4F1VA 3RQTA 1O63A 3LSLA 4JWOA 5KCJB 4G4PA 4UA8A 3EF7A 5I57A 3IB0A 2ZYMA 4DXBA 4HCYA 2Y7IA 3B7DA 3QYTA 1AOVA 4BDNA 3E3KA 4NF8B 3G7WA 4OMBA 4TOZA 4BDRA 1ATGA 5CI5A 1QKBA 1ZMGA 1IXIA 3LBSA 4F1YA 1A8EA 1B3HA 4JWXA 2QMXA 1B3EA 1ELJA 3ECRA 3IB2A 3H03A 3PUWE 4G68A 4I1DA 4EQ7A 1XS5A 2XXXA 2YPNA 2DE4A 2O68A 2YJPA 3HPIA 4ZEFA 3U93A 5I84A 2PVUA 1ZTYA 2OZZA 2V3TA 3T96B 2YLNA 4LUBA 1MPBA 4YB6A 3DM0A 4NE4A 4NF6B 2NOOA 3D4GA 4H8IA 5JEIA 3VLUA 4R74A 3FGSA 2HZ8A 1OIBA 4FORA 3THIA 4F3SA 3PGFA 1IUDA 1ZJLA 2H99A 4ZS9A 4GQOA 4GOTA 3UN6A 4AQ4A 4ESXA 5JK4A 3S9MC 1SDXA 2F5XA 2I3VA 3C36A 4YU0A 4R6YA 4RYAA 4OWDA 4LZ5A 3F11A 4PFWA 4X48A 1POTA 3O6HA 4NTLA 1UTBA 1A99A 1II5A 2PT2A 4LATA 5I58B 4KYSA 4MH5A 4QFLA 1LAGE 4YB5A 3O29A 4Q0CA 2HCAA 5EHMA 3TELA 5I2KA 2PYYA 1JW4A 4GVOA 1B32A 1SQYA 2D3IA 1UIVA 3FASA 5KDTA 1LFGA 3N6UA 4AB6A 1NNTA 1I6QA 4OXVA 4F3GA 3TCHA 2Q8JA 3FVNA 4H67A 4LP2B 4GF8A 2H25A 5BUUA 2HAVA 1I6BA 4YKKA 4F2OA 3GBBA 4KR5A 3SEYA 3TODA 1MQJA 2DWJA 3FJGA 3RY3A 1SBPA 3R26A 4QSEA 4DDDA 3ILUB 2E0SA 3MAMA 4EF1A 1QJMA 1Y20A 1B1XA 4PFYA 2Y7RA 3S2VA 1AIVA 3TUSA 3FJMA 4JBZA 1MY2A 2XXTA 1DPPA 1R9LA 3CRBA 4FIMA 5I58A 1UTHA 4JXIA 4O3BA 2Q9TA 1DSNA 2O84X 3IO6A 4ZZAA 3M3LA 3SKPA 1MQHA 4G8NA 2I0BA 4R75A 3HN0A 4N13A 1TFDA 1IIWA 2ESNA 2I48A 4IY5A 3K1PA 4Q30B 5ITOA 3TTMA 1B1HA 4F39A 1EZPA 2H98A 3LUYA 4HS7A 4OZ9A 2PT1A 4ELQA 2ABHA 2OWSA 1ANFA 2OCUA 3SETA 3IOTA 2P0SA 2FNCA 3G3FA 4P0GA 2IA4A 5HPQA 4MLQA 3UORA 5B7DA 1IZ1A 1PEBA 1B5HA 4RK2A 2VP1A 2P1SA 1A7LA 3SEVA 1SD3A 4DE8A 4KCDA 2R71A 2XXVA 1CE2A 2THIA 2RC7A 4ELPA 1Y9UA 3TPAA 2ZYNA 3G3IA 5H8QA 4F2QA
chains in the Genus database with same CATH superfamily
3C8GA 3S9EA 2XXRA 2WVNA 3O2AA 1JEVA 3BRJA 4P0IA 2HKVA 1FCKA 2HFIA 1FPDA 5EYFA 3OEMA 3DE9A 1R9QA 2R9JA 4U5DE 5LTCA 1MDQA 3MPLA 3SP1A 3AXFA 2H8AA 3B6QA 3PUVE 4GL0A 4NCQA 4G2ZA 1LKXA 3DI5A 1OCOC 3ABKC 4QHQA 1EZOA 3RGYA 3Q6MA 3V5YA 2Z8EA 1POY1 2F3BA 4MJOA 1MMNA 4MS2A 1OW7A 4EDPA 1WN0A 2XSEA 5ET5A 3B0UX 4XXUA 3OEOA 2O69A 4OANA 4KC9A 4PR9A 2B65A 4E0HA 1MXXA 4H45A 4K3FA 3C33A 3KZGA 4LDQA 3C18A 2DI3A 4NTFA 2LK4A 1EI7A 3R2PA 1B6HA 3HV1A 1A41A 4ZEKA 5H8QB 4EQ9A 4AX2A 4QFKA 1J8YF 1AWBA 3GEHA 3K1HA 4EUOA 3TYHA 4JC7A 3QMKA 4I8CA 4NAPA 5HBCA 2CEYA 3CSBA 4PTKA 2HAUA 1NUZA 2QL3A 3H4ZA 3T93B 1NV7A 4QFOA 1TXFA 2H7OA 1ZU5A 1T6QA 3UA8A 5TJ5E 3C8GB 3NMKA 3RQEA 2XRHA 2GHAA 4PFOA 1T5OA 2RD9A 3X1OA 1IMEA 1GTKA 2OBGA 2OJTA 2QS4A 4LONB 1O64A 1BBHA 3O39A 4H5FA 5LDZA 2GFEA 3E9VA 2KLFA 2WX9A 4GWYA 1IW7F 3MZBA 3PUZE 5KYWB 1NH8A 4N4WA 5TPAB 3AG1C 3RQFA 4I3YA 3K33A 1SW1A 5FHOA 1M5FA 5H8FA 3CFLA 3FVKA 3I3VA 2LCHA 1MS7A 3CG3A 4MX6A 3OWTA 3C32A 3JSEO 1ZZPA 2PFDA 3PDMP 5CBRA 2UVJA 4A4AA 2YL0A 2H4IA 3IQCA 3Q29A 2CZHA 1NSGB 1LM3B 1FQAA 1JW1A 2ONKE 4NTAA 1WODA 4IO3A 3AQBA 1A40A 3W2WA 4WEPA 3EPVA 5TP9B 2Z23A 3I6VA 3O6IA 5I59B 4YT2A 1B7UA 3V5AA 4G68C 3ZQYA 4P3LA 3C34A 3ECSA 4R73A 3DAFA 5KDTB 1WTYA 2V3CC 4YKIA 1RYOA 2FVZA 3G3JA 1RKEB 1RMVA 2R9RB 4FEBA 1CB6A 2V93A 3VXCA 3AJMA 4LZ7A 2F7AA 1CGOA 3USDA 5T3JA 4YKPA 1A7DA 1D9VA 1KA0A 4FX5A 2J7PD 1QVSA 1H45A 3VVDA 1OVBA 1Y4TA 3PMVA 3QXMA 3CZ6A 2Y69C 2F36A 3E78A 1M5DA 3ZVRA 4YMAA 2O6AA 1XWJA 1B05A 3W4YA 4WEDA 3TOMA 1O7TA 3FZVA 4AL0A 1ZIUA 1IXCA 1JETA 2XX8A 5DTBA 2ZXWC 2R7TA 1N1CA 3Q6NA 1H9TA 1QUJA 1WOLA 3A11A 4I3MA 3K6XA 1B3LA 3JT1A 4FWVA 3KN7A 1I69A 3RUMA 1MQIA 1US4A 2Y5KA 3IL1B 3IEEA 1G4US 4IO6A 3EHSA 1NLXA 5DQTA 4XTKA 3FVOA 3T9OA 3GANA 1FR0A 1VLTA 5CI8A 4Z9JA 2ONRA 1JR8A 3FBPA 4KD5A 3TD7A 4R32A 3MP6A 4FAJA 3B6WA 3N0TA 1KWHA 2XL8A 5JUAA 3AG3C 4EKWA 1YYZA 2A5TB 1PC3A 3MW0A 2A1DD 3WG7C 4MNDA 3W8IA 2DXRA 4OVSA 4OEUA 4MVMA 4GXSB 4HXVA 1NV4A 4N6HA 5IZ3B 1GS9A 1FTOA 3TKDA 2DE3A 2XXKA 2O1LA 5HSWA 5AC4A 5AA2B 1SR2A 2E87A 3U72A 4ND9A 1P1UA 3LUZA 3IOVA 2PBWA 4PFIA 2NSGA 2QY9A 3WAQA 2DVZA 2WKYA 5F24A 2H5YA 1M5EA 5FTIA 2F78A 2XXHA 3E70C 4DJ9A 4M4GA 1RDZA 2YQYA 4NMYA 3RVYA 1TQGA 1B0LA 1OMPA 2UYFA 3RTFB 1BR2A 2HXWA 3D4CA 3EGDB 4U22A 4X9TA 4YL3A 2HPGA 1IZMA 3R6UA 1CNQA 3GEIA 1ZLQA 2D5RB 2I49A 1UTBB 3JRTA 5I58A 3SEUA 1A8FA 5CMKA 3V5XA 1GV8A 3MJNA 5ET7A 2V26A 2RC9A 3DE8A 1G4WR 1BIYA 4NF5A 3T4RA 5BUOA 2J8WA 4JEAA 4DXCA 1NNKA 1LPEA 2W4BA 2NSFA 2H7VC 2FYIA 5I57B 1RCPA 5DEXB 4IAQA 2YL3A 2GA0A 1SF8A 1NU9C 1MXWA 1BP5A 4AE4B 1OLCA 3FOOA 1YZ0A 2UVGA 2J46A 1OLAA 5T3WA 5JT4A 1NUYA 1B7HA 1LBCA 4P9FA 3O6XA 2RINA 2DXYA 1OR2A 3K0VA 3WAFA 2XD2A 4OFLA 1UG7A 4PC9A 4G68B 4NF4B 2HSQA 3IX1A 5I2NB 3FUZA 4ZE8A 1XHYA 4PETA 1KNYA 1DOVA 2ZNTA 3DM5A 3HCQA 4TQUQ 3FMSA 2EILC 2NUTA 1TWHA 3RYLA 4U4SA 3C4MA 5AA4B 2ZPAA 3K01A 2B0HA 2J0XA 4P47A 5I2KB 2LIGA 1RDXA 5H8NA 2OOCA 3W9VA 5AA1A 4X1DA 1YLMA 2GWWA 4ONYA 5T1DB 3KSJA 1P1WA 4R9FA 3G4ZA 2G93A 4LA9A 3GM1A 1M2OA 4PK4A 4GBWA 4IO5A 3KL4A 4XKRA 2ZNUA 4W8PA 4JSOA 3IOWA 1ZHZA 4GWSA 3KFMA 5EYGA 2Q00A 5LOMA 5CC2A 4GBVA 4UABA 1FBFA 1MH4A 2R02A 2NWJA 4NY3A 3ROJA 3GM3A 1KA1A 3KBRA 4OEVA 4JRZA 1MQGA 4QDLA 1FPLA 1DMBA 5COGA 1LS4A 1DOWA 3A3UA 5H8FB 4F22A 1LBXA 1R4TA 4DZ1A 2PMSA 3QVYA 2YLGA 2HQ0A 4XTCQ 3ISPA 2ZXPA 2X7PA 2RF1A 2Z22A 4U9EA 2XLWA 5KYUB 3V8XB 1OXKA 2W4MA 1FBPA 5JTYA 4CIPA 1B51A 2I6EA 4O7IA 3CR9A 5FTHA 4R6HA 1K9ZA 5L9OA 3NMIA 4P9TA 2Q9CA 1N04A 3IJXB 2UVIA 3H6WA 2F8DA 1B3FA 4CS8A 1NKXA 3UGPA 1TWAA 3CQZA 3EH2A 3W15C 1CPQA 4RK9A 4JWOA 4MVRA 3J06A 4UA8A 1V55C 2ZYMA 4DXBA 3UMIA 4HCYA 1FPEA 5IGAA 3QYTA 1FPIA 3FAJA 3NG1A 4BDRA 3KYJA 5CI5A 4C3DA 4F1YA 1XI6A 3ITFA 2EINC 1ELJA 2A0UA 3LESA 1AEPA 4EQ7A 4N6CA 1XS5A 2DE4A 2JJKA 3U93A 5DW8A 2Y3GA 1CGME 2V3TA 5A6KA 2XM4A 4YB6A 2KR0A 3VLUA 3FGSA 2HZ8A 3THIA 5I7IA 3ZC4A 1IUDA 2EIKC 4GOTA 4ESXA 3MSTA 5JK4A 4ER9A 1Q0KA 4OIOF 1SDXA 4R6YA 4GQHA 3F11A 4PFWA 2G3VA 3ZDLA 1A99A 2PT2A 4JTDB 2HXRA 2OX3A 1LAGE 3O29A 2HCAA 3V7OA 4I3EA 4QBAA 1JW4A 1B32A 2XWOA 1UIVA 2D3IA 5EHHA 4AB6A 4PDHA 4NX1A 4K7BA 3PHF2 3TCHA 2G62A 1VTMP 2KJGA 4YKKA 3SEYA 4PAIA 2P7VA 4QSEA 4PFBA 4DDDA 1Y20A 2XS8A 3HKKA 2Y7RA 3TUSA 2O9XA 4JTCB 4B6IA 1Z7Qc 1LBZA 4DRIB 4JXIA 2Q9TA 4ZZAA 3RVZA 1FPFA 3M3LA 1PD0A 1IIWA 1SZIA 4O7MA 1CGNA 4F39A 2WZFA 2H98A 2R7UA 1O3UA 1EYJA 1ANFA 4GWZA 3A9CA 4CDVA 1HW1A 2WYKA 4P0GA 4CS9A 4MLQA 2PP4A 2OQMA 1B5HA 2XLMA 4GX6A 2P1SA 4NG7A 1B68A 4DE8A 5JP7A 3RW0A 3CEXA 2RC7A 4WGYA 2ZYNA 3IFAA 3QMFA 2ZXRA 2QNLA 1QW0A 4GIZA 2CGEA 2ZZXA 3UK4A 3S29A 3VLWA 5L0DA 2HFBA 2BJIA 5A6JA 3GORA 2V84A 2Z8FA 5KYNA 2KYHA 1YCJA 1LE2A 1MRPA 3LSXA 3RTWB 1MQVA 4E18A 5DS5A 3N24A 1GGGA 2HZLA 1FFHA 2QVUA 4EBBA 2XXWA 2Y5LA 3KC0A 1AVOB 4RPNA 2KNHA 4WGZA 2MHRA 4P1LA 1HMOA 1WASA 1OW8A 2J45A 1J8MF 2LQGA 4OVQA 1H43A 5DLJA 2QS1A 1NNFA 3T22A 1I4YA 4OQOA 2L5VA 3ZWIA 1TWCA 4MW3A 3N5LA 4QXDA 4GXAA 2CDQA 3IOUA 1RXQA 3H6UA 4QRZA 4EXLA 3GWLA 1NUXA 2FGYA 2AP3A 5B70A 1JEUA 4PP0A 3QUJA 4FEDA 2YZSA 3E13X 4YB7A 2F35A 1A54A 2ANJA 3R7CA 3T6GB 1FJ9A 3HLZA 2I58A 3M15A 1IQ7A 4IARA 4AL1A 3KMIA 4C3BA 1B3GA 2R7WA 1Z63A 1NU7D 3EG9B 3K7DA 4OVPA 3TTLA 3IB1A 1VDWA 1OQCA 1LIHA 3L6GA 2DWIA 3TDJA 3W9WA 4Q5SF 1VFDA 3C9HA 4LDRA 4XEFA 3TQWA 3HO7A 1YTVA 1NFNA 5HM4B 2FAPB 3EN3A 4F29A 4C7OB 4G8HA 1TWYA 3U2MA 3IQTA 2DQVA 3JYRA 2LSEA 3L1MA 2AL5A 4MNPA 2BL2A 3FVYA 4DOZA 2VD3A 2Y7KA 2UUHA 4K1OA 4ZE9A 4NQFA 4KYDA 5KCJA 2QRYA 2IEEA 3C8GD 1S50A 2YVKA 4U1ZA 4G7OF 2XX7A 3ILTB 2Q3TA 1G8XA 3U2LA 3IO4A 3L8IA 4OVTA 5EGYA 4X1BA 2CYDA 1FQDA 5L0HA 3TJ6A 1FJ6A 3RNNA 4KBLA 4O6YA 1L3PA 1LBVA 1XVXA 3KBZA 4X8RA 4IGTA 3B6TA 3T1BA 2O7UA 3SXKA 3M79A 3ZSUA 1FPGA 3EQLF 2XWVA 5AA4A 2Q9AA 4P6IC 3FHDA 4O3AA 2IOQA 5BQIA 4OFOA 3RN8A 3MFNA 3MLGA 1URSA 4PFTA 4H54A 3TQOA 2OK2A 4DI4B 2Q88A 3AOUA 2E1SA 4G7HF 5J1DA 2JX0A 2L9JA 2RCAA 3G3GA 1SYHA 1EU8A 3SDFA 2W45A 1T0KA 3CSKA 4DCYA 4X0RA 4BG0A 4DXWA 2Q7RA 4CX9A 4DVYP 5KZTA 1BR1A 4R9GA 1LLSA 1B46A 1U0BB 1VOMA 2AYSA 3Q26A 1BZ4A 2VPOA 5DVJA 2LFFA 2ALUA 1WATA 2XHDA 1UTHB 3BEHA 4C7OA 1TFOB 2XLHA 4RPOA 3O55A 1YVIA 3F47A 4TLLB 3RPLB 1OCRC 4HFKB 4F3BA 4JDFA 2HJMA 3EHMA 1B0HA 3GLBA 4YT8A 4FE8A 2DDKA 3KPHA 2XXUA 2WZLA 2OJED 3RIPA 4HE0A 4QF9A 5AGFA 4ONSA 2D5WA 1LS1A 3HHGA 1QZXA 4C3EA 2O1MA 2PX3A 5AC5A 3KSXA 3UP9A 3AGUA 4J30B 1Q0FA 5E3CA 2WL8A 5EQ7A 2R7OA 1QQ3A 1DCUA 5H8NB 3CG1A 4DBRA 2XX9A 3K1IA 2NUVA 3NKEA 3CHGA 1BKAA 3G3HA 2FIEA 3DXJF 5M2VA 3HNLA 5FHMA 2V25A 1TFAA 3SXZA 4N91A 1OCZC 3ZG1A 3OMBA 1ZHWA 1SVXB 3DD7A 4JZAA 4XEKA 3U5SA 2PNOA 1M2VB 3B9QA 1T6IA 4U23A 1FTMA 1MPCA 4N6DA 3H2VA 4QSDA 4ELRA 2ETSA 2ICWG 3S9OA 1XVYA 1DPEA 1YAEA 2DYSC 1WVJA 3C7JA 1E2XA 3TZAA 4C1TA 3QK6A 3EFOB 3KOTA 4CSAA 1NH7A 3K66A 2AL4A 1ORSC 3FXBA 4MMPA 2EPKX 2VB6A 2WVOA 4DI3D 1FTJA 3MVXA 1ZBMA 5JSLA 4JTAB 4F31B 3B0PA 3G3KA 1B5IA 3DP8A 1RKMA 4N8YA 2CNWD 5A5XA 2OLBA 5ITPA 1Y1ZA 1XZQA 3VFJA 2X51A 4KI2A 1EZ9A 4ULVA 3O66A 3H65A 1E86A 2OWTA 3H06B 4PGNA 5DT6A 3S9LC 4NTBA 3KGCA 1F9BA 3ONMA 2QSXA 5IAIA 3K6BA 3HNKA 5DVIA 4N07A 1MY0A 3TTKA 1HSLA 4GRKA 2J7PA 1NFTA 2BC5A 1T01A 2PF4E 4EBJA 4MEVA 4MIJA 1QVXA 3KH2A 1LAHE 2NXOA 1Z7ME 4A2NB 2HEUA 5B1BC 4ZEDA 3E9XA 3K02A 5CMCA 5CIVA 3D1RA 4ISUA 2O51A 3JZ0A 3VRCA 4YMBA 1B58A 1NZEA 2FA7A 5DVWA 4I44A 3U1OA 1HSEA 3ZS6A 2KGOA 3ZSFA 5BQHA 5KYXB 1Q1KA 3DP4A 4MLVA 5IM2A 4OENA 1VR5A 3DZAA 1LB9A 3MVWA 3H6TA 4GWUA 5EYHA 3ABMC 3TTRA 1ZHYA 4NF5B 1D0YA 4IGRA 1HMDA 4BJTA 3RFYA 1KTMA 3K6VA 1SW4A 5H8HA 1Y3QA 2PFYA 1B4HA 4FJPA 4IO7A 4EXKA 2GHBA 3TFLA 4HW8A 1CPRA 5AE4A 4JCHA 5AA2A 1JPJA 3B71A 1FSAA 3IHUA 2XXPA 4KNWA 4PACA 4NF8A 3JCUQ 1Y6DA 1FPJA 4GYTA 2AWCA 5EK0A 5J16A 2ZXOA 2AVKA 3P7IA 3M3FA 3EFOA 4F3PA 3JSZA 3UMHA 1N76A 4LN5A 4JIOA 3SERA 4N15A 1SI1A 3LS1A 4U9DA 4LERA 4PAFA 4PF6A 2FHYA 4R6KA 4KHZE 2F34A 2F97A 5I59A 3MBPA 1MNEA 2ZMBA 2EIJC 2R25A 1YJGA 1Q0GA 3T6JA 4U5EE 1UIUA 3NRHA 1ST6A 1D9QA 2ONSA 3IK6B 1JOGA 4J7YA 2XWKA 3V89B 1N3XA 2L7AA 4U21A 3JTLO 4HE2A 4LACB 1MDP1 4F1VA 4D4XA 3QW1A 1O63A 4GX4A 2AWYA 4DRJB 2Y7IA 3PMRA 4MHFA 4NF8B 1ATGA 1QKBA 3LBSA 2J0WA 4JWXA 1B3EA 3IB2A 3PUWE 4XQ1A 3ZIBA 3L34A 3HPIA 3HNJA 4AS5A 5GPGB 1U6HA 1MPBA 2NOOA 3D4GA 5JEIA 2ASRA 3VYWA 1ZJLA 1E85A 5FZTA 3QW0A 1K9YA 2I3VA 4CJOA 3WHNA 2A68F 3O10A 4NTLA 1LI7A 4J7TA 2P3NA 3UGOA 4LATA 4KYSA 4GEHA 4G7ZF 4QFLA 3NOHA 1JMWA 5EHMA 3EZHA 3K1IC 2HHMA 3EKIA 5EQ8A 1SQYA 4JVDA 1LFGA 1NNTA 4YN0B 3FVNA 2R7VA 4H67A 4GF8A 1I6BA 1FMWA 4KR5A 1MQJA 2XA5A 2WYPA 3RY3A 1SBPA 3R26A 5E3AA 4EF1A 1K05A 4MVOA 1B1XA 1D1AA 1DPPA 3CRBA 2XLEA 2O84X 1MQHA 4WJ0A 4N13A 2PBEA 2ESNA 3TTMA 2DGJA 4EWCA 3M1CB 3QZCA 4HS7A 4GWXA 1ZVZA 2OWSA 3IOTA 4OD5A 1RJ9A 2FNCA 1D1CA 4JEBA 3JRMO 1PEBA 4JW1A 5A6BD 3DJUB 3IFCA 3SEVA 5B3SC 4E7ZA 4CSAC 2R71A 2XXVA 4XPYA 1CE2A 2THIA 1Y9UA 5H8QA 4F2QA 1IMFA 3S27A 4CS9C 2QLAA 2CW0F 3IAZA 3R7XA 1FNTc 1Z7NE 5IZZA 4IAOA 2I4BA 3VAYA 2Z15A 4ECFA 2DP8A 3EHUA 3S4UA 2WEFA 3B0VC 2DSFA 1NFOA 3CFZA 3U3BA 1URDA 2ZZWA 3JYYA 3TMGA 3DWWA 2UXAA 2J9VA 3LS0A 1IITA 5K2XA 5I3SA 4O6NA 1BK4A 1GQAA 1LFIA 1LGBC 5DEXA 2FBPA 3M3KA 2B3BA 3TULA 3IR1A 4YJWA 3EHNA 2F7CA 1DTGA 1VB5A 1G5ZA 4OERA 3MX3A 4KI0E 2KQZA 1IXGA 3RQGA 1C17M 1IMCA 1YPNA 5A6AA 4OHNA 2VH3A 4OESA 3RPWA 4ZECA 1HE9A 2Q89A 3M8UA 4XEQA 1ZW3A 1K40A 4G78A 4PJLA 2XL4A 5FCLA 4ELQA 5HV9A 2W7YA 2Q4FA 2CEXA 1TT1A 4NEDA 1Y4CA 3SXMA 5CM6A 4AB5A 4H1XA 2QVRA 4DIGA 3O6GA 3DM9B 3PCVA 1SW5A 3MYFA 4N8GA 2NUPB 4LQ2A 1R6ZA 1JRAA 1TFKB 4U4XA 4FATA 4F18A 4ZLDA 2REGA 3BFTA 3MUQA 4O3CA 5H8HB 4H6DA 4XFEA 1PCXA 1OR3A 3MYUA 3C35A 3VDFA 2HS5A 2VHAA 3Q7LA 3PPOA 5CMMA 3RKOF 3PD9A 4YAHX 1NV0A 2AIXA 1LEVA 1YYXA 3U92A 5BWJA 1C03A 2J9UA 1FW0A 4DBQA 5CBSA 4BJ5C 3OOAA 3T66A 4M1VA 4PFUA 3SNHA 3FXRA 1JAFA 3U0CA 3BBRA 1PB9A 3UNGC 4MVUA 4OIQF 3PD8A 4DVZA 4JJFA 3KG2A 4ZDMA 2WVQA 3NKDA 3FV2A 4FECA 1S7YA 4OFJA 1MH3A 4YZZA 1MY3A 2Q9BA 2GRVA 4PCDA 3LUTB 1NUWA 1A0BA 1PB8A 2J9BA 3JZJA 3MVZA 4L17A 5TPAA 4IB4A 2X7QA 2DOJA 3POVA 2H9BA 3MZ1A 2QPQA 3SZPA 5E2QA 5DVFA 2DYRC 5IKBA 3Q28A 4JVSA 2HV6A 3NMJA 5I56A 3FIRA 3IORA 4GL8A 2I15A 2HJ3A 5JVEA 4KFQA 3DAGA 4MCOA 3AG2C 2HMZA 1NV5A 3HTKC 1RJ9B 2EPNA 4FAPB 2Z8DA 4CS7A 2VASA 3N6TA 5H8SA 1I6AA 3EJNA 3VLVA 5D92A 4Z0IA 1MY1A 2XXQA 4NHBA 4NF0A 4CDAA 4QFNA 4CDYA 1MY4A 4U5BE 3PMXA 4IWBA 1P1NA 3ZKLA 3KN3A 1DOTA 2QVVA 2Q2CA 3K00A 4CS8C 4H4KC 4ULWA 3EG9A 3ABLC 1KZ8A 2TMVP 3VE1B 4BLAA 3I4UA 4IRUA 3MP1A 4UACA 1H44A 2QS3A 3MWBA 3I5PA 4ZEBA 4DLDA 4IO2A 2LFDA 4PBHA 3OSRA 1YDIA 3KJ7A 4LLEA 1XOCA 2PFZA 1B9JA 3PPQA 1R1NA 3T9VA 4D4NA 4JURI 1OQHA 1ZU4A 4Z9HA 4GWOA 1B7ZA 3ZTZA 4EUKB 1INPA 1NV6A 2A6EF 3MPKA 5F7VA 4YL1A 1P99A 2OJQA 2I3WA 1MG1A 5ICQA 1NV1A 1VE4A 2OWZA 4NF4A 5ISUA 2I8BA 3IJOB 1H6GA 4EF2A 5L3VA 3OO9A 1FBCA 1A7EA 1MPDA 4MQ9F 1VMAA 2DWAA 3NYMA 5ET6A 1D0XA 3ASOC 1LBYA 3I5QA 2EPLX 2BJJX 3U94A 1IMDA 2UYEA 1PB7A 4HTGA 2OCCC 2VCAA 3AQCA 1Z6AA 4KYEA 4E0IA 4GLIA 2OU6A 1QUKA 2YRFA 3ODBA 2OEXA 2KQ9A 5E33A 2EPMX 2DVCA 3RLFE 3T9XB 1M2VA 5CMBA 3Q27A 4O7GA 3OEKA 4H8JA 3CVGA 4Z7EA 1TKNA 2OKUA 4Q5TA 1BLFA 4NF6A 1B4ZA 3SEXA 2F3DA 1LFHA 4C1UA 4MVSA 1SI0A 1YYJA 3KN8A 1QLEC 4RD9A 2W9YA 4JWYA 5DS6A 1O5HA 2A69F 3CFXA 5JTYB 2REJA 5A5LA 3FJ7A 1G0HA 2GQ1A 3PUXE 1YZAA 4NWDA 5KYUA 4IJJA 5B3IA 3LLKA 3PV0E 3BFUA 3TAJA 1Q9DA 256BA 3C31A 5DS4A 3FD3A 1MXUA 1XZPA 4ELOA 1FQFA 1IMAA 2IBFA 1H7IA 3VV5A 1VSOA 3GZGA 3K6UA 1LSTA 3ZKKA 4EHPA 3H3GA 3V5ZA 4OYVA 1UQWA 3HJCA 2Y7PA 1GR2A 4OD4A 4N06A 1WDNA 2GAQA 5L0FA 2Q2AA 4XWJA 2YL1A 2QTVA 4MTFA 1M5BA 4Q7CA 2R7RA 4H46A 5KYYA 2RC8A 4R2FA 4XKQA 1I4ZA 4ZZEA 2VT5A 5FBPA 3FV1A 3BIGA 3E4RA 5ELVA 5L0GA 1BDJB 4OETA 1N3WA 4RXLA 3US6A 3EGXB 2HZKA 3U8QA 4U1OA 2L6HA 2ZD9A 4BDMA 4XKPA 2FIXA 2GFHA 1NI9A 4BDLA 4E0XA 4IGGA 2LD6A 3N94A 3SEOA 1E83A 2L81A 1B40A 3EGDA 3KJTA 3NDBB 1Y3PA 3O9PA 1S05A 1PV3A 3H2UA 2NUTB 5A5XB 1C02A 1M56C 1Y3NA 2Q8MA 4HCWA 3O97A 5K2YA 3S84A 3TCGA 1FBGA 3OO8A 3LSWA 3PUYE 4PDDA 1LAFE 4JB7A 5IZ3A 3TQLA 5EQ9A 2VGQA 1MXVA 4WKMA 1FQEA 2D21A 3LEOA 5I56B 2ZXTA 1LBBA 2BE5F 2JPUA 1D0ZA 3AG4C 3GEEA 4N6PA 4POXA 4MF3A 1LE4A 5KCJB 3LSLA 3L8JA 5I57A 3B7DA 1IMBA 2VCCA 3E3KA 1F1MA 4E17A 4TOZA 1IXIA 1B3HA 2QE9A 3ECRA 1V54C 2OEVA 2GDCA 4U5HA 3B50A 4I1DA 4ZEFA 2O68A 5I84A 4XF5A 2PVUA 1ZTYA 2YLNA 4LUBA 3DM0A 1QKRA 3KKBA 1SPIA 4R74A 1Z3IX 4JVCA 2PX0A 5KYXA 4F3SA 5HPQA 4N6KA 3UN6A 2V4CA 4AQ4A 2F5XA 4BPMA 3C36A 4OWDA 3LNMB 1FTAA 4X48A 5ESYA 1POTA 3SXYA 2VC9A 1UTBA 2YKZA 1FAPB 5I58B 2YLDA 4MH5A 2Y3HA 5I2KA 1HY5A 1H9GA 3FASA 4JJGA 2P6VA 1I6QA 5A6BA 3T0JA 2HAVA 3GBBA 3TODA 4OA4A 3G50A 3MAMA 1QJMA 1AIVA 1HE1A 3S2VA 4I1OB 1MY2A 2XXTA 4FIMA 4N4UA 3IO6A 4QI2A 1YA7O 3DKAA 3TK0A 4EIYA 2B4MA 5I5PA 4Q30B 5COFA 4IY5A 5ITOA 4PJMA 3B29A 2WB7A 1B1HA 1VYKA 3LUYA 4OZ9A 2PT1A 2RSEB 3KC1A 1G0IA 3HFUA 1ORJA 2IYLD 2OCUA 3SETA 3AGTA 3G3FA 2FFHA 2IA4A 4MW8A 3UORA 2XWIA 2C03A 5B7DA 2L6GA 1IZ1A 3EGXA 4RK2A 2Y3DA 4MNCA 3UR3C 4KCDA 5IZ1A 1MMDA 2MYSA 4ELPA 3G3IA 2MWQA 4FBPA 5JS5A 3FVGA 2NPUA 1RYXA 4Q8RA 1B5JA 2KC3A 3EZIA 4R72A 5T3TA 1ZKBA 3LSFB 2LP4A 4NWCA 3RF3A 1O87A 2HUJA 2P1AA 1E84A 3W2VA 1ORYA 3VVEA 1MM7A 5L0CA 1Z5ZA 1NL5A 3CIJA 3HSTA 3A3CA 1FTLA 1M6TA 5L0IA 3OSQA 1GVCA 3SZRA 4DXUA 3LLIA 4OIPF 1S9TA 4PE5B 1SMYF 2IXPA 2NUPA 2P0NA 1A7VA 1APCA 3UIFA 5L9SA 3GWNA 2XL6A 2IXNA 2EIMC 4ZEIA 2NVUB 1ZYRF 3RT6B 1RDYA 1B52A 1FRPA 4Z9IA 3EPEA 1AMFA 2XXYA 4G61A 4IY6A 4F19A 3FXHA 4N17A 4E7SA 1NNPA 1OXBA 1BR4A 2H7BA 1FPBA 2ZNSA 3U8VA 2KK1A 3H7MA 3M4CA 2NG1A 4XKNA 2AU5A 1BTJA 1QULA 2P2AA 3T6BA 3K1NA 3T9HB 3VVFA 3RH3A 3TOLA 2QFLA 4QFPA 3IQ6A 3A29A 5CRYA 1AH5A 3JYHA 3LEVA 3WODF 1N84A 3V83A 4WABA 2R05A 1J1NA 4L6RA 1PBPA 4P11A 2GH9A 1MXYA 1FBEA 3IQ5A 4KNVA 4O6MA 3KYIA 1V4AA 1FQBA 3NYLA 1N7WA 3SYNA 4CBEA 1ZHTA 4EQBA 2Y7WA 1HW2A 5L0JA 2DYXA 1XC1A 3RT8A 3T9UA 2R03A 3VXBA 1EZPA 2F7BA 2XXAA 3LAYA 1VK5A 4LZ8A 3L6HA 2YEVA 3ZQVA 5F5HA 4PGPA 4RDAA 3K1MA 4O8MA 3BKIB 3DP6A 1JNFA 5I2NA 1IXHA 1M57C 1LCTA 3FATA 2V3QA 3FXUA 3WAEA 1URGA 3Q25A 2CZKA 4K0DA 1QPUA 1FMVA 2ZYOA 5ET8A 5BQGA 3QIMA 4DRHB 4AS4A 2R6GE 1OQGA 1JW5A 1YZCA 3OXNA 1RKEA 3ZTMA 4N81A 4I40A 1NG1A 4IR8A 4JSDA 4QI0A 4W8KA 3GYYA 4DCXA 1FQCA 1MMAA 3U9MA 1NMUA 2P3VA 2J9WA 1YA9A 3A09A 2A6HF 1MXZA 3C62A 1U89A 2Y39A 4FESA 2UVHA 4GWWA 3TCFA 3PPRA 4F1UA 4YT4A 2CMOA 1K04A 4MFIA 4XIGQ 4O79A 5KYYB 2XM0A 1JP4A 2I0CA 4BJ1A 4KQPA 4OIRF 4THIA 4KCCA 1DK4A 2O7IA 1P1OA 2RKMA 4JE9A 1Q0DA 1WWPA 3UMKA 3PPNA 3N2ZB 4H65A 1Y1MA 4GX3A 1XT8A 3S9NC 4PBQA 1TWGA 4OVJA 4PAKA 5F1QA 1Q35A 4LVQA 1M5CA 3QSLA 1QKAA 1L7CA 1LBWA 3PPPA 4P1EA 3X2QC 3OO7A 3N26A 2RCBA 1S7ZA 1YXIA 4I9DA 2XS1A 4HFFB 3TTNA 3OELA 3RPLA 3L0IA 1OKKD 2WBBA 3EQ1A 3K2DA 4RA1A 1FTKA 3ASNC 2Y84A 4HE1A 3RYDA 2F6PA 1ZHXA 1YARO 2YHSA 4UDVA 2JD3A 2QJEA 3LC8A 3SESA 4U5CE 5AA3A 5ICTA 4BDOA 4G8MA 4JKVA 3S0XA 2I4CA 3DLNA 3VM6A 4LQ5A 4E0WA 1H3DA 3I5OA 3K4UA 4OTEA 2X26A 3LR1A 4Q4ZF 3C63A 3PU5A 1FBDA 5DYHA 2WBDA 4GD5A 4HEAJ 2YLIA 4RNSA 2R7XA 1PD1A 2VOZA 3O28A 4YKJA 1P1QA 3EH1A 2C04A 2DS9A 3C8ZA 1JVXA 4G0HA 4YWQA 4ZLCA 3OENA 1UFBA 3Q7GA 3QVZA 2LAOA 4XLPF 2CCYA 1OVTA 1N7XA 1USYH 2P61A 3CSGA 1L5TA 1QGXA 3FDQA 4POWA 2B3FA 5A69A 1IEJA 4YICA 1LCFA 2XLDA 2UUIA 3U8PA 1D4NA 1PBQA 2MKZA 3MVYA 4JCZA 1HSJA 1FTSA 5L9MA 1US5A 1GM5A 2X0CA 1D9YA 3FAPB 5F5FA 2DE2A 4C0RA 4U2RA 2V3UA 5COMA 1B2HA 4OINF 1LB8A 3B8BA 1Z23A 4LLCA 1VFEA 3CI8A 3QUFA 1LAXA 3QTHA 2XXIA 3HHFA 2IM8A 2YWAA 3FOPA 3DELB 2B4LA 1N0TA 4QSCA 4MTGA 4P9KA 4MTOA 1AL3A 1DTZA 2F6GA 1NV2A 3NYJA 1FBHA 2WZGA 3SEWA 3S28A 4XPXA 5AA2D 2CNWA 5IY5C 4M63A 4PJJA 4RY1A 4WXJA 5JLIA 1SYQA 1JVYA 3OD7A 4BDQA 1FPKA 2R7QA 1EA8A 1RKCA 3MQ9A 1EQ1A 1H76A 4MVZA 5TP9A 1OW6A 2YL7A 3GBAA 3H6VA 3EHTA 2HMQA 2OG2A 1MNDA 4PFRA 4MNIA 4P56A 2G29A 3PTYA 4MBPA 5EHSA 5F28E 3U3FA 4HE8D 3CAXA 2L6FA 2ZZVA 3K6WA 4PJNA 4PFPA 4BEMJ 1SYIA 4NN3A 2QMWA 3LJBA 3JV9A 3MC2A 4F3GA 1NBBA 1MQDA 3U9JA 2QS2A 3KEIA 3UGWA 3QAXA 4KPTA 1EKYA 1ZU0A 2CZLA 2M8CA 5L3QA 4ESWA 5B1AC 1D1BA 3MZ9A 5KYWA 4PQJA 4R2BA 1T6UA 2M4EA 1D3KA 4PE3A 1VYIA 2CZIA 3MP8A 2IXOA 2KSFA 3KOSA 2A5SA 2IXMA 1PDAA 1T9KA 1MM6A 4H5GA 1JQFA 2XD3A 5TU0A 4IO4A 4F4BA 2PX1A 2XXAB 4BJ6C 2VPNA 2ZYKA 1SW2A 3OA1A 4P8BA 5K0IA 1WGWA 4AK9A 2VD2A 5FHNA 5JRAA 3PMWA 3M4BA 3U65A 3TEPA 2G3KA 3MYIA 2EPOA 2DWHA 3OO6A 4RJZA 4BJ6A 3F46A 4X04A 1USYE 2A5TA 1EH3A 2DB4A 4IB2A 3GXAA 5L8DA 4U5GA 3W8HA 5EQAA 1GGQA 3FXQA 4H0WA 2F22A 2KW3C 4GFRA 4CIHA 1TR2A 1NV3A 3HNIA 4TLMB 4G77A 1QUIA 4I62A 1A55A 1I5NA 1OKKA 3RQTA 1JPNA 4XLNF 4J32B 4G4PA 3EF7A 3IB0A 2XLOA 4YL0A 1AOVA 2B0JA 4BDNA 4OMBA 3G7WA 2PCRA 1ZMGA 1A8EA 1EYIA 2QMXA 3GM2A 3H03A 4G68A 1OCCC 4BEJA 3DMDA 2XXXA 2YJPA 2YPNA 1R5ID 5DQZA 2OZZA 3T96B 2XLVA 1QSPA 4NE4A 1ZW2A 3TJ5A 2R7SA 4NF6B 4H8IA 2Q74A 4FORA 2VCBA 1OIBA 4NGUA 3PGFA 4ZS9A 2H99A 4MAGA 3S9MC 4GQOA 4YU0A 4RYAA 4LZ5A 3BIHA 3O6HA 1II5A 3IPMO 4U5FE 1DBZA 1VLSA 4YB5A 4Q0CA 3TELA 3LNRA 2PYYA 1AUEA 3G4XA 1Q0MA 4GVOA 5KDTA 3N6UA 4OXVA 4LDKA 4XEVA 2Q8JA 4LP2B 5D91A 2H25A 2R8TA 5BUUA 4CJGA 4F2OA 2DWJA 3FJGA 4AE4A 2QUPA 3ILUB 2E0SA 4O94A 2A0BA 4PFYA 2HV7A 1LVKA 4I1MA 3FJMA 4YK5A 4JBZA 3ATPA 1R9LA 4NC3A 1UTHA 4O3BA 1LI5A 1DSNA 1W2WA 3SKPA 4G8NA 2I0BA 4JVIA 4R75A 2HSBA 3HN0A 3LV0A 4KXPA 1TFDA 3S90A 3MBGA 2I48A 3K1PA 4EBKA 4YT5A 4PF8A 1FFTC 3E79A 4MVQA 2Y3BA 2ABHA 4BJ5A 4OVRA 2P0SA 1V74B 1EYKA 3VF0A 3GODA 4XPWA 3DJNB 2VP1A 1A7LA 1SD3A 1KU2A 1YAUO 2M64A 5CI9A 3TPAA 4RBNA 2D4UA 4NQ8A 1MMGA 4ANJA
chains in the Genus database with same CATH topology
3IAZA 3R7XA 1QW0A 1Z7NE 3S9EA 3FVGA 2I4BA 1RYXA 2XXRA 3O2AA 4GIZA 1JEVA 3UK4A 1B5JA 4Q8RA 4P0IA 3VLWA 3ZKKA 4ECFA 1FCKA 2HFBA 4R72A 2DP8A 3EHUA 5EYFA 3S4UA 2V84A 1ZKBA 2Z8FA 3LSFB 3OEMA 2DSFA 4NWCA 1YCJA 1MRPA 3LSXA 3RTWB 1R9QA 2R9JA 3CFZA 3VVEA 1MM7A 1URDA 1MDQA 1GGGA 2HZLA 1NL5A 3TMGA 3CIJA 2UXAA 3MPLA 2XXWA 3HSTA 3A3CA 1FTLA 3AXFA 4RPNA 3OSQA 1IITA 3B6QA 3PUVE 4GL0A 5K2XA 4G2ZA 1GVCA 3WAFA 4DXUA 4PE5B 1S9TA 1LFIA 1LGBC 1EZOA 4QHQA 1H43A 3RGYA 2QS1A 1NNFA 2Z8EA 5DEXA 1POY1 3T22A 4OQOA 3M3KA 2B3BA 3UIFA 5L9SA 4EDPA 3N5LA 3IR1A 4GXAA 2F7CA 4XXUA 1DTGA 3IOUA 4ZEIA 2O69A 3H6UA 4QRZA 2NVUB 4EXLA 4OERA 2B65A 3RT6B 4KI0E 1B52A 5B70A 1MXXA 1JEUA 3EPEA 4K3FA 1AMFA 3C33A 3KZGA 3QUJA 3E13X 1IXGA 2XXYA 2F35A 4FEDA 4YB7A 4IY6A 4F19A 1A54A 2ANJA 1YPNA 1NNPA 4OHNA 2ZNSA 4OESA 1B6HA 3HV1A 2I58A 3U8VA 4ZEKA 3RPWA 4ZECA 1IQ7A 3H7MA 5H8QB 4EQ9A 4XKNA 2Q89A 1B3GA 1BTJA 3M8UA 4QFKA 1QULA 2P2AA 4EUOA 3TYHA 4I8CA 5HBCA 3CSBA 3K1NA 3T9HB 3TTLA 2HAUA 2QL3A 3H4ZA 3IB1A 3L6GA 4QFOA 2DWIA 3T93B 2W7YA 1TXFA 3TDJA 1TT1A 4NEDA 3W9WA 4QFPA 3UA8A 1Y4CA 1VFDA 3C9HA 5CM6A 5CRYA 4AB5A 1AH5A 4H1XA 3TQWA 3HO7A 1N84A 1YTVA 2GHAA 2OJTA 1GTKA 2QS4A 2OBGA 4LONB 5HM4B 3V83A 4DIGA 1J1NA 1O64A 3EN3A 4F29A 4G8HA 3O6GA 1PBPA 1TWYA 4H5FA 2DQVA 2GFEA 2KLFA 1SW5A 2GH9A 1MXYA 3JYRA 4P11A 3MZBA 4LQ2A 2AL5A 3PUZE 1NH8A 1R6ZA 5TPAB 1FQBA 4U4XA 2VD3A 4FATA 1N7WA 2Y7KA 4F18A 4ZE9A 2REGA 3BFTA 4KYDA 1SW1A 3MUQA 2QRYA 2IEEA 2Y7WA 1S50A 4O3CA 4H6DA 4U1ZA 5H8HB 4EQBA 2XX7A 3ILTB 2DYXA 5FHOA 3C35A 3IO4A 3VDFA 1XC1A 4F22A 2VHAA 3RT8A 3T9UA 1M5FA 3PPOA 4X1BA 3CFLA 3VXBA 3FVKA 3I3VA 5H8FA 1FQDA 2F7BA 5CMMA 1MS7A 3CG3A 3RNNA 3PD9A 4YAHX 1XVXA 3VVDA 2AIXA 3C32A 3U92A 4ZEDA 5BWJA 5CBRA 4LZ8A 2UVJA 4IGTA 2H4IA 3B6TA 3L6HA 3Q29A 2O7UA 1FQAA 1FW0A 1JW1A 5CBSA 2ONKE 3K1MA 3OOAA 1WODA 4IO3A 4M1VA 1A40A 4O3AA 4PFUA 3BKIB 3FXRA 3DP6A 4OFOA 3RN8A 1JNFA 1URSA 4PFTA 4WEPA 5TP9B 1IXHA 2Z23A 3I6VA 3O6IA 2OK2A 5I59B 1B7UA 1LCTA 3V5AA 2Q88A 2E1SA 3BBRA 3FATA 1PB9A 2V3QA 3FXUA 1URGA 4G68C 3Q25A 3WAEA 3PD8A 5J1DA 3KG2A 3C34A 4ZDMA 4R73A 2RCAA 2ZYOA 1SYHA 1EU8A 3G3GA 3FV2A 4YKIA 1RYOA 3SDFA 5KDTB 1T0KA 4FECA 3G3JA 1S7YA 4OFJA 3QIMA 4DCYA 1MH3A 2R6GE 4YZZA 1MY3A 1OQGA 4FEBA 2GRVA 1JW5A 1CB6A 2V93A 3VXCA 5KZTA 4R9GA 1LLSA 4LZ7A 2F7AA 1B46A 3OXNA 3USDA 4YKPA 1PB8A 3JZJA 2AYSA 3MVZA 4JSDA 4L17A 1D9VA 5TPAA 2X7QA 3Q26A 2DOJA 4DCXA 2H9BA 3MZ1A 1FQCA 5DVJA 2LFFA 1H45A 1QVSA 1OVBA 2ALUA 1Y4TA 2QPQA 1NMUA 1UTHB 2XHDA 3PMVA 5DVFA 3QXMA 3Q28A 3A09A 2F36A 5I56A 5IKBA 1M5DA 4RPOA 3FIRA 1MXZA 3IORA 2O6AA 4GL8A 1B05A 3TCFA 4YMAA 2UVHA 4TLLB 1O7TA 4WEDA 3PPRA 4F1UA 3FZVA 4KFQA 1ZIUA 2CMOA 1IXCA 1JETA 2XX8A 5DTBA 4F3BA 4MFIA 4XIGQ 1QUJA 2I0CA 4JDFA 3K6XA 1B3LA 2Z8DA 1B0HA 4KQPA 4THIA 3GLBA 3N6TA 5H8SA 1I6AA 3KN7A 4KCCA 1I69A 4FE8A 2O7IA 1P1OA 2RKMA 2XXUA 3RUMA 1MQIA 1US4A 3VLVA 3IL1B 4Z0IA 1MY1A 2XXQA 3PPNA 4IO6A 4H65A 1Y1MA 3EHSA 1XT8A 3S9NC 4QFNA 4QF9A 1MY4A 3PMXA 2D5WA 4OVJA 3FVOA 5F1QA 1Q35A 4LVQA 1P1NA 3HHGA 3KN3A 1M5CA 3QSLA 3ZKLA 4C1UA 1LFHA 1QKAA 1DOTA 2O1MA 2ONRA 3KSXA 3PPPA 4KD5A 3UP9A 2Q2CA 3K00A 3MP6A 3B6WA 4FAJA 4BLAA 1KWHA 3OO7A 3VE1B 5H8NB 3CG1A 3N26A 2RCBA 3MP1A 2A5TB 2XX9A 3MW0A 1PC3A 1H44A 2QS3A 4UACA 4I9DA 2NUVA 3MWBA 2DXRA 1BKAA 4OEUA 3G3HA 4ZEBA 4DLDA 4GXSB 5AA4A 4IO2A 2LFDA 3TTNA 5M2VA 3OSRA 1FTOA 3TKDA 3KJ7A 2DE3A 5FHMA 2O1LA 3OELA 1XOCA 2V25A 5AA2B 1B9JA 3K2DA 3PPQA 3EQ1A 1R1NA 4ND9A 1P1UA 3U72A 3IOVA 3T9VA 1TFAA 2PBWA 1OQHA 3OMBA 4RA1A 1FTKA 2Y84A 4GWOA 2DVZA 1SVXB 2F6PA 2WKYA 2H5YA 1B7ZA 1M5EA 2QJEA 5FTIA 3LC8A 3SESA 4U23A 1FTMA 1MPCA 5AA3A 5ICTA 2F78A 5F7VA 3MPKA 2XXHA 4G8MA 4QSDA 4BDOA 2I4CA 4ELRA 3DLNA 4LQ5A 4M4GA 1XVYA 1DPEA 4E0WA 1H3DA 1YAEA 3I5OA 2UYFA 4NMYA 1B0LA 1OMPA 1P99A 3K4UA 3RTFB 1WVJA 2X26A 2I3WA 1MG1A 2HXWA 3LR1A 1VE4A 3QK6A 3D4CA 4OTEA 3TZAA 4C1TA 3PU5A 4U22A 3KOTA 4X9TA 5DYHA 4F3PA 4NF4A 1NH7A 4GD5A 5ISUA 2AL4A 3R6UA 1ZLQA 4RNSA 2VOZA 3O28A 2I49A 1UTBB 3IJOB 1P1QA 1FTJA 4YKJA 3SEUA 1A8FA 3MVXA 4EF2A 3OO9A 2DS9A 5CMKA 1ZBMA 1JVXA 1GV8A 4F31B 3MJNA 1MPDA 2RC9A 3G3KA 1B5IA 3OENA 1BIYA 2DWAA 3DP8A 1RKMA 4NF5A 2LAOA 5A5XA 2OLBA 1OVTA 5ITPA 2BJJX 1N7XA 1USYH 3U94A 1Y1ZA 1PB7A 2UYEA 4HTGA 3VFJA 4DXCA 3CSGA 1NNKA 4KYEA 1L5TA 1EZ9A 4GLIA 3O66A 2OWTA 3H06B 4POWA 2B3FA 2FYIA 5DT6A 5I57B 1IEJA 1QUKA 3S9LC 4YICA 3KGCA 3ODBA 1LCFA 5DEXB 1F9BA 3MVYA 1D4NA 1PBQA 2DVCA 3ONMA 3RLFE 2QSXA 1HSJA 1BP5A 1MXWA 1US5A 5L9MA 3T9XB 5IAIA 5DVIA 4N07A 1D9YA 1MY0A 1OLCA 5CMBA 3TTKA 2DE2A 1HSLA 2UVGA 3Q27A 1OLAA 4GRKA 4C0RA 1NFTA 4U2RA 2V3UA 1LB8A 1B2HA 3OEKA 4H8JA 3T66A 3CVGA 1B7HA 1VFEA 3CI8A 1LBCA 1LAHE 1LAXA 1Z7ME 2NXOA 3QUFA 2XXIA 2RINA 4Z7EA 3HHFA 2DXYA 4Q5TA 1BLFA 3DELB 1B4ZA 1N0TA 3K0VA 2HEUA 2XD2A 4NF6A 4OFLA 4QSCA 3SEXA 1AL3A 1DTZA 2F6GA 3E9XA 3K02A 4G68B 4NF4B 4PP0A 5CMCA 4ISUA 2O51A 3IX1A 5I2NB 4YMBA 3FUZA 3SEWA 4ZE8A 1SI0A 1B58A 1XHYA 2FA7A 4PETA 5AA2D 2ZNTA 3KN8A 1JVYA 3HCQA 4RY1A 4WXJA 3VVFA 4TQUQ 3U1OA 1HSEA 4JWYA 3ZS6A 3OD7A 3CFXA 5JTYB 4BDQA 3ZSFA 4U4SA 2REJA 3C4MA 3MQ9A 5AA4B 3FJ7A 3K01A 1H76A 5I2KB 5TP9A 3PUXE 4NWDA 1Q1KA 3GBAA 5H8NA 3DP4A 3H6VA 4MLVA 5AA1A 3W9VA 3EHTA 4OENA 4X1DA 5I2NA 3PV0E 3BFUA 3TAJA 4ONYA 1VR5A 2G29A 4MBPA 3KSJA 1P1WA 1LB9A 3C31A 4R9FA 5EHSA 3FD3A 1MXUA 3MVWA 2G93A 3H6TA 4LA9A 4ELOA 1FQFA 3K6WA 3TTRA 4NF5B 1SYIA 4IGRA 2QMWA 3VV5A 4IO5A 1VSOA 3JV9A 3GZGA 3K6UA 1LSTA 1MQDA 2QS2A 2ZNUA 3KEIA 3MC2A 4XKRA 4JSOA 3IOWA 3H3GA 4OYVA 3UGWA 3K6VA 3QAXA 1SW4A 1UQWA 5ICQA 2Y7PA 5H8HA 1Y3QA 1GR2A 4KPTA 1ZU0A 1B4HA 1WDNA 2CZLA 3KFMA 2Q2AA 4FJPA 4IO7A 4EXKA 2M8CA 2GHBA 3TFLA 4HW8A 5CC2A 5LOMA 5AE4A 4ESWA 1M5BA 3MZ9A 4PQJA 1MH4A 5KCJA 5AA2A 4R2BA 2NWJA 2RC8A 4R2FA 1D3KA 2XXPA 4XKQA 4ZZEA 3KBRA 4OEVA 4NF8A 1MQGA 3MP8A 3FV1A 3E4RA 3KOSA 1DMBA 5ELVA 2A5SA 4OETA 3P7IA 1N3WA 3A3UA 1PDAA 3M3FA 1MM6A 4H5GA 4RXLA 1JQFA 2XD3A 5H8FB 5TU0A 1N76A 2HZKA 4IO4A 2PX1A 2ZYKA 4U1OA 3U8QA 4DZ1A 3SERA 2PMSA 1SW2A 2HQ0A 1SI1A 4XKPA 4XTCQ 4BDMA 2Z22A 2X7PA 2RF1A 4BDLA 2VD2A 4E0XA 5FHNA 3N94A 3PMWA 3V8XB 1B40A 3KJTA 3TEPA 1Y3PA 3O9PA 4R6KA 2DWHA 4KHZE 3OO6A 2F34A 4RJZA 2F97A 5I59A 1B51A 5A5XB 3MBPA 2I6EA 5JTYA 1USYE 2A5TA 1EH3A 1Y3NA 2ZMBA 4IB2A 3CR9A 3GXAA 4HCWA 5FTHA 1UIUA 5L8DA 4R6HA 3O97A 5K2YA 5L9OA 1N04A 3TCGA 3FXQA 4H0WA 3OO8A 3IJXB 2UVIA 3LSWA 3H6WA 3PUYE 1LAFE 4JB7A 2ONSA 2F8DA 4GFRA 2VGQA 1B3FA 1MXVA 3IK6B 4WKMA 3TQLA 1FQEA 1NKXA 1N3XA 2D21A 3V89B 5I56B 2ZXTA 1LBBA 4U21A 4TLMB 4G77A 1QUIA 4I62A 1A55A 1MDP1 4N6PA 4MF3A 4POXA 4RK9A 3W15C 4F1VA 3RQTA 1O63A 3LSLA 4JWOA 5KCJB 4G4PA 4UA8A 3EF7A 5I57A 3IB0A 2ZYMA 4DXBA 4HCYA 2Y7IA 3B7DA 3QYTA 1AOVA 4BDNA 3E3KA 4NF8B 3G7WA 4OMBA 4TOZA 4BDRA 1ATGA 5CI5A 1QKBA 1ZMGA 1IXIA 3LBSA 4F1YA 1A8EA 1B3HA 4JWXA 2QMXA 1B3EA 1ELJA 3ECRA 3IB2A 3H03A 3PUWE 4G68A 4I1DA 4EQ7A 1XS5A 2XXXA 2YPNA 2DE4A 2O68A 2YJPA 3HPIA 4ZEFA 3U93A 5I84A 2PVUA 1ZTYA 2OZZA 2V3TA 3T96B 2YLNA 4LUBA 1MPBA 4YB6A 3DM0A 4NE4A 4NF6B 2NOOA 3D4GA 4H8IA 5JEIA 3VLUA 4R74A 3FGSA 2HZ8A 1OIBA 4FORA 3THIA 4F3SA 3PGFA 1IUDA 1ZJLA 2H99A 4ZS9A 4GQOA 4GOTA 3UN6A 4AQ4A 4ESXA 5JK4A 3S9MC 1SDXA 2F5XA 2I3VA 3C36A 4YU0A 4R6YA 4RYAA 4OWDA 4LZ5A 3F11A 4PFWA 4X48A 1POTA 3O6HA 4NTLA 1UTBA 1A99A 1II5A 2PT2A 4LATA 5I58B 4KYSA 4MH5A 4QFLA 1LAGE 4YB5A 3O29A 4Q0CA 2HCAA 5EHMA 3TELA 5I2KA 2PYYA 1JW4A 4GVOA 1B32A 1SQYA 2D3IA 1UIVA 3FASA 5KDTA 1LFGA 3N6UA 4AB6A 1NNTA 1I6QA 4OXVA 4F3GA 3TCHA 2Q8JA 3FVNA 4H67A 4LP2B 4GF8A 2H25A 5BUUA 2HAVA 1I6BA 4YKKA 4F2OA 3GBBA 4KR5A 3SEYA 3TODA 1MQJA 2DWJA 3FJGA 3RY3A 1SBPA 3R26A 4QSEA 4DDDA 3ILUB 2E0SA 3MAMA 4EF1A 1QJMA 1Y20A 1B1XA 4PFYA 2Y7RA 3S2VA 1AIVA 3TUSA 3FJMA 4JBZA 1MY2A 2XXTA 1DPPA 1R9LA 3CRBA 4FIMA 5I58A 1UTHA 4JXIA 4O3BA 2Q9TA 1DSNA 2O84X 3IO6A 4ZZAA 3M3LA 3SKPA 1MQHA 4G8NA 2I0BA 4R75A 3HN0A 4N13A 1TFDA 1IIWA 2ESNA 2I48A 4IY5A 3K1PA 4Q30B 5ITOA 3TTMA 1B1HA 4F39A 1EZPA 2H98A 3LUYA 4HS7A 4OZ9A 2PT1A 4ELQA 2ABHA 2OWSA 1ANFA 2OCUA 3SETA 3IOTA 2P0SA 2FNCA 3G3FA 4P0GA 2IA4A 5HPQA 4MLQA 3UORA 5B7DA 1IZ1A 1PEBA 1B5HA 4RK2A 2VP1A 2P1SA 1A7LA 3SEVA 1SD3A 4DE8A 4KCDA 2R71A 2XXVA 1CE2A 2THIA 2RC7A 4ELPA 1Y9UA 3TPAA 2ZYNA 3G3IA 5H8QA 4F2QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IAZ A;  3R7X A;  1QW0 A;  1Z7N E;  3S9E A;  3FVG A;  2I4B A;  1RYX A;  2XXR A;  3O2A A;  4GIZ A;  1JEV A;  3UK4 A;  1B5J A;  4Q8R A;  4P0I A;  3VLW A;  3ZKK A;  4ECF A;  1FCK A;  2HFB A;  4R72 A;  2DP8 A;  3EHU A;  5EYF A;  3S4U A;  2V84 A;  1ZKB A;  2Z8F A;  3LSF B;  3OEM A;  2DSF A;  4NWC A;  1YCJ A;  1MRP A;  3LSX A;  3RTW B;  1R9Q A;  2R9J A;  3CFZ A;  3VVE A;  1MM7 A;  1URD A;  1MDQ A;  1GGG A;  2HZL A;  1NL5 A;  3TMG A;  3CIJ A;  2UXA A;  3MPL A;  2XXW A;  3HST A;  3A3C A;  1FTL A;  3AXF A;  4RPN A;  3OSQ A;  1IIT A;  3B6Q A;  3PUV E;  4GL0 A;  5K2X A;  4G2Z A;  1GVC A;  3WAF A;  4DXU A;  4PE5 B;  1S9T A;  1LFI A;  1LGB C;  1EZO A;  4QHQ A;  1H43 A;  3RGY A;  2QS1 A;  1NNF A;  2Z8E A;  5DEX A;  1POY 1;  3T22 A;  4OQO A;  3M3K A;  2B3B A;  3UIF A;  5L9S A;  4EDP A;  3N5L A;  3IR1 A;  4GXA A;  2F7C A;  4XXU A;  1DTG A;  3IOU A;  4ZEI A;  2O69 A;  3H6U A;  4QRZ A;  2NVU B;  4EXL A;  4OER A;  2B65 A;  3RT6 B;  4KI0 E;  1B52 A;  5B70 A;  1MXX A;  1JEU A;  3EPE A;  4K3F A;  1AMF A;  3C33 A;  3KZG A;  3QUJ A;  3E13 X;  1IXG A;  2XXY A;  2F35 A;  4FED A;  4YB7 A;  4IY6 A;  4F19 A;  1A54 A;  2ANJ A;  1YPN A;  1NNP A;  4OHN A;  2ZNS A;  4OES A;  1B6H A;  3HV1 A;  2I58 A;  3U8V A;  4ZEK A;  3RPW A;  4ZEC A;  1IQ7 A;  3H7M A;  5H8Q B;  4EQ9 A;  4XKN A;  2Q89 A;  1B3G A;  1BTJ A;  3M8U A;  4QFK A;  1QUL A;  2P2A A;  4EUO A;  3TYH A;  4I8C A;  5HBC A;  3CSB A;  3K1N A;  3T9H B;  3TTL A;  2HAU A;  2QL3 A;  3H4Z A;  3IB1 A;  3L6G A;  4QFO A;  2DWI A;  3T93 B;  2W7Y A;  1TXF A;  3TDJ A;  1TT1 A;  4NED A;  3W9W A;  4QFP A;  3UA8 A;  1Y4C A;  1VFD A;  3C9H A;  5CM6 A;  5CRY A;  4AB5 A;  1AH5 A;  4H1X A;  3TQW A;  3HO7 A;  1N84 A;  1YTV A;  2GHA A;  2OJT A;  1GTK A;  2QS4 A;  2OBG A;  4LON B;  5HM4 B;  3V83 A;  4DIG A;  1J1N A;  1O64 A;  3EN3 A;  4F29 A;  4G8H A;  3O6G A;  1PBP A;  1TWY A;  4H5F A;  2DQV A;  2GFE A;  2KLF A;  1SW5 A;  2GH9 A;  1MXY A;  3JYR A;  4P11 A;  3MZB A;  4LQ2 A;  2AL5 A;  3PUZ E;  1NH8 A;  1R6Z A;  5TPA B;  1FQB A;  4U4X A;  2VD3 A;  4FAT A;  1N7W A;  2Y7K A;  4F18 A;  4ZE9 A;  2REG A;  3BFT A;  4KYD A;  1SW1 A;  3MUQ A;  2QRY A;  2IEE A;  2Y7W A;  1S50 A;  4O3C A;  4H6D A;  4U1Z A;  5H8H B;  4EQB A;  2XX7 A;  3ILT B;  2DYX A;  5FHO A;  3C35 A;  3IO4 A;  3VDF A;  1XC1 A;  4F22 A;  2VHA A;  3RT8 A;  3T9U A;  1M5F A;  3PPO A;  4X1B A;  3CFL A;  3VXB A;  3FVK A;  3I3V A;  5H8F A;  1FQD A;  2F7B A;  5CMM A;  1MS7 A;  3CG3 A;  3RNN A;  3PD9 A;  4YAH X;  1XVX A;  3VVD A;  2AIX A;  3C32 A;  3U92 A;  4ZED A;  5BWJ A;  5CBR A;  4LZ8 A;  2UVJ A;  4IGT A;  2H4I A;  3B6T A;  3L6H A;  3Q29 A;  2O7U A;  1FQA A;  1FW0 A;  1JW1 A;  5CBS A;  2ONK E;  3K1M A;  3OOA A;  1WOD A;  4IO3 A;  4M1V A;  1A40 A;  4O3A A;  4PFU A;  3BKI B;  3FXR A;  3DP6 A;  4OFO A;  3RN8 A;  1JNF A;  1URS A;  4PFT A;  4WEP A;  5TP9 B;  1IXH A;  2Z23 A;  3I6V A;  3O6I A;  2OK2 A;  5I59 B;  1B7U A;  1LCT A;  3V5A A;  2Q88 A;  2E1S A;  3BBR A;  3FAT A;  1PB9 A;  2V3Q A;  3FXU A;  1URG A;  4G68 C;  3Q25 A;  3WAE A;  3PD8 A;  5J1D A;  3KG2 A;  3C34 A;  4ZDM A;  4R73 A;  2RCA A;  2ZYO A;  1SYH A;  1EU8 A;  3G3G A;  3FV2 A;  4YKI A;  1RYO A;  3SDF A;  5KDT B;  1T0K A;  4FEC A;  3G3J A;  1S7Y A;  4OFJ A;  3QIM A;  4DCY A;  1MH3 A;  2R6G E;  4YZZ A;  1MY3 A;  1OQG A;  4FEB A;  2GRV A;  1JW5 A;  1CB6 A;  2V93 A;  3VXC A;  5KZT A;  4R9G A;  1LLS A;  4LZ7 A;  2F7A A;  1B46 A;  3OXN A;  3USD A;  4YKP A;  1PB8 A;  3JZJ A;  2AYS A;  3MVZ A;  4JSD A;  4L17 A;  1D9V A;  5TPA A;  2X7Q A;  3Q26 A;  2DOJ A;  4DCX A;  2H9B A;  3MZ1 A;  1FQC A;  5DVJ A;  2LFF A;  1H45 A;  1QVS A;  1OVB A;  2ALU A;  1Y4T A;  2QPQ A;  1NMU A;  1UTH B;  2XHD A;  3PMV A;  5DVF A;  3QXM A;  3Q28 A;  3A09 A;  2F36 A;  5I56 A;  5IKB A;  1M5D A;  4RPO A;  3FIR A;  1MXZ A;  3IOR A;  2O6A A;  4GL8 A;  1B05 A;  3TCF A;  4YMA A;  2UVH A;  4TLL B;  1O7T A;  4WED A;  3PPR A;  4F1U A;  3FZV A;  4KFQ A;  1ZIU A;  2CMO A;  1IXC A;  1JET A;  2XX8 A;  5DTB A;  4F3B A;  4MFI A;  4XIG Q;  1QUJ A;  2I0C A;  4JDF A;  3K6X A;  1B3L A;  2Z8D A;  1B0H A;  4KQP A;  4THI A;  3GLB A;  3N6T A;  5H8S A;  1I6A A;  3KN7 A;  4KCC A;  1I69 A;  4FE8 A;  2O7I A;  1P1O A;  2RKM A;  2XXU A;  3RUM A;  1MQI A;  1US4 A;  3VLV A;  3IL1 B;  4Z0I A;  1MY1 A;  2XXQ A;  3PPN A;  4IO6 A;  4H65 A;  1Y1M A;  3EHS A;  1XT8 A;  3S9N C;  4QFN A;  4QF9 A;  1MY4 A;  3PMX A;  2D5W A;  4OVJ A;  3FVO A;  5F1Q A;  1Q35 A;  4LVQ A;  1P1N A;  3HHG A;  3KN3 A;  1M5C A;  3QSL A;  3ZKL A;  4C1U A;  1LFH A;  1QKA A;  1DOT A;  2O1M A;  2ONR A;  3KSX A;  3PPP A;  4KD5 A;  3UP9 A;  2Q2C A;  3K00 A;  3MP6 A;  3B6W A;  4FAJ A;  4BLA A;  1KWH A;  3OO7 A;  3VE1 B;  5H8N B;  3CG1 A;  3N26 A;  2RCB A;  3MP1 A;  2A5T B;  2XX9 A;  3MW0 A;  1PC3 A;  1H44 A;  2QS3 A;  4UAC A;  4I9D A;  2NUV A;  3MWB A;  2DXR A;  1BKA A;  4OEU A;  3G3H A;  4ZEB A;  4DLD A;  4GXS B;  5AA4 A;  4IO2 A;  2LFD A;  3TTN A;  5M2V A;  3OSR A;  1FTO A;  3TKD A;  3KJ7 A;  2DE3 A;  5FHM A;  2O1L A;  3OEL A;  1XOC A;  2V25 A;  5AA2 B;  1B9J A;  3K2D A;  3PPQ A;  3EQ1 A;  1R1N A;  4ND9 A;  1P1U A;  3U72 A;  3IOV A;  3T9V A;  1TFA A;  2PBW A;  1OQH A;  3OMB A;  4RA1 A;  1FTK A;  2Y84 A;  4GWO A;  2DVZ A;  1SVX B;  2F6P A;  2WKY A;  2H5Y A;  1B7Z A;  1M5E A;  2QJE A;  5FTI A;  3LC8 A;  3SES A;  4U23 A;  1FTM A;  1MPC A;  5AA3 A;  5ICT A;  2F78 A;  5F7V A;  3MPK A;  2XXH A;  4G8M A;  4QSD A;  4BDO A;  2I4C A;  4ELR A;  3DLN A;  4LQ5 A;  4M4G A;  1XVY A;  1DPE A;  4E0W A;  1H3D A;  1YAE A;  3I5O A;  2UYF A;  4NMY A;  1B0L A;  1OMP A;  1P99 A;  3K4U A;  3RTF B;  1WVJ A;  2X26 A;  2I3W A;  1MG1 A;  2HXW A;  3LR1 A;  1VE4 A;  3QK6 A;  3D4C A;  4OTE A;  3TZA A;  4C1T A;  3PU5 A;  4U22 A;  3KOT A;  4X9T A;  5DYH A;  4F3P A;  4NF4 A;  1NH7 A;  4GD5 A;  5ISU A;  2AL4 A;  3R6U A;  1ZLQ A;  4RNS A;  2VOZ A;  3O28 A;  2I49 A;  1UTB B;  3IJO B;  1P1Q A;  1FTJ A;  4YKJ A;  3SEU A;  1A8F A;  3MVX A;  4EF2 A;  3OO9 A;  2DS9 A;  5CMK A;  1ZBM A;  1JVX A;  1GV8 A;  4F31 B;  3MJN A;  1MPD A;  2RC9 A;  3G3K A;  1B5I A;  3OEN A;  1BIY A;  2DWA A;  3DP8 A;  1RKM A;  4NF5 A;  2LAO A;  5A5X A;  2OLB A;  1OVT A;  5ITP A;  2BJJ X;  1N7X A;  1USY H;  3U94 A;  1Y1Z A;  1PB7 A;  2UYE A;  4HTG A;  3VFJ A;  4DXC A;  3CSG A;  1NNK A;  4KYE A;  1L5T A;  1EZ9 A;  4GLI A;  3O66 A;  2OWT A;  3H06 B;  4POW A;  2B3F A;  2FYI A;  5DT6 A;  5I57 B;  1IEJ A;  1QUK A;  3S9L C;  4YIC A;  3KGC A;  3ODB A;  1LCF A;  5DEX B;  1F9B A;  3MVY A;  1D4N A;  1PBQ A;  2DVC A;  3ONM A;  3RLF E;  2QSX A;  1HSJ A;  1BP5 A;  1MXW A;  1US5 A;  5L9M A;  3T9X B;  5IAI A;  5DVI A;  4N07 A;  1D9Y A;  1MY0 A;  1OLC A;  5CMB A;  3TTK A;  2DE2 A;  1HSL A;  2UVG A;  3Q27 A;  1OLA A;  4GRK A;  4C0R A;  1NFT A;  4U2R A;  2V3U A;  1LB8 A;  1B2H A;  3OEK A;  4H8J A;  3T66 A;  3CVG A;  1B7H A;  1VFE A;  3CI8 A;  1LBC A;  1LAH E;  1LAX A;  1Z7M E;  2NXO A;  3QUF A;  2XXI A;  2RIN A;  4Z7E A;  3HHF A;  2DXY A;  4Q5T A;  1BLF A;  3DEL B;  1B4Z A;  1N0T A;  3K0V A;  2HEU A;  2XD2 A;  4NF6 A;  4OFL A;  4QSC A;  3SEX A;  1AL3 A;  1DTZ A;  2F6G A;  3E9X A;  3K02 A;  4G68 B;  4NF4 B;  4PP0 A;  5CMC A;  4ISU A;  2O51 A;  3IX1 A;  5I2N B;  4YMB A;  3FUZ A;  3SEW A;  4ZE8 A;  1SI0 A;  1B58 A;  1XHY A;  2FA7 A;  4PET A;  5AA2 D;  2ZNT A;  3KN8 A;  1JVY A;  3HCQ A;  4RY1 A;  4WXJ A;  3VVF A;  4TQU Q;  3U1O A;  1HSE A;  4JWY A;  3ZS6 A;  3OD7 A;  3CFX A;  5JTY B;  4BDQ A;  3ZSF A;  4U4S A;  2REJ A;  3C4M A;  3MQ9 A;  5AA4 B;  3FJ7 A;  3K01 A;  1H76 A;  5I2K B;  5TP9 A;  3PUX E;  4NWD A;  1Q1K A;  3GBA A;  5H8N A;  3DP4 A;  3H6V A;  4MLV A;  5AA1 A;  3W9V A;  3EHT A;  4OEN A;  4X1D A;  5I2N A;  3PV0 E;  3BFU A;  3TAJ A;  4ONY A;  1VR5 A;  2G29 A;  4MBP A;  3KSJ A;  1P1W A;  1LB9 A;  3C31 A;  4R9F A;  5EHS A;  3FD3 A;  1MXU A;  3MVW A;  2G93 A;  3H6T A;  4LA9 A;  4ELO A;  1FQF A;  3K6W A;  3TTR A;  4NF5 B;  1SYI A;  4IGR A;  2QMW A;  3VV5 A;  4IO5 A;  1VSO A;  3JV9 A;  3GZG A;  3K6U A;  1LST A;  1MQD A;  2QS2 A;  2ZNU A;  3KEI A;  3MC2 A;  4XKR A;  4JSO A;  3IOW A;  3H3G A;  4OYV A;  3UGW A;  3K6V A;  3QAX A;  1SW4 A;  1UQW A;  5ICQ A;  2Y7P A;  5H8H A;  1Y3Q A;  1GR2 A;  4KPT A;  1ZU0 A;  1B4H A;  1WDN A;  2CZL A;  3KFM A;  2Q2A A;  4FJP A;  4IO7 A;  4EXK A;  2M8C A;  2GHB A;  3TFL A;  4HW8 A;  5CC2 A;  5LOM A;  5AE4 A;  4ESW A;  1M5B A;  3MZ9 A;  4PQJ A;  1MH4 A;  5KCJ A;  5AA2 A;  4R2B A;  2NWJ A;  2RC8 A;  4R2F A;  1D3K A;  2XXP A;  4XKQ A;  4ZZE A;  3KBR A;  4OEV A;  4NF8 A;  1MQG A;  3MP8 A;  3FV1 A;  3E4R A;  3KOS A;  1DMB A;  5ELV A;  2A5S A;  4OET A;  3P7I A;  1N3W A;  3A3U A;  1PDA A;  3M3F A;  1MM6 A;  4H5G A;  4RXL A;  1JQF A;  2XD3 A;  5H8F B;  5TU0 A;  1N76 A;  2HZK A;  4IO4 A;  2PX1 A;  2ZYK A;  4U1O A;  3U8Q A;  4DZ1 A;  3SER A;  2PMS A;  1SW2 A;  2HQ0 A;  1SI1 A;  4XKP A;  4XTC Q;  4BDM A;  2Z22 A;  2X7P A;  2RF1 A;  4BDL A;  2VD2 A;  4E0X A;  5FHN A;  3N94 A;  3PMW A;  3V8X B;  1B40 A;  3KJT A;  3TEP A;  1Y3P A;  3O9P A;  4R6K A;  2DWH A;  4KHZ E;  3OO6 A;  2F34 A;  4RJZ A;  2F97 A;  5I59 A;  1B51 A;  5A5X B;  3MBP A;  2I6E A;  5JTY A;  1USY E;  2A5T A;  1EH3 A;  1Y3N A;  2ZMB A;  4IB2 A;  3CR9 A;  3GXA A;  4HCW A;  5FTH A;  1UIU A;  5L8D A;  4R6H A;  3O97 A;  5K2Y A;  5L9O A;  1N04 A;  3TCG A;  3FXQ A;  4H0W A;  3OO8 A;  3IJX B;  2UVI A;  3LSW A;  3H6W A;  3PUY E;  1LAF E;  4JB7 A;  2ONS A;  2F8D A;  4GFR A;  2VGQ A;  1B3F A;  1MXV A;  3IK6 B;  4WKM A;  3TQL A;  1FQE A;  1NKX A;  1N3X A;  2D21 A;  3V89 B;  5I56 B;  2ZXT A;  1LBB A;  4U21 A;  4TLM B;  4G77 A;  1QUI A;  4I62 A;  1A55 A;  1MDP 1;  4N6P A;  4MF3 A;  4POX A;  4RK9 A;  3W15 C;  4F1V A;  3RQT A;  1O63 A;  3LSL A;  4JWO A;  5KCJ B;  4G4P A;  4UA8 A;  3EF7 A;  5I57 A;  3IB0 A;  2ZYM A;  4DXB A;  4HCY A;  2Y7I A;  3B7D A;  3QYT A;  1AOV A;  4BDN A;  3E3K A;  4NF8 B;  3G7W A;  4OMB A;  4TOZ A;  4BDR A;  1ATG A;  5CI5 A;  1QKB A;  1ZMG A;  1IXI A;  3LBS A;  4F1Y A;  1A8E A;  1B3H A;  4JWX A;  2QMX A;  1B3E A;  1ELJ A;  3ECR A;  3IB2 A;  3H03 A;  3PUW E;  4G68 A;  4I1D A;  4EQ7 A;  1XS5 A;  2XXX A;  2YPN A;  2DE4 A;  2O68 A;  2YJP A;  3HPI A;  4ZEF A;  3U93 A;  5I84 A;  2PVU A;  1ZTY A;  2OZZ A;  2V3T A;  3T96 B;  2YLN A;  4LUB A;  1MPB A;  4YB6 A;  3DM0 A;  4NE4 A;  4NF6 B;  2NOO A;  3D4G A;  4H8I A;  5JEI A;  3VLU A;  4R74 A;  3FGS A;  2HZ8 A;  1OIB A;  4FOR A;  3THI A;  4F3S A;  3PGF A;  1IUD A;  1ZJL A;  2H99 A;  4ZS9 A;  4GQO A;  4GOT A;  3UN6 A;  4AQ4 A;  4ESX A;  5JK4 A;  3S9M C;  1SDX A;  2F5X A;  2I3V A;  3C36 A;  4YU0 A;  4R6Y A;  4RYA A;  4OWD A;  4LZ5 A;  3F11 A;  4PFW A;  4X48 A;  1POT A;  3O6H A;  4NTL A;  1UTB A;  1A99 A;  1II5 A;  2PT2 A;  4LAT A;  5I58 B;  4KYS A;  4MH5 A;  4QFL A;  1LAG E;  4YB5 A;  3O29 A;  4Q0C A;  2HCA A;  5EHM A;  3TEL A;  5I2K A;  2PYY A;  1JW4 A;  4GVO A;  1B32 A;  1SQY A;  2D3I A;  1UIV A;  3FAS A;  5KDT A;  1LFG A;  3N6U A;  4AB6 A;  1NNT A;  1I6Q A;  4OXV A;  4F3G A;  3TCH A;  2Q8J A;  3FVN A;  4H67 A;  4LP2 B;  4GF8 A;  2H25 A;  5BUU A;  2HAV A;  1I6B A;  4YKK A;  4F2O A;  3GBB A;  4KR5 A;  3SEY A;  3TOD A;  1MQJ A;  2DWJ A;  3FJG A;  3RY3 A;  1SBP A;  3R26 A;  4QSE A;  4DDD A;  3ILU B;  2E0S A;  3MAM A;  4EF1 A;  1QJM A;  1Y20 A;  1B1X A;  4PFY A;  2Y7R A;  3S2V A;  1AIV A;  3TUS A;  3FJM A;  4JBZ A;  1MY2 A;  2XXT A;  1DPP A;  1R9L A;  3CRB A;  4FIM A;  5I58 A;  1UTH A;  4JXI A;  4O3B A;  2Q9T A;  1DSN A;  2O84 X;  3IO6 A;  4ZZA A;  3M3L A;  3SKP A;  1MQH A;  4G8N A;  2I0B A;  4R75 A;  3HN0 A;  4N13 A;  1TFD A;  1IIW A;  2ESN A;  2I48 A;  4IY5 A;  3K1P A;  4Q30 B;  5ITO A;  3TTM A;  1B1H A;  4F39 A;  1EZP A;  2H98 A;  3LUY A;  4HS7 A;  4OZ9 A;  2PT1 A;  4ELQ A;  2ABH A;  2OWS A;  1ANF A;  2OCU A;  3SET A;  3IOT A;  2P0S A;  2FNC A;  3G3F A;  4P0G A;  2IA4 A;  5HPQ A;  4MLQ A;  3UOR A;  5B7D A;  1IZ1 A;  1PEB A;  1B5H A;  4RK2 A;  2VP1 A;  2P1S A;  1A7L A;  3SEV A;  1SD3 A;  4DE8 A;  4KCD A;  2R71 A;  2XXV A;  1CE2 A;  2THI A;  2RC7 A;  4ELP A;  1Y9U A;  3TPA A;  2ZYN A;  3G3I A;  5H8Q A;  4F2Q A; 
#chains in the Genus database with same CATH topology
 3C8G A;  3S9E A;  2XXR A;  2WVN A;  3O2A A;  1JEV A;  3BRJ A;  4P0I A;  2HKV A;  1FCK A;  2HFI A;  1FPD A;  5EYF A;  3OEM A;  3DE9 A;  1R9Q A;  2R9J A;  4U5D E;  5LTC A;  1MDQ A;  3MPL A;  3SP1 A;  3AXF A;  2H8A A;  3B6Q A;  3PUV E;  4GL0 A;  4NCQ A;  4G2Z A;  1LKX A;  3DI5 A;  1OCO C;  3ABK C;  4QHQ A;  1EZO A;  3RGY A;  3Q6M A;  3V5Y A;  2Z8E A;  1POY 1;  2F3B A;  4MJO A;  1MMN A;  4MS2 A;  1OW7 A;  4EDP A;  1WN0 A;  2XSE A;  5ET5 A;  3B0U X;  4XXU A;  3OEO A;  2O69 A;  4OAN A;  4KC9 A;  4PR9 A;  2B65 A;  4E0H A;  1MXX A;  4H45 A;  4K3F A;  3C33 A;  3KZG A;  4LDQ A;  3C18 A;  2DI3 A;  4NTF A;  2LK4 A;  1EI7 A;  3R2P A;  1B6H A;  3HV1 A;  1A41 A;  4ZEK A;  5H8Q B;  4EQ9 A;  4AX2 A;  4QFK A;  1J8Y F;  1AWB A;  3GEH A;  3K1H A;  4EUO A;  3TYH A;  4JC7 A;  3QMK A;  4I8C A;  4NAP A;  5HBC A;  2CEY A;  3CSB A;  4PTK A;  2HAU A;  1NUZ A;  2QL3 A;  3H4Z A;  3T93 B;  1NV7 A;  4QFO A;  1TXF A;  2H7O A;  1ZU5 A;  1T6Q A;  3UA8 A;  5TJ5 E;  3C8G B;  3NMK A;  3RQE A;  2XRH A;  2GHA A;  4PFO A;  1T5O A;  2RD9 A;  3X1O A;  1IME A;  1GTK A;  2OBG A;  2OJT A;  2QS4 A;  4LON B;  1O64 A;  1BBH A;  3O39 A;  4H5F A;  5LDZ A;  2GFE A;  3E9V A;  2KLF A;  2WX9 A;  4GWY A;  1IW7 F;  3MZB A;  3PUZ E;  5KYW B;  1NH8 A;  4N4W A;  5TPA B;  3AG1 C;  3RQF A;  4I3Y A;  3K33 A;  1SW1 A;  5FHO A;  1M5F A;  5H8F A;  3CFL A;  3FVK A;  3I3V A;  2LCH A;  1MS7 A;  3CG3 A;  4MX6 A;  3OWT A;  3C32 A;  3JSE O;  1ZZP A;  2PFD A;  3PDM P;  5CBR A;  2UVJ A;  4A4A A;  2YL0 A;  2H4I A;  3IQC A;  3Q29 A;  2CZH A;  1NSG B;  1LM3 B;  1FQA A;  1JW1 A;  2ONK E;  4NTA A;  1WOD A;  4IO3 A;  3AQB A;  1A40 A;  3W2W A;  4WEP A;  3EPV A;  5TP9 B;  2Z23 A;  3I6V A;  3O6I A;  5I59 B;  4YT2 A;  1B7U A;  3V5A A;  4G68 C;  3ZQY A;  4P3L A;  3C34 A;  3ECS A;  4R73 A;  3DAF A;  5KDT B;  1WTY A;  2V3C C;  4YKI A;  1RYO A;  2FVZ A;  3G3J A;  1RKE B;  1RMV A;  2R9R B;  4FEB A;  1CB6 A;  2V93 A;  3VXC A;  3AJM A;  4LZ7 A;  2F7A A;  1CGO A;  3USD A;  5T3J A;  4YKP A;  1A7D A;  1D9V A;  1KA0 A;  4FX5 A;  2J7P D;  1QVS A;  1H45 A;  3VVD A;  1OVB A;  1Y4T A;  3PMV A;  3QXM A;  3CZ6 A;  2Y69 C;  2F36 A;  3E78 A;  1M5D A;  3ZVR A;  4YMA A;  2O6A A;  1XWJ A;  1B05 A;  3W4Y A;  4WED A;  3TOM A;  1O7T A;  3FZV A;  4AL0 A;  1ZIU A;  1IXC A;  1JET A;  2XX8 A;  5DTB A;  2ZXW C;  2R7T A;  1N1C A;  3Q6N A;  1H9T A;  1QUJ A;  1WOL A;  3A11 A;  4I3M A;  3K6X A;  1B3L A;  3JT1 A;  4FWV A;  3KN7 A;  1I69 A;  3RUM A;  1MQI A;  1US4 A;  2Y5K A;  3IL1 B;  3IEE A;  1G4U S;  4IO6 A;  3EHS A;  1NLX A;  5DQT A;  4XTK A;  3FVO A;  3T9O A;  3GAN A;  1FR0 A;  1VLT A;  5CI8 A;  4Z9J A;  2ONR A;  1JR8 A;  3FBP A;  4KD5 A;  3TD7 A;  4R32 A;  3MP6 A;  4FAJ A;  3B6W A;  3N0T A;  1KWH A;  2XL8 A;  5JUA A;  3AG3 C;  4EKW A;  1YYZ A;  2A5T B;  1PC3 A;  3MW0 A;  2A1D D;  3WG7 C;  4MND A;  3W8I A;  2DXR A;  4OVS A;  4OEU A;  4MVM A;  4GXS B;  4HXV A;  1NV4 A;  4N6H A;  5IZ3 B;  1GS9 A;  1FTO A;  3TKD A;  2DE3 A;  2XXK A;  2O1L A;  5HSW A;  5AC4 A;  5AA2 B;  1SR2 A;  2E87 A;  3U72 A;  4ND9 A;  1P1U A;  3LUZ A;  3IOV A;  2PBW A;  4PFI A;  2NSG A;  2QY9 A;  3WAQ A;  2DVZ A;  2WKY A;  5F24 A;  2H5Y A;  1M5E A;  5FTI A;  2F78 A;  2XXH A;  3E70 C;  4DJ9 A;  4M4G A;  1RDZ A;  2YQY A;  4NMY A;  3RVY A;  1TQG A;  1B0L A;  1OMP A;  2UYF A;  3RTF B;  1BR2 A;  2HXW A;  3D4C A;  3EGD B;  4U22 A;  4X9T A;  4YL3 A;  2HPG A;  1IZM A;  3R6U A;  1CNQ A;  3GEI A;  1ZLQ A;  2D5R B;  2I49 A;  1UTB B;  3JRT A;  5I58 A;  3SEU A;  1A8F A;  5CMK A;  3V5X A;  1GV8 A;  3MJN A;  5ET7 A;  2V26 A;  2RC9 A;  3DE8 A;  1G4W R;  1BIY A;  4NF5 A;  3T4R A;  5BUO A;  2J8W A;  4JEA A;  4DXC A;  1NNK A;  1LPE A;  2W4B A;  2NSF A;  2H7V C;  2FYI A;  5I57 B;  1RCP A;  5DEX B;  4IAQ A;  2YL3 A;  2GA0 A;  1SF8 A;  1NU9 C;  1MXW A;  1BP5 A;  4AE4 B;  1OLC A;  3FOO A;  1YZ0 A;  2UVG A;  2J46 A;  1OLA A;  5T3W A;  5JT4 A;  1NUY A;  1B7H A;  1LBC A;  4P9F A;  3O6X A;  2RIN A;  2DXY A;  1OR2 A;  3K0V A;  3WAF A;  2XD2 A;  4OFL A;  1UG7 A;  4PC9 A;  4G68 B;  4NF4 B;  2HSQ A;  3IX1 A;  5I2N B;  3FUZ A;  4ZE8 A;  1XHY A;  4PET A;  1KNY A;  1DOV A;  2ZNT A;  3DM5 A;  3HCQ A;  4TQU Q;  3FMS A;  2EIL C;  2NUT A;  1TWH A;  3RYL A;  4U4S A;  3C4M A;  5AA4 B;  2ZPA A;  3K01 A;  2B0H A;  2J0X A;  4P47 A;  5I2K B;  2LIG A;  1RDX A;  5H8N A;  2OOC A;  3W9V A;  5AA1 A;  4X1D A;  1YLM A;  2GWW A;  4ONY A;  5T1D B;  3KSJ A;  1P1W A;  4R9F A;  3G4Z A;  2G93 A;  4LA9 A;  3GM1 A;  1M2O A;  4PK4 A;  4GBW A;  4IO5 A;  3KL4 A;  4XKR A;  2ZNU A;  4W8P A;  4JSO A;  3IOW A;  1ZHZ A;  4GWS A;  3KFM A;  5EYG A;  2Q00 A;  5LOM A;  5CC2 A;  4GBV A;  4UAB A;  1FBF A;  1MH4 A;  2R02 A;  2NWJ A;  4NY3 A;  3ROJ A;  3GM3 A;  1KA1 A;  3KBR A;  4OEV A;  4JRZ A;  1MQG A;  4QDL A;  1FPL A;  1DMB A;  5COG A;  1LS4 A;  1DOW A;  3A3U A;  5H8F B;  4F22 A;  1LBX A;  1R4T A;  4DZ1 A;  2PMS A;  3QVY A;  2YLG A;  2HQ0 A;  4XTC Q;  3ISP A;  2ZXP A;  2X7P A;  2RF1 A;  2Z22 A;  4U9E A;  2XLW A;  5KYU B;  3V8X B;  1OXK A;  2W4M A;  1FBP A;  5JTY A;  4CIP A;  1B51 A;  2I6E A;  4O7I A;  3CR9 A;  5FTH A;  4R6H A;  1K9Z A;  5L9O A;  3NMI A;  4P9T A;  2Q9C A;  1N04 A;  3IJX B;  2UVI A;  3H6W A;  2F8D A;  1B3F A;  4CS8 A;  1NKX A;  3UGP A;  1TWA A;  3CQZ A;  3EH2 A;  3W15 C;  1CPQ A;  4RK9 A;  4JWO A;  4MVR A;  3J06 A;  4UA8 A;  1V55 C;  2ZYM A;  4DXB A;  3UMI A;  4HCY A;  1FPE A;  5IGA A;  3QYT A;  1FPI A;  3FAJ A;  3NG1 A;  4BDR A;  3KYJ A;  5CI5 A;  4C3D A;  4F1Y A;  1XI6 A;  3ITF A;  2EIN C;  1ELJ A;  2A0U A;  3LES A;  1AEP A;  4EQ7 A;  4N6C A;  1XS5 A;  2DE4 A;  2JJK A;  3U93 A;  5DW8 A;  2Y3G A;  1CGM E;  2V3T A;  5A6K A;  2XM4 A;  4YB6 A;  2KR0 A;  3VLU A;  3FGS A;  2HZ8 A;  3THI A;  5I7I A;  3ZC4 A;  1IUD A;  2EIK C;  4GOT A;  4ESX A;  3MST A;  5JK4 A;  4ER9 A;  1Q0K A;  4OIO F;  1SDX A;  4R6Y A;  4GQH A;  3F11 A;  4PFW A;  2G3V A;  3ZDL A;  1A99 A;  2PT2 A;  4JTD B;  2HXR A;  2OX3 A;  1LAG E;  3O29 A;  2HCA A;  3V7O A;  4I3E A;  4QBA A;  1JW4 A;  1B32 A;  2XWO A;  1UIV A;  2D3I A;  5EHH A;  4AB6 A;  4PDH A;  4NX1 A;  4K7B A;  3PHF 2;  3TCH A;  2G62 A;  1VTM P;  2KJG A;  4YKK A;  3SEY A;  4PAI A;  2P7V A;  4QSE A;  4PFB A;  4DDD A;  1Y20 A;  2XS8 A;  3HKK A;  2Y7R A;  3TUS A;  2O9X A;  4JTC B;  4B6I A;  1Z7Q c;  1LBZ A;  4DRI B;  4JXI A;  2Q9T A;  4ZZA A;  3RVZ A;  1FPF A;  3M3L A;  1PD0 A;  1IIW A;  1SZI A;  4O7M A;  1CGN A;  4F39 A;  2WZF A;  2H98 A;  2R7U A;  1O3U A;  1EYJ A;  1ANF A;  4GWZ A;  3A9C A;  4CDV A;  1HW1 A;  2WYK A;  4P0G A;  4CS9 A;  4MLQ A;  2PP4 A;  2OQM A;  1B5H A;  2XLM A;  4GX6 A;  2P1S A;  4NG7 A;  1B68 A;  4DE8 A;  5JP7 A;  3RW0 A;  3CEX A;  2RC7 A;  4WGY A;  2ZYN A;  3IFA A;  3QMF A;  2ZXR A;  2QNL A;  1QW0 A;  4GIZ A;  2CGE A;  2ZZX A;  3UK4 A;  3S29 A;  3VLW A;  5L0D A;  2HFB A;  2BJI A;  5A6J A;  3GOR A;  2V84 A;  2Z8F A;  5KYN A;  2KYH A;  1YCJ A;  1LE2 A;  1MRP A;  3LSX A;  3RTW B;  1MQV A;  4E18 A;  5DS5 A;  3N24 A;  1GGG A;  2HZL A;  1FFH A;  2QVU A;  4EBB A;  2XXW A;  2Y5L A;  3KC0 A;  1AVO B;  4RPN A;  2KNH A;  4WGZ A;  2MHR A;  4P1L A;  1HMO A;  1WAS A;  1OW8 A;  2J45 A;  1J8M F;  2LQG A;  4OVQ A;  1H43 A;  5DLJ A;  2QS1 A;  1NNF A;  3T22 A;  1I4Y A;  4OQO A;  2L5V A;  3ZWI A;  1TWC A;  4MW3 A;  3N5L A;  4QXD A;  4GXA A;  2CDQ A;  3IOU A;  1RXQ A;  3H6U A;  4QRZ A;  4EXL A;  3GWL A;  1NUX A;  2FGY A;  2AP3 A;  5B70 A;  1JEU A;  4PP0 A;  3QUJ A;  4FED A;  2YZS A;  3E13 X;  4YB7 A;  2F35 A;  1A54 A;  2ANJ A;  3R7C A;  3T6G B;  1FJ9 A;  3HLZ A;  2I58 A;  3M15 A;  1IQ7 A;  4IAR A;  4AL1 A;  3KMI A;  4C3B A;  1B3G A;  2R7W A;  1Z63 A;  1NU7 D;  3EG9 B;  3K7D A;  4OVP A;  3TTL A;  3IB1 A;  1VDW A;  1OQC A;  1LIH A;  3L6G A;  2DWI A;  3TDJ A;  3W9W A;  4Q5S F;  1VFD A;  3C9H A;  4LDR A;  4XEF A;  3TQW A;  3HO7 A;  1YTV A;  1NFN A;  5HM4 B;  2FAP B;  3EN3 A;  4F29 A;  4C7O B;  4G8H A;  1TWY A;  3U2M A;  3IQT A;  2DQV A;  3JYR A;  2LSE A;  3L1M A;  2AL5 A;  4MNP A;  2BL2 A;  3FVY A;  4DOZ A;  2VD3 A;  2Y7K A;  2UUH A;  4K1O A;  4ZE9 A;  4NQF A;  4KYD A;  5KCJ A;  2QRY A;  2IEE A;  3C8G D;  1S50 A;  2YVK A;  4U1Z A;  4G7O F;  2XX7 A;  3ILT B;  2Q3T A;  1G8X A;  3U2L A;  3IO4 A;  3L8I A;  4OVT A;  5EGY A;  4X1B A;  2CYD A;  1FQD A;  5L0H A;  3TJ6 A;  1FJ6 A;  3RNN A;  4KBL A;  4O6Y A;  1L3P A;  1LBV A;  1XVX A;  3KBZ A;  4X8R A;  4IGT A;  3B6T A;  3T1B A;  2O7U A;  3SXK A;  3M79 A;  3ZSU A;  1FPG A;  3EQL F;  2XWV A;  5AA4 A;  2Q9A A;  4P6I C;  3FHD A;  4O3A A;  2IOQ A;  5BQI A;  4OFO A;  3RN8 A;  3MFN A;  3MLG A;  1URS A;  4PFT A;  4H54 A;  3TQO A;  2OK2 A;  4DI4 B;  2Q88 A;  3AOU A;  2E1S A;  4G7H F;  5J1D A;  2JX0 A;  2L9J A;  2RCA A;  3G3G A;  1SYH A;  1EU8 A;  3SDF A;  2W45 A;  1T0K A;  3CSK A;  4DCY A;  4X0R A;  4BG0 A;  4DXW A;  2Q7R A;  4CX9 A;  4DVY P;  5KZT A;  1BR1 A;  4R9G A;  1LLS A;  1B46 A;  1U0B B;  1VOM A;  2AYS A;  3Q26 A;  1BZ4 A;  2VPO A;  5DVJ A;  2LFF A;  2ALU A;  1WAT A;  2XHD A;  1UTH B;  3BEH A;  4C7O A;  1TFO B;  2XLH A;  4RPO A;  3O55 A;  1YVI A;  3F47 A;  4TLL B;  3RPL B;  1OCR C;  4HFK B;  4F3B A;  4JDF A;  2HJM A;  3EHM A;  1B0H A;  3GLB A;  4YT8 A;  4FE8 A;  2DDK A;  3KPH A;  2XXU A;  2WZL A;  2OJE D;  3RIP A;  4HE0 A;  4QF9 A;  5AGF A;  4ONS A;  2D5W A;  1LS1 A;  3HHG A;  1QZX A;  4C3E A;  2O1M A;  2PX3 A;  5AC5 A;  3KSX A;  3UP9 A;  3AGU A;  4J30 B;  1Q0F A;  5E3C A;  2WL8 A;  5EQ7 A;  2R7O A;  1QQ3 A;  1DCU A;  5H8N B;  3CG1 A;  4DBR A;  2XX9 A;  3K1I A;  2NUV A;  3NKE A;  3CHG A;  1BKA A;  3G3H A;  2FIE A;  3DXJ F;  5M2V A;  3HNL A;  5FHM A;  2V25 A;  1TFA A;  3SXZ A;  4N91 A;  1OCZ C;  3ZG1 A;  3OMB A;  1ZHW A;  1SVX B;  3DD7 A;  4JZA A;  4XEK A;  3U5S A;  2PNO A;  1M2V B;  3B9Q A;  1T6I A;  4U23 A;  1FTM A;  1MPC A;  4N6D A;  3H2V A;  4QSD A;  4ELR A;  2ETS A;  2ICW G;  3S9O A;  1XVY A;  1DPE A;  1YAE A;  2DYS C;  1WVJ A;  3C7J A;  1E2X A;  3TZA A;  4C1T A;  3QK6 A;  3EFO B;  3KOT A;  4CSA A;  1NH7 A;  3K66 A;  2AL4 A;  1ORS C;  3FXB A;  4MMP A;  2EPK X;  2VB6 A;  2WVO A;  4DI3 D;  1FTJ A;  3MVX A;  1ZBM A;  5JSL A;  4JTA B;  4F31 B;  3B0P A;  3G3K A;  1B5I A;  3DP8 A;  1RKM A;  4N8Y A;  2CNW D;  5A5X A;  2OLB A;  5ITP A;  1Y1Z A;  1XZQ A;  3VFJ A;  2X51 A;  4KI2 A;  1EZ9 A;  4ULV A;  3O66 A;  3H65 A;  1E86 A;  2OWT A;  3H06 B;  4PGN A;  5DT6 A;  3S9L C;  4NTB A;  3KGC A;  1F9B A;  3ONM A;  2QSX A;  5IAI A;  3K6B A;  3HNK A;  5DVI A;  4N07 A;  1MY0 A;  3TTK A;  1HSL A;  4GRK A;  2J7P A;  1NFT A;  2BC5 A;  1T01 A;  2PF4 E;  4EBJ A;  4MEV A;  4MIJ A;  1QVX A;  3KH2 A;  1LAH E;  2NXO A;  1Z7M E;  4A2N B;  2HEU A;  5B1B C;  4ZED A;  3E9X A;  3K02 A;  5CMC A;  5CIV A;  3D1R A;  4ISU A;  2O51 A;  3JZ0 A;  3VRC A;  4YMB A;  1B58 A;  1NZE A;  2FA7 A;  5DVW A;  4I44 A;  3U1O A;  1HSE A;  3ZS6 A;  2KGO A;  3ZSF A;  5BQH A;  5KYX B;  1Q1K A;  3DP4 A;  4MLV A;  5IM2 A;  4OEN A;  1VR5 A;  3DZA A;  1LB9 A;  3MVW A;  3H6T A;  4GWU A;  5EYH A;  3ABM C;  3TTR A;  1ZHY A;  4NF5 B;  1D0Y A;  4IGR A;  1HMD A;  4BJT A;  3RFY A;  1KTM A;  3K6V A;  1SW4 A;  5H8H A;  1Y3Q A;  2PFY A;  1B4H A;  4FJP A;  4IO7 A;  4EXK A;  2GHB A;  3TFL A;  4HW8 A;  1CPR A;  5AE4 A;  4JCH A;  5AA2 A;  1JPJ A;  3B71 A;  1FSA A;  3IHU A;  2XXP A;  4KNW A;  4PAC A;  4NF8 A;  3JCU Q;  1Y6D A;  1FPJ A;  4GYT A;  2AWC A;  5EK0 A;  5J16 A;  2ZXO A;  2AVK A;  3P7I A;  3M3F A;  3EFO A;  4F3P A;  3JSZ A;  3UMH A;  1N76 A;  4LN5 A;  4JIO A;  3SER A;  4N15 A;  1SI1 A;  3LS1 A;  4U9D A;  4LER A;  4PAF A;  4PF6 A;  2FHY A;  4R6K A;  4KHZ E;  2F34 A;  2F97 A;  5I59 A;  3MBP A;  1MNE A;  2ZMB A;  2EIJ C;  2R25 A;  1YJG A;  1Q0G A;  3T6J A;  4U5E E;  1UIU A;  3NRH A;  1ST6 A;  1D9Q A;  2ONS A;  3IK6 B;  1JOG A;  4J7Y A;  2XWK A;  3V89 B;  1N3X A;  2L7A A;  4U21 A;  3JTL O;  4HE2 A;  4LAC B;  1MDP 1;  4F1V A;  4D4X A;  3QW1 A;  1O63 A;  4GX4 A;  2AWY A;  4DRJ B;  2Y7I A;  3PMR A;  4MHF A;  4NF8 B;  1ATG A;  1QKB A;  3LBS A;  2J0W A;  4JWX A;  1B3E A;  3IB2 A;  3PUW E;  4XQ1 A;  3ZIB A;  3L34 A;  3HPI A;  3HNJ A;  4AS5 A;  5GPG B;  1U6H A;  1MPB A;  2NOO A;  3D4G A;  5JEI A;  2ASR A;  3VYW A;  1ZJL A;  1E85 A;  5FZT A;  3QW0 A;  1K9Y A;  2I3V A;  4CJO A;  3WHN A;  2A68 F;  3O10 A;  4NTL A;  1LI7 A;  4J7T A;  2P3N A;  3UGO A;  4LAT A;  4KYS A;  4GEH A;  4G7Z F;  4QFL A;  3NOH A;  1JMW A;  5EHM A;  3EZH A;  3K1I C;  2HHM A;  3EKI A;  5EQ8 A;  1SQY A;  4JVD A;  1LFG A;  1NNT A;  4YN0 B;  3FVN A;  2R7V A;  4H67 A;  4GF8 A;  1I6B A;  1FMW A;  4KR5 A;  1MQJ A;  2XA5 A;  2WYP A;  3RY3 A;  1SBP A;  3R26 A;  5E3A A;  4EF1 A;  1K05 A;  4MVO A;  1B1X A;  1D1A A;  1DPP A;  3CRB A;  2XLE A;  2O84 X;  1MQH A;  4WJ0 A;  4N13 A;  2PBE A;  2ESN A;  3TTM A;  2DGJ A;  4EWC A;  3M1C B;  3QZC A;  4HS7 A;  4GWX A;  1ZVZ A;  2OWS A;  3IOT A;  4OD5 A;  1RJ9 A;  2FNC A;  1D1C A;  4JEB A;  3JRM O;  1PEB A;  4JW1 A;  5A6B D;  3DJU B;  3IFC A;  3SEV A;  5B3S C;  4E7Z A;  4CSA C;  2R71 A;  2XXV A;  4XPY A;  1CE2 A;  2THI A;  1Y9U A;  5H8Q A;  4F2Q A;  1IMF A;  3S27 A;  4CS9 C;  2QLA A;  2CW0 F;  3IAZ A;  3R7X A;  1FNT c;  1Z7N E;  5IZZ A;  4IAO A;  2I4B A;  3VAY A;  2Z15 A;  4ECF A;  2DP8 A;  3EHU A;  3S4U A;  2WEF A;  3B0V C;  2DSF A;  1NFO A;  3CFZ A;  3U3B A;  1URD A;  2ZZW A;  3JYY A;  3TMG A;  3DWW A;  2UXA A;  2J9V A;  3LS0 A;  1IIT A;  5K2X A;  5I3S A;  4O6N A;  1BK4 A;  1GQA A;  1LFI A;  1LGB C;  5DEX A;  2FBP A;  3M3K A;  2B3B A;  3TUL A;  3IR1 A;  4YJW A;  3EHN A;  2F7C A;  1DTG A;  1VB5 A;  1G5Z A;  4OER A;  3MX3 A;  4KI0 E;  2KQZ A;  1IXG A;  3RQG A;  1C17 M;  1IMC A;  1YPN A;  5A6A A;  4OHN A;  2VH3 A;  4OES A;  3RPW A;  4ZEC A;  1HE9 A;  2Q89 A;  3M8U A;  4XEQ A;  1ZW3 A;  1K40 A;  4G78 A;  4PJL A;  2XL4 A;  5FCL A;  4ELQ A;  5HV9 A;  2W7Y A;  2Q4F A;  2CEX A;  1TT1 A;  4NED A;  1Y4C A;  3SXM A;  5CM6 A;  4AB5 A;  4H1X A;  2QVR A;  4DIG A;  3O6G A;  3DM9 B;  3PCV A;  1SW5 A;  3MYF A;  4N8G A;  2NUP B;  4LQ2 A;  1R6Z A;  1JRA A;  1TFK B;  4U4X A;  4FAT A;  4F18 A;  4ZLD A;  2REG A;  3BFT A;  3MUQ A;  4O3C A;  5H8H B;  4H6D A;  4XFE A;  1PCX A;  1OR3 A;  3MYU A;  3C35 A;  3VDF A;  2HS5 A;  2VHA A;  3Q7L A;  3PPO A;  5CMM A;  3RKO F;  3PD9 A;  4YAH X;  1NV0 A;  2AIX A;  1LEV A;  1YYX A;  3U92 A;  5BWJ A;  1C03 A;  2J9U A;  1FW0 A;  4DBQ A;  5CBS A;  4BJ5 C;  3OOA A;  3T66 A;  4M1V A;  4PFU A;  3SNH A;  3FXR A;  1JAF A;  3U0C A;  3BBR A;  1PB9 A;  3UNG C;  4MVU A;  4OIQ F;  3PD8 A;  4DVZ A;  4JJF A;  3KG2 A;  4ZDM A;  2WVQ A;  3NKD A;  3FV2 A;  4FEC A;  1S7Y A;  4OFJ A;  1MH3 A;  4YZZ A;  1MY3 A;  2Q9B A;  2GRV A;  4PCD A;  3LUT B;  1NUW A;  1A0B A;  1PB8 A;  2J9B A;  3JZJ A;  3MVZ A;  4L17 A;  5TPA A;  4IB4 A;  2X7Q A;  2DOJ A;  3POV A;  2H9B A;  3MZ1 A;  2QPQ A;  3SZP A;  5E2Q A;  5DVF A;  2DYR C;  5IKB A;  3Q28 A;  4JVS A;  2HV6 A;  3NMJ A;  5I56 A;  3FIR A;  3IOR A;  4GL8 A;  2I15 A;  2HJ3 A;  5JVE A;  4KFQ A;  3DAG A;  4MCO A;  3AG2 C;  2HMZ A;  1NV5 A;  3HTK C;  1RJ9 B;  2EPN A;  4FAP B;  2Z8D A;  4CS7 A;  2VAS A;  3N6T A;  5H8S A;  1I6A A;  3EJN A;  3VLV A;  5D92 A;  4Z0I A;  1MY1 A;  2XXQ A;  4NHB A;  4NF0 A;  4CDA A;  4QFN A;  4CDY A;  1MY4 A;  4U5B E;  3PMX A;  4IWB A;  1P1N A;  3ZKL A;  3KN3 A;  1DOT A;  2QVV A;  2Q2C A;  3K00 A;  4CS8 C;  4H4K C;  4ULW A;  3EG9 A;  3ABL C;  1KZ8 A;  2TMV P;  3VE1 B;  4BLA A;  3I4U A;  4IRU A;  3MP1 A;  4UAC A;  1H44 A;  2QS3 A;  3MWB A;  3I5P A;  4ZEB A;  4DLD A;  4IO2 A;  2LFD A;  4PBH A;  3OSR A;  1YDI A;  3KJ7 A;  4LLE A;  1XOC A;  2PFZ A;  1B9J A;  3PPQ A;  1R1N A;  3T9V A;  4D4N A;  4JUR I;  1OQH A;  1ZU4 A;  4Z9H A;  4GWO A;  1B7Z A;  3ZTZ A;  4EUK B;  1INP A;  1NV6 A;  2A6E F;  3MPK A;  5F7V A;  4YL1 A;  1P99 A;  2OJQ A;  2I3W A;  1MG1 A;  5ICQ A;  1NV1 A;  1VE4 A;  2OWZ A;  4NF4 A;  5ISU A;  2I8B A;  3IJO B;  1H6G A;  4EF2 A;  5L3V A;  3OO9 A;  1FBC A;  1A7E A;  1MPD A;  4MQ9 F;  1VMA A;  2DWA A;  3NYM A;  5ET6 A;  1D0X A;  3ASO C;  1LBY A;  3I5Q A;  2EPL X;  2BJJ X;  3U94 A;  1IMD A;  2UYE A;  1PB7 A;  4HTG A;  2OCC C;  2VCA A;  3AQC A;  1Z6A A;  4KYE A;  4E0I A;  4GLI A;  2OU6 A;  1QUK A;  2YRF A;  3ODB A;  2OEX A;  2KQ9 A;  5E33 A;  2EPM X;  2DVC A;  3RLF E;  3T9X B;  1M2V A;  5CMB A;  3Q27 A;  4O7G A;  3OEK A;  4H8J A;  3CVG A;  4Z7E A;  1TKN A;  2OKU A;  4Q5T A;  1BLF A;  4NF6 A;  1B4Z A;  3SEX A;  2F3D A;  1LFH A;  4C1U A;  4MVS A;  1SI0 A;  1YYJ A;  3KN8 A;  1QLE C;  4RD9 A;  2W9Y A;  4JWY A;  5DS6 A;  1O5H A;  2A69 F;  3CFX A;  5JTY B;  2REJ A;  5A5L A;  3FJ7 A;  1G0H A;  2GQ1 A;  3PUX E;  1YZA A;  4NWD A;  5KYU A;  4IJJ A;  5B3I A;  3LLK A;  3PV0 E;  3BFU A;  3TAJ A;  1Q9D A;  256B A;  3C31 A;  5DS4 A;  3FD3 A;  1MXU A;  1XZP A;  4ELO A;  1FQF A;  1IMA A;  2IBF A;  1H7I A;  3VV5 A;  1VSO A;  3GZG A;  3K6U A;  1LST A;  3ZKK A;  4EHP A;  3H3G A;  3V5Z A;  4OYV A;  1UQW A;  3HJC A;  2Y7P A;  1GR2 A;  4OD4 A;  4N06 A;  1WDN A;  2GAQ A;  5L0F A;  2Q2A A;  4XWJ A;  2YL1 A;  2QTV A;  4MTF A;  1M5B A;  4Q7C A;  2R7R A;  4H46 A;  5KYY A;  2RC8 A;  4R2F A;  4XKQ A;  1I4Z A;  4ZZE A;  2VT5 A;  5FBP A;  3FV1 A;  3BIG A;  3E4R A;  5ELV A;  5L0G A;  1BDJ B;  4OET A;  1N3W A;  4RXL A;  3US6 A;  3EGX B;  2HZK A;  3U8Q A;  4U1O A;  2L6H A;  2ZD9 A;  4BDM A;  4XKP A;  2FIX A;  2GFH A;  1NI9 A;  4BDL A;  4E0X A;  4IGG A;  2LD6 A;  3N94 A;  3SEO A;  1E83 A;  2L81 A;  1B40 A;  3EGD A;  3KJT A;  3NDB B;  1Y3P A;  3O9P A;  1S05 A;  1PV3 A;  3H2U A;  2NUT B;  5A5X B;  1C02 A;  1M56 C;  1Y3N A;  2Q8M A;  4HCW A;  3O97 A;  5K2Y A;  3S84 A;  3TCG A;  1FBG A;  3OO8 A;  3LSW A;  3PUY E;  4PDD A;  1LAF E;  4JB7 A;  5IZ3 A;  3TQL A;  5EQ9 A;  2VGQ A;  1MXV A;  4WKM A;  1FQE A;  2D21 A;  3LEO A;  5I56 B;  2ZXT A;  1LBB A;  2BE5 F;  2JPU A;  1D0Z A;  3AG4 C;  3GEE A;  4N6P A;  4POX A;  4MF3 A;  1LE4 A;  5KCJ B;  3LSL A;  3L8J A;  5I57 A;  3B7D A;  1IMB A;  2VCC A;  3E3K A;  1F1M A;  4E17 A;  4TOZ A;  1IXI A;  1B3H A;  2QE9 A;  3ECR A;  1V54 C;  2OEV A;  2GDC A;  4U5H A;  3B50 A;  4I1D A;  4ZEF A;  2O68 A;  5I84 A;  4XF5 A;  2PVU A;  1ZTY A;  2YLN A;  4LUB A;  3DM0 A;  1QKR A;  3KKB A;  1SPI A;  4R74 A;  1Z3I X;  4JVC A;  2PX0 A;  5KYX A;  4F3S A;  5HPQ A;  4N6K A;  3UN6 A;  2V4C A;  4AQ4 A;  2F5X A;  4BPM A;  3C36 A;  4OWD A;  3LNM B;  1FTA A;  4X48 A;  5ESY A;  1POT A;  3SXY A;  2VC9 A;  1UTB A;  2YKZ A;  1FAP B;  5I58 B;  2YLD A;  4MH5 A;  2Y3H A;  5I2K A;  1HY5 A;  1H9G A;  3FAS A;  4JJG A;  2P6V A;  1I6Q A;  5A6B A;  3T0J A;  2HAV A;  3GBB A;  3TOD A;  4OA4 A;  3G50 A;  3MAM A;  1QJM A;  1AIV A;  1HE1 A;  3S2V A;  4I1O B;  1MY2 A;  2XXT A;  4FIM A;  4N4U A;  3IO6 A;  4QI2 A;  1YA7 O;  3DKA A;  3TK0 A;  4EIY A;  2B4M A;  5I5P A;  4Q30 B;  5COF A;  4IY5 A;  5ITO A;  4PJM A;  3B29 A;  2WB7 A;  1B1H A;  1VYK A;  3LUY A;  4OZ9 A;  2PT1 A;  2RSE B;  3KC1 A;  1G0I A;  3HFU A;  1ORJ A;  2IYL D;  2OCU A;  3SET A;  3AGT A;  3G3F A;  2FFH A;  2IA4 A;  4MW8 A;  3UOR A;  2XWI A;  2C03 A;  5B7D A;  2L6G A;  1IZ1 A;  3EGX A;  4RK2 A;  2Y3D A;  4MNC A;  3UR3 C;  4KCD A;  5IZ1 A;  1MMD A;  2MYS A;  4ELP A;  3G3I A;  2MWQ A;  4FBP A;  5JS5 A;  3FVG A;  2NPU A;  1RYX A;  4Q8R A;  1B5J A;  2KC3 A;  3EZI A;  4R72 A;  5T3T A;  1ZKB A;  3LSF B;  2LP4 A;  4NWC A;  3RF3 A;  1O87 A;  2HUJ A;  2P1A A;  1E84 A;  3W2V A;  1ORY A;  3VVE A;  1MM7 A;  5L0C A;  1Z5Z A;  1NL5 A;  3CIJ A;  3HST A;  3A3C A;  1FTL A;  1M6T A;  5L0I A;  3OSQ A;  1GVC A;  3SZR A;  4DXU A;  3LLI A;  4OIP F;  1S9T A;  4PE5 B;  1SMY F;  2IXP A;  2NUP A;  2P0N A;  1A7V A;  1APC A;  3UIF A;  5L9S A;  3GWN A;  2XL6 A;  2IXN A;  2EIM C;  4ZEI A;  2NVU B;  1ZYR F;  3RT6 B;  1RDY A;  1B52 A;  1FRP A;  4Z9I A;  3EPE A;  1AMF A;  2XXY A;  4G61 A;  4IY6 A;  4F19 A;  3FXH A;  4N17 A;  4E7S A;  1NNP A;  1OXB A;  1BR4 A;  2H7B A;  1FPB A;  2ZNS A;  3U8V A;  2KK1 A;  3H7M A;  3M4C A;  2NG1 A;  4XKN A;  2AU5 A;  1BTJ A;  1QUL A;  2P2A A;  3T6B A;  3K1N A;  3T9H B;  3VVF A;  3RH3 A;  3TOL A;  2QFL A;  4QFP A;  3IQ6 A;  3A29 A;  5CRY A;  1AH5 A;  3JYH A;  3LEV A;  3WOD F;  1N84 A;  3V83 A;  4WAB A;  2R05 A;  1J1N A;  4L6R A;  1PBP A;  4P11 A;  2GH9 A;  1MXY A;  1FBE A;  3IQ5 A;  4KNV A;  4O6M A;  3KYI A;  1V4A A;  1FQB A;  3NYL A;  1N7W A;  3SYN A;  4CBE A;  1ZHT A;  4EQB A;  2Y7W A;  1HW2 A;  5L0J A;  2DYX A;  1XC1 A;  3RT8 A;  3T9U A;  2R03 A;  3VXB A;  1EZP A;  2F7B A;  2XXA A;  3LAY A;  1VK5 A;  4LZ8 A;  3L6H A;  2YEV A;  3ZQV A;  5F5H A;  4PGP A;  4RDA A;  3K1M A;  4O8M A;  3BKI B;  3DP6 A;  1JNF A;  5I2N A;  1IXH A;  1M57 C;  1LCT A;  3FAT A;  2V3Q A;  3FXU A;  3WAE A;  1URG A;  3Q25 A;  2CZK A;  4K0D A;  1QPU A;  1FMV A;  2ZYO A;  5ET8 A;  5BQG A;  3QIM A;  4DRH B;  4AS4 A;  2R6G E;  1OQG A;  1JW5 A;  1YZC A;  3OXN A;  1RKE A;  3ZTM A;  4N81 A;  4I40 A;  1NG1 A;  4IR8 A;  4JSD A;  4QI0 A;  4W8K A;  3GYY A;  4DCX A;  1FQC A;  1MMA A;  3U9M A;  1NMU A;  2P3V A;  2J9W A;  1YA9 A;  3A09 A;  2A6H F;  1MXZ A;  3C62 A;  1U89 A;  2Y39 A;  4FES A;  2UVH A;  4GWW A;  3TCF A;  3PPR A;  4F1U A;  4YT4 A;  2CMO A;  1K04 A;  4MFI A;  4XIG Q;  4O79 A;  5KYY B;  2XM0 A;  1JP4 A;  2I0C A;  4BJ1 A;  4KQP A;  4OIR F;  4THI A;  4KCC A;  1DK4 A;  2O7I A;  1P1O A;  2RKM A;  4JE9 A;  1Q0D A;  1WWP A;  3UMK A;  3PPN A;  3N2Z B;  4H65 A;  1Y1M A;  4GX3 A;  1XT8 A;  3S9N C;  4PBQ A;  1TWG A;  4OVJ A;  4PAK A;  5F1Q A;  1Q35 A;  4LVQ A;  1M5C A;  3QSL A;  1QKA A;  1L7C A;  1LBW A;  3PPP A;  4P1E A;  3X2Q C;  3OO7 A;  3N26 A;  2RCB A;  1S7Z A;  1YXI A;  4I9D A;  2XS1 A;  4HFF B;  3TTN A;  3OEL A;  3RPL A;  3L0I A;  1OKK D;  2WBB A;  3EQ1 A;  3K2D A;  4RA1 A;  1FTK A;  3ASN C;  2Y84 A;  4HE1 A;  3RYD A;  2F6P A;  1ZHX A;  1YAR O;  2YHS A;  4UDV A;  2JD3 A;  2QJE A;  3LC8 A;  3SES A;  4U5C E;  5AA3 A;  5ICT A;  4BDO A;  4G8M A;  4JKV A;  3S0X A;  2I4C A;  3DLN A;  3VM6 A;  4LQ5 A;  4E0W A;  1H3D A;  3I5O A;  3K4U A;  4OTE A;  2X26 A;  3LR1 A;  4Q4Z F;  3C63 A;  3PU5 A;  1FBD A;  5DYH A;  2WBD A;  4GD5 A;  4HEA J;  2YLI A;  4RNS A;  2R7X A;  1PD1 A;  2VOZ A;  3O28 A;  4YKJ A;  1P1Q A;  3EH1 A;  2C04 A;  2DS9 A;  3C8Z A;  1JVX A;  4G0H A;  4YWQ A;  4ZLC A;  3OEN A;  1UFB A;  3Q7G A;  3QVZ A;  2LAO A;  4XLP F;  2CCY A;  1OVT A;  1N7X A;  1USY H;  2P61 A;  3CSG A;  1L5T A;  1QGX A;  3FDQ A;  4POW A;  2B3F A;  5A69 A;  1IEJ A;  4YIC A;  1LCF A;  2XLD A;  2UUI A;  3U8P A;  1D4N A;  1PBQ A;  2MKZ A;  3MVY A;  4JCZ A;  1HSJ A;  1FTS A;  5L9M A;  1US5 A;  1GM5 A;  2X0C A;  1D9Y A;  3FAP B;  5F5F A;  2DE2 A;  4C0R A;  4U2R A;  2V3U A;  5COM A;  1B2H A;  4OIN F;  1LB8 A;  3B8B A;  1Z23 A;  4LLC A;  1VFE A;  3CI8 A;  3QUF A;  1LAX A;  3QTH A;  2XXI A;  3HHF A;  2IM8 A;  2YWA A;  3FOP A;  3DEL B;  2B4L A;  1N0T A;  4QSC A;  4MTG A;  4P9K A;  4MTO A;  1AL3 A;  1DTZ A;  2F6G A;  1NV2 A;  3NYJ A;  1FBH A;  2WZG A;  3SEW A;  3S28 A;  4XPX A;  5AA2 D;  2CNW A;  5IY5 C;  4M63 A;  4PJJ A;  4RY1 A;  4WXJ A;  5JLI A;  1SYQ A;  1JVY A;  3OD7 A;  4BDQ A;  1FPK A;  2R7Q A;  1EA8 A;  1RKC A;  3MQ9 A;  1EQ1 A;  1H76 A;  4MVZ A;  5TP9 A;  1OW6 A;  2YL7 A;  3GBA A;  3H6V A;  3EHT A;  2HMQ A;  2OG2 A;  1MND A;  4PFR A;  4MNI A;  4P56 A;  2G29 A;  3PTY A;  4MBP A;  5EHS A;  5F28 E;  3U3F A;  4HE8 D;  3CAX A;  2L6F A;  2ZZV A;  3K6W A;  4PJN A;  4PFP A;  4BEM J;  1SYI A;  4NN3 A;  2QMW A;  3LJB A;  3JV9 A;  3MC2 A;  4F3G A;  1NBB A;  1MQD A;  3U9J A;  2QS2 A;  3KEI A;  3UGW A;  3QAX A;  4KPT A;  1EKY A;  1ZU0 A;  2CZL A;  2M8C A;  5L3Q A;  4ESW A;  5B1A C;  1D1B A;  3MZ9 A;  5KYW A;  4PQJ A;  4R2B A;  1T6U A;  2M4E A;  1D3K A;  4PE3 A;  1VYI A;  2CZI A;  3MP8 A;  2IXO A;  2KSF A;  3KOS A;  2A5S A;  2IXM A;  1PDA A;  1T9K A;  1MM6 A;  4H5G A;  1JQF A;  2XD3 A;  5TU0 A;  4IO4 A;  4F4B A;  2PX1 A;  2XXA B;  4BJ6 C;  2VPN A;  2ZYK A;  1SW2 A;  3OA1 A;  4P8B A;  5K0I A;  1WGW A;  4AK9 A;  2VD2 A;  5FHN A;  5JRA A;  3PMW A;  3M4B A;  3U65 A;  3TEP A;  2G3K A;  3MYI A;  2EPO A;  2DWH A;  3OO6 A;  4RJZ A;  4BJ6 A;  3F46 A;  4X04 A;  1USY E;  2A5T A;  1EH3 A;  2DB4 A;  4IB2 A;  3GXA A;  5L8D A;  4U5G A;  3W8H A;  5EQA A;  1GGQ A;  3FXQ A;  4H0W A;  2F22 A;  2KW3 C;  4GFR A;  4CIH A;  1TR2 A;  1NV3 A;  3HNI A;  4TLM B;  4G77 A;  1QUI A;  4I62 A;  1A55 A;  1I5N A;  1OKK A;  3RQT A;  1JPN A;  4XLN F;  4J32 B;  4G4P A;  3EF7 A;  3IB0 A;  2XLO A;  4YL0 A;  1AOV A;  2B0J A;  4BDN A;  4OMB A;  3G7W A;  2PCR A;  1ZMG A;  1A8E A;  1EYI A;  2QMX A;  3GM2 A;  3H03 A;  4G68 A;  1OCC C;  4BEJ A;  3DMD A;  2XXX A;  2YJP A;  2YPN A;  1R5I D;  5DQZ A;  2OZZ A;  3T96 B;  2XLV A;  1QSP A;  4NE4 A;  1ZW2 A;  3TJ5 A;  2R7S A;  4NF6 B;  4H8I A;  2Q74 A;  4FOR A;  2VCB A;  1OIB A;  4NGU A;  3PGF A;  4ZS9 A;  2H99 A;  4MAG A;  3S9M C;  4GQO A;  4YU0 A;  4RYA A;  4LZ5 A;  3BIH A;  3O6H A;  1II5 A;  3IPM O;  4U5F E;  1DBZ A;  1VLS A;  4YB5 A;  4Q0C A;  3TEL A;  3LNR A;  2PYY A;  1AUE A;  3G4X A;  1Q0M A;  4GVO A;  5KDT A;  3N6U A;  4OXV A;  4LDK A;  4XEV A;  2Q8J A;  4LP2 B;  5D91 A;  2H25 A;  2R8T A;  5BUU A;  4CJG A;  4F2O A;  2DWJ A;  3FJG A;  4AE4 A;  2QUP A;  3ILU B;  2E0S A;  4O94 A;  2A0B A;  4PFY A;  2HV7 A;  1LVK A;  4I1M A;  3FJM A;  4YK5 A;  4JBZ A;  3ATP A;  1R9L A;  4NC3 A;  1UTH A;  4O3B A;  1LI5 A;  1DSN A;  1W2W A;  3SKP A;  4G8N A;  2I0B A;  4JVI A;  4R75 A;  2HSB A;  3HN0 A;  3LV0 A;  4KXP A;  1TFD A;  3S90 A;  3MBG A;  2I48 A;  3K1P A;  4EBK A;  4YT5 A;  4PF8 A;  1FFT C;  3E79 A;  4MVQ A;  2Y3B A;  2ABH A;  4BJ5 A;  4OVR A;  2P0S A;  1V74 B;  1EYK A;  3VF0 A;  3GOD A;  4XPW A;  3DJN B;  2VP1 A;  1A7L A;  1SD3 A;  1KU2 A;  1YAU O;  2M64 A;  5CI9 A;  3TPA A;  4RBN A;  2D4U A;  4NQ8 A;  1MMG A;  4ANJ A; 
#chains in the Genus database with same CATH homology
 3IAZ A;  3R7X A;  1QW0 A;  1Z7N E;  3S9E A;  3FVG A;  2I4B A;  1RYX A;  2XXR A;  3O2A A;  4GIZ A;  1JEV A;  3UK4 A;  1B5J A;  4Q8R A;  4P0I A;  3VLW A;  3ZKK A;  4ECF A;  1FCK A;  2HFB A;  4R72 A;  2DP8 A;  3EHU A;  5EYF A;  3S4U A;  2V84 A;  1ZKB A;  2Z8F A;  3LSF B;  3OEM A;  2DSF A;  4NWC A;  1YCJ A;  1MRP A;  3LSX A;  3RTW B;  1R9Q A;  2R9J A;  3CFZ A;  3VVE A;  1MM7 A;  1URD A;  1MDQ A;  1GGG A;  2HZL A;  1NL5 A;  3TMG A;  3CIJ A;  2UXA A;  3MPL A;  2XXW A;  3HST A;  3A3C A;  1FTL A;  3AXF A;  4RPN A;  3OSQ A;  1IIT A;  3B6Q A;  3PUV E;  4GL0 A;  5K2X A;  4G2Z A;  1GVC A;  3WAF A;  4DXU A;  4PE5 B;  1S9T A;  1LFI A;  1LGB C;  1EZO A;  4QHQ A;  1H43 A;  3RGY A;  2QS1 A;  1NNF A;  2Z8E A;  5DEX A;  1POY 1;  3T22 A;  4OQO A;  3M3K A;  2B3B A;  3UIF A;  5L9S A;  4EDP A;  3N5L A;  3IR1 A;  4GXA A;  2F7C A;  4XXU A;  1DTG A;  3IOU A;  4ZEI A;  2O69 A;  3H6U A;  4QRZ A;  2NVU B;  4EXL A;  4OER A;  2B65 A;  3RT6 B;  4KI0 E;  1B52 A;  5B70 A;  1MXX A;  1JEU A;  3EPE A;  4K3F A;  1AMF A;  3C33 A;  3KZG A;  3QUJ A;  3E13 X;  1IXG A;  2XXY A;  2F35 A;  4FED A;  4YB7 A;  4IY6 A;  4F19 A;  1A54 A;  2ANJ A;  1YPN A;  1NNP A;  4OHN A;  2ZNS A;  4OES A;  1B6H A;  3HV1 A;  2I58 A;  3U8V A;  4ZEK A;  3RPW A;  4ZEC A;  1IQ7 A;  3H7M A;  5H8Q B;  4EQ9 A;  4XKN A;  2Q89 A;  1B3G A;  1BTJ A;  3M8U A;  4QFK A;  1QUL A;  2P2A A;  4EUO A;  3TYH A;  4I8C A;  5HBC A;  3CSB A;  3K1N A;  3T9H B;  3TTL A;  2HAU A;  2QL3 A;  3H4Z A;  3IB1 A;  3L6G A;  4QFO A;  2DWI A;  3T93 B;  2W7Y A;  1TXF A;  3TDJ A;  1TT1 A;  4NED A;  3W9W A;  4QFP A;  3UA8 A;  1Y4C A;  1VFD A;  3C9H A;  5CM6 A;  5CRY A;  4AB5 A;  1AH5 A;  4H1X A;  3TQW A;  3HO7 A;  1N84 A;  1YTV A;  2GHA A;  2OJT A;  1GTK A;  2QS4 A;  2OBG A;  4LON B;  5HM4 B;  3V83 A;  4DIG A;  1J1N A;  1O64 A;  3EN3 A;  4F29 A;  4G8H A;  3O6G A;  1PBP A;  1TWY A;  4H5F A;  2DQV A;  2GFE A;  2KLF A;  1SW5 A;  2GH9 A;  1MXY A;  3JYR A;  4P11 A;  3MZB A;  4LQ2 A;  2AL5 A;  3PUZ E;  1NH8 A;  1R6Z A;  5TPA B;  1FQB A;  4U4X A;  2VD3 A;  4FAT A;  1N7W A;  2Y7K A;  4F18 A;  4ZE9 A;  2REG A;  3BFT A;  4KYD A;  1SW1 A;  3MUQ A;  2QRY A;  2IEE A;  2Y7W A;  1S50 A;  4O3C A;  4H6D A;  4U1Z A;  5H8H B;  4EQB A;  2XX7 A;  3ILT B;  2DYX A;  5FHO A;  3C35 A;  3IO4 A;  3VDF A;  1XC1 A;  4F22 A;  2VHA A;  3RT8 A;  3T9U A;  1M5F A;  3PPO A;  4X1B A;  3CFL A;  3VXB A;  3FVK A;  3I3V A;  5H8F A;  1FQD A;  2F7B A;  5CMM A;  1MS7 A;  3CG3 A;  3RNN A;  3PD9 A;  4YAH X;  1XVX A;  3VVD A;  2AIX A;  3C32 A;  3U92 A;  4ZED A;  5BWJ A;  5CBR A;  4LZ8 A;  2UVJ A;  4IGT A;  2H4I A;  3B6T A;  3L6H A;  3Q29 A;  2O7U A;  1FQA A;  1FW0 A;  1JW1 A;  5CBS A;  2ONK E;  3K1M A;  3OOA A;  1WOD A;  4IO3 A;  4M1V A;  1A40 A;  4O3A A;  4PFU A;  3BKI B;  3FXR A;  3DP6 A;  4OFO A;  3RN8 A;  1JNF A;  1URS A;  4PFT A;  4WEP A;  5TP9 B;  1IXH A;  2Z23 A;  3I6V A;  3O6I A;  2OK2 A;  5I59 B;  1B7U A;  1LCT A;  3V5A A;  2Q88 A;  2E1S A;  3BBR A;  3FAT A;  1PB9 A;  2V3Q A;  3FXU A;  1URG A;  4G68 C;  3Q25 A;  3WAE A;  3PD8 A;  5J1D A;  3KG2 A;  3C34 A;  4ZDM A;  4R73 A;  2RCA A;  2ZYO A;  1SYH A;  1EU8 A;  3G3G A;  3FV2 A;  4YKI A;  1RYO A;  3SDF A;  5KDT B;  1T0K A;  4FEC A;  3G3J A;  1S7Y A;  4OFJ A;  3QIM A;  4DCY A;  1MH3 A;  2R6G E;  4YZZ A;  1MY3 A;  1OQG A;  4FEB A;  2GRV A;  1JW5 A;  1CB6 A;  2V93 A;  3VXC A;  5KZT A;  4R9G A;  1LLS A;  4LZ7 A;  2F7A A;  1B46 A;  3OXN A;  3USD A;  4YKP A;  1PB8 A;  3JZJ A;  2AYS A;  3MVZ A;  4JSD A;  4L17 A;  1D9V A;  5TPA A;  2X7Q A;  3Q26 A;  2DOJ A;  4DCX A;  2H9B A;  3MZ1 A;  1FQC A;  5DVJ A;  2LFF A;  1H45 A;  1QVS A;  1OVB A;  2ALU A;  1Y4T A;  2QPQ A;  1NMU A;  1UTH B;  2XHD A;  3PMV A;  5DVF A;  3QXM A;  3Q28 A;  3A09 A;  2F36 A;  5I56 A;  5IKB A;  1M5D A;  4RPO A;  3FIR A;  1MXZ A;  3IOR A;  2O6A A;  4GL8 A;  1B05 A;  3TCF A;  4YMA A;  2UVH A;  4TLL B;  1O7T A;  4WED A;  3PPR A;  4F1U A;  3FZV A;  4KFQ A;  1ZIU A;  2CMO A;  1IXC A;  1JET A;  2XX8 A;  5DTB A;  4F3B A;  4MFI A;  4XIG Q;  1QUJ A;  2I0C A;  4JDF A;  3K6X A;  1B3L A;  2Z8D A;  1B0H A;  4KQP A;  4THI A;  3GLB A;  3N6T A;  5H8S A;  1I6A A;  3KN7 A;  4KCC A;  1I69 A;  4FE8 A;  2O7I A;  1P1O A;  2RKM A;  2XXU A;  3RUM A;  1MQI A;  1US4 A;  3VLV A;  3IL1 B;  4Z0I A;  1MY1 A;  2XXQ A;  3PPN A;  4IO6 A;  4H65 A;  1Y1M A;  3EHS A;  1XT8 A;  3S9N C;  4QFN A;  4QF9 A;  1MY4 A;  3PMX A;  2D5W A;  4OVJ A;  3FVO A;  5F1Q A;  1Q35 A;  4LVQ A;  1P1N A;  3HHG A;  3KN3 A;  1M5C A;  3QSL A;  3ZKL A;  4C1U A;  1LFH A;  1QKA A;  1DOT A;  2O1M A;  2ONR A;  3KSX A;  3PPP A;  4KD5 A;  3UP9 A;  2Q2C A;  3K00 A;  3MP6 A;  3B6W A;  4FAJ A;  4BLA A;  1KWH A;  3OO7 A;  3VE1 B;  5H8N B;  3CG1 A;  3N26 A;  2RCB A;  3MP1 A;  2A5T B;  2XX9 A;  3MW0 A;  1PC3 A;  1H44 A;  2QS3 A;  4UAC A;  4I9D A;  2NUV A;  3MWB A;  2DXR A;  1BKA A;  4OEU A;  3G3H A;  4ZEB A;  4DLD A;  4GXS B;  5AA4 A;  4IO2 A;  2LFD A;  3TTN A;  5M2V A;  3OSR A;  1FTO A;  3TKD A;  3KJ7 A;  2DE3 A;  5FHM A;  2O1L A;  3OEL A;  1XOC A;  2V25 A;  5AA2 B;  1B9J A;  3K2D A;  3PPQ A;  3EQ1 A;  1R1N A;  4ND9 A;  1P1U A;  3U72 A;  3IOV A;  3T9V A;  1TFA A;  2PBW A;  1OQH A;  3OMB A;  4RA1 A;  1FTK A;  2Y84 A;  4GWO A;  2DVZ A;  1SVX B;  2F6P A;  2WKY A;  2H5Y A;  1B7Z A;  1M5E A;  2QJE A;  5FTI A;  3LC8 A;  3SES A;  4U23 A;  1FTM A;  1MPC A;  5AA3 A;  5ICT A;  2F78 A;  5F7V A;  3MPK A;  2XXH A;  4G8M A;  4QSD A;  4BDO A;  2I4C A;  4ELR A;  3DLN A;  4LQ5 A;  4M4G A;  1XVY A;  1DPE A;  4E0W A;  1H3D A;  1YAE A;  3I5O A;  2UYF A;  4NMY A;  1B0L A;  1OMP A;  1P99 A;  3K4U A;  3RTF B;  1WVJ A;  2X26 A;  2I3W A;  1MG1 A;  2HXW A;  3LR1 A;  1VE4 A;  3QK6 A;  3D4C A;  4OTE A;  3TZA A;  4C1T A;  3PU5 A;  4U22 A;  3KOT A;  4X9T A;  5DYH A;  4F3P A;  4NF4 A;  1NH7 A;  4GD5 A;  5ISU A;  2AL4 A;  3R6U A;  1ZLQ A;  4RNS A;  2VOZ A;  3O28 A;  2I49 A;  1UTB B;  3IJO B;  1P1Q A;  1FTJ A;  4YKJ A;  3SEU A;  1A8F A;  3MVX A;  4EF2 A;  3OO9 A;  2DS9 A;  5CMK A;  1ZBM A;  1JVX A;  1GV8 A;  4F31 B;  3MJN A;  1MPD A;  2RC9 A;  3G3K A;  1B5I A;  3OEN A;  1BIY A;  2DWA A;  3DP8 A;  1RKM A;  4NF5 A;  2LAO A;  5A5X A;  2OLB A;  1OVT A;  5ITP A;  2BJJ X;  1N7X A;  1USY H;  3U94 A;  1Y1Z A;  1PB7 A;  2UYE A;  4HTG A;  3VFJ A;  4DXC A;  3CSG A;  1NNK A;  4KYE A;  1L5T A;  1EZ9 A;  4GLI A;  3O66 A;  2OWT A;  3H06 B;  4POW A;  2B3F A;  2FYI A;  5DT6 A;  5I57 B;  1IEJ A;  1QUK A;  3S9L C;  4YIC A;  3KGC A;  3ODB A;  1LCF A;  5DEX B;  1F9B A;  3MVY A;  1D4N A;  1PBQ A;  2DVC A;  3ONM A;  3RLF E;  2QSX A;  1HSJ A;  1BP5 A;  1MXW A;  1US5 A;  5L9M A;  3T9X B;  5IAI A;  5DVI A;  4N07 A;  1D9Y A;  1MY0 A;  1OLC A;  5CMB A;  3TTK A;  2DE2 A;  1HSL A;  2UVG A;  3Q27 A;  1OLA A;  4GRK A;  4C0R A;  1NFT A;  4U2R A;  2V3U A;  1LB8 A;  1B2H A;  3OEK A;  4H8J A;  3T66 A;  3CVG A;  1B7H A;  1VFE A;  3CI8 A;  1LBC A;  1LAH E;  1LAX A;  1Z7M E;  2NXO A;  3QUF A;  2XXI A;  2RIN A;  4Z7E A;  3HHF A;  2DXY A;  4Q5T A;  1BLF A;  3DEL B;  1B4Z A;  1N0T A;  3K0V A;  2HEU A;  2XD2 A;  4NF6 A;  4OFL A;  4QSC A;  3SEX A;  1AL3 A;  1DTZ A;  2F6G A;  3E9X A;  3K02 A;  4G68 B;  4NF4 B;  4PP0 A;  5CMC A;  4ISU A;  2O51 A;  3IX1 A;  5I2N B;  4YMB A;  3FUZ A;  3SEW A;  4ZE8 A;  1SI0 A;  1B58 A;  1XHY A;  2FA7 A;  4PET A;  5AA2 D;  2ZNT A;  3KN8 A;  1JVY A;  3HCQ A;  4RY1 A;  4WXJ A;  3VVF A;  4TQU Q;  3U1O A;  1HSE A;  4JWY A;  3ZS6 A;  3OD7 A;  3CFX A;  5JTY B;  4BDQ A;  3ZSF A;  4U4S A;  2REJ A;  3C4M A;  3MQ9 A;  5AA4 B;  3FJ7 A;  3K01 A;  1H76 A;  5I2K B;  5TP9 A;  3PUX E;  4NWD A;  1Q1K A;  3GBA A;  5H8N A;  3DP4 A;  3H6V A;  4MLV A;  5AA1 A;  3W9V A;  3EHT A;  4OEN A;  4X1D A;  5I2N A;  3PV0 E;  3BFU A;  3TAJ A;  4ONY A;  1VR5 A;  2G29 A;  4MBP A;  3KSJ A;  1P1W A;  1LB9 A;  3C31 A;  4R9F A;  5EHS A;  3FD3 A;  1MXU A;  3MVW A;  2G93 A;  3H6T A;  4LA9 A;  4ELO A;  1FQF A;  3K6W A;  3TTR A;  4NF5 B;  1SYI A;  4IGR A;  2QMW A;  3VV5 A;  4IO5 A;  1VSO A;  3JV9 A;  3GZG A;  3K6U A;  1LST A;  1MQD A;  2QS2 A;  2ZNU A;  3KEI A;  3MC2 A;  4XKR A;  4JSO A;  3IOW A;  3H3G A;  4OYV A;  3UGW A;  3K6V A;  3QAX A;  1SW4 A;  1UQW A;  5ICQ A;  2Y7P A;  5H8H A;  1Y3Q A;  1GR2 A;  4KPT A;  1ZU0 A;  1B4H A;  1WDN A;  2CZL A;  3KFM A;  2Q2A A;  4FJP A;  4IO7 A;  4EXK A;  2M8C A;  2GHB A;  3TFL A;  4HW8 A;  5CC2 A;  5LOM A;  5AE4 A;  4ESW A;  1M5B A;  3MZ9 A;  4PQJ A;  1MH4 A;  5KCJ A;  5AA2 A;  4R2B A;  2NWJ A;  2RC8 A;  4R2F A;  1D3K A;  2XXP A;  4XKQ A;  4ZZE A;  3KBR A;  4OEV A;  4NF8 A;  1MQG A;  3MP8 A;  3FV1 A;  3E4R A;  3KOS A;  1DMB A;  5ELV A;  2A5S A;  4OET A;  3P7I A;  1N3W A;  3A3U A;  1PDA A;  3M3F A;  1MM6 A;  4H5G A;  4RXL A;  1JQF A;  2XD3 A;  5H8F B;  5TU0 A;  1N76 A;  2HZK A;  4IO4 A;  2PX1 A;  2ZYK A;  4U1O A;  3U8Q A;  4DZ1 A;  3SER A;  2PMS A;  1SW2 A;  2HQ0 A;  1SI1 A;  4XKP A;  4XTC Q;  4BDM A;  2Z22 A;  2X7P A;  2RF1 A;  4BDL A;  2VD2 A;  4E0X A;  5FHN A;  3N94 A;  3PMW A;  3V8X B;  1B40 A;  3KJT A;  3TEP A;  1Y3P A;  3O9P A;  4R6K A;  2DWH A;  4KHZ E;  3OO6 A;  2F34 A;  4RJZ A;  2F97 A;  5I59 A;  1B51 A;  5A5X B;  3MBP A;  2I6E A;  5JTY A;  1USY E;  2A5T A;  1EH3 A;  1Y3N A;  2ZMB A;  4IB2 A;  3CR9 A;  3GXA A;  4HCW A;  5FTH A;  1UIU A;  5L8D A;  4R6H A;  3O97 A;  5K2Y A;  5L9O A;  1N04 A;  3TCG A;  3FXQ A;  4H0W A;  3OO8 A;  3IJX B;  2UVI A;  3LSW A;  3H6W A;  3PUY E;  1LAF E;  4JB7 A;  2ONS A;  2F8D A;  4GFR A;  2VGQ A;  1B3F A;  1MXV A;  3IK6 B;  4WKM A;  3TQL A;  1FQE A;  1NKX A;  1N3X A;  2D21 A;  3V89 B;  5I56 B;  2ZXT A;  1LBB A;  4U21 A;  4TLM B;  4G77 A;  1QUI A;  4I62 A;  1A55 A;  1MDP 1;  4N6P A;  4MF3 A;  4POX A;  4RK9 A;  3W15 C;  4F1V A;  3RQT A;  1O63 A;  3LSL A;  4JWO A;  5KCJ B;  4G4P A;  4UA8 A;  3EF7 A;  5I57 A;  3IB0 A;  2ZYM A;  4DXB A;  4HCY A;  2Y7I A;  3B7D A;  3QYT A;  1AOV A;  4BDN A;  3E3K A;  4NF8 B;  3G7W A;  4OMB A;  4TOZ A;  4BDR A;  1ATG A;  5CI5 A;  1QKB A;  1ZMG A;  1IXI A;  3LBS A;  4F1Y A;  1A8E A;  1B3H A;  4JWX A;  2QMX A;  1B3E A;  1ELJ A;  3ECR A;  3IB2 A;  3H03 A;  3PUW E;  4G68 A;  4I1D A;  4EQ7 A;  1XS5 A;  2XXX A;  2YPN A;  2DE4 A;  2O68 A;  2YJP A;  3HPI A;  4ZEF A;  3U93 A;  5I84 A;  2PVU A;  1ZTY A;  2OZZ A;  2V3T A;  3T96 B;  2YLN A;  4LUB A;  1MPB A;  4YB6 A;  3DM0 A;  4NE4 A;  4NF6 B;  2NOO A;  3D4G A;  4H8I A;  5JEI A;  3VLU A;  4R74 A;  3FGS A;  2HZ8 A;  1OIB A;  4FOR A;  3THI A;  4F3S A;  3PGF A;  1IUD A;  1ZJL A;  2H99 A;  4ZS9 A;  4GQO A;  4GOT A;  3UN6 A;  4AQ4 A;  4ESX A;  5JK4 A;  3S9M C;  1SDX A;  2F5X A;  2I3V A;  3C36 A;  4YU0 A;  4R6Y A;  4RYA A;  4OWD A;  4LZ5 A;  3F11 A;  4PFW A;  4X48 A;  1POT A;  3O6H A;  4NTL A;  1UTB A;  1A99 A;  1II5 A;  2PT2 A;  4LAT A;  5I58 B;  4KYS A;  4MH5 A;  4QFL A;  1LAG E;  4YB5 A;  3O29 A;  4Q0C A;  2HCA A;  5EHM A;  3TEL A;  5I2K A;  2PYY A;  1JW4 A;  4GVO A;  1B32 A;  1SQY A;  2D3I A;  1UIV A;  3FAS A;  5KDT A;  1LFG A;  3N6U A;  4AB6 A;  1NNT A;  1I6Q A;  4OXV A;  4F3G A;  3TCH A;  2Q8J A;  3FVN A;  4H67 A;  4LP2 B;  4GF8 A;  2H25 A;  5BUU A;  2HAV A;  1I6B A;  4YKK A;  4F2O A;  3GBB A;  4KR5 A;  3SEY A;  3TOD A;  1MQJ A;  2DWJ A;  3FJG A;  3RY3 A;  1SBP A;  3R26 A;  4QSE A;  4DDD A;  3ILU B;  2E0S A;  3MAM A;  4EF1 A;  1QJM A;  1Y20 A;  1B1X A;  4PFY A;  2Y7R A;  3S2V A;  1AIV A;  3TUS A;  3FJM A;  4JBZ A;  1MY2 A;  2XXT A;  1DPP A;  1R9L A;  3CRB A;  4FIM A;  5I58 A;  1UTH A;  4JXI A;  4O3B A;  2Q9T A;  1DSN A;  2O84 X;  3IO6 A;  4ZZA A;  3M3L A;  3SKP A;  1MQH A;  4G8N A;  2I0B A;  4R75 A;  3HN0 A;  4N13 A;  1TFD A;  1IIW A;  2ESN A;  2I48 A;  4IY5 A;  3K1P A;  4Q30 B;  5ITO A;  3TTM A;  1B1H A;  4F39 A;  1EZP A;  2H98 A;  3LUY A;  4HS7 A;  4OZ9 A;  2PT1 A;  4ELQ A;  2ABH A;  2OWS A;  1ANF A;  2OCU A;  3SET A;  3IOT A;  2P0S A;  2FNC A;  3G3F A;  4P0G A;  2IA4 A;  5HPQ A;  4MLQ A;  3UOR A;  5B7D A;  1IZ1 A;  1PEB A;  1B5H A;  4RK2 A;  2VP1 A;  2P1S A;  1A7L A;  3SEV A;  1SD3 A;  4DE8 A;  4KCD A;  2R71 A;  2XXV A;  1CE2 A;  2THI A;  2RC7 A;  4ELP A;  1Y9U A;  3TPA A;  2ZYN A;  3G3I A;  5H8Q A;  4F2Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...