4CBEA

Crystal structure of complement factors h and fhl-1 binding protein bbh06 or crasp-2 from borrelia burgdorferi (native)
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
214
structure length
209
Chain Sequence
GRLNQRNINELKIFVEKAKYYSIKLDAIYNECTGAYNDIMTYSSDQSKVNQAISIFKKDNKIVNKFKELEKIIEEYKPMFLSKLIDDFAIELDQAVDNDSNARHVADSYKKLRKSVVLAYIESFDVISSKFVDSKFVEASKKFVNKAKEFVEENDLIALECIVKTIGDMVNDREINSRSRYNNFYKKEADFLGAAVELEGAYKAIKQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COMPLEMENT REGULATOR-ACQUIRING SURFACE PROTEIN 2 (CRASP-2)
publication title Structural Characterization of Cspz, a Complement Regulator Factor H and Fhl-1 Binding Protein from Borrelia Burgdorferi.
pubmed doi rcsb
source organism Borrelia burgdorferi
molecule tags Cell adhesion
total genus 92
structure length 209
sequence length 214
ec nomenclature
pdb deposition date 2013-10-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1640 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4cbeA00
4BG0A 4CBEA
chains in the Genus database with same CATH superfamily
2L6FA 2OKUA 3IHUA 1NG1A 1Q0GA 3NDBB 4MTGA 3L1MA 1SF8A 2NSFA 2YQYA 2MHRA 1LVKA 1QPUA 1T01A 1TFOB 3ABLC 3FAPB 4O79A 4KI2A 3C8GB 3BRJA 4YT4A 1WN0A 1T6UA 3EQLF 3ZQYA 1JRAA 5E3CA 5E2QA 3ZIBA 1OR2A 2XLDA 3JCUQ 3L0IA 1DOVA 2IXNA 3RIPA 5A6BA 4CJGA 2YRFA 4FX5A 3TQOA 1D0YA 1ZHXA 1G4WR 2YWAA 3O39A 3QZCA 4UDVA 3DD7A 1A41A 1ZU4A 3C8GD 2VCAA 4MTFA 3U5SA 2EPMX 4CSAA 4MW3A 3UGPA 2BE5F 3ASOC 3VAYA 4JCHA 3DWWA 3NMKA 3TOLA 1O3UA 1FMVA 4MVSA 4RD9A 4XPWA 2KYHA 4PFPA 1Q0MA 3EFOB 4LDRA 4DOZA 4E7SA 2R7TA 1Z5ZA 3KKBA 2XLMA 1E84A 2TMVP 4PACA 1J8MF 2M4EA 4YL1A 3EG9A 3TJ6A 1EI7A 2GFHA 2LP4A 2OQMA 4C7OB 1RJ9A 3F46A 4JTAB 2JPUA 4KC9A 2EPNA 2J0WA 1OCCC 2XLWA 2YLDA 4W8KA 3UNGC 1ZHWA 4J32B 4XEFA 2KK1A 3JRTA 5BQIA 1U0BB 4JIOA 2XSEA 2EILC 2FAPB 1KTMA 4AE4A 4HFKB 3L8IA 2QNLA 1QSPA 3Q7GA 4FESA 1OW6A 4BEJA 3ZQVA 2R7SA 2HFIA 1Z7Qc 4RDAA 2WZGA 2YEVA 3FAJA 3GEIA 2CW0F 3FOPA 3H65A 3B0PA 4H4KC 4JRZA 4MVZA 1GS9A 1RKEB 4E0HA 2DB4A 1D0ZA 4KNWA 3U9MA 1D1AA 4G7ZF 1VTMP 1R5ID 1VLSA 1OXBA 4JEBA 1EQ1A 1YARO 1C02A 2R7QA 2GAQA 1MMGA 1NSGB 1ORYA 1GM5A 5DQTA 1VYKA 5A6KA 1CPRA 1HW1A 1LI7A 1N1CA 4OIPF 5IY5C 4HFFB 1T9KA 2HV7A 2P61A 1O87A 1XZPA 3B71A 5BQGA 4DVYP 2RSEB 1BR1A 5L0DA 3MX3A 3DE9A 3NKDA 2B0HA 3EH1A 3OEOA 5COGA 4MVRA 5AC4A 3TULA 2OJED 1RCPA 3K33A 1E85A 2AP3A 5D91A 3W8HA 1ORSC 4O6NA 4B6IA 1S7ZA 5A6JA 1BR4A 3KPHA 1V55C 1PV3A 1R4TA 2PP4A 5HSWA 1FMWA 1ZHZA 4U5DE 4OINF 1SYQA 1YYXA 2Y3GA 4XLNF 4U5CE 3S29A 1ZYRF 4Q7CA 3TK0A 2EPOA 3U8PA 3E70C 3T6JA 5F5FA 5A6AA 3DKAA 1YA7O 3L8JA 3ZC4A 2XS1A 3NYLA 4CJOA 2L81A 1Y6DA 1RJ9B 1FAPB 2HMQA 3L34A 4ONSA 3S27A 4D4NA 1L3PA 2WZFA 3QMKA 1MMDA 3R2PA 3U2MA 4EBJA 5HV9A 3IQCA 1JPNA 2OU6A 3NMJA 2Q3TA 2OJQA 5DS4A 3UMIA 2JX0A 3ECSA 2UUIA 2LFDA 2QLAA 3I5QA 2YL0A 5AGFA 3EFOA 3GM3A 4EBKA 1JAFA 3CZ6A 4YL3A 2PX3A 3GWNA 1YVIA 3JSZA 5GPGB 3GEEA 2CGEA 4OD4A 1PCXA 1EA8A 4EKWA 1OKKD 256BA 2LQGA 4DBQA 2IXMA 4C7OA 1MMNA 3JYHA 4MNDA 3ZG1A 2IOQA 3CQZA 2KQ9A 3LNMB 4YWQA 4NTFA 3LUTB 3UGOA 4DRJB 3QVZA 5CI8A 4N6HA 4O6MA 1V74B 3PCVA 4PJJA 1OR3A 1H9TA 2R25A 4WGYA 2WL8A 2WVOA 1HY5A 1Z6AA 4JURI 3US6A 4Q4ZF 1TWHA 1MNEA 2PNOA 3DE8A 3RW0A 4E7ZA 5L0HA 3LLIA 5JUAA 4Z9HA 3EJNA 1RKEA 1BZ4A 2EPKX 2ZD9A 3AQCA 3CSKA 3DAFA 5KYXB 2R02A 4K0DA 1ST6A 1UFBA 2R7RA 2DI3A 1LIHA 2QTVA 2KJGA 1G4US 3RFYA 1VMAA 2PBEA 3KH2A 3WODF 4YT2A 2HKVA 2HS5A 2L6HA 3GEHA 5E33A 3V7OA 4C3DA 2A6EF 2G62A 5JLIA 4AK9A 2EIJC 4C3EA 3H2VA 2H7BA 1J8YF 3V5XA 4GEHA 4EBBA 1GQAA 1JPJA 2LSEA 3VYWA 2HV6A 5CIVA 4I1MA 2YL1A 4JTCB 4A2NB 1AEPA 1L7CA 4U5EE 1PD1A 4F4BA 4A4AA 2Q9AA 2YL7A 1C03A 4R32A 1KNYA 2NSGA 3LS1A 3N2ZB 5D92A 4U9EA 2XL6A 2LK4A 4WGZA 4K1OA 2AVKA 5AC5A 3KYIA 4FAPB 1WWPA 4IJJA 4EIYA 2G3KA 4E0IA 1E83A 2R9RB 4X0RA 4OIRF 1H9GA 2KNHA 4G78A 3VF0A 3X1OA 2VCCA 2ZXOA 3OA1A 4GQHA 2CDQA 3SP1A 4JTDB 2PX0A 2V3CC 1JOGA 3HTKC 2A0UA 1CGOA 2NUPB 1V54C 5EHHA 1DOWA 4YT5A 3MYIA 4NY3A 5DS5A 4IB4A 1D0XA 4XQ1A 2HUJA 1HMOA 2HJMA 4YN0B 2UUHA 5DS6A 2PF4E 1LKXA 4PJLA 3ZTMA 2EIKC 5K0IA 4JEAA 5B3SC 2J45A 2BC5A 2Z15A 2HSQA 2ICWG 4CDVA 1OKKA 3T9OA 3S84A 1FFHA 3NYJA 2I15A 1K04A 2XLOA 3B29A 2AU5A 3M4CA 4J7TA 4N4WA 2GDCA 3C8ZA 2DYSC 2NPUA 4P9FA 5JT4A 1M57C 2VASA 4U5BE 3M4BA 2A6HF 1LE4A 1AVOB 3J06A 1A7VA 2WZLA 4NTAA 3LAYA 2FGYA 5KYWB 3ITFA 1CGME 1K40A 4YJWA 2IBFA 1CPQA 3KMIA 1LS4A 1ZHTA 3DZAA 2IXPA 3ZTZA 1Y4CA 2H8AA 2ZXPA 2X51A 3GM1A 4WJ0A 3SNHA 1S05A 1ZVZA 3SEOA 3AGTA 3KL4A 5EGYA 2XL4A 1MMAA 2P1AA 2WVNA 2AWYA 1RKCA 3JYYA 4IWBA 5DQZA 3T4RA 4H54A 1LS1A 1VB5A 3U2LA 5KYYA 4CIPA 1SR2A 4YK5A 5KYXA 4XEKA 3W2VA 4DRIB 4XTKA 3C62A 2YHSA 4AL1A 3G4ZA 2JD3A 2MWQA 3U9JA 4G7OF 2CCYA 3GWLA 2IM8A 1JR8A 4U5FE 4DRHB 4NCQA 2XXAA 1LI5A 2J8WA 4JCZA 4M63A 3GANA 3SYNA 2PFDA 5F28E 4C3BA 3HKKA 4Z9JA 2OG2A 2J9UA 1VLTA 2Y3HA 3AOUA 2HZ8A 2XM0A 1VOMA 2J9WA 3E9VA 4JC7A 4L6RA 2R7UA 3C18A 3EZIA 3KYJA 1YDIA 1OW7A 1FFTC 2Q7RA 3FXHA 5E3AA 3U3FA 2CYDA 3AG3C 5FZTA 1BBHA 2QY9A 3Q6MA 4DVZA 3K66A 4U5HA 4ULVA 3K6BA 3JSEO 3DXJF 4EHPA 1FTSA 5TJ5E 3MFNA 3S90A 5JSLA 4BJ6C 3OWTA 2P6VA 3JRMO 2P7VA 1FNTc 5L0JA 3SXYA 2C03A 1OCZC 2MYSA 2NUPA 3X2QC 2QUPA 1G5ZA 2D5RB 4JW1A 3RQEA 3IQ6A 2NUTB 1QLEC 1QVXA 1TWAA 2C04A 4BJ5C 4ULWA 3QTHA 1M2VB 4YT8A 1TWGA 1A7DA 1I4ZA 2E87A 3G4XA 1IW7F 2Q4FA 4BJ1A 1YZCA 2R05A 3AG2C 1BDJB 1I4YA 3S0XA 2WVQA 5T3WA 2W9YA 3A11A 1U89A 1NU9C 3EH2A 1Z63A 3QW0A 4EUKB 2B0JA 4PJNA 1H6GA 3MYFA 3WG7C 2I8BA 4MVMA 4MVUA 3C7JA 3UR3C 5KYYB 2J7PA 1FR0A 2OOCA 4ANJA 2CNWD 3I4UA 1M2OA 3DM5A 3M79A 1Z3IX 2OEXA 2XS8A 1SZIA 1B68A 1TQGA 1ZHYA 3EZHA 1TKNA 1QQ3A 3EGDB 4IARA 1OCRC 1NZEA 3S9OA 1QKRA 2H7VC 2RD9A 1TFKB 4XPXA 3U8VA 4CS9C 1RMVA 4XPYA 5DLJA 3O6XA 1JMWA 2R7VA 3SXZA 1ZW2A 2Y3DA 4O6YA 4I1OB 5JRAA 1K05A 2P0NA 3B9QA 3FHDA 4MTOA 2LFFA 4XEVA 3DM9B 2W45A 2DYRC 4K7BA 3VRCA 3LS0A 5BQHA 2YVKA 2YLGA 3AQBA 1OCOC 1H7IA 5COFA 2EPLX 3DJUB 2R7WA 2KSFA 3ZSUA 4LERA 2HMZA 4BJ6A 4CDAA 1XZQA 2L7AA 1W2WA 4PK4A 3LEOA 1NU7D 2GA0A 1YLMA 5DVWA 5L3QA 2M64A 1KU2A 1O5HA 1WOLA 1HE9A 2KC3A 4JE9A 1C17M 4DBRA 3HNJA 4CIHA 2XL8A 1LM3B 3JZ0A 4BJ5A 3B0UX 1U6HA 2EINC 5KYUB 1T5OA 1TR2A 3K7DA 4PR9A 5COMA 1WASA 3RH3A 1NFNA 2KGOA 3G50A 2J0XA 1LPEA 3IQ5A 2YKZA 1YA9A 2Y3BA 4JJGA 3WAQA 3HNLA 1Q0KA 1NBBA 3AGUA 4E17A 2R7XA 1M56C 2YL3A 4KNVA 4XLPF 2ZXWC 3EGXB 5L0CA 3VM6A 5KYWA 4LLEA 4CS8C 4IAQA 3EHNA 2Q9BA 1Q0FA 3W2WA 3ASNC 3IPMO 3EHMA 4AL0A 1YAUO 3NG1A 2HSBA 5T3TA 3SXMA 2OCCC 2G3VA 3EPVA 2NUTA 3UMHA 4LLCA 5A69A 2ASRA 3LLKA 2FFHA 2XLHA 1M2VA 4N6CA 5JS5A 5KYNA 3F47A 1HE1A 2NG1A 3FVYA 3LESA 1PD0A 4D4XA 5B1BC 1IZMA 2CNWA 3GM2A 3Q6NA 2GWWA 4U9DA 4AX2A 4CS9A 1V4AA 1M6TA 2L6GA 3BEHA 3DAGA 3FMSA 3QW1A 2J7PD 2D4UA 3K1IC 5L3VA 2VB6A 3U0CA 2LIGA 4QDLA 3RKOF 4N06A 3K1HA 4G7HF 1LE2A 3V5ZA 5EK0A 2X0CA 5F5HA 4MVOA 4XWJA 3B0VC 4NC3A 1T6IA 1WGWA 4BEMJ 1WATA 3T6GB 2J46A 4I3MA 2A1DD 4W8PA 3TOMA 3H2UA 5JVEA 4QI2A 1NLXA 2XLEA 2H7OA 4FWVA 1GGQA 3M15A 4J7YA 1ZZPA 3HJCA 1APCA 2KW3C 2DGJA 2Q00A 3A9CA 3DJNB 3EGDA 2HJ3A 4MS2A 1G8XA 2XLVA 3NMIA 3RQGA 4HEAJ 4BJTA 1CGNA 1UG7A 3LNRA 4BPMA 1E86A 1MNDA 2EIMC 4JJFA 3R7CA 2IYLD 5JP7A 1OQCA 4CX9A 4NTBA 3MBGA 4J30B 3LJBA 3O10A 3RVYA 2W4MA 1BR2A 2VC9A 2ZPAA 3JTLO 4P6IC 1OW8A 3DI5A 2AWCA 2LD6A 1A7EA 2WB7A 3AG4C 2ZXRA 4RBNA 3U3BA 3N0TA 3QVYA 4G0HA 3O55A 2L9JA 3NKEA 4MVQA 3RF3A 2F22A 3W4YA 4IGGA 3HNIA 4LDQA 3LEVA 4NQFA 4CS8A 4DXWA 5T1DB 4CDYA 4ZLCA 3MLGA 2LCHA 1HMDA 1A0BA 3FOOA 3GODA 3T6BA 3NRHA 2XXAB 1NFOA 3SXKA 4OD5A 3POVA 3I5PA 3AJMA 3N24A 4GYTA 4MQ9F 1VYIA 3NYMA 1SMYF 1ORJA 3C8GA 3ZVRA 5A6BD 1WTYA 1F1MA 3HLZA 4PJMA 3HNKA 5KYUA 5B3IA 1I5NA 3RYLA 4MW8A 2QE9A 4OIQF 4YL0A 3PDMP 3EG9B 1D1BA 4CBEA 3C63A 2Y69C 3Q7LA 4DJ9A 3K1IA 2Q9CA 1YJGA 3CAXA 5L0GA 5L0IA 5B1AC 5CI9A 3EGXA 1Z23A 1E2XA 1T6QA 3AG1C 2Y39A 4JVSA 4O7GA 4PFOA 3S28A 3UMKA 4AE4B 4OIOF 2R03A 1TWCA 4IAOA 4P9TA 5FCLA 4CSAC 3ABMC 3IQTA 3JT1A 2A0BA 5BUOA 1D1CA 4E18A 3SZRA 1RXQA 2ETSA 1XWJA 2BL2A 2YLIA 2R7OA 2YZSA 3PHF2 4QI0A 3M1CB 2IXOA 3WHNA 4CS7A 1YZAA 1QZXA 2J9BA 2O9XA 3ZDLA 4EWCA 1EKYA 2J9VA 2VCBA 4ZLDA 3DMDA 2XRHA 4JZAA 4I44A 1ZW3A 3PMRA 1VK5A 4WABA 3TD7A 4IRUA 3V5YA 4LACB 3RVZA 3W8IA 1YYJA 2OEVA 1MQVA 3CEXA 3RQFA 1AUEA 3ZWIA 3ABKC 3GORA 4ER9A 2W4BA 4JKVA 2XM4A 3FDQA 4HE8D 2V26A 4LDKA 1ZU5A 2A68F 3IEEA 4Q5SF 5L0FA 4KBLA 2A69F 1OXKA 3ATPA 4U5GA 4Z9IA 4BG0A 1Q0DA 1HW2A 2VH3A 3TJ5A
chains in the Genus database with same CATH topology
1NG1A 3NDBB 1SF8A 1LVKA 3ABLC 4O79A 4YT4A 3EQLF 5E3CA 5E2QA 3ZIBA 3JCUQ 3L0IA 2IXNA 3RIPA 4FX5A 1D0YA 1ZHXA 3O39A 3QZCA 2XXAA 3DD7A 1ZU4A 4CSAA 3UGPA 2BE5F 3ASOC 3VAYA 4JCHA 1FMVA 4RD9A 2R7TA 4PFPA 3EFOB 4DOZA 4E7SA 1Z5ZA 3KKBA 1J8MF 2M4EA 3EG9A 2GFHA 4C7OB 1RJ9A 3F46A 4KC9A 2J0WA 4W8KA 1OCCC 3UNGC 1ZHWA 4J32B 3JRTA 2XSEA 2EILC 4AE4A 4HFKB 3Q7GA 4FESA 4BEJA 2R7SA 4RDAA 2WZGA 2YEVA 3FAJA 2CW0F 3H65A 4H4KC 3B0PA 1D0ZA 4KNWA 1D1AA 4G7ZF 2R7QA 1MMGA 5DQTA 1VYKA 1N1CA 4OIPF 5IY5C 4HFFB 2HV7A 1O87A 4DVYP 1BR1A 3MX3A 3NKDA 3EH1A 3OEOA 3K33A 5D91A 3W8HA 4O6NA 4B6IA 1S7ZA 1BR4A 1V55C 2PP4A 5HSWA 1FMWA 1ZHZA 4U5DE 4OINF 4XLNF 2Y3GA 4U5CE 3S29A 1ZYRF 4Q7CA 3E70C 3T6JA 5F5FA 3ZC4A 3NYLA 2L81A 3L34A 1RJ9B 3S27A 2WZFA 3QMKA 1MMDA 1JPNA 2Q3TA 5DS4A 3UMIA 3ECSA 3I5QA 3EFOA 3CZ6A 2PX3A 3JSZA 2CGEA 4OD4A 1PCXA 1OKKD 4DBQA 2IXMA 4C7OA 1MMNA 3JYHA 4MNDA 3ZG1A 2IOQA 3CQZA 2KQ9A 4YWQA 3UGOA 5CI8A 4O6MA 4PJJA 2WL8A 2WVOA 1Z6AA 4JURI 4Q4ZF 1TWHA 1MNEA 4E7ZA 3LLIA 3EJNA 3CSKA 3AQCA 3DAFA 5KYXB 2R7RA 4K0DA 1ST6A 2QTVA 3RFYA 2KJGA 1VMAA 3KH2A 3WODF 4YT2A 5E33A 3V7OA 4C3DA 2A6EF 2G62A 4AK9A 2EIJC 4C3EA 2H7BA 1J8YF 4GEHA 4EBBA 1JPJA 2LSEA 3VYWA 2HV6A 4I1MA 4A2NB 4U5EE 1PD1A 2Q9AA 4F4BA 3X2QC 3LS1A 3N2ZB 5D92A 4IJJA 2G3KA 4X0RA 4OIRF 2KNHA 3X1OA 2ZXOA 3OA1A 2CDQA 3SP1A 2PX0A 2V3CC 3HTKC 2NUPB 1V54C 5EHHA 4YT5A 4NY3A 5DS5A 1D0XA 4YN0B 5DS6A 2PF4E 1LKXA 4PJLA 2EIKC 5B3SC 2J45A 2Z15A 1OKKA 1FFHA 3NYJA 2DYSC 1M57C 2VASA 4U5BE 2A6HF 2WZLA 3LAYA 2FGYA 5KYWB 3ITFA 4YJWA 3KMIA 1ZHTA 3DZAA 2IXPA 2ZXPA 2X51A 4WJ0A 3SNHA 3SEOA 3KL4A 5EGYA 2XL4A 1MMAA 2WVNA 5DQZA 4IWBA 5KYYA 3T4RA 1LS1A 5KYXA 3W2VA 4XTKA 2YHSA 2MWQA 2JD3A 4U5FE 4M63A 3GANA 3SYNA 2PFDA 4C3BA 2OG2A 2J9UA 2Y3HA 3E9VA 2R7UA 1VOMA 2J9WA 3EZIA 1FFTC 5E3AA 3AG3C 2QY9A 3Q6MA 4DVZA 3K66A 4U5HA 3K6BA 3DXJF 1FTSA 4BJ6C 3OWTA 2P6VA 2P7VA 2C03A 1OCZC 2MYSA 2NUPA 2D5RB 4JW1A 2NUTB 1QLEC 1TWAA 2C04A 4BJ5C 4ULWA 4YT8A 1M2VB 1TWGA 2E87A 1IW7F 4BJ1A 3AG2C 3S0XA 2WVQA 5T3WA 2W9YA 1NU9C 3EH2A 1Z63A 2B0JA 4PJNA 3WG7C 2I8BA 3UR3C 5KYYB 2J7PA 4ANJA 2CNWD 3I4UA 1M2OA 3DM5A 5KYWA 1Z3IX 1SZIA 1ZHYA 3EZHA 1TKNA 3EGDB 1OCRC 1NZEA 2H7VC 4CS9C 5DLJA 3O6XA 2R7VA 2Y3DA 4O6YA 4I1OB 3B9QA 3FHDA 4G7OF 3DM9B 2W45A 2DYRC 4K7BA 3LS0A 3AQBA 1OCOC 3DJUB 2R7WA 3ZSUA 4LERA 4BJ6A 1W2WA 4PK4A 1NU7D 5L3QA 5DVWA 1KU2A 1O5HA 4DBRA 4CIHA 4BJ5A 3B0UX 2EINC 5KYUB 1TR2A 3K7DA 3RH3A 2KGOA 2J0XA 2Y3BA 4JJGA 2R7XA 1M56C 4KNVA 4XLPF 2ZXWC 3EGXB 4LLEA 4CS8C 3EHNA 2Q9BA 3W2WA 3ASNC 3EHMA 3NG1A 5T3TA 2OCCC 2G3VA 3EPVA 2NUTA 3UMHA 4LLCA 3LLKA 2FFHA 1M2VA 5KYNA 3F47A 3FVYA 2NG1A 3LESA 1PD0A 5B1BC 1IZMA 2CNWA 3Q6NA 4CS9A 4AX2A 3DAGA 2J7PD 3K1IC 5L3VA 2VB6A 4QDLA 3RKOF 4N06A 3K1HA 4G7HF 5F5HA 4XWJA 3B0VC 1WGWA 2J46A 4I3MA 2A1DD 4QI2A 2H7OA 4FWVA 3HJCA 2KW3C 2DGJA 3DJNB 3EGDA 1G8XA 4HEAJ 4BJTA 3LNRA 1MNDA 2EIMC 4JJFA 2IYLD 4J30B 3LJBA 2W4MA 1BR2A 4P6IC 2ZPAA 3AG4C 2WB7A 4RBNA 2ZXRA 3N0TA 4G0HA 2L9JA 3NKEA 3LEVA 4CS8A 5T1DB 4ZLCA 3MLGA 2XXAB 3T6BA 3GODA 3NRHA 3POVA 4OD5A 3I5PA 3N24A 4GYTA 4MQ9F 1VYIA 3NYMA 1SMYF 3ZVRA 3HLZA 4PJMA 5KYUA 3RYLA 4OIQF 3EG9B 1D1BA 4CBEA 2Y69C 3Q7LA 2Q9CA 5B1AC 5CI9A 3EGXA 1Z23A 3AG1C 4O7GA 4PFOA 2Y39A 4JVSA 3S28A 3UMKA 4KI2A 4AE4B 4OIOF 1TWCA 4IAOA 5FCLA 4CSAC 3ABMC 3JT1A 5BUOA 1D1CA 3SZRA 2YZSA 2R7OA 3PHF2 3M1CB 2IXOA 4CS7A 1QZXA 2O9XA 4EWCA 2J9VA 4ZLDA 3DMDA 2XRHA 4JZAA 4I44A 3PMRA 1VK5A 3TD7A 4IRUA 4LACB 3W8IA 3ABKC 2W4BA 3FDQA 4HE8D 2V26A 4Q5SF 1ZU5A 2A68F 3IEEA 4KBLA 2A69F 4U5GA 4BG0A 4QI0A 2VH3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BG0 A;  4CBE A; 
#chains in the Genus database with same CATH topology
 2L6F A;  2OKU A;  3IHU A;  1NG1 A;  1Q0G A;  3NDB B;  4MTG A;  3L1M A;  1SF8 A;  2NSF A;  2YQY A;  2MHR A;  1LVK A;  1QPU A;  1T01 A;  1TFO B;  3ABL C;  3FAP B;  4O79 A;  4KI2 A;  3C8G B;  3BRJ A;  4YT4 A;  1WN0 A;  1T6U A;  3EQL F;  3ZQY A;  1JRA A;  5E3C A;  5E2Q A;  3ZIB A;  1OR2 A;  2XLD A;  3JCU Q;  3L0I A;  1DOV A;  2IXN A;  3RIP A;  5A6B A;  4CJG A;  2YRF A;  4FX5 A;  3TQO A;  1D0Y A;  1ZHX A;  1G4W R;  2YWA A;  3O39 A;  3QZC A;  4UDV A;  3DD7 A;  1A41 A;  1ZU4 A;  3C8G D;  2VCA A;  4MTF A;  3U5S A;  2EPM X;  4CSA A;  4MW3 A;  3UGP A;  2BE5 F;  3ASO C;  3VAY A;  4JCH A;  3DWW A;  3NMK A;  3TOL A;  1O3U A;  1FMV A;  4MVS A;  4RD9 A;  4XPW A;  2KYH A;  4PFP A;  1Q0M A;  3EFO B;  4LDR A;  4DOZ A;  4E7S A;  2R7T A;  1Z5Z A;  3KKB A;  2XLM A;  1E84 A;  2TMV P;  4PAC A;  1J8M F;  2M4E A;  4YL1 A;  3EG9 A;  3TJ6 A;  1EI7 A;  2GFH A;  2LP4 A;  2OQM A;  4C7O B;  1RJ9 A;  3F46 A;  4JTA B;  2JPU A;  4KC9 A;  2EPN A;  2J0W A;  1OCC C;  2XLW A;  2YLD A;  4W8K A;  3UNG C;  1ZHW A;  4J32 B;  4XEF A;  2KK1 A;  3JRT A;  5BQI A;  1U0B B;  4JIO A;  2XSE A;  2EIL C;  2FAP B;  1KTM A;  4AE4 A;  4HFK B;  3L8I A;  2QNL A;  1QSP A;  3Q7G A;  4FES A;  1OW6 A;  4BEJ A;  3ZQV A;  2R7S A;  2HFI A;  1Z7Q c;  4RDA A;  2WZG A;  2YEV A;  3FAJ A;  3GEI A;  2CW0 F;  3FOP A;  3H65 A;  3B0P A;  4H4K C;  4JRZ A;  4MVZ A;  1GS9 A;  1RKE B;  4E0H A;  2DB4 A;  1D0Z A;  4KNW A;  3U9M A;  1D1A A;  4G7Z F;  1VTM P;  1R5I D;  1VLS A;  1OXB A;  4JEB A;  1EQ1 A;  1YAR O;  1C02 A;  2R7Q A;  2GAQ A;  1MMG A;  1NSG B;  1ORY A;  1GM5 A;  5DQT A;  1VYK A;  5A6K A;  1CPR A;  1HW1 A;  1LI7 A;  1N1C A;  4OIP F;  5IY5 C;  4HFF B;  1T9K A;  2HV7 A;  2P61 A;  1O87 A;  1XZP A;  3B71 A;  5BQG A;  4DVY P;  2RSE B;  1BR1 A;  5L0D A;  3MX3 A;  3DE9 A;  3NKD A;  2B0H A;  3EH1 A;  3OEO A;  5COG A;  4MVR A;  5AC4 A;  3TUL A;  2OJE D;  1RCP A;  3K33 A;  1E85 A;  2AP3 A;  5D91 A;  3W8H A;  1ORS C;  4O6N A;  4B6I A;  1S7Z A;  5A6J A;  1BR4 A;  3KPH A;  1V55 C;  1PV3 A;  1R4T A;  2PP4 A;  5HSW A;  1FMW A;  1ZHZ A;  4U5D E;  4OIN F;  1SYQ A;  1YYX A;  2Y3G A;  4XLN F;  4U5C E;  3S29 A;  1ZYR F;  4Q7C A;  3TK0 A;  2EPO A;  3U8P A;  3E70 C;  3T6J A;  5F5F A;  5A6A A;  3DKA A;  1YA7 O;  3L8J A;  3ZC4 A;  2XS1 A;  3NYL A;  4CJO A;  2L81 A;  1Y6D A;  1RJ9 B;  1FAP B;  2HMQ A;  3L34 A;  4ONS A;  3S27 A;  4D4N A;  1L3P A;  2WZF A;  3QMK A;  1MMD A;  3R2P A;  3U2M A;  4EBJ A;  5HV9 A;  3IQC A;  1JPN A;  2OU6 A;  3NMJ A;  2Q3T A;  2OJQ A;  5DS4 A;  3UMI A;  2JX0 A;  3ECS A;  2UUI A;  2LFD A;  2QLA A;  3I5Q A;  2YL0 A;  5AGF A;  3EFO A;  3GM3 A;  4EBK A;  1JAF A;  3CZ6 A;  4YL3 A;  2PX3 A;  3GWN A;  1YVI A;  3JSZ A;  5GPG B;  3GEE A;  2CGE A;  4OD4 A;  1PCX A;  1EA8 A;  4EKW A;  1OKK D;  256B A;  2LQG A;  4DBQ A;  2IXM A;  4C7O A;  1MMN A;  3JYH A;  4MND A;  3ZG1 A;  2IOQ A;  3CQZ A;  2KQ9 A;  3LNM B;  4YWQ A;  4NTF A;  3LUT B;  3UGO A;  4DRJ B;  3QVZ A;  5CI8 A;  4N6H A;  4O6M A;  1V74 B;  3PCV A;  4PJJ A;  1OR3 A;  1H9T A;  2R25 A;  4WGY A;  2WL8 A;  2WVO A;  1HY5 A;  1Z6A A;  4JUR I;  3US6 A;  4Q4Z F;  1TWH A;  1MNE A;  2PNO A;  3DE8 A;  3RW0 A;  4E7Z A;  5L0H A;  3LLI A;  5JUA A;  4Z9H A;  3EJN A;  1RKE A;  1BZ4 A;  2EPK X;  2ZD9 A;  3AQC A;  3CSK A;  3DAF A;  5KYX B;  2R02 A;  4K0D A;  1ST6 A;  1UFB A;  2R7R A;  2DI3 A;  1LIH A;  2QTV A;  2KJG A;  1G4U S;  3RFY A;  1VMA A;  2PBE A;  3KH2 A;  3WOD F;  4YT2 A;  2HKV A;  2HS5 A;  2L6H A;  3GEH A;  5E33 A;  3V7O A;  4C3D A;  2A6E F;  2G62 A;  5JLI A;  4AK9 A;  2EIJ C;  4C3E A;  3H2V A;  2H7B A;  1J8Y F;  3V5X A;  4GEH A;  4EBB A;  1GQA A;  1JPJ A;  2LSE A;  3VYW A;  2HV6 A;  5CIV A;  4I1M A;  2YL1 A;  4JTC B;  4A2N B;  1AEP A;  1L7C A;  4U5E E;  1PD1 A;  4F4B A;  4A4A A;  2Q9A A;  2YL7 A;  1C03 A;  4R32 A;  1KNY A;  2NSG A;  3LS1 A;  3N2Z B;  5D92 A;  4U9E A;  2XL6 A;  2LK4 A;  4WGZ A;  4K1O A;  2AVK A;  5AC5 A;  3KYI A;  4FAP B;  1WWP A;  4IJJ A;  4EIY A;  2G3K A;  4E0I A;  1E83 A;  2R9R B;  4X0R A;  4OIR F;  1H9G A;  2KNH A;  4G78 A;  3VF0 A;  3X1O A;  2VCC A;  2ZXO A;  3OA1 A;  4GQH A;  2CDQ A;  3SP1 A;  4JTD B;  2PX0 A;  2V3C C;  1JOG A;  3HTK C;  2A0U A;  1CGO A;  2NUP B;  1V54 C;  5EHH A;  1DOW A;  4YT5 A;  3MYI A;  4NY3 A;  5DS5 A;  4IB4 A;  1D0X A;  4XQ1 A;  2HUJ A;  1HMO A;  2HJM A;  4YN0 B;  2UUH A;  5DS6 A;  2PF4 E;  1LKX A;  4PJL A;  3ZTM A;  2EIK C;  5K0I A;  4JEA A;  5B3S C;  2J45 A;  2BC5 A;  2Z15 A;  2HSQ A;  2ICW G;  4CDV A;  1OKK A;  3T9O A;  3S84 A;  1FFH A;  3NYJ A;  2I15 A;  1K04 A;  2XLO A;  3B29 A;  2AU5 A;  3M4C A;  4J7T A;  4N4W A;  2GDC A;  3C8Z A;  2DYS C;  2NPU A;  4P9F A;  5JT4 A;  1M57 C;  2VAS A;  4U5B E;  3M4B A;  2A6H F;  1LE4 A;  1AVO B;  3J06 A;  1A7V A;  2WZL A;  4NTA A;  3LAY A;  2FGY A;  5KYW B;  3ITF A;  1CGM E;  1K40 A;  4YJW A;  2IBF A;  1CPQ A;  3KMI A;  1LS4 A;  1ZHT A;  3DZA A;  2IXP A;  3ZTZ A;  1Y4C A;  2H8A A;  2ZXP A;  2X51 A;  3GM1 A;  4WJ0 A;  3SNH A;  1S05 A;  1ZVZ A;  3SEO A;  3AGT A;  3KL4 A;  5EGY A;  2XL4 A;  1MMA A;  2P1A A;  2WVN A;  2AWY A;  1RKC A;  3JYY A;  4IWB A;  5DQZ A;  3T4R A;  4H54 A;  1LS1 A;  1VB5 A;  3U2L A;  5KYY A;  4CIP A;  1SR2 A;  4YK5 A;  5KYX A;  4XEK A;  3W2V A;  4DRI B;  4XTK A;  3C62 A;  2YHS A;  4AL1 A;  3G4Z A;  2JD3 A;  2MWQ A;  3U9J A;  4G7O F;  2CCY A;  3GWL A;  2IM8 A;  1JR8 A;  4U5F E;  4DRH B;  4NCQ A;  2XXA A;  1LI5 A;  2J8W A;  4JCZ A;  4M63 A;  3GAN A;  3SYN A;  2PFD A;  5F28 E;  4C3B A;  3HKK A;  4Z9J A;  2OG2 A;  2J9U A;  1VLT A;  2Y3H A;  3AOU A;  2HZ8 A;  2XM0 A;  1VOM A;  2J9W A;  3E9V A;  4JC7 A;  4L6R A;  2R7U A;  3C18 A;  3EZI A;  3KYJ A;  1YDI A;  1OW7 A;  1FFT C;  2Q7R A;  3FXH A;  5E3A A;  3U3F A;  2CYD A;  3AG3 C;  5FZT A;  1BBH A;  2QY9 A;  3Q6M A;  4DVZ A;  3K66 A;  4U5H A;  4ULV A;  3K6B A;  3JSE O;  3DXJ F;  4EHP A;  1FTS A;  5TJ5 E;  3MFN A;  3S90 A;  5JSL A;  4BJ6 C;  3OWT A;  2P6V A;  3JRM O;  2P7V A;  1FNT c;  5L0J A;  3SXY A;  2C03 A;  1OCZ C;  2MYS A;  2NUP A;  3X2Q C;  2QUP A;  1G5Z A;  2D5R B;  4JW1 A;  3RQE A;  3IQ6 A;  2NUT B;  1QLE C;  1QVX A;  1TWA A;  2C04 A;  4BJ5 C;  4ULW A;  3QTH A;  1M2V B;  4YT8 A;  1TWG A;  1A7D A;  1I4Z A;  2E87 A;  3G4X A;  1IW7 F;  2Q4F A;  4BJ1 A;  1YZC A;  2R05 A;  3AG2 C;  1BDJ B;  1I4Y A;  3S0X A;  2WVQ A;  5T3W A;  2W9Y A;  3A11 A;  1U89 A;  1NU9 C;  3EH2 A;  1Z63 A;  3QW0 A;  4EUK B;  2B0J A;  4PJN A;  1H6G A;  3MYF A;  3WG7 C;  2I8B A;  4MVM A;  4MVU A;  3C7J A;  3UR3 C;  5KYY B;  2J7P A;  1FR0 A;  2OOC A;  4ANJ A;  2CNW D;  3I4U A;  1M2O A;  3DM5 A;  3M79 A;  1Z3I X;  2OEX A;  2XS8 A;  1SZI A;  1B68 A;  1TQG A;  1ZHY A;  3EZH A;  1TKN A;  1QQ3 A;  3EGD B;  4IAR A;  1OCR C;  1NZE A;  3S9O A;  1QKR A;  2H7V C;  2RD9 A;  1TFK B;  4XPX A;  3U8V A;  4CS9 C;  1RMV A;  4XPY A;  5DLJ A;  3O6X A;  1JMW A;  2R7V A;  3SXZ A;  1ZW2 A;  2Y3D A;  4O6Y A;  4I1O B;  5JRA A;  1K05 A;  2P0N A;  3B9Q A;  3FHD A;  4MTO A;  2LFF A;  4XEV A;  3DM9 B;  2W45 A;  2DYR C;  4K7B A;  3VRC A;  3LS0 A;  5BQH A;  2YVK A;  2YLG A;  3AQB A;  1OCO C;  1H7I A;  5COF A;  2EPL X;  3DJU B;  2R7W A;  2KSF A;  3ZSU A;  4LER A;  2HMZ A;  4BJ6 A;  4CDA A;  1XZQ A;  2L7A A;  1W2W A;  4PK4 A;  3LEO A;  1NU7 D;  2GA0 A;  1YLM A;  5DVW A;  5L3Q A;  2M64 A;  1KU2 A;  1O5H A;  1WOL A;  1HE9 A;  2KC3 A;  4JE9 A;  1C17 M;  4DBR A;  3HNJ A;  4CIH A;  2XL8 A;  1LM3 B;  3JZ0 A;  4BJ5 A;  3B0U X;  1U6H A;  2EIN C;  5KYU B;  1T5O A;  1TR2 A;  3K7D A;  4PR9 A;  5COM A;  1WAS A;  3RH3 A;  1NFN A;  2KGO A;  3G50 A;  2J0X A;  1LPE A;  3IQ5 A;  2YKZ A;  1YA9 A;  2Y3B A;  4JJG A;  3WAQ A;  3HNL A;  1Q0K A;  1NBB A;  3AGU A;  4E17 A;  2R7X A;  1M56 C;  2YL3 A;  4KNV A;  4XLP F;  2ZXW C;  3EGX B;  5L0C A;  3VM6 A;  5KYW A;  4LLE A;  4CS8 C;  4IAQ A;  3EHN A;  2Q9B A;  1Q0F A;  3W2W A;  3ASN C;  3IPM O;  3EHM A;  4AL0 A;  1YAU O;  3NG1 A;  2HSB A;  5T3T A;  3SXM A;  2OCC C;  2G3V A;  3EPV A;  2NUT A;  3UMH A;  4LLC A;  5A69 A;  2ASR A;  3LLK A;  2FFH A;  2XLH A;  1M2V A;  4N6C A;  5JS5 A;  5KYN A;  3F47 A;  1HE1 A;  2NG1 A;  3FVY A;  3LES A;  1PD0 A;  4D4X A;  5B1B C;  1IZM A;  2CNW A;  3GM2 A;  3Q6N A;  2GWW A;  4U9D A;  4AX2 A;  4CS9 A;  1V4A A;  1M6T A;  2L6G A;  3BEH A;  3DAG A;  3FMS A;  3QW1 A;  2J7P D;  2D4U A;  3K1I C;  5L3V A;  2VB6 A;  3U0C A;  2LIG A;  4QDL A;  3RKO F;  4N06 A;  3K1H A;  4G7H F;  1LE2 A;  3V5Z A;  5EK0 A;  2X0C A;  5F5H A;  4MVO A;  4XWJ A;  3B0V C;  4NC3 A;  1T6I A;  1WGW A;  4BEM J;  1WAT A;  3T6G B;  2J46 A;  4I3M A;  2A1D D;  4W8P A;  3TOM A;  3H2U A;  5JVE A;  4QI2 A;  1NLX A;  2XLE A;  2H7O A;  4FWV A;  1GGQ A;  3M15 A;  4J7Y A;  1ZZP A;  3HJC A;  1APC A;  2KW3 C;  2DGJ A;  2Q00 A;  3A9C A;  3DJN B;  3EGD A;  2HJ3 A;  4MS2 A;  1G8X A;  2XLV A;  3NMI A;  3RQG A;  4HEA J;  4BJT A;  1CGN A;  1UG7 A;  3LNR A;  4BPM A;  1E86 A;  1MND A;  2EIM C;  4JJF A;  3R7C A;  2IYL D;  5JP7 A;  1OQC A;  4CX9 A;  4NTB A;  3MBG A;  4J30 B;  3LJB A;  3O10 A;  3RVY A;  2W4M A;  1BR2 A;  2VC9 A;  2ZPA A;  3JTL O;  4P6I C;  1OW8 A;  3DI5 A;  2AWC A;  2LD6 A;  1A7E A;  2WB7 A;  3AG4 C;  2ZXR A;  4RBN A;  3U3B A;  3N0T A;  3QVY A;  4G0H A;  3O55 A;  2L9J A;  3NKE A;  4MVQ A;  3RF3 A;  2F22 A;  3W4Y A;  4IGG A;  3HNI A;  4LDQ A;  3LEV A;  4NQF A;  4CS8 A;  4DXW A;  5T1D B;  4CDY A;  4ZLC A;  3MLG A;  2LCH A;  1HMD A;  1A0B A;  3FOO A;  3GOD A;  3T6B A;  3NRH A;  2XXA B;  1NFO A;  3SXK A;  4OD5 A;  3POV A;  3I5P A;  3AJM A;  3N24 A;  4GYT A;  4MQ9 F;  1VYI A;  3NYM A;  1SMY F;  1ORJ A;  3C8G A;  3ZVR A;  5A6B D;  1WTY A;  1F1M A;  3HLZ A;  4PJM A;  3HNK A;  5KYU A;  5B3I A;  1I5N A;  3RYL A;  4MW8 A;  2QE9 A;  4OIQ F;  4YL0 A;  3PDM P;  3EG9 B;  1D1B A;  4CBE A;  3C63 A;  2Y69 C;  3Q7L A;  4DJ9 A;  3K1I A;  2Q9C A;  1YJG A;  3CAX A;  5L0G A;  5L0I A;  5B1A C;  5CI9 A;  3EGX A;  1Z23 A;  1E2X A;  1T6Q A;  3AG1 C;  2Y39 A;  4JVS A;  4O7G A;  4PFO A;  3S28 A;  3UMK A;  4AE4 B;  4OIO F;  2R03 A;  1TWC A;  4IAO A;  4P9T A;  5FCL A;  4CSA C;  3ABM C;  3IQT A;  3JT1 A;  2A0B A;  5BUO A;  1D1C A;  4E18 A;  3SZR A;  1RXQ A;  2ETS A;  1XWJ A;  2BL2 A;  2YLI A;  2R7O A;  2YZS A;  3PHF 2;  4QI0 A;  3M1C B;  2IXO A;  3WHN A;  4CS7 A;  1YZA A;  1QZX A;  2J9B A;  2O9X A;  3ZDL A;  4EWC A;  1EKY A;  2J9V A;  2VCB A;  4ZLD A;  3DMD A;  2XRH A;  4JZA A;  4I44 A;  1ZW3 A;  3PMR A;  1VK5 A;  4WAB A;  3TD7 A;  4IRU A;  3V5Y A;  4LAC B;  3RVZ A;  3W8I A;  1YYJ A;  2OEV A;  1MQV A;  3CEX A;  3RQF A;  1AUE A;  3ZWI A;  3ABK C;  3GOR A;  4ER9 A;  2W4B A;  4JKV A;  2XM4 A;  3FDQ A;  4HE8 D;  2V26 A;  4LDK A;  1ZU5 A;  2A68 F;  3IEE A;  4Q5S F;  5L0F A;  4KBL A;  2A69 F;  1OXK A;  3ATP A;  4U5G A;  4Z9I A;  4BG0 A;  1Q0D A;  1HW2 A;  2VH3 A;  3TJ5 A; 
#chains in the Genus database with same CATH homology
 1NG1 A;  3NDB B;  1SF8 A;  1LVK A;  3ABL C;  4O79 A;  4YT4 A;  3EQL F;  5E3C A;  5E2Q A;  3ZIB A;  3JCU Q;  3L0I A;  2IXN A;  3RIP A;  4FX5 A;  1D0Y A;  1ZHX A;  3O39 A;  3QZC A;  2XXA A;  3DD7 A;  1ZU4 A;  4CSA A;  3UGP A;  2BE5 F;  3ASO C;  3VAY A;  4JCH A;  1FMV A;  4RD9 A;  2R7T A;  4PFP A;  3EFO B;  4DOZ A;  4E7S A;  1Z5Z A;  3KKB A;  1J8M F;  2M4E A;  3EG9 A;  2GFH A;  4C7O B;  1RJ9 A;  3F46 A;  4KC9 A;  2J0W A;  4W8K A;  1OCC C;  3UNG C;  1ZHW A;  4J32 B;  3JRT A;  2XSE A;  2EIL C;  4AE4 A;  4HFK B;  3Q7G A;  4FES A;  4BEJ A;  2R7S A;  4RDA A;  2WZG A;  2YEV A;  3FAJ A;  2CW0 F;  3H65 A;  4H4K C;  3B0P A;  1D0Z A;  4KNW A;  1D1A A;  4G7Z F;  2R7Q A;  1MMG A;  5DQT A;  1VYK A;  1N1C A;  4OIP F;  5IY5 C;  4HFF B;  2HV7 A;  1O87 A;  4DVY P;  1BR1 A;  3MX3 A;  3NKD A;  3EH1 A;  3OEO A;  3K33 A;  5D91 A;  3W8H A;  4O6N A;  4B6I A;  1S7Z A;  1BR4 A;  1V55 C;  2PP4 A;  5HSW A;  1FMW A;  1ZHZ A;  4U5D E;  4OIN F;  4XLN F;  2Y3G A;  4U5C E;  3S29 A;  1ZYR F;  4Q7C A;  3E70 C;  3T6J A;  5F5F A;  3ZC4 A;  3NYL A;  2L81 A;  3L34 A;  1RJ9 B;  3S27 A;  2WZF A;  3QMK A;  1MMD A;  1JPN A;  2Q3T A;  5DS4 A;  3UMI A;  3ECS A;  3I5Q A;  3EFO A;  3CZ6 A;  2PX3 A;  3JSZ A;  2CGE A;  4OD4 A;  1PCX A;  1OKK D;  4DBQ A;  2IXM A;  4C7O A;  1MMN A;  3JYH A;  4MND A;  3ZG1 A;  2IOQ A;  3CQZ A;  2KQ9 A;  4YWQ A;  3UGO A;  5CI8 A;  4O6M A;  4PJJ A;  2WL8 A;  2WVO A;  1Z6A A;  4JUR I;  4Q4Z F;  1TWH A;  1MNE A;  4E7Z A;  3LLI A;  3EJN A;  3CSK A;  3AQC A;  3DAF A;  5KYX B;  2R7R A;  4K0D A;  1ST6 A;  2QTV A;  3RFY A;  2KJG A;  1VMA A;  3KH2 A;  3WOD F;  4YT2 A;  5E33 A;  3V7O A;  4C3D A;  2A6E F;  2G62 A;  4AK9 A;  2EIJ C;  4C3E A;  2H7B A;  1J8Y F;  4GEH A;  4EBB A;  1JPJ A;  2LSE A;  3VYW A;  2HV6 A;  4I1M A;  4A2N B;  4U5E E;  1PD1 A;  2Q9A A;  4F4B A;  3X2Q C;  3LS1 A;  3N2Z B;  5D92 A;  4IJJ A;  2G3K A;  4X0R A;  4OIR F;  2KNH A;  3X1O A;  2ZXO A;  3OA1 A;  2CDQ A;  3SP1 A;  2PX0 A;  2V3C C;  3HTK C;  2NUP B;  1V54 C;  5EHH A;  4YT5 A;  4NY3 A;  5DS5 A;  1D0X A;  4YN0 B;  5DS6 A;  2PF4 E;  1LKX A;  4PJL A;  2EIK C;  5B3S C;  2J45 A;  2Z15 A;  1OKK A;  1FFH A;  3NYJ A;  2DYS C;  1M57 C;  2VAS A;  4U5B E;  2A6H F;  2WZL A;  3LAY A;  2FGY A;  5KYW B;  3ITF A;  4YJW A;  3KMI A;  1ZHT A;  3DZA A;  2IXP A;  2ZXP A;  2X51 A;  4WJ0 A;  3SNH A;  3SEO A;  3KL4 A;  5EGY A;  2XL4 A;  1MMA A;  2WVN A;  5DQZ A;  4IWB A;  5KYY A;  3T4R A;  1LS1 A;  5KYX A;  3W2V A;  4XTK A;  2YHS A;  2MWQ A;  2JD3 A;  4U5F E;  4M63 A;  3GAN A;  3SYN A;  2PFD A;  4C3B A;  2OG2 A;  2J9U A;  2Y3H A;  3E9V A;  2R7U A;  1VOM A;  2J9W A;  3EZI A;  1FFT C;  5E3A A;  3AG3 C;  2QY9 A;  3Q6M A;  4DVZ A;  3K66 A;  4U5H A;  3K6B A;  3DXJ F;  1FTS A;  4BJ6 C;  3OWT A;  2P6V A;  2P7V A;  2C03 A;  1OCZ C;  2MYS A;  2NUP A;  2D5R B;  4JW1 A;  2NUT B;  1QLE C;  1TWA A;  2C04 A;  4BJ5 C;  4ULW A;  4YT8 A;  1M2V B;  1TWG A;  2E87 A;  1IW7 F;  4BJ1 A;  3AG2 C;  3S0X A;  2WVQ A;  5T3W A;  2W9Y A;  1NU9 C;  3EH2 A;  1Z63 A;  2B0J A;  4PJN A;  3WG7 C;  2I8B A;  3UR3 C;  5KYY B;  2J7P A;  4ANJ A;  2CNW D;  3I4U A;  1M2O A;  3DM5 A;  5KYW A;  1Z3I X;  1SZI A;  1ZHY A;  3EZH A;  1TKN A;  3EGD B;  1OCR C;  1NZE A;  2H7V C;  4CS9 C;  5DLJ A;  3O6X A;  2R7V A;  2Y3D A;  4O6Y A;  4I1O B;  3B9Q A;  3FHD A;  4G7O F;  3DM9 B;  2W45 A;  2DYR C;  4K7B A;  3LS0 A;  3AQB A;  1OCO C;  3DJU B;  2R7W A;  3ZSU A;  4LER A;  4BJ6 A;  1W2W A;  4PK4 A;  1NU7 D;  5L3Q A;  5DVW A;  1KU2 A;  1O5H A;  4DBR A;  4CIH A;  4BJ5 A;  3B0U X;  2EIN C;  5KYU B;  1TR2 A;  3K7D A;  3RH3 A;  2KGO A;  2J0X A;  2Y3B A;  4JJG A;  2R7X A;  1M56 C;  4KNV A;  4XLP F;  2ZXW C;  3EGX B;  4LLE A;  4CS8 C;  3EHN A;  2Q9B A;  3W2W A;  3ASN C;  3EHM A;  3NG1 A;  5T3T A;  2OCC C;  2G3V A;  3EPV A;  2NUT A;  3UMH A;  4LLC A;  3LLK A;  2FFH A;  1M2V A;  5KYN A;  3F47 A;  3FVY A;  2NG1 A;  3LES A;  1PD0 A;  5B1B C;  1IZM A;  2CNW A;  3Q6N A;  4CS9 A;  4AX2 A;  3DAG A;  2J7P D;  3K1I C;  5L3V A;  2VB6 A;  4QDL A;  3RKO F;  4N06 A;  3K1H A;  4G7H F;  5F5H A;  4XWJ A;  3B0V C;  1WGW A;  2J46 A;  4I3M A;  2A1D D;  4QI2 A;  2H7O A;  4FWV A;  3HJC A;  2KW3 C;  2DGJ A;  3DJN B;  3EGD A;  1G8X A;  4HEA J;  4BJT A;  3LNR A;  1MND A;  2EIM C;  4JJF A;  2IYL D;  4J30 B;  3LJB A;  2W4M A;  1BR2 A;  4P6I C;  2ZPA A;  3AG4 C;  2WB7 A;  4RBN A;  2ZXR A;  3N0T A;  4G0H A;  2L9J A;  3NKE A;  3LEV A;  4CS8 A;  5T1D B;  4ZLC A;  3MLG A;  2XXA B;  3T6B A;  3GOD A;  3NRH A;  3POV A;  4OD5 A;  3I5P A;  3N24 A;  4GYT A;  4MQ9 F;  1VYI A;  3NYM A;  1SMY F;  3ZVR A;  3HLZ A;  4PJM A;  5KYU A;  3RYL A;  4OIQ F;  3EG9 B;  1D1B A;  4CBE A;  2Y69 C;  3Q7L A;  2Q9C A;  5B1A C;  5CI9 A;  3EGX A;  1Z23 A;  3AG1 C;  4O7G A;  4PFO A;  2Y39 A;  4JVS A;  3S28 A;  3UMK A;  4KI2 A;  4AE4 B;  4OIO F;  1TWC A;  4IAO A;  5FCL A;  4CSA C;  3ABM C;  3JT1 A;  5BUO A;  1D1C A;  3SZR A;  2YZS A;  2R7O A;  3PHF 2;  3M1C B;  2IXO A;  4CS7 A;  1QZX A;  2O9X A;  4EWC A;  2J9V A;  4ZLD A;  3DMD A;  2XRH A;  4JZA A;  4I44 A;  3PMR A;  1VK5 A;  3TD7 A;  4IRU A;  4LAC B;  3W8I A;  3ABK C;  2W4B A;  3FDQ A;  4HE8 D;  2V26 A;  4Q5S F;  1ZU5 A;  2A68 F;  3IEE A;  4KBL A;  2A69 F;  4U5G A;  4BG0 A;  4QI0 A;  2VH3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...