4CBEA

Crystal structure of complement factors h and fhl-1 binding protein bbh06 or crasp-2 from borrelia burgdorferi (native)
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
214
structure length
209
Chain Sequence
GRLNQRNINELKIFVEKAKYYSIKLDAIYNECTGAYNDIMTYSSDQSKVNQAISIFKKDNKIVNKFKELEKIIEEYKPMFLSKLIDDFAIELDQAVDNDSNARHVADSYKKLRKSVVLAYIESFDVISSKFVDSKFVEASKKFVNKAKEFVEENDLIALECIVKTIGDMVNDREINSRSRYNNFYKKEADFLGAAVELEGAYKAIKQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Characterization of Cspz, a Complement Regulator Factor H and Fhl-1 Binding Protein from Borrelia Burgdorferi.
pubmed doi rcsb
source organism Borrelia burgdorferi
molecule tags Cell adhesion
molecule keywords COMPLEMENT REGULATOR-ACQUIRING SURFACE PROTEIN 2 (CRASP-2)
total genus 92
structure length 209
sequence length 214
ec nomenclature
pdb deposition date 2013-10-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1640 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4cbeA00
4BG0A 4CBEA
chains in the Genus database with same CATH superfamily
3ZWIA 4XEFA 1PD0A 3C8GB 2BE5F 1RJ9A 3JYYA 4O6MA 3VRCA 3ABMC 1A7EA 2Y3GA 4IAOA 2ZXRA 2DI3A 4IARA 4GQHA 2W9YA 1M6TA 1K40A 4LDKA 3FVYA 5K0IA 3C18A 3F47A 3LEOA 2L7AA 4AE4A 1FFTC 2HV6A 2R7XA 1H6GA 2XLMA 3ATPA 3EJNA 3NYJA 1M2VB 5DLJA 4CS8A 5DQTA 5D92A 5L0HA 2AVKA 3IQ6A 5E33A 1H7IA 1D1BA 1BR4A 1ZU5A 4CSAC 2L81A 3BEHA 1CGOA 3MX3A 4JCZA 5KYWB 1VTMP 4G78A 3O10A 2PFDA 3FOOA 2R7QA 3US6A 2XM0A 1Z6AA 2Y3DA 4KC9A 1H9GA 4OD5A 1HY5A 2NUPB 5KYXB 3ECSA 3ZVRA 4CDVA 5KYUB 3NMJA 3HLZA 3SNHA 4JTDB 4CBEA 2EILC 3V5YA 2Y3BA 3W2WA 5E3AA 4CJOA 2Q3TA 4U9EA 4CDYA 1HE1A 5KYNA 1HW2A 1TWAA 4C3BA 3SXYA 3RIPA 4E0HA 2PF4E 3G50A 3QMKA 3POVA 1LE4A 1ZU4A 3G4XA 4RDAA 3X1OA 2R7VA 4E7ZA 2EPMX 1C17M 2CNWD 1RXQA 2IOQA 2JX0A 3AQCA 4JZAA 1HMOA 3MBGA 3FXHA 3LLIA 1BR2A 1HMDA 1R5ID 3SXMA 4EIYA 2YQYA 3N0TA 4YWQA 1GM5A 1B68A 1LI5A 3RQGA 2Q4FA 3RH3A 5BQIA 3DE9A 3UR3C 3H2VA 3MYFA 1Q0DA 3DAGA 3K66A 3QW0A 2DB4A 3LNMB 2Q9BA 3DZAA 3I5QA 2X51A 4NY3A 1I4ZA 4PJNA 4H54A 3GEEA 3TK0A 3TULA 1TKNA 3AQBA 1KTMA 3ASNC 3C62A 3IHUA 3SZRA 2XLVA 5KYUA 1H9TA 2OJED 3L8JA 1LM3B 3EH2A 3GANA 1E86A 3T6JA 1J8MF 1FTSA 1BDJB 1RKCA 2Q9AA 2YWAA 3G4ZA 3JSZA 4QDLA 4DVZA 1OQCA 1NFNA 4XQ1A 3HNIA 2XSEA 3B9QA 2CYDA 4OIOF 4JC7A 1VYKA 3RKOF 3EG9B 3B0PA 4JE9A 1OXKA 2H7BA 3Q6NA 1OCZC 3DJUB 4EHPA 4C7OB 1ZHWA 2W4BA 4MW3A 1QPUA 1RJ9B 2Y39A 1JPNA 1OR3A 3UNGC 5GPGB 4BG0A 3PMRA 3I5PA 3RQEA 4XTKA 4N6CA 1V74B 4NTFA 3U8PA 2Y69C 2Q00A 4J32B 4X0RA 1ORJA 2OOCA 3JRMO 2NSFA 3A9CA 1OW6A 2ASRA 3K7DA 4Z9IA 3SYNA 4ZLCA 4BJTA 1AEPA 4O6YA 2UUHA 2HJMA 3C8GD 4PJLA 3JTLO 4CS9A 1KU2A 2EPOA 1OXBA 5A6BA 2V26A 4RD9A 1T6UA 3EPVA 3N2ZB 3V7OA 2J9WA 3L8IA 4XEKA 4BJ5A 4WGZA 5FCLA 3PHF2 4YT4A 2YL7A 4EKWA 2ZXOA 3DKAA 4J30B 2CGEA 4XPXA 4G0HA 3KMIA 2G3VA 4KNWA 3LESA 5EHHA 4A4AA 4J7YA 4MVZA 2YKZA 1PCXA 3OEOA 2HSQA 4BEMJ 2ZPAA 4DBQA 1A7VA 1IZMA 1Q0MA 3ASOC 1ZYRF 5F28E 4Z9JA 4JJGA 5T3TA 1YJGA 2LK4A 4MW8A 5L0FA 4QI0A 1FMVA 2HMQA 2YHSA 4ULWA 3DMDA 3RYLA 5KYXA 2R7UA 4XWJA 4ER9A 2KYHA 5T3WA 3U3BA 5AC5A 1I5NA 4F4BA 4W8KA 3MYIA 4MVMA 1JAFA 1VK5A 3O6XA 5HSWA 1JMWA 1DOWA 1G5ZA 2KC3A 2NPUA 1T6IA 5CI8A 1NLXA 1K05A 3K1IA 4U5GA 4AL0A 1NBBA 4BJ6C 5AC4A 4DRIB 3HKKA 3M4BA 4R32A 3S0XA 3EH1A 2MHRA 1F1MA 2LQGA 2MYSA 2VB6A 1FMWA 3UMIA 1OCCC 2KSFA 1BBHA 4OIPF 2DYSC 1XWJA 1M56C 4IWBA 5A6AA 5JS5A 1LPEA 1PV3A 3IPMO 2ZD9A 4PFPA 2WZFA 3C8ZA 3HNLA 2R25A 3JZ0A 4MVUA 3S27A 3WHNA 4CJGA 4G7HF 1MMNA 1AUEA 1T9KA 1WTYA 3E9VA 3K6BA 3RVYA 2VCAA 2DYRC 4WABA 4EUKB 3U0CA 1A7DA 2LFFA 4AE4B 4XLPF 4JURI 2XXAB 4DBRA 3DE8A 4LACB 4MNDA 5TJ5E 1LKXA 1NZEA 2EIJC 1BZ4A 3FAPB 1YA7O 4E18A 3DWWA 2GAQA 4EWCA 2NUPA 3QVYA 5F5FA 3TQOA 3Q6MA 1ORSC 2G3KA 4O6NA 3LNRA 4ONSA 5L0DA 5CI9A 3EZHA 3LEVA 2X0CA 4U5CE 2LFDA 1EA8A 3CQZA 4JTCB 4YJWA 2QE9A 1WATA 2WZLA 2HV7A 1OR2A 5B3IA 2OEVA 1YYXA 2B0HA 3NYLA 3SXKA 1UG7A 2VC9A 5L3QA 1KNYA 2YZSA 2EPKX 2IM8A 1G8XA 3WG7C 4PR9A 4EBKA 1NG1A 2OCCC 4P9TA 2L9JA 4D4NA 2IXPA 2J8WA 1FFHA 5E2QA 3ZQYA 4BPMA 2CW0F 1GS9A 2H7OA 4CS9C 5A6KA 4PJJA 5A69A 3C63A 3QTHA 1N1CA 3S29A 1T6QA 3C8GA 1FNTc 2XS8A 4JEAA 2WB7A 3T4RA 1MNEA 1ZZPA 2YL0A 3H2UA 3EHNA 2I15A 2XL4A 3DXJF 2GDCA 4UDVA 2GWWA 2M4EA 3NRHA 2GFHA 2HJ3A 2LP4A 1WWPA 2RSEB 2WVNA 3CSKA 4N6HA 1OW8A 4NQFA 5L0CA 4LLEA 1Z63A 2VH3A 2XM4A 3EFOB 3KPHA 1O3UA 2CNWA 3T6BA 1E85A 3NMIA 4YT5A 4EBJA 2P61A 3LUTB 3B0VC 2W45A 1J8YF 3GORA 4BEJA 5EK0A 1U6HA 5JLIA 4H4KC 2PNOA 4U5HA 1IW7F 3AG2C 3AGTA 4FWVA 1QZXA 1YA9A 2KNHA 4KNVA 2JPUA 3B29A 1LI7A 4I44A 1SF8A 2H7VC 3DM5A 3RVZA 3U2LA 4DOZA 1Y6DA 2NSGA 1QVXA 2CDQA 1FR0A 3J06A 3SP1A 2D4UA 3FMSA 3AJMA 2XS1A 5JRAA 4XPYA 2RD9A 3GEHA 2R03A 4YL1A 3TOMA 4DJ9A 5KYWA 2R7WA 4DRJB 1YDIA 2ZXWC 1ZHXA 2H8AA 2L6GA 3NKEA 4JTAB 3U5SA 1K04A 2R05A 2JD3A 5JT4A 3NKDA 4B6IA 5JSLA 1D0ZA 1DOVA 1ZHTA 2WVQA 1QKRA 1D1AA 3QW1A 2J7PD 2A68F 3MLGA 3DD7A 2O9XA 2IXNA 3GM2A 3NMKA 4N06A 3TOLA 1M57C 3EFOA 3F46A 3KYJA 4PFOA 4E0IA 1O87A 3VF0A 4I1MA 4U5EE 1LS4A 1VB5A 4MTOA 4U5DE 2V3CC 4CX9A 3ITFA 2C03A 3X2QC 1SR2A 1U89A 2EIKC 2QY9A 3RF3A 2XL8A 4CSAA 2A0UA 1MQVA 1RCPA 3C7JA 2I8BA 2QNLA 3L34A 3JSEO 1Q0FA 1TQGA 2NG1A 2Q7RA 3TJ6A 2R9RB 5DQZA 5A6JA 1D0YA 3H65A 1SYQA 1VMAA 2HZ8A 1Z23A 3GM1A 3QVZA 4JEBA 1MMGA 2BL2A 3UMHA 3GODA 3IEEA 3U8VA 3B0UX 3JYHA 1G4US 1VLSA 5E3CA 3NG1A 3EQLF 2HSBA 3AG3C 4HEAJ 5DS6A 5A6BD 2UUIA 3W4YA 1Z5ZA 5COMA 4JRZA 2FAPB 2J9UA 4CIHA 3KH2A 3NYMA 2VCCA 2J0XA 5FZTA 4CIPA 4LDQA 1E83A 4M63A 2EPLX 3ZIBA 2LCHA 2XLHA 3W8HA 2VASA 3AGUA 4IB4A 1VOMA 1YZCA 3T6GB 4DXWA 3DI5A 4O79A 4FAPB 4JIOA 3CZ6A 4W8PA 5L3VA 2L6HA 3T9OA 2PX0A 3Q7GA 1LS1A 4DRHB 4PACA 1TWHA 2XLOA 1APCA 1G4WR 1Q0GA 2YL1A 2E87A 5AGFA 1CGNA 1JR8A 5JUAA 2OEXA 2J0WA 3E70C 1YARO 3UGOA 2R7OA 5KYYA 1OKKD 3W2VA 5IY5C 5HV9A 4LERA 4HFFB 4YL0A 5COFA 2OJQA 1W2WA 1WASA 2GA0A 1Z7Qc 3KL4A 2IXMA 3OA1A 4XPWA 5F5HA 1E2XA 4CS7A 1VYIA 4PK4A 4L6RA 4JVSA 2VCBA 4IRUA 3U3FA 4WGYA 1JPJA 2HS5A 4XLNF 1EKYA 1TFKB 1QLEC 2FGYA 4HFKB 4RBNA 4U9DA 2R02A 2IXOA 1MMDA 1OCOC 1ZW3A 2HMZA 2YLIA 3CEXA 2NUTA 2BC5A 4P6IC 4YT2A 2XLDA 4NTAA 2R7SA 5D91A 1S05A 2G62A 3SEOA 4KI2A 4Q7CA 3ZTZA 3EGDB 4O7GA 4OIQF 1U0BB 3V5ZA 3K33A 2R7TA 2YLGA 2ETSA 3K1HA 4IJJA 2J9VA 5CIVA 1CPRA 2Z15A 4EBBA 2PX3A 2A0BA 2XLEA 1LE2A 1LVKA 4OINF 1Q0KA 2XLWA 2XL6A 3MFNA 4GYTA 3DJNB 1SZIA 2J46A 1FAPB 3W8IA 3TD7A 3ZSUA 1OCRC 4DVYP 2AWCA 5BQHA 1C02A 2LIGA 4JW1A 4GEHA 3L0IA 4N4WA 4OIRF 3S84A 3N24A 1A0BA 2KK1A 4G7ZF 1V54C 2LD6A 4PJMA 1TWCA 1T5OA 2TMVP 1EI7A 3ZC4A 4YT8A 1M2VA 4Q4ZF 5DS4A 2HKVA 3IQTA 4CS8C 2CCYA 3KKBA 3BRJA 3GWNA 3EG9A 2OG2A 1JOGA 3ZTMA 4QI2A 4E7SA 2A6HF 2QTVA 3LS0A 3M1CB 3U2MA 1NU7D 2QUPA 2PBEA 3GM3A 3M15A 3QZCA 4I3MA 2YLDA 3S90A 3O39A 2A69F 4JKVA 3AOUA 4AX2A 3SXZA 1NU9C 4BJ5C 2KGOA 3LS1A 2XXAA 3FAJA 4ULVA 2C04A 3WAQA 2B0JA 2L6FA 1RKEA 3AG1C 3PCVA 5JVEA 2P0NA 1RMVA 4YL3A 3ABLC 1NFOA 3CAXA 3VAYA 4YK5A 4FESA 5DVWA 2Q9CA 4JJFA 3OWTA 4MVOA 4MTGA 2YVKA 1EQ1A 3A11A 2OKUA 1QQ3A 3S9OA 3PDMP 2OQMA 1GGQA 1M2OA 1E84A 1OKKA 5L0JA 1ZHZA 4Q5SF 2P1AA 3R2PA 4KBLA 4IAQA 4JCHA 4I1OB 4MS2A 3V5XA 3ZQVA 1VLTA 1Y4CA 1ZVZA 5COGA 2WZGA 4MVQA 3ZDLA 3VM6A 4CDAA 1TR2A 1XZPA 4AK9A 2DGJA 4XEVA 4LLCA 2QLAA 4C3EA 2AP3A 3DAFA 3EHMA 5KYYB 1MMAA 1MNDA 2PP4A 3KYIA 1V55C 2YEVA 3FOPA 2IYLD 3VYWA 4ZLDA 1D1CA 1TWGA 2EIMC 2ZXPA 1WGWA 2R7RA 2WL8A 3LLKA 3ABKC 1T01A 2EPNA 1YZAA 4C7OA 3JT1A 4OD4A 3ZG1A 1QSPA 3FDQA 2P6VA 5B1AC 4C3DA 2WVOA 5JP7A 3FHDA 1AVOB 3R7CA 3AG4C 1SMYF 1C03A 3K1IC 2J7PA 4K0DA 2KQ9A 5EGYA 4BJ1A 3RQFA 2D5RB 4WJ0A 3LAYA 5T1DB 1PD1A 2W4MA 1S7ZA 4U5BE 4YN0B 5DS5A 2YL3A 3IQCA 2P7VA 3B71A 1CGME 3RW0A 2J45A 1L7CA 2Y3HA 4BJ6A 5BUOA 1L3PA 3L1MA 4MTFA 1HW1A 3GEIA 2IBFA 1YYJA 3HTKC 3M79A 4FX5A 2FFHA 2KW3C 2XRHA 2LSEA 4G7OF 1D0XA 4D4XA 4NCQA 1LIHA 1ORYA 4E17A 1A41A 1Z3IX 4K7BA 1WOLA 2F22A 3M4CA 4LDRA 2MWQA 3EGXB 1YVIA 3HNKA 3DM9B 2A6EF 3O55A 4ANJA 2ICWG 4MVRA 3S28A 1BR1A 1WN0A 1OW7A 4MQ9F 4J7TA 4K1OA 3TJ5A 3WODF 2M64A 4NC3A 1UFBA 2OU6A 2KJGA 2AU5A 5B1BC 3NDBB 5B3SC 4HE8D 1O5HA 1YLMA 4Z9HA 5L0IA 3UGPA 3LJBA 4MVSA 1HE9A 3IQ5A 2HFIA 3HJCA 1ZHYA 3U9MA 1ZW2A 256BA 2HUJA 4IGGA 1XZQA 4NTBA 1NSGB 1TFOB 2A1DD 1YAUO 4A2NB 2AWYA 5BQGA 3JRTA 1RKEB 3GWLA 1I4YA 3EGDA 1JRAA 3UMKA 2J9BA 1V4AA 2EINC 4U5FE 1ST6A 3U9JA 3I4UA 3Q7LA 4P9FA 1GQAA 2YRFA 3EZIA 4AL1A 2NUTB 5L0GA 1R4TA 3RFYA 3EGXA 3JCUQ 3HNJA 1CPQA
chains in the Genus database with same CATH topology
1PD0A 2BE5F 1RJ9A 4O6MA 3ABMC 2Y3GA 4IAOA 2ZXRA 2W9YA 3FVYA 3F47A 4AE4A 1FFTC 2HV6A 2R7XA 3EJNA 3NYJA 1M2VB 4CS8A 5DQTA 5D92A 5E33A 1D1BA 1BR4A 1ZU5A 4CSAC 2L81A 3MX3A 5KYWB 2PFDA 2R7QA 1Z6AA 2Y3DA 4KC9A 4OD5A 2NUPB 5KYXB 3ECSA 3ZVRA 5KYUB 3HLZA 3SNHA 4CBEA 2EILC 2Y3BA 3W2WA 5E3AA 2Q3TA 5KYNA 1TWAA 4C3BA 3RIPA 2PF4E 3QMKA 3POVA 1ZU4A 4RDAA 3X1OA 2R7VA 4E7ZA 2CNWD 2IOQA 4JZAA 3AQCA 3LLIA 1BR2A 3N0TA 4YWQA 3RH3A 3UR3C 3DAGA 3K66A 2Q9BA 3DZAA 3I5QA 2X51A 4NY3A 4PJNA 1TKNA 3AQBA 3ASNC 3SZRA 5KYUA 3EH2A 3GANA 3T6JA 1J8MF 1FTSA 4QDLA 3JSZA 2Q9AA 4DVZA 2XSEA 3B9QA 1VYKA 3RKOF 3EG9B 3B0PA 2H7BA 3Q6NA 1OCZC 3DJUB 4C7OB 1ZHWA 2W4BA 2Y39A 1RJ9B 3UNGC 1JPNA 4BG0A 3PMRA 3I5PA 4XTKA 2Y69C 4J32B 4X0RA 3SYNA 3K7DA 4ZLCA 4BJTA 4O6YA 4PJLA 4CS9A 1KU2A 2V26A 4RD9A 3EPVA 3N2ZB 3V7OA 2J9WA 5FCLA 3PHF2 4YT4A 2ZXOA 4J30B 2CGEA 4G0HA 3KMIA 2G3VA 4KNWA 3LESA 5EHHA 4DBQA 1PCXA 3OEOA 2ZPAA 1IZMA 3ASOC 1ZYRF 5T3TA 4JJGA 4QI0A 1FMVA 2YHSA 4ULWA 3RYLA 3DMDA 5KYXA 2R7UA 4XWJA 5T3WA 4F4BA 4W8KA 3O6XA 1VK5A 5HSWA 5CI8A 4U5GA 4BJ6C 3S0XA 3EH1A 2MYSA 2VB6A 1FMWA 3UMIA 1OCCC 4OIPF 2DYSC 1M56C 4IWBA 4PFPA 2WZFA 4OIOF 3S27A 4G7HF 1MMNA 3E9VA 3K6BA 2DYRC 4AE4B 4XLPF 4JURI 2XXAB 4DBRA 4MNDA 1LKXA 1NZEA 2EIJC 4EWCA 2NUPA 5F5FA 3Q6MA 2G3KA 4O6NA 3LNRA 5CI9A 3EZHA 3LEVA 4U5CE 3CQZA 4YJWA 2WZLA 2HV7A 5L3QA 3NYLA 2YZSA 1G8XA 3WG7C 1NG1A 2OCCC 2L9JA 2IXPA 1FFHA 5E2QA 2CW0F 2H7OA 4CS9C 4PJJA 1N1CA 3S29A 2WB7A 3T4RA 1MNEA 3EHNA 2XL4A 3DXJF 2M4EA 3NRHA 2GFHA 3CSKA 2WVNA 1Z63A 4LLEA 2VH3A 3EFOB 2CNWA 3T6BA 4YT5A 3B0VC 2W45A 1J8YF 4BEJA 4H4KC 4U5HA 1IW7F 3AG2C 4FWVA 1QZXA 2KNHA 4KNVA 4I44A 1SF8A 2H7VC 3DM5A 4DOZA 2CDQA 3SP1A 5KYWA 2R7WA 2ZXWC 1ZHXA 3NKEA 2JD3A 3NKDA 4B6IA 1D0ZA 1ZHTA 2WVQA 1D1AA 2J7PD 2A68F 3MLGA 3DD7A 2O9XA 2IXNA 4N06A 1M57C 3EFOA 3F46A 4PFOA 1O87A 4I1MA 4U5EE 4U5DE 2V3CC 3ITFA 2C03A 3X2QC 2EIKC 2QY9A 4CSAA 2I8BA 3L34A 5DQZA 2NG1A 1D0YA 3H65A 1VMAA 1Z23A 1MMGA 3UMHA 3GODA 3IEEA 3B0UX 3JYHA 5E3CA 3NG1A 3EQLF 3AG3C 4HEAJ 5DS6A 1Z5ZA 2J9UA 4CIHA 3KH2A 3NYMA 2J0XA 4M63A 3ZIBA 3W8HA 2VASA 1VOMA 4O79A 3CZ6A 5L3VA 2PX0A 3Q7GA 1LS1A 1TWHA 2E87A 3UGOA 3E70C 2J0WA 2R7OA 5KYYA 1OKKD 3W2VA 5IY5C 4LERA 4HFFB 1W2WA 3KL4A 2IXMA 3OA1A 5F5HA 4CS7A 1VYIA 4PK4A 4JVSA 4IRUA 1JPJA 4XLNF 2FGYA 1QLEC 4HFKB 5DLJA 4RBNA 4BJ5A 5B3SC 1MMDA 2IXOA 1OCOC 4YT2A 2NUTA 4P6IC 2R7SA 5D91A 2G62A 3SEOA 4KI2A 4Q7CA 3EGDB 4O7GA 4OIQF 3K33A 2R7TA 4IJJA 3K1HA 2J9VA 2Z15A 4EBBA 2PX3A 1LVKA 4OINF 4GYTA 3DJNB 1SZIA 2J46A 3W8IA 3TD7A 3ZSUA 1OCRC 4DVYP 4JW1A 4GEHA 3L0IA 4OIRF 3N24A 4G7ZF 1V54C 4PJMA 1TWCA 3ZC4A 4YT8A 1M2VA 4Q4ZF 5DS4A 4CS8C 3KKBA 3EG9A 2OG2A 4QI2A 4E7SA 2A6HF 2QTVA 3M1CB 3LS0A 1NU7D 3QZCA 4I3MA 3O39A 2A69F 4AX2A 1NU9C 4BJ5C 2KGOA 3LS1A 2XXAA 3FAJA 2C04A 2B0JA 3AG1C 3ABLC 3VAYA 4FESA 5DVWA 2Q9CA 4JJFA 3OWTA 1M2OA 1OKKA 1ZHZA 4Q5SF 4KBLA 4JCHA 4I1OB 2WZGA 1TR2A 4AK9A 2DGJA 4LLCA 4C3EA 3DAFA 5KYYB 3EHMA 1MMAA 1MNDA 2PP4A 1V55C 2YEVA 3VYWA 2IYLD 4ZLDA 1D1CA 1TWGA 2EIMC 2ZXPA 1WGWA 2R7RA 2WL8A 3LLKA 3ABKC 4C7OA 3JT1A 4OD4A 3ZG1A 3FDQA 2P6VA 5B1AC 4C3DA 2WVOA 3FHDA 3AG4C 1SMYF 3K1IC 2J7PA 4K0DA 2KQ9A 5EGYA 4BJ1A 2D5RB 4WJ0A 3LAYA 5T1DB 1PD1A 2W4MA 1S7ZA 4U5BE 4YN0B 5DS5A 2P7VA 2J45A 2Y3HA 5BUOA 4BJ6A 3HTKC 4FX5A 2FFHA 2KW3C 2XRHA 2LSEA 4G7OF 1D0XA 1Z3IX 4K7BA 2MWQA 3EGXB 3DM9B 2A6EF 4ANJA 3S28A 1BR1A 4MQ9F 3WODF 2KJGA 5B1BC 3NDBB 4HE8D 1O5HA 3UGPA 3LJBA 3HJCA 1ZHYA 2A1DD 4A2NB 3JRTA 3EGDA 3UMKA 2EINC 4U5FE 1ST6A 3I4UA 3Q7LA 3EZIA 2NUTB 4LACB 3RFYA 3EGXA 3JCUQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BG0 A;  4CBE A; 
#chains in the Genus database with same CATH topology
 3ZWI A;  4XEF A;  1PD0 A;  3C8G B;  2BE5 F;  1RJ9 A;  3JYY A;  4O6M A;  3VRC A;  3ABM C;  1A7E A;  2Y3G A;  4IAO A;  2ZXR A;  2DI3 A;  4IAR A;  4GQH A;  2W9Y A;  1M6T A;  1K40 A;  4LDK A;  3FVY A;  5K0I A;  3C18 A;  3F47 A;  3LEO A;  2L7A A;  4AE4 A;  1FFT C;  2HV6 A;  2R7X A;  1H6G A;  2XLM A;  3ATP A;  3EJN A;  3NYJ A;  1M2V B;  5DLJ A;  4CS8 A;  5DQT A;  5D92 A;  5L0H A;  2AVK A;  3IQ6 A;  5E33 A;  1H7I A;  1D1B A;  1BR4 A;  1ZU5 A;  4CSA C;  2L81 A;  3BEH A;  1CGO A;  3MX3 A;  4JCZ A;  5KYW B;  1VTM P;  4G78 A;  3O10 A;  2PFD A;  3FOO A;  2R7Q A;  3US6 A;  2XM0 A;  1Z6A A;  2Y3D A;  4KC9 A;  1H9G A;  4OD5 A;  1HY5 A;  2NUP B;  5KYX B;  3ECS A;  3ZVR A;  4CDV A;  5KYU B;  3NMJ A;  3HLZ A;  3SNH A;  4JTD B;  4CBE A;  2EIL C;  3V5Y A;  2Y3B A;  3W2W A;  5E3A A;  4CJO A;  2Q3T A;  4U9E A;  4CDY A;  1HE1 A;  5KYN A;  1HW2 A;  1TWA A;  4C3B A;  3SXY A;  3RIP A;  4E0H A;  2PF4 E;  3G50 A;  3QMK A;  3POV A;  1LE4 A;  1ZU4 A;  3G4X A;  4RDA A;  3X1O A;  2R7V A;  4E7Z A;  2EPM X;  1C17 M;  2CNW D;  1RXQ A;  2IOQ A;  2JX0 A;  3AQC A;  4JZA A;  1HMO A;  3MBG A;  3FXH A;  3LLI A;  1BR2 A;  1HMD A;  1R5I D;  3SXM A;  4EIY A;  2YQY A;  3N0T A;  4YWQ A;  1GM5 A;  1B68 A;  1LI5 A;  3RQG A;  2Q4F A;  3RH3 A;  5BQI A;  3DE9 A;  3UR3 C;  3H2V A;  3MYF A;  1Q0D A;  3DAG A;  3K66 A;  3QW0 A;  2DB4 A;  3LNM B;  2Q9B A;  3DZA A;  3I5Q A;  2X51 A;  4NY3 A;  1I4Z A;  4PJN A;  4H54 A;  3GEE A;  3TK0 A;  3TUL A;  1TKN A;  3AQB A;  1KTM A;  3ASN C;  3C62 A;  3IHU A;  3SZR A;  2XLV A;  5KYU A;  1H9T A;  2OJE D;  3L8J A;  1LM3 B;  3EH2 A;  3GAN A;  1E86 A;  3T6J A;  1J8M F;  1FTS A;  1BDJ B;  1RKC A;  2Q9A A;  2YWA A;  3G4Z A;  3JSZ A;  4QDL A;  4DVZ A;  1OQC A;  1NFN A;  4XQ1 A;  3HNI A;  2XSE A;  3B9Q A;  2CYD A;  4OIO F;  4JC7 A;  1VYK A;  3RKO F;  3EG9 B;  3B0P A;  4JE9 A;  1OXK A;  2H7B A;  3Q6N A;  1OCZ C;  3DJU B;  4EHP A;  4C7O B;  1ZHW A;  2W4B A;  4MW3 A;  1QPU A;  1RJ9 B;  2Y39 A;  1JPN A;  1OR3 A;  3UNG C;  5GPG B;  4BG0 A;  3PMR A;  3I5P A;  3RQE A;  4XTK A;  4N6C A;  1V74 B;  4NTF A;  3U8P A;  2Y69 C;  2Q00 A;  4J32 B;  4X0R A;  1ORJ A;  2OOC A;  3JRM O;  2NSF A;  3A9C A;  1OW6 A;  2ASR A;  3K7D A;  4Z9I A;  3SYN A;  4ZLC A;  4BJT A;  1AEP A;  4O6Y A;  2UUH A;  2HJM A;  3C8G D;  4PJL A;  3JTL O;  4CS9 A;  1KU2 A;  2EPO A;  1OXB A;  5A6B A;  2V26 A;  4RD9 A;  1T6U A;  3EPV A;  3N2Z B;  3V7O A;  2J9W A;  3L8I A;  4XEK A;  4BJ5 A;  4WGZ A;  5FCL A;  3PHF 2;  4YT4 A;  2YL7 A;  4EKW A;  2ZXO A;  3DKA A;  4J30 B;  2CGE A;  4XPX A;  4G0H A;  3KMI A;  2G3V A;  4KNW A;  3LES A;  5EHH A;  4A4A A;  4J7Y A;  4MVZ A;  2YKZ A;  1PCX A;  3OEO A;  2HSQ A;  4BEM J;  2ZPA A;  4DBQ A;  1A7V A;  1IZM A;  1Q0M A;  3ASO C;  1ZYR F;  5F28 E;  4Z9J A;  4JJG A;  5T3T A;  1YJG A;  2LK4 A;  4MW8 A;  5L0F A;  4QI0 A;  1FMV A;  2HMQ A;  2YHS A;  4ULW A;  3DMD A;  3RYL A;  5KYX A;  2R7U A;  4XWJ A;  4ER9 A;  2KYH A;  5T3W A;  3U3B A;  5AC5 A;  1I5N A;  4F4B A;  4W8K A;  3MYI A;  4MVM A;  1JAF A;  1VK5 A;  3O6X A;  5HSW A;  1JMW A;  1DOW A;  1G5Z A;  2KC3 A;  2NPU A;  1T6I A;  5CI8 A;  1NLX A;  1K05 A;  3K1I A;  4U5G A;  4AL0 A;  1NBB A;  4BJ6 C;  5AC4 A;  4DRI B;  3HKK A;  3M4B A;  4R32 A;  3S0X A;  3EH1 A;  2MHR A;  1F1M A;  2LQG A;  2MYS A;  2VB6 A;  1FMW A;  3UMI A;  1OCC C;  2KSF A;  1BBH A;  4OIP F;  2DYS C;  1XWJ A;  1M56 C;  4IWB A;  5A6A A;  5JS5 A;  1LPE A;  1PV3 A;  3IPM O;  2ZD9 A;  4PFP A;  2WZF A;  3C8Z A;  3HNL A;  2R25 A;  3JZ0 A;  4MVU A;  3S27 A;  3WHN A;  4CJG A;  4G7H F;  1MMN A;  1AUE A;  1T9K A;  1WTY A;  3E9V A;  3K6B A;  3RVY A;  2VCA A;  2DYR C;  4WAB A;  4EUK B;  3U0C A;  1A7D A;  2LFF A;  4AE4 B;  4XLP F;  4JUR I;  2XXA B;  4DBR A;  3DE8 A;  4LAC B;  4MND A;  5TJ5 E;  1LKX A;  1NZE A;  2EIJ C;  1BZ4 A;  3FAP B;  1YA7 O;  4E18 A;  3DWW A;  2GAQ A;  4EWC A;  2NUP A;  3QVY A;  5F5F A;  3TQO A;  3Q6M A;  1ORS C;  2G3K A;  4O6N A;  3LNR A;  4ONS A;  5L0D A;  5CI9 A;  3EZH A;  3LEV A;  2X0C A;  4U5C E;  2LFD A;  1EA8 A;  3CQZ A;  4JTC B;  4YJW A;  2QE9 A;  1WAT A;  2WZL A;  2HV7 A;  1OR2 A;  5B3I A;  2OEV A;  1YYX A;  2B0H A;  3NYL A;  3SXK A;  1UG7 A;  2VC9 A;  5L3Q A;  1KNY A;  2YZS A;  2EPK X;  2IM8 A;  1G8X A;  3WG7 C;  4PR9 A;  4EBK A;  1NG1 A;  2OCC C;  4P9T A;  2L9J A;  4D4N A;  2IXP A;  2J8W A;  1FFH A;  5E2Q A;  3ZQY A;  4BPM A;  2CW0 F;  1GS9 A;  2H7O A;  4CS9 C;  5A6K A;  4PJJ A;  5A69 A;  3C63 A;  3QTH A;  1N1C A;  3S29 A;  1T6Q A;  3C8G A;  1FNT c;  2XS8 A;  4JEA A;  2WB7 A;  3T4R A;  1MNE A;  1ZZP A;  2YL0 A;  3H2U A;  3EHN A;  2I15 A;  2XL4 A;  3DXJ F;  2GDC A;  4UDV A;  2GWW A;  2M4E A;  3NRH A;  2GFH A;  2HJ3 A;  2LP4 A;  1WWP A;  2RSE B;  2WVN A;  3CSK A;  4N6H A;  1OW8 A;  4NQF A;  5L0C A;  4LLE A;  1Z63 A;  2VH3 A;  2XM4 A;  3EFO B;  3KPH A;  1O3U A;  2CNW A;  3T6B A;  1E85 A;  3NMI A;  4YT5 A;  4EBJ A;  2P61 A;  3LUT B;  3B0V C;  2W45 A;  1J8Y F;  3GOR A;  4BEJ A;  5EK0 A;  1U6H A;  5JLI A;  4H4K C;  2PNO A;  4U5H A;  1IW7 F;  3AG2 C;  3AGT A;  4FWV A;  1QZX A;  1YA9 A;  2KNH A;  4KNV A;  2JPU A;  3B29 A;  1LI7 A;  4I44 A;  1SF8 A;  2H7V C;  3DM5 A;  3RVZ A;  3U2L A;  4DOZ A;  1Y6D A;  2NSG A;  1QVX A;  2CDQ A;  1FR0 A;  3J06 A;  3SP1 A;  2D4U A;  3FMS A;  3AJM A;  2XS1 A;  5JRA A;  4XPY A;  2RD9 A;  3GEH A;  2R03 A;  4YL1 A;  3TOM A;  4DJ9 A;  5KYW A;  2R7W A;  4DRJ B;  1YDI A;  2ZXW C;  1ZHX A;  2H8A A;  2L6G A;  3NKE A;  4JTA B;  3U5S A;  1K04 A;  2R05 A;  2JD3 A;  5JT4 A;  3NKD A;  4B6I A;  5JSL A;  1D0Z A;  1DOV A;  1ZHT A;  2WVQ A;  1QKR A;  1D1A A;  3QW1 A;  2J7P D;  2A68 F;  3MLG A;  3DD7 A;  2O9X A;  2IXN A;  3GM2 A;  3NMK A;  4N06 A;  3TOL A;  1M57 C;  3EFO A;  3F46 A;  3KYJ A;  4PFO A;  4E0I A;  1O87 A;  3VF0 A;  4I1M A;  4U5E E;  1LS4 A;  1VB5 A;  4MTO A;  4U5D E;  2V3C C;  4CX9 A;  3ITF A;  2C03 A;  3X2Q C;  1SR2 A;  1U89 A;  2EIK C;  2QY9 A;  3RF3 A;  2XL8 A;  4CSA A;  2A0U A;  1MQV A;  1RCP A;  3C7J A;  2I8B A;  2QNL A;  3L34 A;  3JSE O;  1Q0F A;  1TQG A;  2NG1 A;  2Q7R A;  3TJ6 A;  2R9R B;  5DQZ A;  5A6J A;  1D0Y A;  3H65 A;  1SYQ A;  1VMA A;  2HZ8 A;  1Z23 A;  3GM1 A;  3QVZ A;  4JEB A;  1MMG A;  2BL2 A;  3UMH A;  3GOD A;  3IEE A;  3U8V A;  3B0U X;  3JYH A;  1G4U S;  1VLS A;  5E3C A;  3NG1 A;  3EQL F;  2HSB A;  3AG3 C;  4HEA J;  5DS6 A;  5A6B D;  2UUI A;  3W4Y A;  1Z5Z A;  5COM A;  4JRZ A;  2FAP B;  2J9U A;  4CIH A;  3KH2 A;  3NYM A;  2VCC A;  2J0X A;  5FZT A;  4CIP A;  4LDQ A;  1E83 A;  4M63 A;  2EPL X;  3ZIB A;  2LCH A;  2XLH A;  3W8H A;  2VAS A;  3AGU A;  4IB4 A;  1VOM A;  1YZC A;  3T6G B;  4DXW A;  3DI5 A;  4O79 A;  4FAP B;  4JIO A;  3CZ6 A;  4W8P A;  5L3V A;  2L6H A;  3T9O A;  2PX0 A;  3Q7G A;  1LS1 A;  4DRH B;  4PAC A;  1TWH A;  2XLO A;  1APC A;  1G4W R;  1Q0G A;  2YL1 A;  2E87 A;  5AGF A;  1CGN A;  1JR8 A;  5JUA A;  2OEX A;  2J0W A;  3E70 C;  1YAR O;  3UGO A;  2R7O A;  5KYY A;  1OKK D;  3W2V A;  5IY5 C;  5HV9 A;  4LER A;  4HFF B;  4YL0 A;  5COF A;  2OJQ A;  1W2W A;  1WAS A;  2GA0 A;  1Z7Q c;  3KL4 A;  2IXM A;  3OA1 A;  4XPW A;  5F5H A;  1E2X A;  4CS7 A;  1VYI A;  4PK4 A;  4L6R A;  4JVS A;  2VCB A;  4IRU A;  3U3F A;  4WGY A;  1JPJ A;  2HS5 A;  4XLN F;  1EKY A;  1TFK B;  1QLE C;  2FGY A;  4HFK B;  4RBN A;  4U9D A;  2R02 A;  2IXO A;  1MMD A;  1OCO C;  1ZW3 A;  2HMZ A;  2YLI A;  3CEX A;  2NUT A;  2BC5 A;  4P6I C;  4YT2 A;  2XLD A;  4NTA A;  2R7S A;  5D91 A;  1S05 A;  2G62 A;  3SEO A;  4KI2 A;  4Q7C A;  3ZTZ A;  3EGD B;  4O7G A;  4OIQ F;  1U0B B;  3V5Z A;  3K33 A;  2R7T A;  2YLG A;  2ETS A;  3K1H A;  4IJJ A;  2J9V A;  5CIV A;  1CPR A;  2Z15 A;  4EBB A;  2PX3 A;  2A0B A;  2XLE A;  1LE2 A;  1LVK A;  4OIN F;  1Q0K A;  2XLW A;  2XL6 A;  3MFN A;  4GYT A;  3DJN B;  1SZI A;  2J46 A;  1FAP B;  3W8I A;  3TD7 A;  3ZSU A;  1OCR C;  4DVY P;  2AWC A;  5BQH A;  1C02 A;  2LIG A;  4JW1 A;  4GEH A;  3L0I A;  4N4W A;  4OIR F;  3S84 A;  3N24 A;  1A0B A;  2KK1 A;  4G7Z F;  1V54 C;  2LD6 A;  4PJM A;  1TWC A;  1T5O A;  2TMV P;  1EI7 A;  3ZC4 A;  4YT8 A;  1M2V A;  4Q4Z F;  5DS4 A;  2HKV A;  3IQT A;  4CS8 C;  2CCY A;  3KKB A;  3BRJ A;  3GWN A;  3EG9 A;  2OG2 A;  1JOG A;  3ZTM A;  4QI2 A;  4E7S A;  2A6H F;  2QTV A;  3LS0 A;  3M1C B;  3U2M A;  1NU7 D;  2QUP A;  2PBE A;  3GM3 A;  3M15 A;  3QZC A;  4I3M A;  2YLD A;  3S90 A;  3O39 A;  2A69 F;  4JKV A;  3AOU A;  4AX2 A;  3SXZ A;  1NU9 C;  4BJ5 C;  2KGO A;  3LS1 A;  2XXA A;  3FAJ A;  4ULV A;  2C04 A;  3WAQ A;  2B0J A;  2L6F A;  1RKE A;  3AG1 C;  3PCV A;  5JVE A;  2P0N A;  1RMV A;  4YL3 A;  3ABL C;  1NFO A;  3CAX A;  3VAY A;  4YK5 A;  4FES A;  5DVW A;  2Q9C A;  4JJF A;  3OWT A;  4MVO A;  4MTG A;  2YVK A;  1EQ1 A;  3A11 A;  2OKU A;  1QQ3 A;  3S9O A;  3PDM P;  2OQM A;  1GGQ A;  1M2O A;  1E84 A;  1OKK A;  5L0J A;  1ZHZ A;  4Q5S F;  2P1A A;  3R2P A;  4KBL A;  4IAQ A;  4JCH A;  4I1O B;  4MS2 A;  3V5X A;  3ZQV A;  1VLT A;  1Y4C A;  1ZVZ A;  5COG A;  2WZG A;  4MVQ A;  3ZDL A;  3VM6 A;  4CDA A;  1TR2 A;  1XZP A;  4AK9 A;  2DGJ A;  4XEV A;  4LLC A;  2QLA A;  4C3E A;  2AP3 A;  3DAF A;  3EHM A;  5KYY B;  1MMA A;  1MND A;  2PP4 A;  3KYI A;  1V55 C;  2YEV A;  3FOP A;  2IYL D;  3VYW A;  4ZLD A;  1D1C A;  1TWG A;  2EIM C;  2ZXP A;  1WGW A;  2R7R A;  2WL8 A;  3LLK A;  3ABK C;  1T01 A;  2EPN A;  1YZA A;  4C7O A;  3JT1 A;  4OD4 A;  3ZG1 A;  1QSP A;  3FDQ A;  2P6V A;  5B1A C;  4C3D A;  2WVO A;  5JP7 A;  3FHD A;  1AVO B;  3R7C A;  3AG4 C;  1SMY F;  1C03 A;  3K1I C;  2J7P A;  4K0D A;  2KQ9 A;  5EGY A;  4BJ1 A;  3RQF A;  2D5R B;  4WJ0 A;  3LAY A;  5T1D B;  1PD1 A;  2W4M A;  1S7Z A;  4U5B E;  4YN0 B;  5DS5 A;  2YL3 A;  3IQC A;  2P7V A;  3B71 A;  1CGM E;  3RW0 A;  2J45 A;  1L7C A;  2Y3H A;  4BJ6 A;  5BUO A;  1L3P A;  3L1M A;  4MTF A;  1HW1 A;  3GEI A;  2IBF A;  1YYJ A;  3HTK C;  3M79 A;  4FX5 A;  2FFH A;  2KW3 C;  2XRH A;  2LSE A;  4G7O F;  1D0X A;  4D4X A;  4NCQ A;  1LIH A;  1ORY A;  4E17 A;  1A41 A;  1Z3I X;  4K7B A;  1WOL A;  2F22 A;  3M4C A;  4LDR A;  2MWQ A;  3EGX B;  1YVI A;  3HNK A;  3DM9 B;  2A6E F;  3O55 A;  4ANJ A;  2ICW G;  4MVR A;  3S28 A;  1BR1 A;  1WN0 A;  1OW7 A;  4MQ9 F;  4J7T A;  4K1O A;  3TJ5 A;  3WOD F;  2M64 A;  4NC3 A;  1UFB A;  2OU6 A;  2KJG A;  2AU5 A;  5B1B C;  3NDB B;  5B3S C;  4HE8 D;  1O5H A;  1YLM A;  4Z9H A;  5L0I A;  3UGP A;  3LJB A;  4MVS A;  1HE9 A;  3IQ5 A;  2HFI A;  3HJC A;  1ZHY A;  3U9M A;  1ZW2 A;  256B A;  2HUJ A;  4IGG A;  1XZQ A;  4NTB A;  1NSG B;  1TFO B;  2A1D D;  1YAU O;  4A2N B;  2AWY A;  5BQG A;  3JRT A;  1RKE B;  3GWL A;  1I4Y A;  3EGD A;  1JRA A;  3UMK A;  2J9B A;  1V4A A;  2EIN C;  4U5F E;  1ST6 A;  3U9J A;  3I4U A;  3Q7L A;  4P9F A;  1GQA A;  2YRF A;  3EZI A;  4AL1 A;  2NUT B;  5L0G A;  1R4T A;  3RFY A;  3EGX A;  3JCU Q;  3HNJ A;  1CPQ A; 
#chains in the Genus database with same CATH homology
 1PD0 A;  2BE5 F;  1RJ9 A;  4O6M A;  3ABM C;  2Y3G A;  4IAO A;  2ZXR A;  2W9Y A;  3FVY A;  3F47 A;  4AE4 A;  1FFT C;  2HV6 A;  2R7X A;  3EJN A;  3NYJ A;  1M2V B;  4CS8 A;  5DQT A;  5D92 A;  5E33 A;  1D1B A;  1BR4 A;  1ZU5 A;  4CSA C;  2L81 A;  3MX3 A;  5KYW B;  2PFD A;  2R7Q A;  1Z6A A;  2Y3D A;  4KC9 A;  4OD5 A;  2NUP B;  5KYX B;  3ECS A;  3ZVR A;  5KYU B;  3HLZ A;  3SNH A;  4CBE A;  2EIL C;  2Y3B A;  3W2W A;  5E3A A;  2Q3T A;  5KYN A;  1TWA A;  4C3B A;  3RIP A;  2PF4 E;  3QMK A;  3POV A;  1ZU4 A;  4RDA A;  3X1O A;  2R7V A;  4E7Z A;  2CNW D;  2IOQ A;  4JZA A;  3AQC A;  3LLI A;  1BR2 A;  3N0T A;  4YWQ A;  3RH3 A;  3UR3 C;  3DAG A;  3K66 A;  2Q9B A;  3DZA A;  3I5Q A;  2X51 A;  4NY3 A;  4PJN A;  1TKN A;  3AQB A;  3ASN C;  3SZR A;  5KYU A;  3EH2 A;  3GAN A;  3T6J A;  1J8M F;  1FTS A;  4QDL A;  3JSZ A;  2Q9A A;  4DVZ A;  2XSE A;  3B9Q A;  1VYK A;  3RKO F;  3EG9 B;  3B0P A;  2H7B A;  3Q6N A;  1OCZ C;  3DJU B;  4C7O B;  1ZHW A;  2W4B A;  2Y39 A;  1RJ9 B;  3UNG C;  1JPN A;  4BG0 A;  3PMR A;  3I5P A;  4XTK A;  2Y69 C;  4J32 B;  4X0R A;  3SYN A;  3K7D A;  4ZLC A;  4BJT A;  4O6Y A;  4PJL A;  4CS9 A;  1KU2 A;  2V26 A;  4RD9 A;  3EPV A;  3N2Z B;  3V7O A;  2J9W A;  5FCL A;  3PHF 2;  4YT4 A;  2ZXO A;  4J30 B;  2CGE A;  4G0H A;  3KMI A;  2G3V A;  4KNW A;  3LES A;  5EHH A;  4DBQ A;  1PCX A;  3OEO A;  2ZPA A;  1IZM A;  3ASO C;  1ZYR F;  5T3T A;  4JJG A;  4QI0 A;  1FMV A;  2YHS A;  4ULW A;  3RYL A;  3DMD A;  5KYX A;  2R7U A;  4XWJ A;  5T3W A;  4F4B A;  4W8K A;  3O6X A;  1VK5 A;  5HSW A;  5CI8 A;  4U5G A;  4BJ6 C;  3S0X A;  3EH1 A;  2MYS A;  2VB6 A;  1FMW A;  3UMI A;  1OCC C;  4OIP F;  2DYS C;  1M56 C;  4IWB A;  4PFP A;  2WZF A;  4OIO F;  3S27 A;  4G7H F;  1MMN A;  3E9V A;  3K6B A;  2DYR C;  4AE4 B;  4XLP F;  4JUR I;  2XXA B;  4DBR A;  4MND A;  1LKX A;  1NZE A;  2EIJ C;  4EWC A;  2NUP A;  5F5F A;  3Q6M A;  2G3K A;  4O6N A;  3LNR A;  5CI9 A;  3EZH A;  3LEV A;  4U5C E;  3CQZ A;  4YJW A;  2WZL A;  2HV7 A;  5L3Q A;  3NYL A;  2YZS A;  1G8X A;  3WG7 C;  1NG1 A;  2OCC C;  2L9J A;  2IXP A;  1FFH A;  5E2Q A;  2CW0 F;  2H7O A;  4CS9 C;  4PJJ A;  1N1C A;  3S29 A;  2WB7 A;  3T4R A;  1MNE A;  3EHN A;  2XL4 A;  3DXJ F;  2M4E A;  3NRH A;  2GFH A;  3CSK A;  2WVN A;  1Z63 A;  4LLE A;  2VH3 A;  3EFO B;  2CNW A;  3T6B A;  4YT5 A;  3B0V C;  2W45 A;  1J8Y F;  4BEJ A;  4H4K C;  4U5H A;  1IW7 F;  3AG2 C;  4FWV A;  1QZX A;  2KNH A;  4KNV A;  4I44 A;  1SF8 A;  2H7V C;  3DM5 A;  4DOZ A;  2CDQ A;  3SP1 A;  5KYW A;  2R7W A;  2ZXW C;  1ZHX A;  3NKE A;  2JD3 A;  3NKD A;  4B6I A;  1D0Z A;  1ZHT A;  2WVQ A;  1D1A A;  2J7P D;  2A68 F;  3MLG A;  3DD7 A;  2O9X A;  2IXN A;  4N06 A;  1M57 C;  3EFO A;  3F46 A;  4PFO A;  1O87 A;  4I1M A;  4U5E E;  4U5D E;  2V3C C;  3ITF A;  2C03 A;  3X2Q C;  2EIK C;  2QY9 A;  4CSA A;  2I8B A;  3L34 A;  5DQZ A;  2NG1 A;  1D0Y A;  3H65 A;  1VMA A;  1Z23 A;  1MMG A;  3UMH A;  3GOD A;  3IEE A;  3B0U X;  3JYH A;  5E3C A;  3NG1 A;  3EQL F;  3AG3 C;  4HEA J;  5DS6 A;  1Z5Z A;  2J9U A;  4CIH A;  3KH2 A;  3NYM A;  2J0X A;  4M63 A;  3ZIB A;  3W8H A;  2VAS A;  1VOM A;  4O79 A;  3CZ6 A;  5L3V A;  2PX0 A;  3Q7G A;  1LS1 A;  1TWH A;  2E87 A;  3UGO A;  3E70 C;  2J0W A;  2R7O A;  5KYY A;  1OKK D;  3W2V A;  5IY5 C;  4LER A;  4HFF B;  1W2W A;  3KL4 A;  2IXM A;  3OA1 A;  5F5H A;  4CS7 A;  1VYI A;  4PK4 A;  4JVS A;  4IRU A;  1JPJ A;  4XLN F;  2FGY A;  1QLE C;  4HFK B;  5DLJ A;  4RBN A;  4BJ5 A;  5B3S C;  1MMD A;  2IXO A;  1OCO C;  4YT2 A;  2NUT A;  4P6I C;  2R7S A;  5D91 A;  2G62 A;  3SEO A;  4KI2 A;  4Q7C A;  3EGD B;  4O7G A;  4OIQ F;  3K33 A;  2R7T A;  4IJJ A;  3K1H A;  2J9V A;  2Z15 A;  4EBB A;  2PX3 A;  1LVK A;  4OIN F;  4GYT A;  3DJN B;  1SZI A;  2J46 A;  3W8I A;  3TD7 A;  3ZSU A;  1OCR C;  4DVY P;  4JW1 A;  4GEH A;  3L0I A;  4OIR F;  3N24 A;  4G7Z F;  1V54 C;  4PJM A;  1TWC A;  3ZC4 A;  4YT8 A;  1M2V A;  4Q4Z F;  5DS4 A;  4CS8 C;  3KKB A;  3EG9 A;  2OG2 A;  4QI2 A;  4E7S A;  2A6H F;  2QTV A;  3M1C B;  3LS0 A;  1NU7 D;  3QZC A;  4I3M A;  3O39 A;  2A69 F;  4AX2 A;  1NU9 C;  4BJ5 C;  2KGO A;  3LS1 A;  2XXA A;  3FAJ A;  2C04 A;  2B0J A;  3AG1 C;  3ABL C;  3VAY A;  4FES A;  5DVW A;  2Q9C A;  4JJF A;  3OWT A;  1M2O A;  1OKK A;  1ZHZ A;  4Q5S F;  4KBL A;  4JCH A;  4I1O B;  2WZG A;  1TR2 A;  4AK9 A;  2DGJ A;  4LLC A;  4C3E A;  3DAF A;  5KYY B;  3EHM A;  1MMA A;  1MND A;  2PP4 A;  1V55 C;  2YEV A;  3VYW A;  2IYL D;  4ZLD A;  1D1C A;  1TWG A;  2EIM C;  2ZXP A;  1WGW A;  2R7R A;  2WL8 A;  3LLK A;  3ABK C;  4C7O A;  3JT1 A;  4OD4 A;  3ZG1 A;  3FDQ A;  2P6V A;  5B1A C;  4C3D A;  2WVO A;  3FHD A;  3AG4 C;  1SMY F;  3K1I C;  2J7P A;  4K0D A;  2KQ9 A;  5EGY A;  4BJ1 A;  2D5R B;  4WJ0 A;  3LAY A;  5T1D B;  1PD1 A;  2W4M A;  1S7Z A;  4U5B E;  4YN0 B;  5DS5 A;  2P7V A;  2J45 A;  2Y3H A;  5BUO A;  4BJ6 A;  3HTK C;  4FX5 A;  2FFH A;  2KW3 C;  2XRH A;  2LSE A;  4G7O F;  1D0X A;  1Z3I X;  4K7B A;  2MWQ A;  3EGX B;  3DM9 B;  2A6E F;  4ANJ A;  3S28 A;  1BR1 A;  4MQ9 F;  3WOD F;  2KJG A;  5B1B C;  3NDB B;  4HE8 D;  1O5H A;  3UGP A;  3LJB A;  3HJC A;  1ZHY A;  2A1D D;  4A2N B;  3JRT A;  3EGD A;  3UMK A;  2EIN C;  4U5F E;  1ST6 A;  3I4U A;  3Q7L A;  3EZI A;  2NUT B;  4LAC B;  3RFY A;  3EGX A;  3JCU Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...