4CBEA

Crystal structure of complement factors h and fhl-1 binding protein bbh06 or crasp-2 from borrelia burgdorferi (native)
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
214
structure length
209
Chain Sequence
GRLNQRNINELKIFVEKAKYYSIKLDAIYNECTGAYNDIMTYSSDQSKVNQAISIFKKDNKIVNKFKELEKIIEEYKPMFLSKLIDDFAIELDQAVDNDSNARHVADSYKKLRKSVVLAYIESFDVISSKFVDSKFVEASKKFVNKAKEFVEENDLIALECIVKTIGDMVNDREINSRSRYNNFYKKEADFLGAAVELEGAYKAIKQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords COMPLEMENT REGULATOR-ACQUIRING SURFACE PROTEIN 2 (CRASP-2)
publication title Structural Characterization of Cspz, a Complement Regulator Factor H and Fhl-1 Binding Protein from Borrelia Burgdorferi.
pubmed doi rcsb
source organism Borrelia burgdorferi
total genus 92
structure length 209
sequence length 214
ec nomenclature
pdb deposition date 2013-10-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1640 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4cbeA00
4BG0A 4CBEA
chains in the Genus database with same CATH superfamily
5JS5A 1OKKA 2WZFA 1MNEA 2NUTB 5L3QA 3GANA 4XPWA 3RVZA 3ZWIA 1E2XA 2CYDA 2M4EA 3PMRA 4H54A 3U3FA 3LS1A 4YJWA 2R7QA 2OCCC 2P6VA 3EGXA 3ZTZA 3U2MA 4AE4A 2CW0F 4BPMA 2R7UA 3N24A 2HMZA 1TWAA 3DXJF 3C63A 5HSWA 1O3UA 4UDVA 4ZLCA 1JRAA 1K04A 2ASRA 2A6HF 1O5HA 4G0HA 3JZ0A 2LP4A 3S28A 4E7ZA 2EPLX 1MMGA 1OW7A 3EH2A 3IQTA 3NMJA 1Z7Qc 3LEVA 4W8KA 1V54C 3JSEO 4JW1A 3QMKA 4RD9A 3X1OA 1YLMA 2IBFA 3CSKA 3NKDA 1XZPA 3S0XA 1HE1A 1RKEB 1W2WA 2GAQA 3AQBA 3LEOA 3DJUB 3GORA 2HKVA 4C3BA 2J0XA 3KYIA 2VCCA 4NY3A 3DM5A 3SXYA 2X51A 3B71A 3F47A 4P9TA 2R7XA 4BEMJ 3G4ZA 5E2QA 4GEHA 3ABLC 1OQCA 4LACB 5B3SC 2J7PA 1XWJA 2OEXA 4K7BA 4BG0A 4I44A 3ASOC 2H7VC 3I5PA 3ZC4A 2PBEA 1E85A 4JVSA 4HFFB 3VF0A 3H2VA 4DJ9A 5DS5A 2W45A 5KYXB 2Q9BA 1HMOA 2H7BA 2I8BA 3EH1A 4GQHA 4MVUA 5BUOA 3U3BA 1I5NA 4JCZA 3DKAA 3SXKA 4CDVA 2ZXRA 4CX9A 1GGQA 2VCBA 1G4US 2QTVA 1F1MA 2WZLA 5CIVA 2EPKX 3DAGA 2CCYA 1FR0A 4G78A 2HV7A 2Q3TA 1FAPB 3ZQVA 1VMAA 2Q00A 2YL7A 2EIJC 4CIHA 3B29A 1QVXA 3LNMB 4MVSA 4QI2A 2R7VA 1LI5A 4U5FE 4EBJA 3PDMP 1TWHA 4JE9A 4O79A 2G62A 2EPNA 3MFNA 4KBLA 5A6KA 1ZHXA 4JC7A 3S29A 1ORJA 3C7JA 5COMA 2L6GA 5GPGB 2WVOA 4G7HF 3UGPA 2A68F 3TD7A 4MVOA 3CZ6A 3NYMA 2WVQA 3DM9B 3TOMA 4E0HA 3Q7GA 1AUEA 3FOPA 4NTAA 4OD4A 3LUTB 3B0PA 1WATA 3NKEA 4YK5A 2XXAA 1S05A 1RCPA 4YL0A 4HFKB 3SNHA 4D4NA 1JR8A 3QTHA 3GM2A 1BR2A 1T9KA 2PNOA 4OD5A 4X0RA 3EG9B 1FTSA 4BJ6A 2EIMC 4ER9A 3RYLA 4E0IA 2YEVA 3CQZA 4CS9A 4IAQA 1Z3IX 1MQVA 3AOUA 1YYJA 2J9BA 1ORSC 2ZXPA 3FVYA 2NPUA 5COGA 2LSEA 1BR4A 3LLKA 1A7VA 3W2VA 5DS6A 3GM1A 4RBNA 5AC5A 2QNLA 256BA 1Q0KA 3RH3A 3RQEA 1YZAA 3GODA 2HMQA 1V74B 2ZXOA 3I5QA 4WGYA 1M6TA 3GEHA 1QKRA 3T6BA 1TWGA 2XS8A 4CS8A 1HMDA 2OJED 2HV6A 4O6MA 1C03A 5JRAA 2VASA 3ZVRA 4H4KC 4XEKA 2RD9A 2YVKA 3EGDB 3C8ZA 4MQ9F 4K0DA 2AWCA 1OCOC 2YL0A 1QZXA 1WN0A 3BRJA 2VH3A 2ICWG 3M4BA 3V5XA 1MNDA 3KH2A 1WASA 5L0HA 2KNHA 5L0JA 1T6IA 3DJNB 5JLIA 1LI7A 2FFHA 3SEOA 1FFTC 2YQYA 4M63A 3B0UX 5JUAA 4JTDB 4XLNF 2HSBA 4IARA 5COFA 2BE5F 4BEJA 3SZRA 2B0JA 5TJ5E 1G4WR 1WWPA 2L7AA 1LS4A 2RSEB 3DMDA 5KYUB 1HY5A 1U6HA 2YKZA 3MX3A 3S27A 4U5EE 1SMYF 1M57C 5CI9A 3N2ZB 1OR3A 4PACA 1Y4CA 1OW6A 2A6EF 3WHNA 1TWCA 2NG1A 1LS1A 2XLWA 4C3EA 4CSAA 1KNYA 2PFDA 2JX0A 2IM8A 1TR2A 3U2LA 2OJQA 2D4UA 3W2WA 3ZG1A 1PV3A 4AX2A 4DOZA 4XPXA 4YWQA 3VAYA 4CBEA 1SR2A 2LIGA 1IZMA 3K6BA 4BJ5A 2V3CC 3A9CA 2GFHA 2NUPB 1H9GA 3PHF2 3ASNC 1EKYA 1Q0FA 2CGEA 2R25A 1G8XA 4U9DA 1C17M 4N6HA 1NSGB 2EPMX 3QW0A 5JP7A 3GWNA 4JRZA 4P6IC 4LLCA 1I4YA 2Y69C 3U9JA 3UMHA 3TULA 3HNIA 3IHUA 4OIOF 2QUPA 1NFOA 3RVYA 4U9EA 2R9RB 5KYYB 1A7EA 2J9UA 1J8YF 3KMIA 1NFNA 4MTOA 2ZPAA 2CNWD 1D0XA 2VC9A 4JURI 5E3AA 2WVNA 2VB6A 5L0FA 3CEXA 2H8AA 1H9TA 1SYQA 2KQ9A 1MMNA 2V26A 3RIPA 3VRCA 4YT2A 3GWLA 4E17A 4IB4A 3C8GA 4Z9JA 1UG7A 4E18A 1ZW3A 2J8WA 5CI8A 1HW1A 1PD0A 1JPJA 4AK9A 3AJMA 3X2QC 2G3KA 2L9JA 3EQLF 2P1AA 3ITFA 1R4TA 4LDQA 4N06A 3MBGA 4CJOA 3U0CA 3TJ6A 3UNGC 1YZCA 3QVZA 1ZU5A 2AP3A 2C03A 4IGGA 4BJ1A 3U8VA 4HEAJ 2CDQA 2KK1A 3M79A 4BJ6C 3DE9A 4LLEA 5IY5C 4CS7A 3HNJA 4CS9C 3LESA 3JRTA 5FZTA 2R7OA 4EBBA 2J9VA 3S90A 3LAYA 2TMVP 2Q9AA 5KYWA 1I4ZA 3CAXA 3K1IC 4LDKA 3AQCA 2XLVA 4YT5A 3UMKA 4O6NA 3HTKC 2DB4A 1T5OA 2Q9CA 3ATPA 3UMIA 1GS9A 2AVKA 3WG7C 1EA8A 3K33A 2IXNA 4CS8C 3KPHA 5T3TA 4ULVA 1D0ZA 3ZQYA 1EQ1A 2R7SA 3J06A 2L81A 2AU5A 5AGFA 1D1BA 2Y3DA 4JTCB 4G7OF 1VB5A 3DWWA 1ST6A 2HUJA 2Y3GA 3DAFA 3EFOA 4QDLA 3JT1A 1YAUO 5F28E 3IQ6A 4DRJB 1E83A 4W8PA 1Z5ZA 4C7OA 1EI7A 1A41A 1ZW2A 2EINC 1QLEC 2DYSC 3FHDA 3F46A 2XLHA 1M2VA 1VK5A 4I1MA 3ECSA 4PJMA 1YARO 3POVA 4DBQA 1CPRA 4D4XA 1ZVZA 3JYYA 4O6YA 2JD3A 4BJTA 2YWAA 4OIRF 4N6CA 4YL3A 1Z6AA 5F5HA 3W8IA 3ZDLA 3K66A 3T6GB 5A6BD 1J8MF 1WOLA 3HNKA 3TQOA 5KYNA 2LK4A 2XM4A 2ZXWC 2QLAA 3M1CB 1YA7O 3MYIA 1OKKD 2NUTA 3NG1A 3NRHA 3A11A 1K05A 1CGNA 2R03A 3FXHA 4JJFA 4ONSA 4YT4A 3O6XA 3EPVA 4OIQF 3EGXB 2M64A 3EHMA 3OA1A 4AE4B 3RW0A 3SYNA 4DXWA 4XLPF 3VM6A 1BR1A 2I15A 2OOCA 4KC9A 1HW2A 3FOOA 3HLZA 4Z9IA 1A7DA 2YL1A 2HS5A 3DI5A 2LFDA 3OEOA 3L8IA 2J0WA 4CDAA 2EPOA 3LNRA 2Y39A 5E3CA 1LE2A 2XLDA 2F22A 3L34A 1WTYA 2YL3A 4CIPA 3IEEA 3RF3A 1Z63A 2LD6A 3B9QA 5AC4A 2LCHA 1LM3B 2YLGA 3NMKA 1OR2A 2IXPA 3JCUQ 1VLTA 5BQIA 5JT4A 5T1DB 3K7DA 1S7ZA 4EWCA 3GEIA 4J7YA 4XEVA 1VTMP 2O9XA 2KSFA 2MWQA 4YL1A 3DE8A 1NU7D 2XLOA 3EZHA 1YVIA 1IW7F 1JMWA 3NMIA 5T3WA 2XL6A 2VCAA 3HKKA 3DD7A 4J7TA 1CPQA 1SF8A 5DVWA 2J7PD 1FFHA 3DZAA 1OXKA 3M15A 5EHHA 4PR9A 3VYWA 2R7TA 3T9OA 1E86A 2HZ8A 4MTFA 3AG4C 5KYXA 1SZIA 3S9OA 4C3DA 1DOVA 1LVKA 3R7CA 3W4YA 1RMVA 2LQGA 3MLGA 1NU9C 2W9YA 3TK0A 2UUIA 2R7RA 1RXQA 3AG1C 3SXMA 5BQGA 1BZ4A 1RJ9A 3EFOB 2P7VA 5D92A 1JOGA 3O39A 4MVRA 4KI2A 1T01A 1NZEA 3UGOA 4IRUA 5F5FA 1Q0GA 1Q0DA 1UFBA 5D91A 4G7ZF 3IQ5A 3FAPB 5L0CA 2LFFA 4WABA 4XEFA 5K0IA 1YYXA 2H7OA 4EKWA 2AWYA 2A1DD 3R2PA 1L3PA 2DYRC 4JEAA 1K40A 4EUKB 1R5ID 2P61A 5JSLA 3B0VC 2G3VA 2YRFA 1O87A 5BQHA 1ZHTA 3L8JA 1PD1A 4YN0B 3UR3C 1ZZPA 1L7CA 2PX0A 5HV9A 4MW3A 2HJ3A 3RQFA 3ZIBA 2XXAB 1C02A 1N1CA 4NC3A 2HFIA 2XM0A 4A4AA 4U5BE 1D1AA 1FNTc 1U0BB 3JRMO 4DVZA 4KNWA 2GWWA 4QI0A 4OIPF 1AVOB 3EG9A 2OEVA 1ZYRF 1GQAA 4LERA 4RDAA 2IOQA 3K1HA 3LJBA 3SXZA 3WAQA 5A6JA 1QSPA 3T6JA 1ZHWA 1V55C 5E33A 3ABKC 2YLDA 3M4CA 2OQMA 1TFKB 1JAFA 3GM3A 1G5ZA 3Q6MA 3MYFA 5L3VA 1NBBA 1CGOA 3G50A 2GDCA 2XL8A 1MMDA 2KC3A 2JPUA 4K1OA 2EIKC 5DLJA 5DQTA 3TJ5A 4JJGA 4JKVA 2MYSA 2XSEA 3LLIA 4WGZA 4WJ0A 3QW1A 3EGDA 4DRIB 2L6FA 5A6AA 1FMVA 3O55A 4KNVA 3U8PA 3AGUA 3HJCA 4B6IA 3EZIA 1XZQA 1OXBA 3LS0A 3QZCA 4XPYA 4Z9HA 5B1BC 3US6A 5DS4A 1NLXA 3NDBB 1VOMA 4XTKA 4Q7CA 3AG3C 1T6QA 3HNLA 1QQ3A 2IYLD 3FAJA 3I4UA 3SP1A 3TOLA 2WL8A 4EBKA 2J9WA 4MVMA 3ZTMA 1APCA 2FAPB 5KYUA 1WGWA 3AGTA 2P0NA 1H7IA 2KW3C 1GM5A 3E9VA 4PFOA 1NG1A 2EILC 2IXOA 3OWTA 1V4AA 2DI3A 3EHNA 4FAPB 1T6UA 4FESA 3WODF 1LE4A 3EJNA 2BC5A 3KL4A 2XRHA 4PFPA 4ULWA 4ZLDA 4PJLA 4U5GA 2MHRA 2KGOA 1D0YA 4MS2A 4U5DE 4MTGA 2W4MA 2XS1A 4ANJA 2UUHA 3W8HA 2NUPA 1RJ9B 2GA0A 4DRHB 2OU6A 4CJGA 5L0IA 1VLSA 4EIYA 4MNDA 4CSAC 1U89A 4CDYA 2NSFA 2J46A 2OKUA 2XLMA 4PK4A 1BDJB 1TKNA 2D5RB 4J30B 5EGYA 4IWBA 1YJGA 2A0UA 2WB7A 3NYJA 4JCHA 4JZAA 3IPMO 5L0DA 4Q5SF 4BJ5C 2WZGA 4PJNA 2IXMA 3L1MA 4JIOA 3GEEA 2CNWA 2L6HA 4XWJA 4I3MA 5KYYA 1Q0MA 2C04A 2ETSA 1B68A 1Y6DA 3BEHA 3FMSA 3E70C 1DOWA 2X0CA 4XQ1A 3RKOF 1FMWA 1OCZC 4I1OB 2XLEA 3U9MA 2OG2A 3JSZA 4DBRA 3S84A 3C8GB 1OCCC 3JTLO 2PX3A 3IQCA 1MMAA 2NSGA 2R02A 3C8GD 2Q7RA 3RFYA 1M56C 3V5ZA 4GYTA 4LDRA 2HJMA 1TQGA 1OCRC 2W4BA 4FX5A 4IAOA 1D1CA 1RKEA 3JYHA 3T4RA 5EK0A 2B0HA 1YA9A 3K1IA 3N0TA 2Q4FA 3O10A 4E7SA 2XL4A 2ZD9A 4NTFA 2J45A 3Q6NA 2HSQA 4NCQA 4U5CE 3AG2C 4U5HA 3FDQA 1OW8A 2A0BA 1VYIA 4MW8A 2A69F 2Y3HA 4YT8A 5KYWB 3NYLA 1Z23A 1LIHA 3ABMC 3KKBA 2FGYA 4PJJA 1AEPA 4NTBA 1LPEA 2Z15A 1E84A 4NQFA 1CGME 1M2OA 4MVZA 3U5SA 3QVYA 4DVYP 3H2UA 5A69A 4AL1A 4J32B 4O7GA 4P9FA 3V7OA 1H6GA 1KU2A 1HE9A 4R32A 1QPUA 4HE8D 1JPNA 1ORYA 5B1AC 2PF4E 1TFOB 4L6RA 3V5YA 1KTMA 5DQZA 1ZHZA 1BBHA 4FWVA 5JVEA 2Y3BA 4JTAB 4Q4ZF 4C7OB 2KJGA 1PCXA 2YHSA 3C62A 2QY9A 4A2NB 1YDIA 2BL2A 1M2VB 4EHPA 3G4XA 1LKXA 3Q7LA 3L0IA 4JEBA 4MVQA 3RQGA 4AL0A 5B3IA 1VYKA 4F4BA 5A6BA 2QE9A 3KYJA 2R05A 1ZHYA 4OINF 2PP4A 1RKCA 2KYHA 2YLIA 3H65A 2DGJA 2E87A 2YZSA 4N4WA 1A0BA 4IJJA 3C18A 3ZSUA 5FCLA 5L0GA 3PCVA 2R7WA 1ZU4A
chains in the Genus database with same CATH topology
1OKKA 2WZFA 1MNEA 2NUTB 5L3QA 3GANA 2M4EA 3PMRA 3LS1A 4YJWA 2R7QA 2OCCC 2P6VA 3EGXA 4AE4A 2CW0F 2R7UA 3N24A 1TWAA 3DXJF 5HSWA 4ZLCA 4G0HA 2A6HF 1O5HA 4E7ZA 3S28A 1MMGA 3EH2A 3LEVA 4W8KA 1V54C 4JW1A 3QMKA 4RD9A 3X1OA 3CSKA 3NKDA 3S0XA 1W2WA 3AQBA 3DJUB 4C3BA 2J0XA 4NY3A 3DM5A 2X51A 3F47A 2R7XA 5E2QA 4GEHA 3ABLC 4LACB 5B3SC 2J7PA 4K7BA 4BG0A 4I44A 3ASOC 2H7VC 3I5PA 3ZC4A 4JVSA 4HFFB 5DS5A 2W45A 5KYXB 2Q9BA 2H7BA 2I8BA 3EH1A 5BUOA 2ZXRA 2QTVA 2WZLA 3DAGA 2HV7A 2Q3TA 1VMAA 2EIJC 4CIHA 4QI2A 2R7VA 4U5FE 1TWHA 4O79A 2G62A 4KBLA 1ZHXA 3S29A 2WVOA 4G7HF 3UGPA 2A68F 3TD7A 3CZ6A 3NYMA 2WVQA 3DM9B 3Q7GA 4OD4A 3B0PA 3NKEA 2XXAA 4HFKB 3SNHA 1BR2A 4OD5A 4X0RA 3EG9B 1FTSA 4BJ6A 2EIMC 3RYLA 2YEVA 3CQZA 4CS9A 1Z3IX 3FVYA 2ZXPA 2LSEA 1BR4A 3LLKA 3W2VA 5DS6A 4RBNA 3RH3A 3GODA 3I5QA 2ZXOA 3T6BA 1TWGA 4CS8A 2HV6A 4O6MA 2VASA 3ZVRA 4H4KC 3EGDB 4MQ9F 4K0DA 1OCOC 1QZXA 2VH3A 3KH2A 1MNDA 2KNHA 3DJNB 2FFHA 3SEOA 1FFTC 4M63A 3B0UX 4XLNF 2BE5F 4BEJA 3SZRA 2B0JA 3DMDA 5KYUB 3MX3A 3S27A 4U5EE 1SMYF 1M57C 5CI9A 3N2ZB 2A6EF 4CSAA 4C3EA 1TWCA 2NG1A 1LS1A 2PFDA 3W2WA 1TR2A 4DOZA 4AX2A 3ZG1A 4YWQA 3VAYA 4CBEA 1IZMA 3K6BA 4BJ5A 2V3CC 2GFHA 2NUPB 3PHF2 3ASNC 2CGEA 1G8XA 4P6IC 3UMHA 4OIOF 4LLCA 2Y69C 5KYYB 2J9UA 1J8YF 3KMIA 2ZPAA 2CNWD 1D0XA 4JURI 5E3AA 2WVNA 2VB6A 2V26A 2KQ9A 1MMNA 3RIPA 4YT2A 5CI8A 1PD0A 1JPJA 4AK9A 3X2QC 2G3KA 2L9JA 3EQLF 3ITFA 4N06A 3UNGC 1ZU5A 2C03A 4BJ1A 4HEAJ 2CDQA 4BJ6C 4LLEA 5IY5C 4CS7A 4CS9C 3LESA 3JRTA 4EBBA 2R7OA 2J9VA 3LAYA 2Q9AA 5KYWA 3K1IC 3AQCA 4YT5A 3UMKA 4O6NA 3HTKC 2Q9CA 3UMIA 3WG7C 3K33A 2IXNA 4CS8C 5T3TA 1D0ZA 2R7SA 2L81A 1D1BA 2Y3DA 4G7OF 3EFOA 1ST6A 2Y3GA 3DAFA 4QDLA 3JT1A 4C7OA 1Z5ZA 2EINC 1QLEC 2DYSC 3FHDA 3F46A 4PJMA 1M2VA 1VK5A 4I1MA 3ECSA 3POVA 4DBQA 4O6YA 2JD3A 4BJTA 4OIRF 3W8IA 1Z6AA 5F5HA 3K66A 1J8MF 5KYNA 2ZXWC 3M1CB 1OKKD 2NUTA 3NG1A 3NRHA 4JJFA 4YT4A 3O6XA 3EPVA 4OIQF 3EGXB 3EHMA 3OA1A 4AE4B 3SYNA 4XLPF 1BR1A 4KC9A 3HLZA 3OEOA 2J0WA 3LNRA 2Y39A 5E3CA 3L34A 1Z63A 3IEEA 3B9QA 2IXPA 3JCUQ 5T1DB 3K7DA 1S7ZA 4EWCA 2O9XA 2MWQA 1NU7D 3EZHA 1IW7F 5T3WA 3DD7A 1SF8A 5DVWA 2J7PD 1FFHA 3DZAA 5EHHA 3VYWA 2R7TA 3AG4C 5KYXA 1SZIA 4C3DA 1LVKA 3MLGA 1NU9C 2W9YA 2R7RA 3AG1C 5D92A 1RJ9A 3EFOB 2P7VA 3O39A 4KI2A 5F5FA 1NZEA 3UGOA 4IRUA 5D91A 4G7ZF 2H7OA 2A1DD 2DYRC 2G3VA 1O87A 1ZHTA 1PD1A 4YN0B 3UR3C 3B0VC 2PX0A 2XXAB 3ZIBA 1N1CA 4U5BE 1D1AA 4DVZA 4KNWA 4QI0A 4OIPF 3EG9A 1ZYRF 4LERA 4RDAA 2IOQA 3K1HA 3LJBA 3T6JA 1ZHWA 1V55C 5E33A 3ABKC 3Q6MA 5L3VA 1MMDA 2EIKC 5DLJA 5DQTA 4JJGA 2MYSA 2XSEA 3LLIA 4WJ0A 3EGDA 1FMVA 4KNVA 3HJCA 4B6IA 3EZIA 3LS0A 3QZCA 5DS4A 5B1BC 3NDBB 1VOMA 4XTKA 4Q7CA 3AG3C 2IYLD 3FAJA 3I4UA 3SP1A 2WL8A 2J9WA 5KYUA 1WGWA 2KW3C 3E9VA 4PFOA 1NG1A 2EILC 2IXOA 3OWTA 3EHNA 4FESA 3WODF 3EJNA 4ZLDA 3KL4A 2XRHA 4PFPA 4ULWA 4PJLA 4U5GA 2KGOA 1D0YA 4U5DE 2W4MA 4ANJA 3W8HA 2NUPA 1RJ9B 4CSAC 4MNDA 2J46A 4PK4A 5EGYA 1TKNA 2D5RB 4J30B 4IWBA 2WB7A 3NYJA 4JCHA 4JZAA 4Q5SF 4BJ5C 2WZGA 4PJNA 2IXMA 4XWJA 2CNWA 5KYYA 4I3MA 2C04A 3E70C 3RKOF 1FMWA 1OCZC 4I1OB 2OG2A 3JSZA 4DBRA 1OCCC 2PX3A 1MMAA 3RFYA 1M56C 4GYTA 4IAOA 1OCRC 2W4BA 4FX5A 1D1CA 3JYHA 3T4RA 3N0TA 4E7SA 2XL4A 2J45A 3Q6NA 4U5CE 3AG2C 4U5HA 3FDQA 4YT8A 1VYIA 2A69F 2Y3HA 5KYWB 3NYLA 1Z23A 3ABMC 3KKBA 2FGYA 4PJJA 2Z15A 1M2OA 4DVYP 4J32B 4O7GA 3V7OA 1KU2A 4HE8D 1JPNA 5B1AC 2PF4E 5DQZA 1ZHZA 4FWVA 2Y3BA 4C7OB 4Q4ZF 2KJGA 1PCXA 2YHSA 2QY9A 4A2NB 1M2VB 1LKXA 3Q7LA 3L0IA 1VYKA 4F4BA 1ZHYA 4OINF 2PP4A 3H65A 2DGJA 2E87A 2YZSA 3ZSUA 2R7WA 4IJJA 5FCLA 1ZU4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BG0 A;  4CBE A; 
#chains in the Genus database with same CATH topology
 5JS5 A;  1OKK A;  2WZF A;  1MNE A;  2NUT B;  5L3Q A;  3GAN A;  4XPW A;  3RVZ A;  3ZWI A;  1E2X A;  2CYD A;  2M4E A;  3PMR A;  4H54 A;  3U3F A;  3LS1 A;  4YJW A;  2R7Q A;  2OCC C;  2P6V A;  3EGX A;  3ZTZ A;  3U2M A;  4AE4 A;  2CW0 F;  4BPM A;  2R7U A;  3N24 A;  2HMZ A;  1TWA A;  3DXJ F;  3C63 A;  5HSW A;  1O3U A;  4UDV A;  4ZLC A;  1JRA A;  1K04 A;  2ASR A;  2A6H F;  1O5H A;  4G0H A;  3JZ0 A;  2LP4 A;  3S28 A;  4E7Z A;  2EPL X;  1MMG A;  1OW7 A;  3EH2 A;  3IQT A;  3NMJ A;  1Z7Q c;  3LEV A;  4W8K A;  1V54 C;  3JSE O;  4JW1 A;  3QMK A;  4RD9 A;  3X1O A;  1YLM A;  2IBF A;  3CSK A;  3NKD A;  1XZP A;  3S0X A;  1HE1 A;  1RKE B;  1W2W A;  2GAQ A;  3AQB A;  3LEO A;  3DJU B;  3GOR A;  2HKV A;  4C3B A;  2J0X A;  3KYI A;  2VCC A;  4NY3 A;  3DM5 A;  3SXY A;  2X51 A;  3B71 A;  3F47 A;  4P9T A;  2R7X A;  4BEM J;  3G4Z A;  5E2Q A;  4GEH A;  3ABL C;  1OQC A;  4LAC B;  5B3S C;  2J7P A;  1XWJ A;  2OEX A;  4K7B A;  4BG0 A;  4I44 A;  3ASO C;  2H7V C;  3I5P A;  3ZC4 A;  2PBE A;  1E85 A;  4JVS A;  4HFF B;  3VF0 A;  3H2V A;  4DJ9 A;  5DS5 A;  2W45 A;  5KYX B;  2Q9B A;  1HMO A;  2H7B A;  2I8B A;  3EH1 A;  4GQH A;  4MVU A;  5BUO A;  3U3B A;  1I5N A;  4JCZ A;  3DKA A;  3SXK A;  4CDV A;  2ZXR A;  4CX9 A;  1GGQ A;  2VCB A;  1G4U S;  2QTV A;  1F1M A;  2WZL A;  5CIV A;  2EPK X;  3DAG A;  2CCY A;  1FR0 A;  4G78 A;  2HV7 A;  2Q3T A;  1FAP B;  3ZQV A;  1VMA A;  2Q00 A;  2YL7 A;  2EIJ C;  4CIH A;  3B29 A;  1QVX A;  3LNM B;  4MVS A;  4QI2 A;  2R7V A;  1LI5 A;  4U5F E;  4EBJ A;  3PDM P;  1TWH A;  4JE9 A;  4O79 A;  2G62 A;  2EPN A;  3MFN A;  4KBL A;  5A6K A;  1ZHX A;  4JC7 A;  3S29 A;  1ORJ A;  3C7J A;  5COM A;  2L6G A;  5GPG B;  2WVO A;  4G7H F;  3UGP A;  2A68 F;  3TD7 A;  4MVO A;  3CZ6 A;  3NYM A;  2WVQ A;  3DM9 B;  3TOM A;  4E0H A;  3Q7G A;  1AUE A;  3FOP A;  4NTA A;  4OD4 A;  3LUT B;  3B0P A;  1WAT A;  3NKE A;  4YK5 A;  2XXA A;  1S05 A;  1RCP A;  4YL0 A;  4HFK B;  3SNH A;  4D4N A;  1JR8 A;  3QTH A;  3GM2 A;  1BR2 A;  1T9K A;  2PNO A;  4OD5 A;  4X0R A;  3EG9 B;  1FTS A;  4BJ6 A;  2EIM C;  4ER9 A;  3RYL A;  4E0I A;  2YEV A;  3CQZ A;  4CS9 A;  4IAQ A;  1Z3I X;  1MQV A;  3AOU A;  1YYJ A;  2J9B A;  1ORS C;  2ZXP A;  3FVY A;  2NPU A;  5COG A;  2LSE A;  1BR4 A;  3LLK A;  1A7V A;  3W2V A;  5DS6 A;  3GM1 A;  4RBN A;  5AC5 A;  2QNL A;  256B A;  1Q0K A;  3RH3 A;  3RQE A;  1YZA A;  3GOD A;  2HMQ A;  1V74 B;  2ZXO A;  3I5Q A;  4WGY A;  1M6T A;  3GEH A;  1QKR A;  3T6B A;  1TWG A;  2XS8 A;  4CS8 A;  1HMD A;  2OJE D;  2HV6 A;  4O6M A;  1C03 A;  5JRA A;  2VAS A;  3ZVR A;  4H4K C;  4XEK A;  2RD9 A;  2YVK A;  3EGD B;  3C8Z A;  4MQ9 F;  4K0D A;  2AWC A;  1OCO C;  2YL0 A;  1QZX A;  1WN0 A;  3BRJ A;  2VH3 A;  2ICW G;  3M4B A;  3V5X A;  1MND A;  3KH2 A;  1WAS A;  5L0H A;  2KNH A;  5L0J A;  1T6I A;  3DJN B;  5JLI A;  1LI7 A;  2FFH A;  3SEO A;  1FFT C;  2YQY A;  4M63 A;  3B0U X;  5JUA A;  4JTD B;  4XLN F;  2HSB A;  4IAR A;  5COF A;  2BE5 F;  4BEJ A;  3SZR A;  2B0J A;  5TJ5 E;  1G4W R;  1WWP A;  2L7A A;  1LS4 A;  2RSE B;  3DMD A;  5KYU B;  1HY5 A;  1U6H A;  2YKZ A;  3MX3 A;  3S27 A;  4U5E E;  1SMY F;  1M57 C;  5CI9 A;  3N2Z B;  1OR3 A;  4PAC A;  1Y4C A;  1OW6 A;  2A6E F;  3WHN A;  1TWC A;  2NG1 A;  1LS1 A;  2XLW A;  4C3E A;  4CSA A;  1KNY A;  2PFD A;  2JX0 A;  2IM8 A;  1TR2 A;  3U2L A;  2OJQ A;  2D4U A;  3W2W A;  3ZG1 A;  1PV3 A;  4AX2 A;  4DOZ A;  4XPX A;  4YWQ A;  3VAY A;  4CBE A;  1SR2 A;  2LIG A;  1IZM A;  3K6B A;  4BJ5 A;  2V3C C;  3A9C A;  2GFH A;  2NUP B;  1H9G A;  3PHF 2;  3ASN C;  1EKY A;  1Q0F A;  2CGE A;  2R25 A;  1G8X A;  4U9D A;  1C17 M;  4N6H A;  1NSG B;  2EPM X;  3QW0 A;  5JP7 A;  3GWN A;  4JRZ A;  4P6I C;  4LLC A;  1I4Y A;  2Y69 C;  3U9J A;  3UMH A;  3TUL A;  3HNI A;  3IHU A;  4OIO F;  2QUP A;  1NFO A;  3RVY A;  4U9E A;  2R9R B;  5KYY B;  1A7E A;  2J9U A;  1J8Y F;  3KMI A;  1NFN A;  4MTO A;  2ZPA A;  2CNW D;  1D0X A;  2VC9 A;  4JUR I;  5E3A A;  2WVN A;  2VB6 A;  5L0F A;  3CEX A;  2H8A A;  1H9T A;  1SYQ A;  2KQ9 A;  1MMN A;  2V26 A;  3RIP A;  3VRC A;  4YT2 A;  3GWL A;  4E17 A;  4IB4 A;  3C8G A;  4Z9J A;  1UG7 A;  4E18 A;  1ZW3 A;  2J8W A;  5CI8 A;  1HW1 A;  1PD0 A;  1JPJ A;  4AK9 A;  3AJM A;  3X2Q C;  2G3K A;  2L9J A;  3EQL F;  2P1A A;  3ITF A;  1R4T A;  4LDQ A;  4N06 A;  3MBG A;  4CJO A;  3U0C A;  3TJ6 A;  3UNG C;  1YZC A;  3QVZ A;  1ZU5 A;  2AP3 A;  2C03 A;  4IGG A;  4BJ1 A;  3U8V A;  4HEA J;  2CDQ A;  2KK1 A;  3M79 A;  4BJ6 C;  3DE9 A;  4LLE A;  5IY5 C;  4CS7 A;  3HNJ A;  4CS9 C;  3LES A;  3JRT A;  5FZT A;  2R7O A;  4EBB A;  2J9V A;  3S90 A;  3LAY A;  2TMV P;  2Q9A A;  5KYW A;  1I4Z A;  3CAX A;  3K1I C;  4LDK A;  3AQC A;  2XLV A;  4YT5 A;  3UMK A;  4O6N A;  3HTK C;  2DB4 A;  1T5O A;  2Q9C A;  3ATP A;  3UMI A;  1GS9 A;  2AVK A;  3WG7 C;  1EA8 A;  3K33 A;  2IXN A;  4CS8 C;  3KPH A;  5T3T A;  4ULV A;  1D0Z A;  3ZQY A;  1EQ1 A;  2R7S A;  3J06 A;  2L81 A;  2AU5 A;  5AGF A;  1D1B A;  2Y3D A;  4JTC B;  4G7O F;  1VB5 A;  3DWW A;  1ST6 A;  2HUJ A;  2Y3G A;  3DAF A;  3EFO A;  4QDL A;  3JT1 A;  1YAU O;  5F28 E;  3IQ6 A;  4DRJ B;  1E83 A;  4W8P A;  1Z5Z A;  4C7O A;  1EI7 A;  1A41 A;  1ZW2 A;  2EIN C;  1QLE C;  2DYS C;  3FHD A;  3F46 A;  2XLH A;  1M2V A;  1VK5 A;  4I1M A;  3ECS A;  4PJM A;  1YAR O;  3POV A;  4DBQ A;  1CPR A;  4D4X A;  1ZVZ A;  3JYY A;  4O6Y A;  2JD3 A;  4BJT A;  2YWA A;  4OIR F;  4N6C A;  4YL3 A;  1Z6A A;  5F5H A;  3W8I A;  3ZDL A;  3K66 A;  3T6G B;  5A6B D;  1J8M F;  1WOL A;  3HNK A;  3TQO A;  5KYN A;  2LK4 A;  2XM4 A;  2ZXW C;  2QLA A;  3M1C B;  1YA7 O;  3MYI A;  1OKK D;  2NUT A;  3NG1 A;  3NRH A;  3A11 A;  1K05 A;  1CGN A;  2R03 A;  3FXH A;  4JJF A;  4ONS A;  4YT4 A;  3O6X A;  3EPV A;  4OIQ F;  3EGX B;  2M64 A;  3EHM A;  3OA1 A;  4AE4 B;  3RW0 A;  3SYN A;  4DXW A;  4XLP F;  3VM6 A;  1BR1 A;  2I15 A;  2OOC A;  4KC9 A;  1HW2 A;  3FOO A;  3HLZ A;  4Z9I A;  1A7D A;  2YL1 A;  2HS5 A;  3DI5 A;  2LFD A;  3OEO A;  3L8I A;  2J0W A;  4CDA A;  2EPO A;  3LNR A;  2Y39 A;  5E3C A;  1LE2 A;  2XLD A;  2F22 A;  3L34 A;  1WTY A;  2YL3 A;  4CIP A;  3IEE A;  3RF3 A;  1Z63 A;  2LD6 A;  3B9Q A;  5AC4 A;  2LCH A;  1LM3 B;  2YLG A;  3NMK A;  1OR2 A;  2IXP A;  3JCU Q;  1VLT A;  5BQI A;  5JT4 A;  5T1D B;  3K7D A;  1S7Z A;  4EWC A;  3GEI A;  4J7Y A;  4XEV A;  1VTM P;  2O9X A;  2KSF A;  2MWQ A;  4YL1 A;  3DE8 A;  1NU7 D;  2XLO A;  3EZH A;  1YVI A;  1IW7 F;  1JMW A;  3NMI A;  5T3W A;  2XL6 A;  2VCA A;  3HKK A;  3DD7 A;  4J7T A;  1CPQ A;  1SF8 A;  5DVW A;  2J7P D;  1FFH A;  3DZA A;  1OXK A;  3M15 A;  5EHH A;  4PR9 A;  3VYW A;  2R7T A;  3T9O A;  1E86 A;  2HZ8 A;  4MTF A;  3AG4 C;  5KYX A;  1SZI A;  3S9O A;  4C3D A;  1DOV A;  1LVK A;  3R7C A;  3W4Y A;  1RMV A;  2LQG A;  3MLG A;  1NU9 C;  2W9Y A;  3TK0 A;  2UUI A;  2R7R A;  1RXQ A;  3AG1 C;  3SXM A;  5BQG A;  1BZ4 A;  1RJ9 A;  3EFO B;  2P7V A;  5D92 A;  1JOG A;  3O39 A;  4MVR A;  4KI2 A;  1T01 A;  1NZE A;  3UGO A;  4IRU A;  5F5F A;  1Q0G A;  1Q0D A;  1UFB A;  5D91 A;  4G7Z F;  3IQ5 A;  3FAP B;  5L0C A;  2LFF A;  4WAB A;  4XEF A;  5K0I A;  1YYX A;  2H7O A;  4EKW A;  2AWY A;  2A1D D;  3R2P A;  1L3P A;  2DYR C;  4JEA A;  1K40 A;  4EUK B;  1R5I D;  2P61 A;  5JSL A;  3B0V C;  2G3V A;  2YRF A;  1O87 A;  5BQH A;  1ZHT A;  3L8J A;  1PD1 A;  4YN0 B;  3UR3 C;  1ZZP A;  1L7C A;  2PX0 A;  5HV9 A;  4MW3 A;  2HJ3 A;  3RQF A;  3ZIB A;  2XXA B;  1C02 A;  1N1C A;  4NC3 A;  2HFI A;  2XM0 A;  4A4A A;  4U5B E;  1D1A A;  1FNT c;  1U0B B;  3JRM O;  4DVZ A;  4KNW A;  2GWW A;  4QI0 A;  4OIP F;  1AVO B;  3EG9 A;  2OEV A;  1ZYR F;  1GQA A;  4LER A;  4RDA A;  2IOQ A;  3K1H A;  3LJB A;  3SXZ A;  3WAQ A;  5A6J A;  1QSP A;  3T6J A;  1ZHW A;  1V55 C;  5E33 A;  3ABK C;  2YLD A;  3M4C A;  2OQM A;  1TFK B;  1JAF A;  3GM3 A;  1G5Z A;  3Q6M A;  3MYF A;  5L3V A;  1NBB A;  1CGO A;  3G50 A;  2GDC A;  2XL8 A;  1MMD A;  2KC3 A;  2JPU A;  4K1O A;  2EIK C;  5DLJ A;  5DQT A;  3TJ5 A;  4JJG A;  4JKV A;  2MYS A;  2XSE A;  3LLI A;  4WGZ A;  4WJ0 A;  3QW1 A;  3EGD A;  4DRI B;  2L6F A;  5A6A A;  1FMV A;  3O55 A;  4KNV A;  3U8P A;  3AGU A;  3HJC A;  4B6I A;  3EZI A;  1XZQ A;  1OXB A;  3LS0 A;  3QZC A;  4XPY A;  4Z9H A;  5B1B C;  3US6 A;  5DS4 A;  1NLX A;  3NDB B;  1VOM A;  4XTK A;  4Q7C A;  3AG3 C;  1T6Q A;  3HNL A;  1QQ3 A;  2IYL D;  3FAJ A;  3I4U A;  3SP1 A;  3TOL A;  2WL8 A;  4EBK A;  2J9W A;  4MVM A;  3ZTM A;  1APC A;  2FAP B;  5KYU A;  1WGW A;  3AGT A;  2P0N A;  1H7I A;  2KW3 C;  1GM5 A;  3E9V A;  4PFO A;  1NG1 A;  2EIL C;  2IXO A;  3OWT A;  1V4A A;  2DI3 A;  3EHN A;  4FAP B;  1T6U A;  4FES A;  3WOD F;  1LE4 A;  3EJN A;  2BC5 A;  3KL4 A;  2XRH A;  4PFP A;  4ULW A;  4ZLD A;  4PJL A;  4U5G A;  2MHR A;  2KGO A;  1D0Y A;  4MS2 A;  4U5D E;  4MTG A;  2W4M A;  2XS1 A;  4ANJ A;  2UUH A;  3W8H A;  2NUP A;  1RJ9 B;  2GA0 A;  4DRH B;  2OU6 A;  4CJG A;  5L0I A;  1VLS A;  4EIY A;  4MND A;  4CSA C;  1U89 A;  4CDY A;  2NSF A;  2J46 A;  2OKU A;  2XLM A;  4PK4 A;  1BDJ B;  1TKN A;  2D5R B;  4J30 B;  5EGY A;  4IWB A;  1YJG A;  2A0U A;  2WB7 A;  3NYJ A;  4JCH A;  4JZA A;  3IPM O;  5L0D A;  4Q5S F;  4BJ5 C;  2WZG A;  4PJN A;  2IXM A;  3L1M A;  4JIO A;  3GEE A;  2CNW A;  2L6H A;  4XWJ A;  4I3M A;  5KYY A;  1Q0M A;  2C04 A;  2ETS A;  1B68 A;  1Y6D A;  3BEH A;  3FMS A;  3E70 C;  1DOW A;  2X0C A;  4XQ1 A;  3RKO F;  1FMW A;  1OCZ C;  4I1O B;  2XLE A;  3U9M A;  2OG2 A;  3JSZ A;  4DBR A;  3S84 A;  3C8G B;  1OCC C;  3JTL O;  2PX3 A;  3IQC A;  1MMA A;  2NSG A;  2R02 A;  3C8G D;  2Q7R A;  3RFY A;  1M56 C;  3V5Z A;  4GYT A;  4LDR A;  2HJM A;  1TQG A;  1OCR C;  2W4B A;  4FX5 A;  4IAO A;  1D1C A;  1RKE A;  3JYH A;  3T4R A;  5EK0 A;  2B0H A;  1YA9 A;  3K1I A;  3N0T A;  2Q4F A;  3O10 A;  4E7S A;  2XL4 A;  2ZD9 A;  4NTF A;  2J45 A;  3Q6N A;  2HSQ A;  4NCQ A;  4U5C E;  3AG2 C;  4U5H A;  3FDQ A;  1OW8 A;  2A0B A;  1VYI A;  4MW8 A;  2A69 F;  2Y3H A;  4YT8 A;  5KYW B;  3NYL A;  1Z23 A;  1LIH A;  3ABM C;  3KKB A;  2FGY A;  4PJJ A;  1AEP A;  4NTB A;  1LPE A;  2Z15 A;  1E84 A;  4NQF A;  1CGM E;  1M2O A;  4MVZ A;  3U5S A;  3QVY A;  4DVY P;  3H2U A;  5A69 A;  4AL1 A;  4J32 B;  4O7G A;  4P9F A;  3V7O A;  1H6G A;  1KU2 A;  1HE9 A;  4R32 A;  1QPU A;  4HE8 D;  1JPN A;  1ORY A;  5B1A C;  2PF4 E;  1TFO B;  4L6R A;  3V5Y A;  1KTM A;  5DQZ A;  1ZHZ A;  1BBH A;  4FWV A;  5JVE A;  2Y3B A;  4JTA B;  4Q4Z F;  4C7O B;  2KJG A;  1PCX A;  2YHS A;  3C62 A;  2QY9 A;  4A2N B;  1YDI A;  2BL2 A;  1M2V B;  4EHP A;  3G4X A;  1LKX A;  3Q7L A;  3L0I A;  4JEB A;  4MVQ A;  3RQG A;  4AL0 A;  5B3I A;  1VYK A;  4F4B A;  5A6B A;  2QE9 A;  3KYJ A;  2R05 A;  1ZHY A;  4OIN F;  2PP4 A;  1RKC A;  2KYH A;  2YLI A;  3H65 A;  2DGJ A;  2E87 A;  2YZS A;  4N4W A;  1A0B A;  4IJJ A;  3C18 A;  3ZSU A;  5FCL A;  5L0G A;  3PCV A;  2R7W A;  1ZU4 A; 
#chains in the Genus database with same CATH homology
 1OKK A;  2WZF A;  1MNE A;  2NUT B;  5L3Q A;  3GAN A;  2M4E A;  3PMR A;  3LS1 A;  4YJW A;  2R7Q A;  2OCC C;  2P6V A;  3EGX A;  4AE4 A;  2CW0 F;  2R7U A;  3N24 A;  1TWA A;  3DXJ F;  5HSW A;  4ZLC A;  4G0H A;  2A6H F;  1O5H A;  4E7Z A;  3S28 A;  1MMG A;  3EH2 A;  3LEV A;  4W8K A;  1V54 C;  4JW1 A;  3QMK A;  4RD9 A;  3X1O A;  3CSK A;  3NKD A;  3S0X A;  1W2W A;  3AQB A;  3DJU B;  4C3B A;  2J0X A;  4NY3 A;  3DM5 A;  2X51 A;  3F47 A;  2R7X A;  5E2Q A;  4GEH A;  3ABL C;  4LAC B;  5B3S C;  2J7P A;  4K7B A;  4BG0 A;  4I44 A;  3ASO C;  2H7V C;  3I5P A;  3ZC4 A;  4JVS A;  4HFF B;  5DS5 A;  2W45 A;  5KYX B;  2Q9B A;  2H7B A;  2I8B A;  3EH1 A;  5BUO A;  2ZXR A;  2QTV A;  2WZL A;  3DAG A;  2HV7 A;  2Q3T A;  1VMA A;  2EIJ C;  4CIH A;  4QI2 A;  2R7V A;  4U5F E;  1TWH A;  4O79 A;  2G62 A;  4KBL A;  1ZHX A;  3S29 A;  2WVO A;  4G7H F;  3UGP A;  2A68 F;  3TD7 A;  3CZ6 A;  3NYM A;  2WVQ A;  3DM9 B;  3Q7G A;  4OD4 A;  3B0P A;  3NKE A;  2XXA A;  4HFK B;  3SNH A;  1BR2 A;  4OD5 A;  4X0R A;  3EG9 B;  1FTS A;  4BJ6 A;  2EIM C;  3RYL A;  2YEV A;  3CQZ A;  4CS9 A;  1Z3I X;  3FVY A;  2ZXP A;  2LSE A;  1BR4 A;  3LLK A;  3W2V A;  5DS6 A;  4RBN A;  3RH3 A;  3GOD A;  3I5Q A;  2ZXO A;  3T6B A;  1TWG A;  4CS8 A;  2HV6 A;  4O6M A;  2VAS A;  3ZVR A;  4H4K C;  3EGD B;  4MQ9 F;  4K0D A;  1OCO C;  1QZX A;  2VH3 A;  3KH2 A;  1MND A;  2KNH A;  3DJN B;  2FFH A;  3SEO A;  1FFT C;  4M63 A;  3B0U X;  4XLN F;  2BE5 F;  4BEJ A;  3SZR A;  2B0J A;  3DMD A;  5KYU B;  3MX3 A;  3S27 A;  4U5E E;  1SMY F;  1M57 C;  5CI9 A;  3N2Z B;  2A6E F;  4CSA A;  4C3E A;  1TWC A;  2NG1 A;  1LS1 A;  2PFD A;  3W2W A;  1TR2 A;  4DOZ A;  4AX2 A;  3ZG1 A;  4YWQ A;  3VAY A;  4CBE A;  1IZM A;  3K6B A;  4BJ5 A;  2V3C C;  2GFH A;  2NUP B;  3PHF 2;  3ASN C;  2CGE A;  1G8X A;  4P6I C;  3UMH A;  4OIO F;  4LLC A;  2Y69 C;  5KYY B;  2J9U A;  1J8Y F;  3KMI A;  2ZPA A;  2CNW D;  1D0X A;  4JUR I;  5E3A A;  2WVN A;  2VB6 A;  2V26 A;  2KQ9 A;  1MMN A;  3RIP A;  4YT2 A;  5CI8 A;  1PD0 A;  1JPJ A;  4AK9 A;  3X2Q C;  2G3K A;  2L9J A;  3EQL F;  3ITF A;  4N06 A;  3UNG C;  1ZU5 A;  2C03 A;  4BJ1 A;  4HEA J;  2CDQ A;  4BJ6 C;  4LLE A;  5IY5 C;  4CS7 A;  4CS9 C;  3LES A;  3JRT A;  4EBB A;  2R7O A;  2J9V A;  3LAY A;  2Q9A A;  5KYW A;  3K1I C;  3AQC A;  4YT5 A;  3UMK A;  4O6N A;  3HTK C;  2Q9C A;  3UMI A;  3WG7 C;  3K33 A;  2IXN A;  4CS8 C;  5T3T A;  1D0Z A;  2R7S A;  2L81 A;  1D1B A;  2Y3D A;  4G7O F;  3EFO A;  1ST6 A;  2Y3G A;  3DAF A;  4QDL A;  3JT1 A;  4C7O A;  1Z5Z A;  2EIN C;  1QLE C;  2DYS C;  3FHD A;  3F46 A;  4PJM A;  1M2V A;  1VK5 A;  4I1M A;  3ECS A;  3POV A;  4DBQ A;  4O6Y A;  2JD3 A;  4BJT A;  4OIR F;  3W8I A;  1Z6A A;  5F5H A;  3K66 A;  1J8M F;  5KYN A;  2ZXW C;  3M1C B;  1OKK D;  2NUT A;  3NG1 A;  3NRH A;  4JJF A;  4YT4 A;  3O6X A;  3EPV A;  4OIQ F;  3EGX B;  3EHM A;  3OA1 A;  4AE4 B;  3SYN A;  4XLP F;  1BR1 A;  4KC9 A;  3HLZ A;  3OEO A;  2J0W A;  3LNR A;  2Y39 A;  5E3C A;  3L34 A;  1Z63 A;  3IEE A;  3B9Q A;  2IXP A;  3JCU Q;  5T1D B;  3K7D A;  1S7Z A;  4EWC A;  2O9X A;  2MWQ A;  1NU7 D;  3EZH A;  1IW7 F;  5T3W A;  3DD7 A;  1SF8 A;  5DVW A;  2J7P D;  1FFH A;  3DZA A;  5EHH A;  3VYW A;  2R7T A;  3AG4 C;  5KYX A;  1SZI A;  4C3D A;  1LVK A;  3MLG A;  1NU9 C;  2W9Y A;  2R7R A;  3AG1 C;  5D92 A;  1RJ9 A;  3EFO B;  2P7V A;  3O39 A;  4KI2 A;  5F5F A;  1NZE A;  3UGO A;  4IRU A;  5D91 A;  4G7Z F;  2H7O A;  2A1D D;  2DYR C;  2G3V A;  1O87 A;  1ZHT A;  1PD1 A;  4YN0 B;  3UR3 C;  3B0V C;  2PX0 A;  2XXA B;  3ZIB A;  1N1C A;  4U5B E;  1D1A A;  4DVZ A;  4KNW A;  4QI0 A;  4OIP F;  3EG9 A;  1ZYR F;  4LER A;  4RDA A;  2IOQ A;  3K1H A;  3LJB A;  3T6J A;  1ZHW A;  1V55 C;  5E33 A;  3ABK C;  3Q6M A;  5L3V A;  1MMD A;  2EIK C;  5DLJ A;  5DQT A;  4JJG A;  2MYS A;  2XSE A;  3LLI A;  4WJ0 A;  3EGD A;  1FMV A;  4KNV A;  3HJC A;  4B6I A;  3EZI A;  3LS0 A;  3QZC A;  5DS4 A;  5B1B C;  3NDB B;  1VOM A;  4XTK A;  4Q7C A;  3AG3 C;  2IYL D;  3FAJ A;  3I4U A;  3SP1 A;  2WL8 A;  2J9W A;  5KYU A;  1WGW A;  2KW3 C;  3E9V A;  4PFO A;  1NG1 A;  2EIL C;  2IXO A;  3OWT A;  3EHN A;  4FES A;  3WOD F;  3EJN A;  4ZLD A;  3KL4 A;  2XRH A;  4PFP A;  4ULW A;  4PJL A;  4U5G A;  2KGO A;  1D0Y A;  4U5D E;  2W4M A;  4ANJ A;  3W8H A;  2NUP A;  1RJ9 B;  4CSA C;  4MND A;  2J46 A;  4PK4 A;  5EGY A;  1TKN A;  2D5R B;  4J30 B;  4IWB A;  2WB7 A;  3NYJ A;  4JCH A;  4JZA A;  4Q5S F;  4BJ5 C;  2WZG A;  4PJN A;  2IXM A;  4XWJ A;  2CNW A;  5KYY A;  4I3M A;  2C04 A;  3E70 C;  3RKO F;  1FMW A;  1OCZ C;  4I1O B;  2OG2 A;  3JSZ A;  4DBR A;  1OCC C;  2PX3 A;  1MMA A;  3RFY A;  1M56 C;  4GYT A;  4IAO A;  1OCR C;  2W4B A;  4FX5 A;  1D1C A;  3JYH A;  3T4R A;  3N0T A;  4E7S A;  2XL4 A;  2J45 A;  3Q6N A;  4U5C E;  3AG2 C;  4U5H A;  3FDQ A;  4YT8 A;  1VYI A;  2A69 F;  2Y3H A;  5KYW B;  3NYL A;  1Z23 A;  3ABM C;  3KKB A;  2FGY A;  4PJJ A;  2Z15 A;  1M2O A;  4DVY P;  4J32 B;  4O7G A;  3V7O A;  1KU2 A;  4HE8 D;  1JPN A;  5B1A C;  2PF4 E;  5DQZ A;  1ZHZ A;  4FWV A;  2Y3B A;  4C7O B;  4Q4Z F;  2KJG A;  1PCX A;  2YHS A;  2QY9 A;  4A2N B;  1M2V B;  1LKX A;  3Q7L A;  3L0I A;  1VYK A;  4F4B A;  1ZHY A;  4OIN F;  2PP4 A;  3H65 A;  2DGJ A;  2E87 A;  2YZS A;  3ZSU A;  2R7W A;  4IJJ A;  5FCL A;  1ZU4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...