4CBEA

Crystal structure of complement factors h and fhl-1 binding protein bbh06 or crasp-2 from borrelia burgdorferi (native)
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
214
structure length
209
Chain Sequence
b'GRLNQRNINELKIFVEKAKYYSIKLDAIYNECTGAYNDIMTYSSDQSKVNQAISIFKKDNKIVNKFKELEKIIEEYKPMFLSKLIDDFAIELDQAVDNDSNARHVADSYKKLRKSVVLAYIESFDVISSKFVDSKFVEASKKFVNKAKEFVEENDLIALECIVKTIGDMVNDREINSRSRYNNFYKKEADFLGAAVELEGAYKAIKQTL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COMPLEMENT REGULATOR-ACQUIRING SURFACE PROTEIN 2 (CRASP-2)
publication title Structural Characterization of Cspz, a Complement Regulator Factor H and Fhl-1 Binding Protein from Borrelia Burgdorferi.
pubmed doi rcsb
source organism Borrelia burgdorferi
molecule tags Cell adhesion
total genus 92
structure length 209
sequence length 214
ec nomenclature
pdb deposition date 2013-10-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1640 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4cbeA00
4BG0A 4CBEA
chains in the Genus database with same CATH superfamily
2X51A 1QKRA 5FCLA 1SF8A 1YARO 2ZXRA 4N6CA 4N4WA 4WJ0A 1CGOA 4MNDA 2WZGA 3DE8A 4MTFA 1T6IA 2H7BA 1I4YA 2C03A 2JPUA 2L9JA 2YLGA 4Q7CA 2BL2A 3BEHA 1OCCC 1FNTc 4E7SA 4XQ1A 2R7VA 1VLSA 1AUEA 2CDQA 1I4ZA 3IQ5A 3CEXA 2EIMC 4K7BA 2AVKA 4NC3A 3PDMP 3RF3A 4JEBA 4YL1A 5E33A 3W8HA 1J8MF 2H8AA 3UGPA 2O9XA 3KMIA 2UUIA 5COMA 1OQCA 3SEOA 1PD0A 1SR2A 4O6NA 2D4UA 2G62A 2OKUA 4CSAC 3DJUB 3DD7A 3LLKA 1QPUA 2PBEA 2NUPA 3SP1A 3CAXA 2I15A 5A6JA 5D92A 1A7EA 1NZEA 2IXPA 3MLGA 1LS1A 4WABA 3EHNA 4YJWA 4YN0B 1EQ1A 2GWWA 4FESA 3K66A 3LJBA 4E0IA 2OU6A 2QTVA 1N1CA 4JURI 4XLPF 1V55C 3ZC4A 1GS9A 1UFBA 1XZPA 2PF4E 4QI0A 4ONSA 2DYRC 3AG2C 3ATPA 2J0XA 4JE9A 4PJJA 4ZLCA 3RW0A 2YLDA 4OIQF 2NG1A 4C7OB 3ZTZA 3FAJA 4DVYP 5JRAA 2Z15A 2KQ9A 2Q00A 1LE4A 2ZXPA 4RD9A 4XWJA 4Z9IA 3VF0A 2Y3HA 5DQTA 2QY9A 1YDIA 2ZXWC 4CS9C 1D0XA 4AE4A 2H7VC 3EGXB 5DS5A 1FMVA 2HSBA 2J45A 3RVYA 3K33A 4NCQA 3I5PA 3U8VA 4CDYA 5AC4A 2QLAA 5L0CA 5T3TA 1G4US 4XEFA 4X0RA 3O6XA 2J9VA 4JTDB 3EH1A 3L1MA 4P9FA 3NYLA 2M64A 1BDJB 5TJ5E 2HMQA 3Q6MA 2HFIA 3EPVA 4CBEA 3IQCA 1OCOC 3RH3A 2XXAB 3IQTA 3UNGC 4J7YA 5F5HA 4JEAA 4MS2A 3VM6A 1Y6DA 3IEEA 1M2OA 3RQFA 3S90A 3DAFA 3JCUQ 2G3KA 1SMYF 1I5NA 1UG7A 4EUKB 2MWQA 3A11A 2PP4A 3M79A 2NUTB 4K0DA 4AL0A 2RSEB 5B3IA 3KYIA 3B29A 4O6YA 4A2NB 5F28E 3NYMA 1IW7F 1C17M 1QQ3A 2WB7A 3QZCA 3ABKC 1NSGB 1YLMA 3HLZA 4MTGA 3U8PA 3K7DA 1T01A 1V4AA 3O39A 2YEVA 1A7DA 4Z9HA 5A6KA 4JZAA 3K1HA 1HW2A 4CS8C 3HKKA 4U5GA 2Q3TA 4PACA 3DKAA 4BJ5A 1PV3A 3AG1C 5DQZA 1CPQA 1O3UA 2YLIA 3U0CA 2XLVA 3B0PA 3X2QC 3JRTA 3ABMC 1OCZC 1ZVZA 2KYHA 3NG1A 4NQFA 4OIRF 5K0IA 2YL0A 3DM5A 3FOOA 4IJJA 4PJLA 1WOLA 3EQLF 2MHRA 3V5YA 5L3VA 1C02A 2EPKX 1G4WR 4OINF 2Q9CA 3TQOA 4IAOA 1CGNA 2AP3A 4KC9A 2XLEA 1A0BA 4EIYA 2XL8A 3FAPB 4RDAA 3EHMA 1D1CA 2A0BA 1HE9A 1LI5A 2UUHA 4B6IA 4D4XA 2YHSA 3Q7LA 4C7OA 2VB6A 3ZG1A 4AX2A 5EHHA 5KYWA 4BEJA 5KYYB 1ZHTA 2L7AA 3DXJF 5E3AA 3SXKA 1FMWA 4DBRA 3NRHA 5EGYA 3NMIA 3PHF2 2QNLA 2YL1A 2LQGA 3EZIA 4KNWA 3X1OA 4BJ6A 2J0WA 4Q4ZF 3J06A 3EGXA 2EPOA 5F5FA 1KTMA 4YT2A 2CW0F 2R7XA 4E0HA 1ZHXA 1GM5A 5T3WA 1TR2A 3F46A 1YA7O 3TOMA 1U0BB 2L81A 3DE9A 3O10A 5B1BC 3H2VA 3KPHA 1BZ4A 1XWJA 2LFDA 3GORA 4DOZA 4ZLDA 2J8WA 2XS8A 4KBLA 5DLJA 3N0TA 5JSLA 2KNHA 2JD3A 1D0YA 1ORJA 4H4KC 4I1MA 4MW8A 5COGA 3SXMA 3GM1A 4ER9A 3HNKA 3M15A 2R25A 4LDQA 4O6MA 4WGYA 3OA1A 3TJ5A 4YWQA 5KYNA 1WGWA 2WVNA 3ITFA 4U9DA 4QDLA 3RKOF 1ORYA 2R05A 2XLMA 2AU5A 2HV6A 4O79A 4WGZA 3TD7A 1H9TA 3QW0A 3NDBB 5L3QA 4JJFA 2VC9A 4MVOA 2NUTA 2P61A 2BE5F 3QW1A 5EK0A 3GEIA 2Y3GA 2IXMA 2KSFA 3RQEA 5JS5A 3SZRA 1Z3IX 1MMGA 3C7JA 4XLNF 3UMKA 3U2LA 1TFOB 2NPUA 3CSKA 3U9JA 5IY5C 5JT4A 2EIKC 3WAQA 2XRHA 3PCVA 1NFNA 1VTMP 4R32A 3C8GB 3UMIA 4U5EE 3OWTA 1Q0MA 4CJOA 2P0NA 1Z6AA 3L8IA 1OR3A 1OW8A 2FFHA 2PX3A 2WVOA 3AQCA 4W8KA 1FFTC 4ULWA 3TULA 2HMZA 1T6QA 4YK5A 1LM3B 4U9EA 3DAGA 3FDQA 5L0HA 2E87A 3ABLC 4BJTA 1E84A 2ZXOA 2AWYA 4GQHA 3LNRA 1TWGA 1SZIA 4PJNA 4YT4A 3B0UX 1NFOA 3FMSA 2PX0A 2R7WA 2B0JA 2KW3C 1TWHA 4JCZA 2R7QA 4LLEA 4W8PA 2OOCA 3ZVRA 1S05A 4U5HA 2IYLD 3C18A 2IBFA 4MQ9F 4HFFB 2VCAA 2IXNA 4IAQA 4DXWA 3VYWA 5JP7A 4XPWA 2Y3DA 3S27A 4XPYA 1MNEA 5CI9A 2B0HA 1M2VB 3FOPA 5CI8A 4JJGA 3LS1A 3U3FA 2EINC 4HFKB 1M6TA 1Z63A 3IHUA 2XLOA 2IXOA 4NY3A 3W4YA 3N2ZB 3V5ZA 3AJMA 3OEOA 3M1CB 5A6BA 3K6BA 4E18A 1FTSA 3NYJA 5KYYA 2KC3A 3Q7GA 3VAYA 4PK4A 1ZW3A 2V26A 3ASNC 4AL1A 5AC5A 3DWWA 5DVWA 2LIGA 4JCHA 1G5ZA 3GWLA 1L3PA 4MVUA 2CGEA 1OR2A 4GEHA 1RXQA 4BJ5C 3DZAA 1LKXA 1KNYA 5KYXB 2W45A 1Z7Qc 4UDVA 3L8JA 3QVZA 1A41A 4JTAB 1YJGA 1OCRC 3MYFA 3W2WA 4XTKA 3FXHA 3TK0A 4Q5SF 1YVIA 2KGOA 1R5ID 1V54C 1F1MA 1A7VA 3JZ0A 2NSGA 1ZU5A 2VASA 2OJED 3JTLO 1VMAA 3O55A 3R2PA 2NSFA 4OD4A 5D91A 4QI2A 1O87A 2R02A 2ZD9A 2P6VA 1Q0DA 5KYUB 1EKYA 5E3CA 2P7VA 2WVQA 3HTKC 1O5HA 3WODF 4F4BA 4I3MA 3LESA 3SNHA 1RMVA 5E2QA 4J32B 4A4AA 2QE9A 4G7OF 4LDKA 5BQGA 1CGME 4EWCA 1Y4CA 2R7OA 4BJ6C 3HJCA 1T9KA 1H9GA 2JX0A 2XLWA 1ZHWA 1J8YF 3WG7C 3WHNA 5HSWA 1YZCA 2HS5A 3HNIA 3MYIA 1JOGA 4XEVA 2IM8A 4G7ZF 1U89A 5A6BD 4JTCB 4DRJB 2OEVA 4IGGA 3W2VA 2YRFA 1JPNA 2VCCA 1VB5A 2XM4A 3EH2A 2KK1A 3DJNB 5JLIA 1OXBA 2GA0A 1HMOA 5DS6A 1BR2A 1JRAA 1ZU4A 2Y69C 1LE2A 2D5RB 2LSEA 2A6EF 2XM0A 2WZLA 2XLHA 3E9VA 1PCXA 2YKZA 3HNLA 3F47A 4MVSA 1Q0FA 2LD6A 5L0GA 5A69A 3RVZA 2TMVP 3V7OA 2CYDA 3ASOC 3FHDA 3GANA 1LI7A 2OEXA 1M2VA 3IQ6A 4C3EA 1T6UA 3RQGA 3EG9B 2HJMA 2R03A 1T5OA 2QUPA 2Y3BA 256BA 2OJQA 3G4XA 4PR9A 5T1DB 3S29A 3JYHA 1SYQA 3ZWIA 1VLTA 2DI3A 1R4TA 2FGYA 3KL4A 3JRMO 1ZHYA 4HE8D 4IRUA 4KNVA 1OW7A 4MVQA 4PFOA 1QZXA 4EBJA 1MQVA 2WL8A 4HEAJ 4JC7A 4L6RA 2R7UA 1VOMA 1BR1A 3CZ6A 3LUTB 3NMKA 4JIOA 2YWAA 3HNJA 5B1AC 5KYXA 2Q9AA 2I8BA 1LS4A 3DI5A 3NKDA 3PMRA 1H7IA 3ZQYA 2A1DD 3N24A 4FX5A 2BC5A 2MYSA 4E7ZA 2X0CA 2J46A 3C8GD 3KYJA 1YAUO 2L6GA 1NU7D 4CIPA 1RKEB 2R9RB 2VCBA 3E70C 2XLDA 4I44A 1G8XA 3B9QA 3JYYA 1K05A 1OKKA 1YYXA 2F22A 2HUJA 3JSEO 2XXAA 2G3VA 4YL0A 4YT5A 3T6JA 4NTAA 3S9OA 1MNDA 1L7CA 3AG4C 1QLEC 2OG2A 1D1AA 1H6GA 1LPEA 4JRZA 2DB4A 2GDCA 4DBQA 4O7GA 4M63A 5L0IA 4AK9A 3SXYA 2YZSA 4RBNA 1DOWA 2W9YA 3T4RA 4FWVA 4BJ1A 2HV7A 3EFOB 2J7PA 2W4BA 3H65A 1D0ZA 2XS1A 1C03A 2R7SA 2W4MA 4OD5A 1HW1A 4OIOF 1NG1A 3V5XA 3UMHA 3TOLA 4MTOA 1W2WA 1CPRA 2R7RA 4C3BA 3POVA 2A68F 5JUAA 3LAYA 3US6A 2HSQA 3EGDB 4YL3A 2EIJC 4N6HA 4P9TA 4U5FE 5BQIA 4DJ9A 1E85A 4G78A 3G50A 3BRJA 4XEKA 2Q7RA 4CJGA 5CIVA 1YA9A 4NTFA 2GAQA 3U3BA 2CNWA 2EILC 1QSPA 1ZZPA 4JKVA 3LEVA 1FFHA 4EBBA 2HKVA 4OIPF 1TWAA 1XZQA 3EG9A 3MBGA 3K1IA 2L6FA 1OKKD 1OW6A 4H54A 4LERA 2GFHA 4ULVA 3L34A 4DRHB 2OQMA 3SXZA 4LDRA 5COFA 1BR4A 3ZQVA 2YVKA 2XL6A 1ZYRF 1NBBA 2PNOA 2H7OA 1FAPB 1ST6A 2CCYA 1ZW2A 4JW1A 1ORSC 3T6BA 4E17A 3LEOA 1Q0KA 4CDAA 1WN0A 4BG0A 3W8IA 5KYWB 3M4CA 3DMDA 2WZFA 1JAFA 2A0UA 3A9CA 2J7PD 3M4BA 1M57C 3ECSA 5GPGB 1VYKA 3NKEA 4P6IC 1TFKB 3VRCA 3B71A 3I4UA 1MMNA 4J30B 1RKEA 5L0DA 1RCPA 3KH2A 3I5QA 2LP4A 1WWPA 3IPMO 4G0HA 3ZDLA 5HV9A 4MVZA 4PJMA 2ZPAA 1YZAA 4CSAA 4NTBA 1E86A 1QVXA 2C04A 2Q9BA 3R7CA 4CX9A 1VYIA 1WASA 3GM2A 4IARA 3B0VC 3UGOA 1TWCA 3ZTMA 3QMKA 2DGJA 3AGTA 3H2UA 4EBKA 1ZHZA 3JSZA 1HMDA 1WTYA 3MFNA 4J7TA 3RYLA 1RJ9B 1Z5ZA 2CNWD 2IOQA 1EI7A 1KU2A 3QVYA 3SYNA 4U5CE 3C8GA 3EFOA 2R7TA 2FAPB 3LNMB 4BPMA 1FR0A 3RIPA 4DVZA 4K1OA 3AQBA 3TJ6A 1K40A 5BQHA 3GODA 1MMAA 5L0FA 2A6HF 2EPLX 2ICWG 3C62A 4CIHA 2PFDA 2DYSC 1S7ZA 3G4ZA 4CS9A 2RD9A 2XSEA 4Z9JA 3EGDA 1AVOB 2V3CC 1YYJA 5DS4A 1Q0GA 3FVYA 2Q4FA 3JT1A 1JR8A 5BUOA 4KI2A 1Z23A 4EKWA 2VH3A 2YQYA 3ZSUA 4DRIB 3C63A 3CQZA 3Q6NA 2LCHA 3EZHA 1VK5A 3U2MA 2NUPB 1B68A 4C3DA 4U5DE 1HE1A 5B3SC 4LACB 1GGQA 3ZIBA 1D1BA 1APCA 1DOVA 1NLXA 3GEEA 3S84A 3GEHA 2LK4A 2LFFA 4IB4A 1JMWA 3GM3A 2KJGA 1AEPA 2YL3A 2HJ3A 5FZTA 4MVMA 5L0JA 4LLCA 2YL7A 1LVKA 1LIHA 2L6HA 3KKBA 4IWBA 4I1OB 1RKCA 2P1AA 4CDVA 4MW3A 4CS7A 3U9MA 3MX3A 2Y39A 1K04A 2M4EA 1JPJA 3S28A 1TQGA 1V74B 4N06A 3EJNA 4JVSA 2EPNA 3AGUA 4GYTA 4D4NA 4AE4B 2ETSA 2ASRA 1MMDA 4CS8A 3T6GB 4FAPB 2OCCC 3C8ZA 4YT8A 3DM9B 2J9UA 3RFYA 1WATA 3UR3C 5KYUA 3L0IA 1EA8A 2J9BA 5A6AA 4EHPA 5AGFA 4BEMJ 1IZMA 4MVRA 3T9OA 3U5SA 2A69F 2AWCA 1M56C 4XPXA 4ANJA 1TKNA 3QTHA 4PFPA 1GQAA 3K1IC 1E83A 3LS0A 2EPMX 4U5BE 2XL4A 1HY5A 2J9WA 3AG3C 5JVEA 1RJ9A 1PD1A 1E2XA 3LLIA 1NU9C 3AOUA 3NMJA 3S0XA 4G7HF 2HZ8A 3GWNA 1OXKA 1BBHA 1U6HA
chains in the Genus database with same CATH topology
2X51A 5FCLA 1SF8A 2ZXRA 4WJ0A 4MNDA 2WZGA 5DQTA 2L9JA 2H7BA 2C03A 4Q7CA 1OCCC 4E7SA 2R7VA 2CDQA 2EIMC 4K7BA 5E33A 3W8HA 1J8MF 3UGPA 2O9XA 3KMIA 3SEOA 1PD0A 4O6NA 2G62A 4CSAC 3DJUB 3DD7A 3LLKA 2NUPA 3SP1A 5D92A 3MLGA 1NZEA 2IXPA 4YJWA 1LS1A 4YN0B 3EHNA 4FESA 3K66A 3LJBA 2QTVA 1N1CA 4JURI 4XLPF 1V55C 3ZC4A 2PF4E 4QI0A 2DYRC 3AG2C 4PJJA 2J0XA 4ZLCA 4OIQF 2NG1A 4C7OB 3FAJA 4DVYP 2Z15A 2KQ9A 2ZXPA 4RD9A 4XWJA 2Y3HA 2QY9A 4CS9C 2ZXWC 1D0XA 4AE4A 2H7VC 3EGXB 1FMVA 2J45A 3K33A 3I5PA 5T3TA 4X0RA 3O6XA 2J9VA 3EH1A 3NYLA 3Q6MA 3EPVA 4CBEA 1OCOC 3RH3A 2XXAB 3UNGC 5F5HA 3IEEA 1M2OA 3DAFA 3JCUQ 2G3KA 1SMYF 2R7WA 2MWQA 2PP4A 2NUTB 4K0DA 4O6YA 4A2NB 3NYMA 1IW7F 2WB7A 3QZCA 3ABKC 3HLZA 3K7DA 3O39A 2YEVA 4JZAA 3K1HA 4CS8C 4U5GA 2Q3TA 4BJ5A 3AG1C 5DQZA 3B0PA 3X2QC 3JRTA 3ABMC 1OCZC 4OIRF 3NG1A 3DM5A 4IJJA 4PJLA 3EQLF 5L3VA 4OINF 2Q9CA 4IAOA 4KC9A 4RDAA 3EHMA 1D1CA 4B6IA 2YHSA 3Q7LA 4C7OA 2VB6A 3ZG1A 4AX2A 5EHHA 5KYWA 4BEJA 5KYYB 1ZHTA 3DXJF 5E3AA 5EGYA 4DBRA 1FMWA 3NRHA 3PHF2 4BJ6A 3EZIA 4KNWA 3X1OA 2J0WA 4Q4ZF 3EGXA 5F5FA 4YT2A 2CW0F 2R7XA 1ZHXA 5T3WA 1TR2A 3F46A 2L81A 5B1BC 4ZLDA 4DOZA 5DLJA 4KBLA 3N0TA 2KNHA 2JD3A 1D0YA 4H4KC 4I1MA 2XXAA 5DS5A 4O6MA 4YWQA 3OA1A 5KYNA 1WGWA 2WVNA 3ITFA 4QDLA 3RKOF 4O79A 2HV6A 3TD7A 3NDBB 5L3QA 4JJFA 2NUTA 2BE5F 2Y3GA 2IXMA 3SZRA 1Z3IX 1MMGA 4XLNF 3UMKA 5IY5C 3CSKA 2EIKC 2XRHA 3UMIA 4U5EE 3OWTA 1Z6AA 4W8KA 2FFHA 2PX3A 2WVOA 3AQCA 1FFTC 4ULWA 3DAGA 3FDQA 2E87A 3ABLC 4BJTA 2ZXOA 4PJNA 3LNRA 1TWGA 1SZIA 4YT4A 3B0UX 2PX0A 2B0JA 2KW3C 1TWHA 3ZVRA 2R7QA 4LLEA 4U5HA 2IYLD 4MQ9F 4HFFB 2IXNA 3VYWA 2Y3DA 3S27A 1MNEA 5CI9A 1M2VB 5CI8A 4JJGA 3LS1A 1Z63A 2EINC 4HFKB 2R7RA 2IXOA 4NY3A 3N2ZB 3OEOA 3M1CB 3K6BA 1FTSA 3NYJA 5KYYA 3Q7GA 3VAYA 4PK4A 2V26A 3ASNC 5DVWA 4JCHA 2CGEA 4GEHA 4BJ5C 3DZAA 1LKXA 5KYXB 2W45A 1OCRC 3W2WA 4XTKA 4Q5SF 2KGOA 1V54C 1ZU5A 2VASA 1VMAA 5D91A 4QI2A 4OD4A 1O87A 2P6VA 5KYUB 5E3CA 2P7VA 2WVQA 3HTKC 1O5HA 3WODF 4F4BA 4I3MA 3LESA 3SNHA 5E2QA 4J32B 4G7OF 4EWCA 2R7OA 4BJ6C 3HJCA 1ZHWA 1J8YF 3WG7C 5HSWA 4G7ZF 3W2VA 1JPNA 3EH2A 3DJNB 5DS6A 1BR2A 1ZU4A 2Y69C 2D5RB 2LSEA 2A6EF 2WZLA 3E9VA 1PCXA 3F47A 3V7OA 3ASOC 3FHDA 3GANA 1M2VA 4C3EA 3EG9B 2Y3BA 5T1DB 3S29A 3JYHA 3KL4A 4HE8D 2FGYA 4PFOA 1ZHYA 4IRUA 4KNVA 1QZXA 2WL8A 4HEAJ 2R7UA 1VOMA 1BR1A 3CZ6A 5B1AC 5KYXA 3NKDA 2I8BA 2Q9AA 3PMRA 2A1DD 3N24A 4FX5A 2MYSA 4E7ZA 2J46A 1NU7D 3E70C 4I44A 1G8XA 3B9QA 1OKKA 2G3VA 4YT5A 3T6JA 1MNDA 3AG4C 1QLEC 2OG2A 1D1AA 4DBQA 4O7GA 4M63A 4AK9A 2YZSA 4RBNA 2W9YA 3T4RA 4FWVA 4BJ1A 2HV7A 3EFOB 2J7PA 2W4BA 3H65A 1D0ZA 2R7SA 2W4MA 4OD5A 4OIOF 1NG1A 3UMHA 1W2WA 4C3BA 3POVA 2A68F 3LAYA 3EGDB 2EIJC 4U5FE 2CNWA 2EILC 4EBBA 3LEVA 1FFHA 4OIPF 1TWAA 3EG9A 1OKKD 4LERA 2GFHA 3L34A 1BR4A 1ZYRF 2H7OA 4JW1A 1ST6A 3T6BA 4BG0A 3W8IA 5KYWB 3DMDA 2WZFA 2J7PD 1M57C 3ECSA 1VYKA 3NKEA 4P6IC 3I4UA 1MMNA 4J30B 3KH2A 3I5QA 4G0HA 4PJMA 2ZPAA 4CSAA 2Q9BA 2C04A 3B0VC 1VYIA 3UGOA 1TWCA 3QMKA 2DGJA 1ZHZA 3JSZA 3RYLA 1RJ9B 1Z5ZA 2CNWD 2IOQA 1KU2A 3SYNA 4U5CE 3EFOA 2R7TA 3RIPA 4DVZA 3AQBA 3GODA 1MMAA 2A6HF 4CIHA 2PFDA 2DYSC 1S7ZA 4CS9A 2XSEA 3EGDA 2V3CC 5DS4A 3FVYA 3JT1A 5BUOA 4KI2A 1Z23A 2VH3A 3ZSUA 3CQZA 3Q6NA 3EZHA 1VK5A 2NUPB 4C3DA 4U5DE 5B3SC 4LACB 3ZIBA 1D1BA 2KJGA 4LLCA 1LVKA 3KKBA 4IWBA 4I1OB 4CS7A 3MX3A 2Y39A 2M4EA 1JPJA 3S28A 4N06A 3EJNA 4JVSA 4GYTA 4AE4B 1MMDA 4CS8A 4YT8A 2OCCC 3DM9B 2J9UA 3RFYA 3UR3C 5KYUA 3L0IA 1IZMA 2A69F 1M56C 4ANJA 1TKNA 4PFPA 3K1IC 3LS0A 4U5BE 2XL4A 2J9WA 3AG3C 1RJ9A 1PD1A 3LLIA 1NU9C 3S0XA 4G7HF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BG0 A;  4CBE A; 
#chains in the Genus database with same CATH topology
 2X51 A;  1QKR A;  5FCL A;  1SF8 A;  1YAR O;  2ZXR A;  4N6C A;  4N4W A;  4WJ0 A;  1CGO A;  4MND A;  2WZG A;  3DE8 A;  4MTF A;  1T6I A;  2H7B A;  1I4Y A;  2C03 A;  2JPU A;  2L9J A;  2YLG A;  4Q7C A;  2BL2 A;  3BEH A;  1OCC C;  1FNT c;  4E7S A;  4XQ1 A;  2R7V A;  1VLS A;  1AUE A;  2CDQ A;  1I4Z A;  3IQ5 A;  3CEX A;  2EIM C;  4K7B A;  2AVK A;  4NC3 A;  3PDM P;  3RF3 A;  4JEB A;  4YL1 A;  5E33 A;  3W8H A;  1J8M F;  2H8A A;  3UGP A;  2O9X A;  3KMI A;  2UUI A;  5COM A;  1OQC A;  3SEO A;  1PD0 A;  1SR2 A;  4O6N A;  2D4U A;  2G62 A;  2OKU A;  4CSA C;  3DJU B;  3DD7 A;  3LLK A;  1QPU A;  2PBE A;  2NUP A;  3SP1 A;  3CAX A;  2I15 A;  5A6J A;  5D92 A;  1A7E A;  1NZE A;  2IXP A;  3MLG A;  1LS1 A;  4WAB A;  3EHN A;  4YJW A;  4YN0 B;  1EQ1 A;  2GWW A;  4FES A;  3K66 A;  3LJB A;  4E0I A;  2OU6 A;  2QTV A;  1N1C A;  4JUR I;  4XLP F;  1V55 C;  3ZC4 A;  1GS9 A;  1UFB A;  1XZP A;  2PF4 E;  4QI0 A;  4ONS A;  2DYR C;  3AG2 C;  3ATP A;  2J0X A;  4JE9 A;  4PJJ A;  4ZLC A;  3RW0 A;  2YLD A;  4OIQ F;  2NG1 A;  4C7O B;  3ZTZ A;  3FAJ A;  4DVY P;  5JRA A;  2Z15 A;  2KQ9 A;  2Q00 A;  1LE4 A;  2ZXP A;  4RD9 A;  4XWJ A;  4Z9I A;  3VF0 A;  2Y3H A;  5DQT A;  2QY9 A;  1YDI A;  2ZXW C;  4CS9 C;  1D0X A;  4AE4 A;  2H7V C;  3EGX B;  5DS5 A;  1FMV A;  2HSB A;  2J45 A;  3RVY A;  3K33 A;  4NCQ A;  3I5P A;  3U8V A;  4CDY A;  5AC4 A;  2QLA A;  5L0C A;  5T3T A;  1G4U S;  4XEF A;  4X0R A;  3O6X A;  2J9V A;  4JTD B;  3EH1 A;  3L1M A;  4P9F A;  3NYL A;  2M64 A;  1BDJ B;  5TJ5 E;  2HMQ A;  3Q6M A;  2HFI A;  3EPV A;  4CBE A;  3IQC A;  1OCO C;  3RH3 A;  2XXA B;  3IQT A;  3UNG C;  4J7Y A;  5F5H A;  4JEA A;  4MS2 A;  3VM6 A;  1Y6D A;  3IEE A;  1M2O A;  3RQF A;  3S90 A;  3DAF A;  3JCU Q;  2G3K A;  1SMY F;  1I5N A;  1UG7 A;  4EUK B;  2MWQ A;  3A11 A;  2PP4 A;  3M79 A;  2NUT B;  4K0D A;  4AL0 A;  2RSE B;  5B3I A;  3KYI A;  3B29 A;  4O6Y A;  4A2N B;  5F28 E;  3NYM A;  1IW7 F;  1C17 M;  1QQ3 A;  2WB7 A;  3QZC A;  3ABK C;  1NSG B;  1YLM A;  3HLZ A;  4MTG A;  3U8P A;  3K7D A;  1T01 A;  1V4A A;  3O39 A;  2YEV A;  1A7D A;  4Z9H A;  5A6K A;  4JZA A;  3K1H A;  1HW2 A;  4CS8 C;  3HKK A;  4U5G A;  2Q3T A;  4PAC A;  3DKA A;  4BJ5 A;  1PV3 A;  3AG1 C;  5DQZ A;  1CPQ A;  1O3U A;  2YLI A;  3U0C A;  2XLV A;  3B0P A;  3X2Q C;  3JRT A;  3ABM C;  1OCZ C;  1ZVZ A;  2KYH A;  3NG1 A;  4NQF A;  4OIR F;  5K0I A;  2YL0 A;  3DM5 A;  3FOO A;  4IJJ A;  4PJL A;  1WOL A;  3EQL F;  2MHR A;  3V5Y A;  5L3V A;  1C02 A;  2EPK X;  1G4W R;  4OIN F;  2Q9C A;  3TQO A;  4IAO A;  1CGN A;  2AP3 A;  4KC9 A;  2XLE A;  1A0B A;  4EIY A;  2XL8 A;  3FAP B;  4RDA A;  3EHM A;  1D1C A;  2A0B A;  1HE9 A;  1LI5 A;  2UUH A;  4B6I A;  4D4X A;  2YHS A;  3Q7L A;  4C7O A;  2VB6 A;  3ZG1 A;  4AX2 A;  5EHH A;  5KYW A;  4BEJ A;  5KYY B;  1ZHT A;  2L7A A;  3DXJ F;  5E3A A;  3SXK A;  1FMW A;  4DBR A;  3NRH A;  5EGY A;  3NMI A;  3PHF 2;  2QNL A;  2YL1 A;  2LQG A;  3EZI A;  4KNW A;  3X1O A;  4BJ6 A;  2J0W A;  4Q4Z F;  3J06 A;  3EGX A;  2EPO A;  5F5F A;  1KTM A;  4YT2 A;  2CW0 F;  2R7X A;  4E0H A;  1ZHX A;  1GM5 A;  5T3W A;  1TR2 A;  3F46 A;  1YA7 O;  3TOM A;  1U0B B;  2L81 A;  3DE9 A;  3O10 A;  5B1B C;  3H2V A;  3KPH A;  1BZ4 A;  1XWJ A;  2LFD A;  3GOR A;  4DOZ A;  4ZLD A;  2J8W A;  2XS8 A;  4KBL A;  5DLJ A;  3N0T A;  5JSL A;  2KNH A;  2JD3 A;  1D0Y A;  1ORJ A;  4H4K C;  4I1M A;  4MW8 A;  5COG A;  3SXM A;  3GM1 A;  4ER9 A;  3HNK A;  3M15 A;  2R25 A;  4LDQ A;  4O6M A;  4WGY A;  3OA1 A;  3TJ5 A;  4YWQ A;  5KYN A;  1WGW A;  2WVN A;  3ITF A;  4U9D A;  4QDL A;  3RKO F;  1ORY A;  2R05 A;  2XLM A;  2AU5 A;  2HV6 A;  4O79 A;  4WGZ A;  3TD7 A;  1H9T A;  3QW0 A;  3NDB B;  5L3Q A;  4JJF A;  2VC9 A;  4MVO A;  2NUT A;  2P61 A;  2BE5 F;  3QW1 A;  5EK0 A;  3GEI A;  2Y3G A;  2IXM A;  2KSF A;  3RQE A;  5JS5 A;  3SZR A;  1Z3I X;  1MMG A;  3C7J A;  4XLN F;  3UMK A;  3U2L A;  1TFO B;  2NPU A;  3CSK A;  3U9J A;  5IY5 C;  5JT4 A;  2EIK C;  3WAQ A;  2XRH A;  3PCV A;  1NFN A;  1VTM P;  4R32 A;  3C8G B;  3UMI A;  4U5E E;  3OWT A;  1Q0M A;  4CJO A;  2P0N A;  1Z6A A;  3L8I A;  1OR3 A;  1OW8 A;  2FFH A;  2PX3 A;  2WVO A;  3AQC A;  4W8K A;  1FFT C;  4ULW A;  3TUL A;  2HMZ A;  1T6Q A;  4YK5 A;  1LM3 B;  4U9E A;  3DAG A;  3FDQ A;  5L0H A;  2E87 A;  3ABL C;  4BJT A;  1E84 A;  2ZXO A;  2AWY A;  4GQH A;  3LNR A;  1TWG A;  1SZI A;  4PJN A;  4YT4 A;  3B0U X;  1NFO A;  3FMS A;  2PX0 A;  2R7W A;  2B0J A;  2KW3 C;  1TWH A;  4JCZ A;  2R7Q A;  4LLE A;  4W8P A;  2OOC A;  3ZVR A;  1S05 A;  4U5H A;  2IYL D;  3C18 A;  2IBF A;  4MQ9 F;  4HFF B;  2VCA A;  2IXN A;  4IAQ A;  4DXW A;  3VYW A;  5JP7 A;  4XPW A;  2Y3D A;  3S27 A;  4XPY A;  1MNE A;  5CI9 A;  2B0H A;  1M2V B;  3FOP A;  5CI8 A;  4JJG A;  3LS1 A;  3U3F A;  2EIN C;  4HFK B;  1M6T A;  1Z63 A;  3IHU A;  2XLO A;  2IXO A;  4NY3 A;  3W4Y A;  3N2Z B;  3V5Z A;  3AJM A;  3OEO A;  3M1C B;  5A6B A;  3K6B A;  4E18 A;  1FTS A;  3NYJ A;  5KYY A;  2KC3 A;  3Q7G A;  3VAY A;  4PK4 A;  1ZW3 A;  2V26 A;  3ASN C;  4AL1 A;  5AC5 A;  3DWW A;  5DVW A;  2LIG A;  4JCH A;  1G5Z A;  3GWL A;  1L3P A;  4MVU A;  2CGE A;  1OR2 A;  4GEH A;  1RXQ A;  4BJ5 C;  3DZA A;  1LKX A;  1KNY A;  5KYX B;  2W45 A;  1Z7Q c;  4UDV A;  3L8J A;  3QVZ A;  1A41 A;  4JTA B;  1YJG A;  1OCR C;  3MYF A;  3W2W A;  4XTK A;  3FXH A;  3TK0 A;  4Q5S F;  1YVI A;  2KGO A;  1R5I D;  1V54 C;  1F1M A;  1A7V A;  3JZ0 A;  2NSG A;  1ZU5 A;  2VAS A;  2OJE D;  3JTL O;  1VMA A;  3O55 A;  3R2P A;  2NSF A;  4OD4 A;  5D91 A;  4QI2 A;  1O87 A;  2R02 A;  2ZD9 A;  2P6V A;  1Q0D A;  5KYU B;  1EKY A;  5E3C A;  2P7V A;  2WVQ A;  3HTK C;  1O5H A;  3WOD F;  4F4B A;  4I3M A;  3LES A;  3SNH A;  1RMV A;  5E2Q A;  4J32 B;  4A4A A;  2QE9 A;  4G7O F;  4LDK A;  5BQG A;  1CGM E;  4EWC A;  1Y4C A;  2R7O A;  4BJ6 C;  3HJC A;  1T9K A;  1H9G A;  2JX0 A;  2XLW A;  1ZHW A;  1J8Y F;  3WG7 C;  3WHN A;  5HSW A;  1YZC A;  2HS5 A;  3HNI A;  3MYI A;  1JOG A;  4XEV A;  2IM8 A;  4G7Z F;  1U89 A;  5A6B D;  4JTC B;  4DRJ B;  2OEV A;  4IGG A;  3W2V A;  2YRF A;  1JPN A;  2VCC A;  1VB5 A;  2XM4 A;  3EH2 A;  2KK1 A;  3DJN B;  5JLI A;  1OXB A;  2GA0 A;  1HMO A;  5DS6 A;  1BR2 A;  1JRA A;  1ZU4 A;  2Y69 C;  1LE2 A;  2D5R B;  2LSE A;  2A6E F;  2XM0 A;  2WZL A;  2XLH A;  3E9V A;  1PCX A;  2YKZ A;  3HNL A;  3F47 A;  4MVS A;  1Q0F A;  2LD6 A;  5L0G A;  5A69 A;  3RVZ A;  2TMV P;  3V7O A;  2CYD A;  3ASO C;  3FHD A;  3GAN A;  1LI7 A;  2OEX A;  1M2V A;  3IQ6 A;  4C3E A;  1T6U A;  3RQG A;  3EG9 B;  2HJM A;  2R03 A;  1T5O A;  2QUP A;  2Y3B A;  256B A;  2OJQ A;  3G4X A;  4PR9 A;  5T1D B;  3S29 A;  3JYH A;  1SYQ A;  3ZWI A;  1VLT A;  2DI3 A;  1R4T A;  2FGY A;  3KL4 A;  3JRM O;  1ZHY A;  4HE8 D;  4IRU A;  4KNV A;  1OW7 A;  4MVQ A;  4PFO A;  1QZX A;  4EBJ A;  1MQV A;  2WL8 A;  4HEA J;  4JC7 A;  4L6R A;  2R7U A;  1VOM A;  1BR1 A;  3CZ6 A;  3LUT B;  3NMK A;  4JIO A;  2YWA A;  3HNJ A;  5B1A C;  5KYX A;  2Q9A A;  2I8B A;  1LS4 A;  3DI5 A;  3NKD A;  3PMR A;  1H7I A;  3ZQY A;  2A1D D;  3N24 A;  4FX5 A;  2BC5 A;  2MYS A;  4E7Z A;  2X0C A;  2J46 A;  3C8G D;  3KYJ A;  1YAU O;  2L6G A;  1NU7 D;  4CIP A;  1RKE B;  2R9R B;  2VCB A;  3E70 C;  2XLD A;  4I44 A;  1G8X A;  3B9Q A;  3JYY A;  1K05 A;  1OKK A;  1YYX A;  2F22 A;  2HUJ A;  3JSE O;  2XXA A;  2G3V A;  4YL0 A;  4YT5 A;  3T6J A;  4NTA A;  3S9O A;  1MND A;  1L7C A;  3AG4 C;  1QLE C;  2OG2 A;  1D1A A;  1H6G A;  1LPE A;  4JRZ A;  2DB4 A;  2GDC A;  4DBQ A;  4O7G A;  4M63 A;  5L0I A;  4AK9 A;  3SXY A;  2YZS A;  4RBN A;  1DOW A;  2W9Y A;  3T4R A;  4FWV A;  4BJ1 A;  2HV7 A;  3EFO B;  2J7P A;  2W4B A;  3H65 A;  1D0Z A;  2XS1 A;  1C03 A;  2R7S A;  2W4M A;  4OD5 A;  1HW1 A;  4OIO F;  1NG1 A;  3V5X A;  3UMH A;  3TOL A;  4MTO A;  1W2W A;  1CPR A;  2R7R A;  4C3B A;  3POV A;  2A68 F;  5JUA A;  3LAY A;  3US6 A;  2HSQ A;  3EGD B;  4YL3 A;  2EIJ C;  4N6H A;  4P9T A;  4U5F E;  5BQI A;  4DJ9 A;  1E85 A;  4G78 A;  3G50 A;  3BRJ A;  4XEK A;  2Q7R A;  4CJG A;  5CIV A;  1YA9 A;  4NTF A;  2GAQ A;  3U3B A;  2CNW A;  2EIL C;  1QSP A;  1ZZP A;  4JKV A;  3LEV A;  1FFH A;  4EBB A;  2HKV A;  4OIP F;  1TWA A;  1XZQ A;  3EG9 A;  3MBG A;  3K1I A;  2L6F A;  1OKK D;  1OW6 A;  4H54 A;  4LER A;  2GFH A;  4ULV A;  3L34 A;  4DRH B;  2OQM A;  3SXZ A;  4LDR A;  5COF A;  1BR4 A;  3ZQV A;  2YVK A;  2XL6 A;  1ZYR F;  1NBB A;  2PNO A;  2H7O A;  1FAP B;  1ST6 A;  2CCY A;  1ZW2 A;  4JW1 A;  1ORS C;  3T6B A;  4E17 A;  3LEO A;  1Q0K A;  4CDA A;  1WN0 A;  4BG0 A;  3W8I A;  5KYW B;  3M4C A;  3DMD A;  2WZF A;  1JAF A;  2A0U A;  3A9C A;  2J7P D;  3M4B A;  1M57 C;  3ECS A;  5GPG B;  1VYK A;  3NKE A;  4P6I C;  1TFK B;  3VRC A;  3B71 A;  3I4U A;  1MMN A;  4J30 B;  1RKE A;  5L0D A;  1RCP A;  3KH2 A;  3I5Q A;  2LP4 A;  1WWP A;  3IPM O;  4G0H A;  3ZDL A;  5HV9 A;  4MVZ A;  4PJM A;  2ZPA A;  1YZA A;  4CSA A;  4NTB A;  1E86 A;  1QVX A;  2C04 A;  2Q9B A;  3R7C A;  4CX9 A;  1VYI A;  1WAS A;  3GM2 A;  4IAR A;  3B0V C;  3UGO A;  1TWC A;  3ZTM A;  3QMK A;  2DGJ A;  3AGT A;  3H2U A;  4EBK A;  1ZHZ A;  3JSZ A;  1HMD A;  1WTY A;  3MFN A;  4J7T A;  3RYL A;  1RJ9 B;  1Z5Z A;  2CNW D;  2IOQ A;  1EI7 A;  1KU2 A;  3QVY A;  3SYN A;  4U5C E;  3C8G A;  3EFO A;  2R7T A;  2FAP B;  3LNM B;  4BPM A;  1FR0 A;  3RIP A;  4DVZ A;  4K1O A;  3AQB A;  3TJ6 A;  1K40 A;  5BQH A;  3GOD A;  1MMA A;  5L0F A;  2A6H F;  2EPL X;  2ICW G;  3C62 A;  4CIH A;  2PFD A;  2DYS C;  1S7Z A;  3G4Z A;  4CS9 A;  2RD9 A;  2XSE A;  4Z9J A;  3EGD A;  1AVO B;  2V3C C;  1YYJ A;  5DS4 A;  1Q0G A;  3FVY A;  2Q4F A;  3JT1 A;  1JR8 A;  5BUO A;  4KI2 A;  1Z23 A;  4EKW A;  2VH3 A;  2YQY A;  3ZSU A;  4DRI B;  3C63 A;  3CQZ A;  3Q6N A;  2LCH A;  3EZH A;  1VK5 A;  3U2M A;  2NUP B;  1B68 A;  4C3D A;  4U5D E;  1HE1 A;  5B3S C;  4LAC B;  1GGQ A;  3ZIB A;  1D1B A;  1APC A;  1DOV A;  1NLX A;  3GEE A;  3S84 A;  3GEH A;  2LK4 A;  2LFF A;  4IB4 A;  1JMW A;  3GM3 A;  2KJG A;  1AEP A;  2YL3 A;  2HJ3 A;  5FZT A;  4MVM A;  5L0J A;  4LLC A;  2YL7 A;  1LVK A;  1LIH A;  2L6H A;  3KKB A;  4IWB A;  4I1O B;  1RKC A;  2P1A A;  4CDV A;  4MW3 A;  4CS7 A;  3U9M A;  3MX3 A;  2Y39 A;  1K04 A;  2M4E A;  1JPJ A;  3S28 A;  1TQG A;  1V74 B;  4N06 A;  3EJN A;  4JVS A;  2EPN A;  3AGU A;  4GYT A;  4D4N A;  4AE4 B;  2ETS A;  2ASR A;  1MMD A;  4CS8 A;  3T6G B;  4FAP B;  2OCC C;  3C8Z A;  4YT8 A;  3DM9 B;  2J9U A;  3RFY A;  1WAT A;  3UR3 C;  5KYU A;  3L0I A;  1EA8 A;  2J9B A;  5A6A A;  4EHP A;  5AGF A;  4BEM J;  1IZM A;  4MVR A;  3T9O A;  3U5S A;  2A69 F;  2AWC A;  1M56 C;  4XPX A;  4ANJ A;  1TKN A;  3QTH A;  4PFP A;  1GQA A;  3K1I C;  1E83 A;  3LS0 A;  2EPM X;  4U5B E;  2XL4 A;  1HY5 A;  2J9W A;  3AG3 C;  5JVE A;  1RJ9 A;  1PD1 A;  1E2X A;  3LLI A;  1NU9 C;  3AOU A;  3NMJ A;  3S0X A;  4G7H F;  2HZ8 A;  3GWN A;  1OXK A;  1BBH A;  1U6H A; 
#chains in the Genus database with same CATH homology
 2X51 A;  5FCL A;  1SF8 A;  2ZXR A;  4WJ0 A;  4MND A;  2WZG A;  5DQT A;  2L9J A;  2H7B A;  2C03 A;  4Q7C A;  1OCC C;  4E7S A;  2R7V A;  2CDQ A;  2EIM C;  4K7B A;  5E33 A;  3W8H A;  1J8M F;  3UGP A;  2O9X A;  3KMI A;  3SEO A;  1PD0 A;  4O6N A;  2G62 A;  4CSA C;  3DJU B;  3DD7 A;  3LLK A;  2NUP A;  3SP1 A;  5D92 A;  3MLG A;  1NZE A;  2IXP A;  4YJW A;  1LS1 A;  4YN0 B;  3EHN A;  4FES A;  3K66 A;  3LJB A;  2QTV A;  1N1C A;  4JUR I;  4XLP F;  1V55 C;  3ZC4 A;  2PF4 E;  4QI0 A;  2DYR C;  3AG2 C;  4PJJ A;  2J0X A;  4ZLC A;  4OIQ F;  2NG1 A;  4C7O B;  3FAJ A;  4DVY P;  2Z15 A;  2KQ9 A;  2ZXP A;  4RD9 A;  4XWJ A;  2Y3H A;  2QY9 A;  4CS9 C;  2ZXW C;  1D0X A;  4AE4 A;  2H7V C;  3EGX B;  1FMV A;  2J45 A;  3K33 A;  3I5P A;  5T3T A;  4X0R A;  3O6X A;  2J9V A;  3EH1 A;  3NYL A;  3Q6M A;  3EPV A;  4CBE A;  1OCO C;  3RH3 A;  2XXA B;  3UNG C;  5F5H A;  3IEE A;  1M2O A;  3DAF A;  3JCU Q;  2G3K A;  1SMY F;  2R7W A;  2MWQ A;  2PP4 A;  2NUT B;  4K0D A;  4O6Y A;  4A2N B;  3NYM A;  1IW7 F;  2WB7 A;  3QZC A;  3ABK C;  3HLZ A;  3K7D A;  3O39 A;  2YEV A;  4JZA A;  3K1H A;  4CS8 C;  4U5G A;  2Q3T A;  4BJ5 A;  3AG1 C;  5DQZ A;  3B0P A;  3X2Q C;  3JRT A;  3ABM C;  1OCZ C;  4OIR F;  3NG1 A;  3DM5 A;  4IJJ A;  4PJL A;  3EQL F;  5L3V A;  4OIN F;  2Q9C A;  4IAO A;  4KC9 A;  4RDA A;  3EHM A;  1D1C A;  4B6I A;  2YHS A;  3Q7L A;  4C7O A;  2VB6 A;  3ZG1 A;  4AX2 A;  5EHH A;  5KYW A;  4BEJ A;  5KYY B;  1ZHT A;  3DXJ F;  5E3A A;  5EGY A;  4DBR A;  1FMW A;  3NRH A;  3PHF 2;  4BJ6 A;  3EZI A;  4KNW A;  3X1O A;  2J0W A;  4Q4Z F;  3EGX A;  5F5F A;  4YT2 A;  2CW0 F;  2R7X A;  1ZHX A;  5T3W A;  1TR2 A;  3F46 A;  2L81 A;  5B1B C;  4ZLD A;  4DOZ A;  5DLJ A;  4KBL A;  3N0T A;  2KNH A;  2JD3 A;  1D0Y A;  4H4K C;  4I1M A;  2XXA A;  5DS5 A;  4O6M A;  4YWQ A;  3OA1 A;  5KYN A;  1WGW A;  2WVN A;  3ITF A;  4QDL A;  3RKO F;  4O79 A;  2HV6 A;  3TD7 A;  3NDB B;  5L3Q A;  4JJF A;  2NUT A;  2BE5 F;  2Y3G A;  2IXM A;  3SZR A;  1Z3I X;  1MMG A;  4XLN F;  3UMK A;  5IY5 C;  3CSK A;  2EIK C;  2XRH A;  3UMI A;  4U5E E;  3OWT A;  1Z6A A;  4W8K A;  2FFH A;  2PX3 A;  2WVO A;  3AQC A;  1FFT C;  4ULW A;  3DAG A;  3FDQ A;  2E87 A;  3ABL C;  4BJT A;  2ZXO A;  4PJN A;  3LNR A;  1TWG A;  1SZI A;  4YT4 A;  3B0U X;  2PX0 A;  2B0J A;  2KW3 C;  1TWH A;  3ZVR A;  2R7Q A;  4LLE A;  4U5H A;  2IYL D;  4MQ9 F;  4HFF B;  2IXN A;  3VYW A;  2Y3D A;  3S27 A;  1MNE A;  5CI9 A;  1M2V B;  5CI8 A;  4JJG A;  3LS1 A;  1Z63 A;  2EIN C;  4HFK B;  2R7R A;  2IXO A;  4NY3 A;  3N2Z B;  3OEO A;  3M1C B;  3K6B A;  1FTS A;  3NYJ A;  5KYY A;  3Q7G A;  3VAY A;  4PK4 A;  2V26 A;  3ASN C;  5DVW A;  4JCH A;  2CGE A;  4GEH A;  4BJ5 C;  3DZA A;  1LKX A;  5KYX B;  2W45 A;  1OCR C;  3W2W A;  4XTK A;  4Q5S F;  2KGO A;  1V54 C;  1ZU5 A;  2VAS A;  1VMA A;  5D91 A;  4QI2 A;  4OD4 A;  1O87 A;  2P6V A;  5KYU B;  5E3C A;  2P7V A;  2WVQ A;  3HTK C;  1O5H A;  3WOD F;  4F4B A;  4I3M A;  3LES A;  3SNH A;  5E2Q A;  4J32 B;  4G7O F;  4EWC A;  2R7O A;  4BJ6 C;  3HJC A;  1ZHW A;  1J8Y F;  3WG7 C;  5HSW A;  4G7Z F;  3W2V A;  1JPN A;  3EH2 A;  3DJN B;  5DS6 A;  1BR2 A;  1ZU4 A;  2Y69 C;  2D5R B;  2LSE A;  2A6E F;  2WZL A;  3E9V A;  1PCX A;  3F47 A;  3V7O A;  3ASO C;  3FHD A;  3GAN A;  1M2V A;  4C3E A;  3EG9 B;  2Y3B A;  5T1D B;  3S29 A;  3JYH A;  3KL4 A;  4HE8 D;  2FGY A;  4PFO A;  1ZHY A;  4IRU A;  4KNV A;  1QZX A;  2WL8 A;  4HEA J;  2R7U A;  1VOM A;  1BR1 A;  3CZ6 A;  5B1A C;  5KYX A;  3NKD A;  2I8B A;  2Q9A A;  3PMR A;  2A1D D;  3N24 A;  4FX5 A;  2MYS A;  4E7Z A;  2J46 A;  1NU7 D;  3E70 C;  4I44 A;  1G8X A;  3B9Q A;  1OKK A;  2G3V A;  4YT5 A;  3T6J A;  1MND A;  3AG4 C;  1QLE C;  2OG2 A;  1D1A A;  4DBQ A;  4O7G A;  4M63 A;  4AK9 A;  2YZS A;  4RBN A;  2W9Y A;  3T4R A;  4FWV A;  4BJ1 A;  2HV7 A;  3EFO B;  2J7P A;  2W4B A;  3H65 A;  1D0Z A;  2R7S A;  2W4M A;  4OD5 A;  4OIO F;  1NG1 A;  3UMH A;  1W2W A;  4C3B A;  3POV A;  2A68 F;  3LAY A;  3EGD B;  2EIJ C;  4U5F E;  2CNW A;  2EIL C;  4EBB A;  3LEV A;  1FFH A;  4OIP F;  1TWA A;  3EG9 A;  1OKK D;  4LER A;  2GFH A;  3L34 A;  1BR4 A;  1ZYR F;  2H7O A;  4JW1 A;  1ST6 A;  3T6B A;  4BG0 A;  3W8I A;  5KYW B;  3DMD A;  2WZF A;  2J7P D;  1M57 C;  3ECS A;  1VYK A;  3NKE A;  4P6I C;  3I4U A;  1MMN A;  4J30 B;  3KH2 A;  3I5Q A;  4G0H A;  4PJM A;  2ZPA A;  4CSA A;  2Q9B A;  2C04 A;  3B0V C;  1VYI A;  3UGO A;  1TWC A;  3QMK A;  2DGJ A;  1ZHZ A;  3JSZ A;  3RYL A;  1RJ9 B;  1Z5Z A;  2CNW D;  2IOQ A;  1KU2 A;  3SYN A;  4U5C E;  3EFO A;  2R7T A;  3RIP A;  4DVZ A;  3AQB A;  3GOD A;  1MMA A;  2A6H F;  4CIH A;  2PFD A;  2DYS C;  1S7Z A;  4CS9 A;  2XSE A;  3EGD A;  2V3C C;  5DS4 A;  3FVY A;  3JT1 A;  5BUO A;  4KI2 A;  1Z23 A;  2VH3 A;  3ZSU A;  3CQZ A;  3Q6N A;  3EZH A;  1VK5 A;  2NUP B;  4C3D A;  4U5D E;  5B3S C;  4LAC B;  3ZIB A;  1D1B A;  2KJG A;  4LLC A;  1LVK A;  3KKB A;  4IWB A;  4I1O B;  4CS7 A;  3MX3 A;  2Y39 A;  2M4E A;  1JPJ A;  3S28 A;  4N06 A;  3EJN A;  4JVS A;  4GYT A;  4AE4 B;  1MMD A;  4CS8 A;  4YT8 A;  2OCC C;  3DM9 B;  2J9U A;  3RFY A;  3UR3 C;  5KYU A;  3L0I A;  1IZM A;  2A69 F;  1M56 C;  4ANJ A;  1TKN A;  4PFP A;  3K1I C;  3LS0 A;  4U5B E;  2XL4 A;  2J9W A;  3AG3 C;  1RJ9 A;  1PD1 A;  3LLI A;  1NU9 C;  3S0X A;  4G7H F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...