4XEKA

Pyk2-fat domain in complex with leupaxin ld4 motif
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
137
structure length
137
Chain Sequence
HMANLDRTDDLVYLNVMELVRAVLELKNELSQLPPEGYVVVVKNVGLTLRKLIGSVDDLLPSLPSSSRTEIEGTQKLLNKDLAELINKMRLAQQNAVTSLSEEAKRQMLTASHTLAVDAKNLLDAVDQAKVLANLAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Cell adhesion
molecule keywords Protein-tyrosine kinase 2-beta
publication title Structural Basis for the Interaction between Pyk2-FAT Domain and Leupaxin LD Repeats.
pubmed doi rcsb
source organism Homo sapiens
total genus 60
structure length 137
sequence length 137
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2014-12-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 4xekA00
1K05A 2YWAA 1WWPA 2KK1A 1WTYA 2L6FA 2Q00A 3U3FA 1UFBA 3GM3A 3O10A 3MFNA 3C8GD 4R32A 3B71A 4EBKA 2L6HA 4XEVA 1ZZPA 3L8JA 3RQFA 1OW6A 3C8GB 3GM2A 3JYYA 3K7DA 3C8GA 2HSBA 3BRJA 1KTMA 4EBJA 1V4AA 2L6GA 1PV3A 1OW8A 2JX0A 3RQGA 1QVXA 3L8IA 2LK4A 3TULA 2PBEA 5F28E 1K40A 4XEFA 2JPUA 1K04A 4XEKA 1O3UA 3JZ0A 3U0CA 3C18A 3RQEA 3AJMA 3S9OA 1WOLA 1JOGA 1KNYA 3GM1A 1OW7A 4NQFA
chains in the Genus database with same CATH superfamily
1RJ9A 2Z15A 5TJ5E 2IYLD 4YK5A 4OIRF 3QMKA 2IOQA 4C3DA 2NG1A 3WAQA 2J9BA 1O5HA 2LSEA 4XEVA 2PX3A 2EPKX 5A6JA 1GM5A 3V7OA 4KNWA 4AE4B 2HV6A 4JTDB 4RD9A 2NSFA 1YAUO 2NUTB 3FOPA 4MQ9F 3U5SA 1LI7A 4WGZA 4IWBA 4ZLDA 4ER9A 2NUTA 4MVSA 4DBRA 2PBEA 4GQHA 4K1OA 1K40A 1R5ID 4JTAB 3F46A 4I1MA 3RF3A 1LKXA 4L6RA 1ZHTA 1ZYRF 2A68F 2OEXA 1VYIA 1XZQA 2B0JA 2O9XA 2ZXWC 1LS4A 4D4XA 1LI5A 3AJMA 5E3AA 3ZVRA 4CS8A 4F4BA 1E86A 5K0IA 4LLEA 2L9JA 5COFA 1SZIA 4CDVA 2Q4FA 3HLZA 4NQFA 2XRHA 4YWQA 3M1CB 2NSGA 5KYWB 3AGTA 1QZXA 3C8ZA 4XLNF 4BEJA 2HFIA 1YA7O 4JKVA 3AG4C 3CQZA 3RQFA 4EKWA 2CNWD 3CZ6A 4CIPA 3MX3A 2PFDA 2ZXPA 1TWAA 3KPHA 3W8IA 4YT8A 1SYQA 2LD6A 2CNWA 4LDKA 2DYSC 4JJGA 1SMYF 1Z6AA 1VLTA 3VF0A 3IPMO 2B0HA 2JPUA 2AWCA 3SP1A 2A1DD 3V5YA 4XEKA 4A2NB 1T6QA 1M56C 3SXYA 4DJ9A 1QQ3A 4IAOA 1HW1A 4HE8D 4E0HA 3H2UA 3V5XA 3K66A 3FAJA 1OW7A 1HY5A 2H7BA 2YWAA 4BJTA 2JD3A 4DOZA 1PCXA 3N24A 1C17M 4P9FA 1FTSA 2CW0F 5GPGB 2IXNA 4YL1A 2YKZA 3JTLO 3GM2A 5CI9A 1YARO 2YL7A 4OINF 2EILC 3R7CA 4XTKA 3AOUA 5DS5A 4E18A 3I4UA 4FWVA 1ZU4A 4FAPB 1LM3B 5JS5A 2FGYA 2LK4A 3SXKA 3PDMP 3E70C 3V5ZA 5DS4A 2OQMA 4DRIB 2Q9AA 3HJCA 3LEVA 1ZW3A 3LJBA 1YVIA 1NLXA 2MYSA 2P1AA 1YZAA 4U5GA 3RQEA 3NYLA 4PJMA 1ZHYA 3HNKA 1OCRC 2GWWA 4WABA 4CDAA 3K6BA 1R4TA 1M2OA 1YZCA 5COGA 2KK1A 4YT2A 1JAFA 2IBFA 3F47A 1QKRA 4P6IC 3LLKA 4XPWA 1APCA 5FZTA 3W4YA 2YEVA 4EBKA 3PCVA 1F1MA 1Q0GA 2ZD9A 3DE9A 2R9RB 3DM5A 3NKDA 1N1CA 4MVOA 3S28A 3JT1A 1MMDA 5COMA 2TMVP 5B1BC 3VM6A 2XS8A 3L0IA 3AG2C 2EIMC 2JX0A 3EH1A 4K7BA 1CGME 2BL2A 1L3PA 3A9CA 1YA9A 1OXKA 3GANA 1YYXA 5FCLA 4U5FE 4CX9A 2HMQA 2KGOA 3CSKA 5BQHA 2R25A 3M4BA 4RBNA 3DAGA 3VYWA 4OIPF 2Y3DA 4A4AA 1LPEA 3W2VA 4N4WA 1S05A 3IQ6A 2V26A 1MNEA 4EHPA 3HTKC 1Q0KA 1ST6A 4AL1A 2A0BA 3L1MA 5KYYA 3LLIA 4LDQA 2D4UA 1BDJB 3DE8A 1CPQA 1AUEA 2NUPB 4I3MA 4LACB 5L3QA 1RCPA 2BC5A 4U5BE 2PNOA 1Q0MA 2P7VA 3GODA 4JCZA 2KSFA 4EIYA 2A69F 1NU9C 5JLIA 4MNDA 2A6HF 2CDQA 4QDLA 3AQCA 4PJLA 1ZU5A 3SXZA 2L6GA 3TOMA 4HFFB 2E87A 3RQGA 4CS9A 3GWLA 3Q6NA 2HV7A 3J06A 2R7VA 1K04A 2YRFA 2XXAA 1D0XA 2OU6A 5BQGA 4CBEA 2YHSA 1JRAA 5E2QA 3ZSUA 3UGOA 3H65A 4G0HA 3ABKC 4IRUA 4EBBA 1Z63A 4U9DA 5JVEA 2G3VA 3EGXB 4MTGA 3E9VA 1RJ9B 3EGDB 3ABMC 1ZVZA 3HKKA 4N6HA 1HMOA 4OIQF 1NBBA 4BJ6A 2I15A 4O6NA 4WGYA 3MYFA 3EGDA 2YLDA 4O7GA 3QTHA 4ANJA 1O87A 2VCAA 2J9VA 1AVOB 3K1IA 1LIHA 3LNRA 2R7RA 1FFHA 2QLAA 3LEOA 4YL0A 5A6BD 1A41A 5B1AC 1FMWA 2R7TA 3HNIA 1HE9A 2ICWG 3DJUB 2P61A 3T6JA 2DYRC 2QUPA 5A6BA 4U5CE 1LS1A 4WJ0A 2VC9A 5HV9A 3UNGC 3NG1A 3WG7C 5KYXA 4MTOA 4NC3A 4E7SA 1OR3A 1A0BA 1VTMP 2UUIA 1NU7D 4PR9A 2G62A 3AQBA 4G7HF 4DRHB 2OJED 2HUJA 1ZHWA 2W4MA 3KYIA 4FX5A 5DLJA 3S29A 1PD0A 2R02A 3U8VA 4ONSA 1K05A 3LESA 5DVWA 1L7CA 1WTYA 2L6FA 2QY9A 3ECSA 3GEHA 4U5HA 3O10A 3UMHA 3R2PA 2J7PD 3AG3C 3WODF 4JRZA 3TOLA 3PHF2 1MQVA 1ZW2A 3I5PA 1BZ4A 4G7ZF 2CCYA 2OCCC 3S90A 2J7PA 3RVYA 4C3EA 4XLPF 3JYHA 3B0PA 3W8HA 4JEBA 4HEAJ 3L8IA 2CGEA 2P0NA 3K1HA 4OIOF 3SYNA 3KL4A 1MMGA 2C04A 2R7WA 3OWTA 1OCCC 1SR2A 1OQCA 4EWCA 4G7OF 1CGOA 2VCBA 4XPYA 3QVYA 2DB4A 1WOLA 2EINC 1LE2A 3LS0A 1KNYA 3NMJA 3O6XA 4MVUA 2R7OA 1FAPB 2LIGA 4Z9IA 4JW1A 5L3VA 2PP4A 5F5FA 4NTBA 2XLEA 2LQGA 2YL3A 2IM8A 3U3FA 2Q00A 4O6YA 4BJ1A 1E2XA 2LFDA 1H9GA 3C8GD 1B68A 4MTFA 1OKKA 2L6HA 2YL0A 2YLIA 3GORA 1E84A 1GS9A 3SNHA 3B0UX 2HSQA 3C8GA 2J0WA 2Q7RA 1D1AA 1ZHZA 4JJFA 5JSLA 3WHNA 4EBJA 1KTMA 2R05A 1OXBA 1CGNA 2YQYA 3ABLC 4BJ5C 2DGJA 4W8PA 4MVQA 3U2LA 4ZLCA 3X1OA 1VYKA 4JIOA 5F28E 1G4US 1Q0DA 5L0JA 2KW3C 3QW1A 5B3SC 2AWYA 4XPXA 2WVOA 3TK0A 4YT5A 4NY3A 1O3UA 2DI3A 1NZEA 2XL6A 3O55A 3TJ6A 3JZ0A 4I44A 1M2VB 3O39A 3U8PA 3UMIA 4PJNA 3N0TA 1RKCA 2ETSA 2F22A 2WVQA 3DWWA 4HFKB 4ULWA 3L34A 4IGGA 1M2VA 2IXPA 1A7VA 5IY5C 2OG2A 4B6IA 3S27A 5A6KA 4PK4A 4CSAC 1UFBA 3AGUA 4PJJA 4IARA 1BR1A 2XLOA 1ZZPA 1FFTC 3LS1A 3JYYA 5L0HA 5A6AA 2X0CA 3EPVA 4JVSA 1V4AA 2EIKC 1OW8A 1YLMA 2AVKA 1T6UA 2GA0A 1LE4A 2VASA 1H6GA 2HJMA 2KYHA 1W2WA 2GDCA 2ZXRA 3EQLF 1M57C 2VB6A 1QSPA 3EJNA 4Q4ZF 1T9KA 1IW7F 1NFNA 1OCZC 1OR2A 1MMAA 1Z5ZA 3DJNB 2KJGA 2XLDA 2QNLA 1FMVA 4LERA 4XWJA 2OJQA 3S0XA 4C3BA 3IQCA 3EGXA 3TJ5A 3QZCA 5KYYB 3KMIA 3NMKA 3SZRA 1S7ZA 4YL3A 5EGYA 3MBGA 2UUHA 5KYUB 1UG7A 1Y6DA 4MW8A 4I1OB 1OW6A 5KYUA 4E17A 3NMIA 4CDYA 2Y3BA 1E83A 1LVKA 1VK5A 3C62A 1XWJA 3LUTB 1TR2A 4PACA 4QI0A 3T4RA 4NTFA 2FAPB 2J8WA 1BBHA 2LP4A 3FVYA 4GYTA 3ZIBA 4CJOA 2MWQA 3GWNA 1GQAA 2GFHA 4KI2A 4IJJA 2XLMA 3GEEA 2XM0A 3S9OA 1Y4CA 1OCOC 2H7OA 4J30B 4CS8C 1EI7A 2BE5F 5B3IA 4X0RA 4KC9A 3IHUA 4IAQA 3S84A 2RSEB 3Q7LA 4JE9A 1EKYA 3EZIA 1A7EA 3DZAA 5BUOA 2W4BA 2ZXOA 1WN0A 2HZ8A 2J45A 2YZSA 1MMNA 4CIHA 2WVNA 2EPMX 1PD1A 3EZHA 3M79A 4N06A 2HS5A 2G3KA 4C7OA 2CYDA 3C7JA 2WZGA 4PFPA 1QLEC 5KYNA 1JMWA 2QE9A 4DVYP 1PV3A 1H7IA 3IEEA 5CIVA 1M6TA 2XSEA 2XS1A 3DMDA 2AP3A 1JPJA 2KC3A 5KYXB 2PF4E 3I5QA 3JRTA 3FHDA 3W2WA 4D4NA 1D1BA 4H54A 3BEHA 3EH2A 4RDAA 1VLSA 5HSWA 2V3CC 3DM9B 1TWHA 3EFOA 3JRMO 2QTVA 1DOWA 3G4XA 3ZTZA 1FR0A 3ATPA 1QPUA 4BEMJ 1JOGA 3DD7A 3IQ5A 3OA1A 3Q6MA 3T6BA 3OEOA 1A7DA 3UGPA 3U9JA 2J9WA 3EG9B 2L7AA 1I4ZA 2HMZA 2YVKA 4AX2A 2R7UA 3EG9A 5EHHA 3RKOF 3ZTMA 3B71A 4JCHA 1G8XA 2VCCA 5D91A 4K0DA 2H7VC 3DAFA 3K7DA 2D5RB 4O79A 4J7YA 4YJWA 4AE4A 2Y69C 3BRJA 2YL1A 1D0ZA 2R03A 1T6IA 3C63A 5E3CA 3T6GB 3RFYA 5F5HA 5A69A 3FXHA 1G4WR 4MW3A 1EQ1A 4LLCA 2Q3TA 1XZPA 1YJGA 2Y3HA 5L0IA 3FMSA 5AC5A 2EPNA 2W45A 3B29A 3A11A 4JZAA 4N6CA 1Z7Qc 3KYJA 5JP7A 3IQTA 2L81A 5CI8A 4PFOA 1RMVA 4GEHA 2XL8A 2XLVA 3U9MA 5D92A 1OKKD 3GEIA 3GM3A 4MVMA 1NG1A 1WATA 2ASRA 1CPRA 4IB4A 4CS7A 3RIPA 5KYWA 4BG0A 2NPUA 1RXQA 3C8GB 3DKAA 3K33A 2A0UA 3L8JA 2FFHA 2A6EF 1YYJA 2J9UA 4YN0B 3NYJA 4CJGA 2J46A 3H2VA 1HE1A 3NRHA 1SF8A 1GGQA 3ASNC 4U5DE 3RVZA 3G4ZA 5AC4A 3TULA 2YLGA 1U0BB 2H8AA 5E33A 256BA 4ULVA 2RD9A 2GAQA 3HNLA 1I4YA 2AU5A 3KKBA 2XXAB 3LAYA 3C18A 3M4CA 3PMRA 5T1DB 3U3BA 4NCQA 4Z9JA 3ZDLA 1V74B 2EIJC 2IXMA 1TFOB 1D1CA 1WWPA 1VB5A 1ZHXA 3ZQYA 4BPMA 3ZQVA 2OEVA 1C02A 4XQ1A 2C03A 2M64A 1V54C 3U2MA 5BQIA 2LFFA 1VMAA 2PX0A 3RW0A 5L0GA 3G50A 2OKUA 3ZC4A 4CS9C 2IXOA 1T5OA 1RKEB 1FNTc 3ITFA 2R7XA 2OOCA 3FDQA 4DVZA 2XLWA 3RH3A 1RKEA 3HNJA 3FAPB 3JSEO 3Q7GA 2XL4A 3N2ZB 3EHNA 4Z9HA 4MVZA 3SEOA 5DQZA 3MYIA 2WZFA 3QVZA 3TD7A 5JT4A 2W9YA 3M15A 1I5NA 1ORSC 5JUAA 3NDBB 4EUKB 2WL8A 4U9EA 4BJ6C 1WASA 2EPOA 3VAYA 3QW0A 4G78A 4M63A 3MFNA 5DQTA 4R32A 4MVRA 4P9TA 2KQ9A 5JRAA 1NFOA 3EHMA 1JPNA 2P6VA 3JCUQ 3JSZA 3K1IC 3KH2A 4J32B 2WB7A 2ZPAA 1DOVA 4LDRA 5T3WA 1JR8A 3ZG1A 4Q7CA 4NTAA 1Q0FA 4DRJB 1BR2A 2LCHA 2J0XA 2Y39A 2Y3GA 1Z23A 3AG1C 5T3TA 3FOOA 3ZWIA 4BJ5A 1YDIA 3DXJF 1KU2A 1J8MF 2KNHA 3DI5A 2HJ3A 4JURI 4JEAA 2WZLA 4XEFA 2Q9BA 3VRCA 3NYMA 1U89A 4OD5A 3U0CA 4QI2A 4E0IA 1TFKB 1ORYA 4W8KA 3SXMA 3POVA 1J8YF 4H4KC 1NSGB 1D0YA 5EK0A 3TQOA 4J7TA 4E7ZA 4KBLA 4UDVA 1WGWA 1TWCA 3UMKA 2R7QA 1TWGA 5L0DA 1IZMA 2HKVA 4CSAA 2R7SA 2VH3A 1HW2A 1G5ZA 3NKEA 1V55C 4YT4A 3CAXA 2NUPA 1VOMA 4MS2A 1E85A 1ORJA 4C7OB 3US6A 4U5EE 2HSBA 1H9TA 1C03A 3T9OA 3LNMB 4FESA 4KNVA 4AL0A 4DXWA 4DBQA 1TKNA 1QVXA 5AGFA 3B0VC 1HMDA 4O6MA 2X51A 4JC7A 4OD4A 4AK9A 1MNDA 2EPLX 4JTCB 5DS6A 3CEXA 3EFOB 4Q5SF 1TQGA 1Z3IX 2XM4A 3B9QA 2XLHA 3RYLA 3ASOC 2I8BA 2M4EA 5L0FA 1T01A 2Q9CA 1BR4A 2MHRA 3MLGA 3X2QC 3GM1A 5L0CA 3UR3C 1EA8A 1U6HA 1AEPA
chains in the Genus database with same CATH topology
1K05A 2YWAA 1WWPA 2KK1A 1WTYA 2L6FA 2Q00A 3U3FA 1UFBA 3GM3A 3O10A 3MFNA 3C8GD 4R32A 3B71A 4EBKA 2L6HA 4XEVA 1ZZPA 3L8JA 3RQFA 1OW6A 3C8GB 3GM2A 3JYYA 3K7DA 3C8GA 2HSBA 3BRJA 1KTMA 4EBJA 1V4AA 2L6GA 1PV3A 1OW8A 2JX0A 3RQGA 1QVXA 3L8IA 2LK4A 3TULA 2PBEA 5F28E 1K40A 4XEFA 2JPUA 1K04A 4XEKA 1O3UA 3JZ0A 3U0CA 3C18A 3RQEA 3AJMA 3S9OA 1WOLA 1JOGA 1KNYA 3GM1A 1OW7A 4NQFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K05 A;  2YWA A;  1WWP A;  2KK1 A;  1WTY A;  2L6F A;  2Q00 A;  3U3F A;  1UFB A;  3GM3 A;  3O10 A;  3MFN A;  3C8G D;  4R32 A;  3B71 A;  4EBK A;  2L6H A;  4XEV A;  1ZZP A;  3L8J A;  3RQF A;  1OW6 A;  3C8G B;  3GM2 A;  3JYY A;  3K7D A;  3C8G A;  2HSB A;  3BRJ A;  1KTM A;  4EBJ A;  1V4A A;  2L6G A;  1PV3 A;  1OW8 A;  2JX0 A;  3RQG A;  1QVX A;  3L8I A;  2LK4 A;  3TUL A;  2PBE A;  5F28 E;  1K40 A;  4XEF A;  2JPU A;  1K04 A;  4XEK A;  1O3U A;  3JZ0 A;  3U0C A;  3C18 A;  3RQE A;  3AJM A;  3S9O A;  1WOL A;  1JOG A;  1KNY A;  3GM1 A;  1OW7 A;  4NQF A; 
#chains in the Genus database with same CATH topology
 1RJ9 A;  2Z15 A;  5TJ5 E;  2IYL D;  4YK5 A;  4OIR F;  3QMK A;  2IOQ A;  4C3D A;  2NG1 A;  3WAQ A;  2J9B A;  1O5H A;  2LSE A;  4XEV A;  2PX3 A;  2EPK X;  5A6J A;  1GM5 A;  3V7O A;  4KNW A;  4AE4 B;  2HV6 A;  4JTD B;  4RD9 A;  2NSF A;  1YAU O;  2NUT B;  3FOP A;  4MQ9 F;  3U5S A;  1LI7 A;  4WGZ A;  4IWB A;  4ZLD A;  4ER9 A;  2NUT A;  4MVS A;  4DBR A;  2PBE A;  4GQH A;  4K1O A;  1K40 A;  1R5I D;  4JTA B;  3F46 A;  4I1M A;  3RF3 A;  1LKX A;  4L6R A;  1ZHT A;  1ZYR F;  2A68 F;  2OEX A;  1VYI A;  1XZQ A;  2B0J A;  2O9X A;  2ZXW C;  1LS4 A;  4D4X A;  1LI5 A;  3AJM A;  5E3A A;  3ZVR A;  4CS8 A;  4F4B A;  1E86 A;  5K0I A;  4LLE A;  2L9J A;  5COF A;  1SZI A;  4CDV A;  2Q4F A;  3HLZ A;  4NQF A;  2XRH A;  4YWQ A;  3M1C B;  2NSG A;  5KYW B;  3AGT A;  1QZX A;  3C8Z A;  4XLN F;  4BEJ A;  2HFI A;  1YA7 O;  4JKV A;  3AG4 C;  3CQZ A;  3RQF A;  4EKW A;  2CNW D;  3CZ6 A;  4CIP A;  3MX3 A;  2PFD A;  2ZXP A;  1TWA A;  3KPH A;  3W8I A;  4YT8 A;  1SYQ A;  2LD6 A;  2CNW A;  4LDK A;  2DYS C;  4JJG A;  1SMY F;  1Z6A A;  1VLT A;  3VF0 A;  3IPM O;  2B0H A;  2JPU A;  2AWC A;  3SP1 A;  2A1D D;  3V5Y A;  4XEK A;  4A2N B;  1T6Q A;  1M56 C;  3SXY A;  4DJ9 A;  1QQ3 A;  4IAO A;  1HW1 A;  4HE8 D;  4E0H A;  3H2U A;  3V5X A;  3K66 A;  3FAJ A;  1OW7 A;  1HY5 A;  2H7B A;  2YWA A;  4BJT A;  2JD3 A;  4DOZ A;  1PCX A;  3N24 A;  1C17 M;  4P9F A;  1FTS A;  2CW0 F;  5GPG B;  2IXN A;  4YL1 A;  2YKZ A;  3JTL O;  3GM2 A;  5CI9 A;  1YAR O;  2YL7 A;  4OIN F;  2EIL C;  3R7C A;  4XTK A;  3AOU A;  5DS5 A;  4E18 A;  3I4U A;  4FWV A;  1ZU4 A;  4FAP B;  1LM3 B;  5JS5 A;  2FGY A;  2LK4 A;  3SXK A;  3PDM P;  3E70 C;  3V5Z A;  5DS4 A;  2OQM A;  4DRI B;  2Q9A A;  3HJC A;  3LEV A;  1ZW3 A;  3LJB A;  1YVI A;  1NLX A;  2MYS A;  2P1A A;  1YZA A;  4U5G A;  3RQE A;  3NYL A;  4PJM A;  1ZHY A;  3HNK A;  1OCR C;  2GWW A;  4WAB A;  4CDA A;  3K6B A;  1R4T A;  1M2O A;  1YZC A;  5COG A;  2KK1 A;  4YT2 A;  1JAF A;  2IBF A;  3F47 A;  1QKR A;  4P6I C;  3LLK A;  4XPW A;  1APC A;  5FZT A;  3W4Y A;  2YEV A;  4EBK A;  3PCV A;  1F1M A;  1Q0G A;  2ZD9 A;  3DE9 A;  2R9R B;  3DM5 A;  3NKD A;  1N1C A;  4MVO A;  3S28 A;  3JT1 A;  1MMD A;  5COM A;  2TMV P;  5B1B C;  3VM6 A;  2XS8 A;  3L0I A;  3AG2 C;  2EIM C;  2JX0 A;  3EH1 A;  4K7B A;  1CGM E;  2BL2 A;  1L3P A;  3A9C A;  1YA9 A;  1OXK A;  3GAN A;  1YYX A;  5FCL A;  4U5F E;  4CX9 A;  2HMQ A;  2KGO A;  3CSK A;  5BQH A;  2R25 A;  3M4B A;  4RBN A;  3DAG A;  3VYW A;  4OIP F;  2Y3D A;  4A4A A;  1LPE A;  3W2V A;  4N4W A;  1S05 A;  3IQ6 A;  2V26 A;  1MNE A;  4EHP A;  3HTK C;  1Q0K A;  1ST6 A;  4AL1 A;  2A0B A;  3L1M A;  5KYY A;  3LLI A;  4LDQ A;  2D4U A;  1BDJ B;  3DE8 A;  1CPQ A;  1AUE A;  2NUP B;  4I3M A;  4LAC B;  5L3Q A;  1RCP A;  2BC5 A;  4U5B E;  2PNO A;  1Q0M A;  2P7V A;  3GOD A;  4JCZ A;  2KSF A;  4EIY A;  2A69 F;  1NU9 C;  5JLI A;  4MND A;  2A6H F;  2CDQ A;  4QDL A;  3AQC A;  4PJL A;  1ZU5 A;  3SXZ A;  2L6G A;  3TOM A;  4HFF B;  2E87 A;  3RQG A;  4CS9 A;  3GWL A;  3Q6N A;  2HV7 A;  3J06 A;  2R7V A;  1K04 A;  2YRF A;  2XXA A;  1D0X A;  2OU6 A;  5BQG A;  4CBE A;  2YHS A;  1JRA A;  5E2Q A;  3ZSU A;  3UGO A;  3H65 A;  4G0H A;  3ABK C;  4IRU A;  4EBB A;  1Z63 A;  4U9D A;  5JVE A;  2G3V A;  3EGX B;  4MTG A;  3E9V A;  1RJ9 B;  3EGD B;  3ABM C;  1ZVZ A;  3HKK A;  4N6H A;  1HMO A;  4OIQ F;  1NBB A;  4BJ6 A;  2I15 A;  4O6N A;  4WGY A;  3MYF A;  3EGD A;  2YLD A;  4O7G A;  3QTH A;  4ANJ A;  1O87 A;  2VCA A;  2J9V A;  1AVO B;  3K1I A;  1LIH A;  3LNR A;  2R7R A;  1FFH A;  2QLA A;  3LEO A;  4YL0 A;  5A6B D;  1A41 A;  5B1A C;  1FMW A;  2R7T A;  3HNI A;  1HE9 A;  2ICW G;  3DJU B;  2P61 A;  3T6J A;  2DYR C;  2QUP A;  5A6B A;  4U5C E;  1LS1 A;  4WJ0 A;  2VC9 A;  5HV9 A;  3UNG C;  3NG1 A;  3WG7 C;  5KYX A;  4MTO A;  4NC3 A;  4E7S A;  1OR3 A;  1A0B A;  1VTM P;  2UUI A;  1NU7 D;  4PR9 A;  2G62 A;  3AQB A;  4G7H F;  4DRH B;  2OJE D;  2HUJ A;  1ZHW A;  2W4M A;  3KYI A;  4FX5 A;  5DLJ A;  3S29 A;  1PD0 A;  2R02 A;  3U8V A;  4ONS A;  1K05 A;  3LES A;  5DVW A;  1L7C A;  1WTY A;  2L6F A;  2QY9 A;  3ECS A;  3GEH A;  4U5H A;  3O10 A;  3UMH A;  3R2P A;  2J7P D;  3AG3 C;  3WOD F;  4JRZ A;  3TOL A;  3PHF 2;  1MQV A;  1ZW2 A;  3I5P A;  1BZ4 A;  4G7Z F;  2CCY A;  2OCC C;  3S90 A;  2J7P A;  3RVY A;  4C3E A;  4XLP F;  3JYH A;  3B0P A;  3W8H A;  4JEB A;  4HEA J;  3L8I A;  2CGE A;  2P0N A;  3K1H A;  4OIO F;  3SYN A;  3KL4 A;  1MMG A;  2C04 A;  2R7W A;  3OWT A;  1OCC C;  1SR2 A;  1OQC A;  4EWC A;  4G7O F;  1CGO A;  2VCB A;  4XPY A;  3QVY A;  2DB4 A;  1WOL A;  2EIN C;  1LE2 A;  3LS0 A;  1KNY A;  3NMJ A;  3O6X A;  4MVU A;  2R7O A;  1FAP B;  2LIG A;  4Z9I A;  4JW1 A;  5L3V A;  2PP4 A;  5F5F A;  4NTB A;  2XLE A;  2LQG A;  2YL3 A;  2IM8 A;  3U3F A;  2Q00 A;  4O6Y A;  4BJ1 A;  1E2X A;  2LFD A;  1H9G A;  3C8G D;  1B68 A;  4MTF A;  1OKK A;  2L6H A;  2YL0 A;  2YLI A;  3GOR A;  1E84 A;  1GS9 A;  3SNH A;  3B0U X;  2HSQ A;  3C8G A;  2J0W A;  2Q7R A;  1D1A A;  1ZHZ A;  4JJF A;  5JSL A;  3WHN A;  4EBJ A;  1KTM A;  2R05 A;  1OXB A;  1CGN A;  2YQY A;  3ABL C;  4BJ5 C;  2DGJ A;  4W8P A;  4MVQ A;  3U2L A;  4ZLC A;  3X1O A;  1VYK A;  4JIO A;  5F28 E;  1G4U S;  1Q0D A;  5L0J A;  2KW3 C;  3QW1 A;  5B3S C;  2AWY A;  4XPX A;  2WVO A;  3TK0 A;  4YT5 A;  4NY3 A;  1O3U A;  2DI3 A;  1NZE A;  2XL6 A;  3O55 A;  3TJ6 A;  3JZ0 A;  4I44 A;  1M2V B;  3O39 A;  3U8P A;  3UMI A;  4PJN A;  3N0T A;  1RKC A;  2ETS A;  2F22 A;  2WVQ A;  3DWW A;  4HFK B;  4ULW A;  3L34 A;  4IGG A;  1M2V A;  2IXP A;  1A7V A;  5IY5 C;  2OG2 A;  4B6I A;  3S27 A;  5A6K A;  4PK4 A;  4CSA C;  1UFB A;  3AGU A;  4PJJ A;  4IAR A;  1BR1 A;  2XLO A;  1ZZP A;  1FFT C;  3LS1 A;  3JYY A;  5L0H A;  5A6A A;  2X0C A;  3EPV A;  4JVS A;  1V4A A;  2EIK C;  1OW8 A;  1YLM A;  2AVK A;  1T6U A;  2GA0 A;  1LE4 A;  2VAS A;  1H6G A;  2HJM A;  2KYH A;  1W2W A;  2GDC A;  2ZXR A;  3EQL F;  1M57 C;  2VB6 A;  1QSP A;  3EJN A;  4Q4Z F;  1T9K A;  1IW7 F;  1NFN A;  1OCZ C;  1OR2 A;  1MMA A;  1Z5Z A;  3DJN B;  2KJG A;  2XLD A;  2QNL A;  1FMV A;  4LER A;  4XWJ A;  2OJQ A;  3S0X A;  4C3B A;  3IQC A;  3EGX A;  3TJ5 A;  3QZC A;  5KYY B;  3KMI A;  3NMK A;  3SZR A;  1S7Z A;  4YL3 A;  5EGY A;  3MBG A;  2UUH A;  5KYU B;  1UG7 A;  1Y6D A;  4MW8 A;  4I1O B;  1OW6 A;  5KYU A;  4E17 A;  3NMI A;  4CDY A;  2Y3B A;  1E83 A;  1LVK A;  1VK5 A;  3C62 A;  1XWJ A;  3LUT B;  1TR2 A;  4PAC A;  4QI0 A;  3T4R A;  4NTF A;  2FAP B;  2J8W A;  1BBH A;  2LP4 A;  3FVY A;  4GYT A;  3ZIB A;  4CJO A;  2MWQ A;  3GWN A;  1GQA A;  2GFH A;  4KI2 A;  4IJJ A;  2XLM A;  3GEE A;  2XM0 A;  3S9O A;  1Y4C A;  1OCO C;  2H7O A;  4J30 B;  4CS8 C;  1EI7 A;  2BE5 F;  5B3I A;  4X0R A;  4KC9 A;  3IHU A;  4IAQ A;  3S84 A;  2RSE B;  3Q7L A;  4JE9 A;  1EKY A;  3EZI A;  1A7E A;  3DZA A;  5BUO A;  2W4B A;  2ZXO A;  1WN0 A;  2HZ8 A;  2J45 A;  2YZS A;  1MMN A;  4CIH A;  2WVN A;  2EPM X;  1PD1 A;  3EZH A;  3M79 A;  4N06 A;  2HS5 A;  2G3K A;  4C7O A;  2CYD A;  3C7J A;  2WZG A;  4PFP A;  1QLE C;  5KYN A;  1JMW A;  2QE9 A;  4DVY P;  1PV3 A;  1H7I A;  3IEE A;  5CIV A;  1M6T A;  2XSE A;  2XS1 A;  3DMD A;  2AP3 A;  1JPJ A;  2KC3 A;  5KYX B;  2PF4 E;  3I5Q A;  3JRT A;  3FHD A;  3W2W A;  4D4N A;  1D1B A;  4H54 A;  3BEH A;  3EH2 A;  4RDA A;  1VLS A;  5HSW A;  2V3C C;  3DM9 B;  1TWH A;  3EFO A;  3JRM O;  2QTV A;  1DOW A;  3G4X A;  3ZTZ A;  1FR0 A;  3ATP A;  1QPU A;  4BEM J;  1JOG A;  3DD7 A;  3IQ5 A;  3OA1 A;  3Q6M A;  3T6B A;  3OEO A;  1A7D A;  3UGP A;  3U9J A;  2J9W A;  3EG9 B;  2L7A A;  1I4Z A;  2HMZ A;  2YVK A;  4AX2 A;  2R7U A;  3EG9 A;  5EHH A;  3RKO F;  3ZTM A;  3B71 A;  4JCH A;  1G8X A;  2VCC A;  5D91 A;  4K0D A;  2H7V C;  3DAF A;  3K7D A;  2D5R B;  4O79 A;  4J7Y A;  4YJW A;  4AE4 A;  2Y69 C;  3BRJ A;  2YL1 A;  1D0Z A;  2R03 A;  1T6I A;  3C63 A;  5E3C A;  3T6G B;  3RFY A;  5F5H A;  5A69 A;  3FXH A;  1G4W R;  4MW3 A;  1EQ1 A;  4LLC A;  2Q3T A;  1XZP A;  1YJG A;  2Y3H A;  5L0I A;  3FMS A;  5AC5 A;  2EPN A;  2W45 A;  3B29 A;  3A11 A;  4JZA A;  4N6C A;  1Z7Q c;  3KYJ A;  5JP7 A;  3IQT A;  2L81 A;  5CI8 A;  4PFO A;  1RMV A;  4GEH A;  2XL8 A;  2XLV A;  3U9M A;  5D92 A;  1OKK D;  3GEI A;  3GM3 A;  4MVM A;  1NG1 A;  1WAT A;  2ASR A;  1CPR A;  4IB4 A;  4CS7 A;  3RIP A;  5KYW A;  4BG0 A;  2NPU A;  1RXQ A;  3C8G B;  3DKA A;  3K33 A;  2A0U A;  3L8J A;  2FFH A;  2A6E F;  1YYJ A;  2J9U A;  4YN0 B;  3NYJ A;  4CJG A;  2J46 A;  3H2V A;  1HE1 A;  3NRH A;  1SF8 A;  1GGQ A;  3ASN C;  4U5D E;  3RVZ A;  3G4Z A;  5AC4 A;  3TUL A;  2YLG A;  1U0B B;  2H8A A;  5E33 A;  256B A;  4ULV A;  2RD9 A;  2GAQ A;  3HNL A;  1I4Y A;  2AU5 A;  3KKB A;  2XXA B;  3LAY A;  3C18 A;  3M4C A;  3PMR A;  5T1D B;  3U3B A;  4NCQ A;  4Z9J A;  3ZDL A;  1V74 B;  2EIJ C;  2IXM A;  1TFO B;  1D1C A;  1WWP A;  1VB5 A;  1ZHX A;  3ZQY A;  4BPM A;  3ZQV A;  2OEV A;  1C02 A;  4XQ1 A;  2C03 A;  2M64 A;  1V54 C;  3U2M A;  5BQI A;  2LFF A;  1VMA A;  2PX0 A;  3RW0 A;  5L0G A;  3G50 A;  2OKU A;  3ZC4 A;  4CS9 C;  2IXO A;  1T5O A;  1RKE B;  1FNT c;  3ITF A;  2R7X A;  2OOC A;  3FDQ A;  4DVZ A;  2XLW A;  3RH3 A;  1RKE A;  3HNJ A;  3FAP B;  3JSE O;  3Q7G A;  2XL4 A;  3N2Z B;  3EHN A;  4Z9H A;  4MVZ A;  3SEO A;  5DQZ A;  3MYI A;  2WZF A;  3QVZ A;  3TD7 A;  5JT4 A;  2W9Y A;  3M15 A;  1I5N A;  1ORS C;  5JUA A;  3NDB B;  4EUK B;  2WL8 A;  4U9E A;  4BJ6 C;  1WAS A;  2EPO A;  3VAY A;  3QW0 A;  4G78 A;  4M63 A;  3MFN A;  5DQT A;  4R32 A;  4MVR A;  4P9T A;  2KQ9 A;  5JRA A;  1NFO A;  3EHM A;  1JPN A;  2P6V A;  3JCU Q;  3JSZ A;  3K1I C;  3KH2 A;  4J32 B;  2WB7 A;  2ZPA A;  1DOV A;  4LDR A;  5T3W A;  1JR8 A;  3ZG1 A;  4Q7C A;  4NTA A;  1Q0F A;  4DRJ B;  1BR2 A;  2LCH A;  2J0X A;  2Y39 A;  2Y3G A;  1Z23 A;  3AG1 C;  5T3T A;  3FOO A;  3ZWI A;  4BJ5 A;  1YDI A;  3DXJ F;  1KU2 A;  1J8M F;  2KNH A;  3DI5 A;  2HJ3 A;  4JUR I;  4JEA A;  2WZL A;  4XEF A;  2Q9B A;  3VRC A;  3NYM A;  1U89 A;  4OD5 A;  3U0C A;  4QI2 A;  4E0I A;  1TFK B;  1ORY A;  4W8K A;  3SXM A;  3POV A;  1J8Y F;  4H4K C;  1NSG B;  1D0Y A;  5EK0 A;  3TQO A;  4J7T A;  4E7Z A;  4KBL A;  4UDV A;  1WGW A;  1TWC A;  3UMK A;  2R7Q A;  1TWG A;  5L0D A;  1IZM A;  2HKV A;  4CSA A;  2R7S A;  2VH3 A;  1HW2 A;  1G5Z A;  3NKE A;  1V55 C;  4YT4 A;  3CAX A;  2NUP A;  1VOM A;  4MS2 A;  1E85 A;  1ORJ A;  4C7O B;  3US6 A;  4U5E E;  2HSB A;  1H9T A;  1C03 A;  3T9O A;  3LNM B;  4FES A;  4KNV A;  4AL0 A;  4DXW A;  4DBQ A;  1TKN A;  1QVX A;  5AGF A;  3B0V C;  1HMD A;  4O6M A;  2X51 A;  4JC7 A;  4OD4 A;  4AK9 A;  1MND A;  2EPL X;  4JTC B;  5DS6 A;  3CEX A;  3EFO B;  4Q5S F;  1TQG A;  1Z3I X;  2XM4 A;  3B9Q A;  2XLH A;  3RYL A;  3ASO C;  2I8B A;  2M4E A;  5L0F A;  1T01 A;  2Q9C A;  1BR4 A;  2MHR A;  3MLG A;  3X2Q C;  3GM1 A;  5L0C A;  3UR3 C;  1EA8 A;  1U6H A;  1AEP A; 
#chains in the Genus database with same CATH homology
 1K05 A;  2YWA A;  1WWP A;  2KK1 A;  1WTY A;  2L6F A;  2Q00 A;  3U3F A;  1UFB A;  3GM3 A;  3O10 A;  3MFN A;  3C8G D;  4R32 A;  3B71 A;  4EBK A;  2L6H A;  4XEV A;  1ZZP A;  3L8J A;  3RQF A;  1OW6 A;  3C8G B;  3GM2 A;  3JYY A;  3K7D A;  3C8G A;  2HSB A;  3BRJ A;  1KTM A;  4EBJ A;  1V4A A;  2L6G A;  1PV3 A;  1OW8 A;  2JX0 A;  3RQG A;  1QVX A;  3L8I A;  2LK4 A;  3TUL A;  2PBE A;  5F28 E;  1K40 A;  4XEF A;  2JPU A;  1K04 A;  4XEK A;  1O3U A;  3JZ0 A;  3U0C A;  3C18 A;  3RQE A;  3AJM A;  3S9O A;  1WOL A;  1JOG A;  1KNY A;  3GM1 A;  1OW7 A;  4NQF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...