4XEKA

Pyk2-fat domain in complex with leupaxin ld4 motif
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
137
structure length
137
Chain Sequence
HMANLDRTDDLVYLNVMELVRAVLELKNELSQLPPEGYVVVVKNVGLTLRKLIGSVDDLLPSLPSSSRTEIEGTQKLLNKDLAELINKMRLAQQNAVTSLSEEAKRQMLTASHTLAVDAKNLLDAVDQAKVLANLAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Protein-tyrosine kinase 2-beta
publication title Structural Basis for the Interaction between Pyk2-FAT Domain and Leupaxin LD Repeats.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 60
structure length 137
sequence length 137
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2014-12-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 4xekA00
1OW8A 3B71A 3AJMA 3S9OA 1UFBA 3RQEA 1OW7A 2KK1A 2L6GA 3C18A 3BRJA 4EBKA 4XEKA 4R32A 3K7DA 2JX0A 2HSBA 2JPUA 2L6FA 3L8IA 4XEFA 3RQFA 2YWAA 4NQFA 1JOGA 2Q00A 3JYYA 1KNYA 3MFNA 1PV3A 1ZZPA 2LK4A 1V4AA 1K05A 1K40A 1K04A 3GM1A 3GM3A 3TULA 3C8GB 1KTMA 3C8GA 3JZ0A 1WWPA 3L8JA 4XEVA 1QVXA 3U0CA 2L6HA 5F28E 1WOLA 3C8GD 1O3UA 3RQGA 3U3FA 4EBJA 1WTYA 3GM2A 3O10A 2PBEA 1OW6A
chains in the Genus database with same CATH superfamily
3EPVA 2FFHA 1HE1A 2AP3A 1Q0FA 3EFOA 4E0HA 1YVIA 3R7CA 1MMAA 2XLDA 1TFOB 1JPJA 5F5HA 1OR3A 3H2UA 3S84A 2M4EA 2JPUA 1PD0A 3L8IA 4XTKA 2XXAA 5B1AC 2J0WA 3MX3A 4CS9A 1WN0A 3ZIBA 4E0IA 4DVYP 4Z9HA 2LCHA 4J32B 4JTDB 4JRZA 5DQZA 2EIJC 2R9RB 4BPMA 2R7UA 1C03A 2V3CC 3LEOA 4JTCB 4PJMA 5DQTA 2Q9BA 1KTMA 3O39A 1OCRC 2B0JA 1LIHA 2YHSA 3EG9A 4JURI 4LLEA 2A1DD 1D0ZA 3L0IA 4XQ1A 3W8IA 3B29A 3MYIA 4I3MA 2NUTA 1A7DA 1VYKA 3ZSUA 4A4AA 5COGA 5D91A 3ZQVA 2YL3A 1U0BB 2HMQA 3VYWA 3RQFA 3PMRA 3FDQA 1V74B 2P7VA 4ZLDA 2HJMA 1FMVA 3ZWIA 4BG0A 3DMDA 1R5ID 1Q0GA 2CYDA 3IQ6A 3RQEA 3WG7C 5JT4A 3ITFA 4DBQA 2ZXRA 1AUEA 3C8ZA 1E86A 3SXKA 3OEOA 4WGZA 3KKBA 3GEHA 3U2MA 2AU5A 3T9OA 1RKCA 1VOMA 2HJ3A 3BEHA 2J45A 1MNDA 3T4RA 1ZVZA 3LLKA 4U9EA 3VM6A 4K0DA 1OKKD 3W8HA 1WOLA 3C8GD 4JIOA 1XZPA 5EGYA 2OU6A 2Q7RA 2J7PD 3V5YA 3O10A 5E33A 5KYUB 3B71A 1C17M 3NKEA 4LDKA 4MW3A 3U8PA 3ATPA 2Q4FA 2PNOA 3DI5A 2J9BA 1T01A 2QLAA 1U6HA 1TWGA 1W2WA 1JMWA 4MTFA 3WHNA 2WZGA 2WVQA 4MVSA 4MVMA 2A0UA 5COFA 4D4XA 3C62A 3LNMB 1JRAA 2Q9CA 2QTVA 2XM4A 5L0IA 3L34A 4EKWA 3U8VA 5DS4A 1Y6DA 4E17A 1IZMA 2Z15A 3C8GB 1Z63A 2AVKA 3QZCA 3Q7GA 4AE4B 1OCZC 2R25A 2YL0A 1LE4A 5CIVA 3GM2A 5DS6A 2IXPA 4K1OA 4G0HA 4HFFB 3V5XA 3RVYA 1TWHA 3EJNA 1BR1A 1ZW3A 2WZLA 2W9YA 5B3IA 2P6VA 3M15A 3FVYA 2XL4A 3IQCA 3PCVA 3W4YA 5IY5C 1E83A 2HV6A 1SR2A 2NUPA 3AQCA 3B9QA 4ONSA 1OW7A 4GEHA 1YA9A 2P61A 3EZIA 3U2LA 2NPUA 3DAGA 3HNJA 4IGGA 2BL2A 4YT2A 3ZTMA 1HMOA 2EPLX 5EK0A 4C3DA 3JYHA 4BJ5C 1Z7Qc 5BQIA 1PV3A 4O7GA 5F5FA 4CS8C 1OXBA 4EUKB 3LESA 3NYMA 1BR2A 1QZXA 1Z23A 1H6GA 3NMJA 4GQHA 4U5FE 4AL0A 4Q5SF 1M2VA 2R05A 2EIKC 2OQMA 1YJGA 4Z9JA 5EHHA 1EA8A 1T6UA 3HLZA 3W2VA 1FAPB 5A6BA 2KSFA 3FHDA 2JD3A 3Q6NA 5A6JA 3VF0A 1FNTc 5B3SC 3EHNA 4BJ6C 2AWCA 3OA1A 2HV7A 5BUOA 3ZVRA 1LS4A 3AJMA 2LQGA 3UGPA 3N2ZB 4XPXA 4L6RA 1YDIA 4EBBA 4PK4A 1O5HA 3ZTZA 5DLJA 2Y69C 1BBHA 1Q0KA 1JPNA 3UMHA 3WODF 3GODA 2L6FA 2HSBA 4IB4A 1MMDA 3K1IA 4NQFA 4U5EE 5GPGB 1MNEA 2BC5A 1PD1A 2XL8A 2ZPAA 4OINF 4C3EA 4AX2A 2WB7A 1ZYRF 1I5NA 2KJGA 2I15A 1NSGB 2J9WA 1LPEA 3GM3A 3GWNA 3NRHA 4MVUA 3UMIA 1H9TA 4DJ9A 3JZ0A 4XLPF 3AQBA 3B0PA 3DJUB 3DAFA 3L8JA 4Q7CA 2KQ9A 3V7OA 1D0XA 256BA 1U89A 2HSQA 2MWQA 4QDLA 2G62A 2E87A 3I5PA 4NC3A 3EH1A 2DYRC 4PFOA 1E2XA 2Y3HA 5T3WA 2R7TA 2LFFA 3R2PA 3B0VC 1TKNA 3MBGA 1LE2A 4ANJA 2R7SA 4IJJA 4C7OB 3PDMP 2LSEA 2EPKX 1G4WR 2CDQA 2XLOA 2D5RB 1ZU4A 2OEXA 2J46A 3G50A 4U5CE 1N1CA 2IXNA 5L0DA 5T1DB 4P9FA 1YAUO 1ZHWA 4OIOF 4XPWA 1QLEC 5BQHA 4J7YA 1LVKA 1RCPA 3EGDB 2UUIA 4RBNA 3EZHA 1FMWA 1HW1A 4OIPF 1QSPA 1L7CA 2R7RA 1QVXA 3HTKC 5COMA 2IXOA 3IQTA 4IARA 4H4KC 5JUAA 3S0XA 4PACA 2XS8A 4CDAA 2GWWA 2CNWD 2QUPA 2YLIA 3EFOB 3UNGC 4MVOA 5CI8A 1I4ZA 4E18A 3UGOA 2H8AA 4DRHB 2BE5F 2KW3C 1SZIA 2WZFA 3LAYA 4LDRA 2YZSA 4LLCA 5AC4A 4H54A 4XEFA 2XXAB 3ABLC 5DVWA 4ULVA 1RJ9A 2X51A 3F46A 3JYYA 4K7BA 1H7IA 2VCCA 3HNIA 4KNWA 3EGXA 4NY3A 3RF3A 3EH2A 1QQ3A 1T5OA 2LP4A 3GM1A 3N24A 5A69A 2O9XA 2A6EF 2J9UA 4JJGA 3W2WA 1D0YA 1KU2A 1S05A 3AG3C 3AG4C 1Z5ZA 3EG9B 1NU7D 3HNLA 4RD9A 3AGUA 2NUTB 1T6QA 4CS9C 1OXKA 3U3FA 3U0CA 3VRCA 1O3UA 2FAPB 1EQ1A 5E2QA 2KYHA 3C7JA 3X1OA 3RQGA 2V26A 1DOWA 3K66A 1LM3B 1A41A 5KYXA 3QW1A 4JW1A 4MQ9F 3HJCA 2OJQA 1JAFA 2CW0F 3HKKA 3M1CB 2XSEA 1R4TA 4HEAJ 2NG1A 4YL1A 5E3AA 4CDVA 2DI3A 4M63A 4CSAC 4IAOA 2J8WA 1M57C 4LERA 3C63A 4JJFA 4YT8A 1CGME 1G5ZA 2IOQA 2QE9A 3QMKA 2P1AA 2H7OA 2Y3DA 3F47A 1OKKA 2WVNA 1J8YF 3FOPA 4A2NB 1D1AA 2A68F 1E85A 1ORYA 2XLVA 4CDYA 3SZRA 1G4US 1D1CA 2LD6A 2IBFA 2IYLD 2VH3A 3KL4A 4HFKB 3UMKA 2L81A 3US6A 3ZG1A 1OQCA 2C04A 2CCYA 2YL1A 3G4ZA 4CBEA 2H7VC 2A0BA 2W45A 2HFIA 4WABA 1T6IA 3TOLA 3DM9B 1RKEA 5L3VA 3T6BA 1AVOB 4N4WA 5HV9A 2Q9AA 3Q7LA 4KNVA 2EILC 3WAQA 4OD5A 3AGTA 2VCBA 2KGOA 4YK5A 2H7BA 2R7QA 5KYYA 5JRAA 4R32A 1CPQA 5KYWA 4JCHA 3ABKC 1M6TA 1LS1A 1YYXA 2VASA 5B1BC 1GQAA 1ZHTA 4EWCA 2G3VA 3RH3A 2DB4A 3K6BA 4JEAA 3ZC4A 4BJ6A 4MTGA 4EIYA 4N6CA 4U5GA 2GFHA 2YLGA 3CSKA 4DRIB 2YLDA 4ULWA 3S90A 1YZAA 3JSZA 2FGYA 2GAQA 3RIPA 1NU9C 1NLXA 1OCCC 4MVZA 4B6IA 3B0UX 2DGJA 4MVRA 1V55C 4N6HA 4CJGA 1WGWA 4O6NA 2Y39A 3QVYA 1TR2A 3CZ6A 4P6IC 1ZW2A 2DYSC 3S9OA 2CGEA 5L0HA 3EHMA 2NUPB 3NDBB 4FWVA 4E7SA 5HSWA 4OIQF 1ZHXA 3JRMO 3JCUQ 3V5ZA 4DXWA 2HKVA 2A69F 4I44A 2ASRA 2D4UA 2YQYA 2OEVA 3JRTA 1XWJA 3SXMA 4E7ZA 2Y3BA 4JTAB 3CEXA 3FAJA 4JKVA 1JR8A 3DWWA 1VK5A 2PFDA 2R03A 4NTFA 2WVOA 5JVEA 1QPUA 1M2VB 2IM8A 4N06A 3VAYA 4XEVA 3KH2A 1ORSC 1LKXA 4JVSA 1GGQA 2L6HA 3HNKA 4MNDA 4AL1A 4ZLCA 4YN0B 2W4BA 3FXHA 1VB5A 1XZQA 2EIMC 3NKDA 1OW8A 4O79A 4CX9A 4PJNA 1GS9A 1YZCA 3CQZA 5FZTA 4CIPA 4YL0A 2W4MA 1D1BA 3GANA 2L6GA 1QKRA 2NSFA 2EPNA 1ZU5A 2Y3GA 3BRJA 3EQLF 1Y4CA 3DE8A 3O6XA 1M56C 3IPMO 5L0FA 4Z9IA 5L3QA 1ST6A 2YKZA 2LIGA 3LLIA 1PCXA 1UG7A 1ZZPA 1CGNA 2ZXOA 1O87A 3OWTA 4KI2A 3ASOC 4U5DE 1YYJA 2C03A 4NTAA 4PR9A 3E9VA 1VMAA 3FOOA 1MMNA 3K1IC 2QY9A 4GYTA 4UDVA 2ZXPA 4G7HF 4EBJA 1WATA 1LI5A 1A7VA 2PBEA 2AWYA 1HY5A 1OW6A 4HE8D 4F4BA 1EI7A 1A0BA 3ZDLA 4U5BE 2R02A 4CIHA 1SMYF 1G8XA 2EPMX 4FX5A 1VLTA 3KYJA 4RDAA 2L7AA 2HS5A 3NYLA 3LEVA 4WJ0A 3U9MA 4KBLA 1E84A 1HE9A 2L9JA 3E70C 1BZ4A 1ZHYA 2ZXWC 3LNRA 4IWBA 3RYLA 2I8BA 5A6AA 3AG1C 2KC3A 1KNYA 4I1MA 3TQOA 2G3KA 1V4AA 1K40A 2M64A 1NFOA 4IAQA 4XWJA 2XRHA 4DVZA 4DOZA 1WASA 2VCAA 3I5QA 4DBRA 2Q3TA 3DKAA 3RKOF 2XLWA 4KC9A 4CSAA 3A11A 3QW0A 4J30B 4YJWA 2CNWA 3U9JA 4YT4A 3KYIA 4O6YA 3RFYA 1NZEA 3O55A 4U5HA 4BJTA 5A6KA 5KYUA 1VYIA 2R7WA 2YL7A 2XS1A 4XLNF 4YT5A 3GEIA 4O6MA 1SF8A 5T3TA 4AK9A 1FFTC 3IQ5A 1DOVA 3DJNB 1H9GA 3ASNC 3JTLO 5K0IA 3T6JA 1OCOC 3NYJA 2VC9A 3NMKA 4XEKA 1Z6AA 2ZD9A 5E3CA 1CPRA 2X0CA 3U5SA 1FTSA 4BEMJ 1RJ9B 4J7TA 3QTHA 2A6HF 2Q00A 4MW8A 3S29A 3DZAA 5AC5A 5TJ5E 3MFNA 4P9TA 3EGXB 3M4BA 3KMIA 4PJLA 1APCA 3UR3C 1SYQA 2OKUA 2J9VA 3GORA 3SXZA 5JSLA 3S27A 2XLHA 2HUJA 2GDCA 3AOUA 4G78A 3Q6MA 4CJOA 1VLSA 5D92A 2OJED 3LUTB 3M79A 3C8GA 3DD7A 2J7PA 2OG2A 4AE4A 4EHPA 1HW2A 2ETSA 3NG1A 4JC7A 4OIRF 4JE9A 5KYNA 1NBBA 4LACB 4QI2A 1C02A 1TWCA 3RW0A 1OR2A 2PX0A 1RXQA 1YA7O 4CS7A 4BJ5A 4MS2A 1LI7A 5KYXB 2EPOA 1TWAA 5L0JA 2KNHA 4FESA 5AGFA 3J06A 2VB6A 4CS8A 3DM5A 2R7VA 1TFKB 2NSGA 3C18A 4EBKA 2HMZA 3GWLA 5DS5A 1F1MA 3SXYA 1JOGA 3LS1A 2J0XA 3FMSA 2LFDA 3FAPB 2XL6A 3IEEA 4JCZA 4W8KA 2LK4A 4IRUA 2GA0A 3KPHA 3SNHA 3G4XA 3IHUA 1K04A 2YVKA 4MVQA 5JP7A 2RSEB 4BEJA 3POVA 3QVZA 3L1MA 4JEBA 1M2OA 4U9DA 4YWQA 4NTBA 5L0CA 1RKEB 3NMIA 1ZHZA 3MLGA 3LJBA 2P0NA 3T6GB 4ER9A 4PJJA 4XPYA 3M4CA 2ICWG 5A6BD 5L0GA 2RD9A 3H2VA 2R7XA 2XM0A 1J8MF 1UFBA 1MQVA 2MYSA 4MTOA 5KYYB 4G7OF 1I4YA 1BDJB 3H65A 5FCLA 1Q0MA 4PFPA 2EINC 1NG1A 5KYWB 2PF4E 5CI9A 1V54C 3TK0A 4LDQA 2WL8A 2R7OA 2YRFA 1ORJA 4JZAA 3X2QC 4D4NA 3ABMC 5JLIA 1K05A 4BJ1A 2YEVA 3N0TA 4YL3A 3TD7A 5JS5A 3TULA 1TQGA 1L3PA 3SEOA 3TOMA 3DE9A 2QNLA 4FAPB 1GM5A 1RMVA 2UUHA 3AG2C 3JT1A 3MYFA 2HZ8A 1Z3IX 1B68A 1S7ZA 1WTYA 3ZQYA 4X0RA 3GEEA 3ECSA 3K1HA 1T9KA 1VTMP 2IXMA 1YLMA 1YARO 3K33A 3TJ6A 2OCCC 3S28A 2KK1A 2OOCA 4C7OA 3RVZA 2MHRA 1IW7F 4OD4A 3TJ5A 4C3BA 3K7DA 2JX0A 1MMGA 1EKYA 1Q0DA 3PHF2 2XLMA 2YWAA 4NCQA 3DXJF 1BR4A 4I1OB 5BQGA 3I4UA 3JSEO 3SYNA 2XLEA 4QI0A 3U3BA 1NFNA 2PX3A 3LS0A 3EGDA 4DRJB 1AEPA 3A9CA 1A7EA 3SP1A 4WGYA 1FR0A 1WWPA 2TMVP 4G7ZF 2B0HA 2F22A 5F28E 1FFHA 1CGOA 2PP4A 4W8PA 3CAXA 1HMDA 4Q4ZF
chains in the Genus database with same CATH topology
1OW8A 3B71A 3AJMA 3S9OA 1UFBA 3RQEA 1OW7A 2KK1A 2L6GA 3C18A 3BRJA 4EBKA 4XEKA 4R32A 3K7DA 2JX0A 2HSBA 2JPUA 2L6FA 3L8IA 4XEFA 3RQFA 2YWAA 4NQFA 1JOGA 2Q00A 3JYYA 1KNYA 3MFNA 1PV3A 1ZZPA 2LK4A 1V4AA 1K05A 1K40A 1K04A 3GM1A 3GM3A 3TULA 3C8GB 1KTMA 3C8GA 3JZ0A 1WWPA 3L8JA 4XEVA 1QVXA 3U0CA 2L6HA 5F28E 1WOLA 3C8GD 1O3UA 3RQGA 3U3FA 4EBJA 1WTYA 3GM2A 3O10A 2PBEA 1OW6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OW8 A;  3B71 A;  3AJM A;  3S9O A;  1UFB A;  3RQE A;  1OW7 A;  2KK1 A;  2L6G A;  3C18 A;  3BRJ A;  4EBK A;  4XEK A;  4R32 A;  3K7D A;  2JX0 A;  2HSB A;  2JPU A;  2L6F A;  3L8I A;  4XEF A;  3RQF A;  2YWA A;  4NQF A;  1JOG A;  2Q00 A;  3JYY A;  1KNY A;  3MFN A;  1PV3 A;  1ZZP A;  2LK4 A;  1V4A A;  1K05 A;  1K40 A;  1K04 A;  3GM1 A;  3GM3 A;  3TUL A;  3C8G B;  1KTM A;  3C8G A;  3JZ0 A;  1WWP A;  3L8J A;  4XEV A;  1QVX A;  3U0C A;  2L6H A;  5F28 E;  1WOL A;  3C8G D;  1O3U A;  3RQG A;  3U3F A;  4EBJ A;  1WTY A;  3GM2 A;  3O10 A;  2PBE A;  1OW6 A; 
#chains in the Genus database with same CATH topology
 3EPV A;  2FFH A;  1HE1 A;  2AP3 A;  1Q0F A;  3EFO A;  4E0H A;  1YVI A;  3R7C A;  1MMA A;  2XLD A;  1TFO B;  1JPJ A;  5F5H A;  1OR3 A;  3H2U A;  3S84 A;  2M4E A;  2JPU A;  1PD0 A;  3L8I A;  4XTK A;  2XXA A;  5B1A C;  2J0W A;  3MX3 A;  4CS9 A;  1WN0 A;  3ZIB A;  4E0I A;  4DVY P;  4Z9H A;  2LCH A;  4J32 B;  4JTD B;  4JRZ A;  5DQZ A;  2EIJ C;  2R9R B;  4BPM A;  2R7U A;  1C03 A;  2V3C C;  3LEO A;  4JTC B;  4PJM A;  5DQT A;  2Q9B A;  1KTM A;  3O39 A;  1OCR C;  2B0J A;  1LIH A;  2YHS A;  3EG9 A;  4JUR I;  4LLE A;  2A1D D;  1D0Z A;  3L0I A;  4XQ1 A;  3W8I A;  3B29 A;  3MYI A;  4I3M A;  2NUT A;  1A7D A;  1VYK A;  3ZSU A;  4A4A A;  5COG A;  5D91 A;  3ZQV A;  2YL3 A;  1U0B B;  2HMQ A;  3VYW A;  3RQF A;  3PMR A;  3FDQ A;  1V74 B;  2P7V A;  4ZLD A;  2HJM A;  1FMV A;  3ZWI A;  4BG0 A;  3DMD A;  1R5I D;  1Q0G A;  2CYD A;  3IQ6 A;  3RQE A;  3WG7 C;  5JT4 A;  3ITF A;  4DBQ A;  2ZXR A;  1AUE A;  3C8Z A;  1E86 A;  3SXK A;  3OEO A;  4WGZ A;  3KKB A;  3GEH A;  3U2M A;  2AU5 A;  3T9O A;  1RKC A;  1VOM A;  2HJ3 A;  3BEH A;  2J45 A;  1MND A;  3T4R A;  1ZVZ A;  3LLK A;  4U9E A;  3VM6 A;  4K0D A;  1OKK D;  3W8H A;  1WOL A;  3C8G D;  4JIO A;  1XZP A;  5EGY A;  2OU6 A;  2Q7R A;  2J7P D;  3V5Y A;  3O10 A;  5E33 A;  5KYU B;  3B71 A;  1C17 M;  3NKE A;  4LDK A;  4MW3 A;  3U8P A;  3ATP A;  2Q4F A;  2PNO A;  3DI5 A;  2J9B A;  1T01 A;  2QLA A;  1U6H A;  1TWG A;  1W2W A;  1JMW A;  4MTF A;  3WHN A;  2WZG A;  2WVQ A;  4MVS A;  4MVM A;  2A0U A;  5COF A;  4D4X A;  3C62 A;  3LNM B;  1JRA A;  2Q9C A;  2QTV A;  2XM4 A;  5L0I A;  3L34 A;  4EKW A;  3U8V A;  5DS4 A;  1Y6D A;  4E17 A;  1IZM A;  2Z15 A;  3C8G B;  1Z63 A;  2AVK A;  3QZC A;  3Q7G A;  4AE4 B;  1OCZ C;  2R25 A;  2YL0 A;  1LE4 A;  5CIV A;  3GM2 A;  5DS6 A;  2IXP A;  4K1O A;  4G0H A;  4HFF B;  3V5X A;  3RVY A;  1TWH A;  3EJN A;  1BR1 A;  1ZW3 A;  2WZL A;  2W9Y A;  5B3I A;  2P6V A;  3M15 A;  3FVY A;  2XL4 A;  3IQC A;  3PCV A;  3W4Y A;  5IY5 C;  1E83 A;  2HV6 A;  1SR2 A;  2NUP A;  3AQC A;  3B9Q A;  4ONS A;  1OW7 A;  4GEH A;  1YA9 A;  2P61 A;  3EZI A;  3U2L A;  2NPU A;  3DAG A;  3HNJ A;  4IGG A;  2BL2 A;  4YT2 A;  3ZTM A;  1HMO A;  2EPL X;  5EK0 A;  4C3D A;  3JYH A;  4BJ5 C;  1Z7Q c;  5BQI A;  1PV3 A;  4O7G A;  5F5F A;  4CS8 C;  1OXB A;  4EUK B;  3LES A;  3NYM A;  1BR2 A;  1QZX A;  1Z23 A;  1H6G A;  3NMJ A;  4GQH A;  4U5F E;  4AL0 A;  4Q5S F;  1M2V A;  2R05 A;  2EIK C;  2OQM A;  1YJG A;  4Z9J A;  5EHH A;  1EA8 A;  1T6U A;  3HLZ A;  3W2V A;  1FAP B;  5A6B A;  2KSF A;  3FHD A;  2JD3 A;  3Q6N A;  5A6J A;  3VF0 A;  1FNT c;  5B3S C;  3EHN A;  4BJ6 C;  2AWC A;  3OA1 A;  2HV7 A;  5BUO A;  3ZVR A;  1LS4 A;  3AJM A;  2LQG A;  3UGP A;  3N2Z B;  4XPX A;  4L6R A;  1YDI A;  4EBB A;  4PK4 A;  1O5H A;  3ZTZ A;  5DLJ A;  2Y69 C;  1BBH A;  1Q0K A;  1JPN A;  3UMH A;  3WOD F;  3GOD A;  2L6F A;  2HSB A;  4IB4 A;  1MMD A;  3K1I A;  4NQF A;  4U5E E;  5GPG B;  1MNE A;  2BC5 A;  1PD1 A;  2XL8 A;  2ZPA A;  4OIN F;  4C3E A;  4AX2 A;  2WB7 A;  1ZYR F;  1I5N A;  2KJG A;  2I15 A;  1NSG B;  2J9W A;  1LPE A;  3GM3 A;  3GWN A;  3NRH A;  4MVU A;  3UMI A;  1H9T A;  4DJ9 A;  3JZ0 A;  4XLP F;  3AQB A;  3B0P A;  3DJU B;  3DAF A;  3L8J A;  4Q7C A;  2KQ9 A;  3V7O A;  1D0X A;  256B A;  1U89 A;  2HSQ A;  2MWQ A;  4QDL A;  2G62 A;  2E87 A;  3I5P A;  4NC3 A;  3EH1 A;  2DYR C;  4PFO A;  1E2X A;  2Y3H A;  5T3W A;  2R7T A;  2LFF A;  3R2P A;  3B0V C;  1TKN A;  3MBG A;  1LE2 A;  4ANJ A;  2R7S A;  4IJJ A;  4C7O B;  3PDM P;  2LSE A;  2EPK X;  1G4W R;  2CDQ A;  2XLO A;  2D5R B;  1ZU4 A;  2OEX A;  2J46 A;  3G50 A;  4U5C E;  1N1C A;  2IXN A;  5L0D A;  5T1D B;  4P9F A;  1YAU O;  1ZHW A;  4OIO F;  4XPW A;  1QLE C;  5BQH A;  4J7Y A;  1LVK A;  1RCP A;  3EGD B;  2UUI A;  4RBN A;  3EZH A;  1FMW A;  1HW1 A;  4OIP F;  1QSP A;  1L7C A;  2R7R A;  1QVX A;  3HTK C;  5COM A;  2IXO A;  3IQT A;  4IAR A;  4H4K C;  5JUA A;  3S0X A;  4PAC A;  2XS8 A;  4CDA A;  2GWW A;  2CNW D;  2QUP A;  2YLI A;  3EFO B;  3UNG C;  4MVO A;  5CI8 A;  1I4Z A;  4E18 A;  3UGO A;  2H8A A;  4DRH B;  2BE5 F;  2KW3 C;  1SZI A;  2WZF A;  3LAY A;  4LDR A;  2YZS A;  4LLC A;  5AC4 A;  4H54 A;  4XEF A;  2XXA B;  3ABL C;  5DVW A;  4ULV A;  1RJ9 A;  2X51 A;  3F46 A;  3JYY A;  4K7B A;  1H7I A;  2VCC A;  3HNI A;  4KNW A;  3EGX A;  4NY3 A;  3RF3 A;  3EH2 A;  1QQ3 A;  1T5O A;  2LP4 A;  3GM1 A;  3N24 A;  5A69 A;  2O9X A;  2A6E F;  2J9U A;  4JJG A;  3W2W A;  1D0Y A;  1KU2 A;  1S05 A;  3AG3 C;  3AG4 C;  1Z5Z A;  3EG9 B;  1NU7 D;  3HNL A;  4RD9 A;  3AGU A;  2NUT B;  1T6Q A;  4CS9 C;  1OXK A;  3U3F A;  3U0C A;  3VRC A;  1O3U A;  2FAP B;  1EQ1 A;  5E2Q A;  2KYH A;  3C7J A;  3X1O A;  3RQG A;  2V26 A;  1DOW A;  3K66 A;  1LM3 B;  1A41 A;  5KYX A;  3QW1 A;  4JW1 A;  4MQ9 F;  3HJC A;  2OJQ A;  1JAF A;  2CW0 F;  3HKK A;  3M1C B;  2XSE A;  1R4T A;  4HEA J;  2NG1 A;  4YL1 A;  5E3A A;  4CDV A;  2DI3 A;  4M63 A;  4CSA C;  4IAO A;  2J8W A;  1M57 C;  4LER A;  3C63 A;  4JJF A;  4YT8 A;  1CGM E;  1G5Z A;  2IOQ A;  2QE9 A;  3QMK A;  2P1A A;  2H7O A;  2Y3D A;  3F47 A;  1OKK A;  2WVN A;  1J8Y F;  3FOP A;  4A2N B;  1D1A A;  2A68 F;  1E85 A;  1ORY A;  2XLV A;  4CDY A;  3SZR A;  1G4U S;  1D1C A;  2LD6 A;  2IBF A;  2IYL D;  2VH3 A;  3KL4 A;  4HFK B;  3UMK A;  2L81 A;  3US6 A;  3ZG1 A;  1OQC A;  2C04 A;  2CCY A;  2YL1 A;  3G4Z A;  4CBE A;  2H7V C;  2A0B A;  2W45 A;  2HFI A;  4WAB A;  1T6I A;  3TOL A;  3DM9 B;  1RKE A;  5L3V A;  3T6B A;  1AVO B;  4N4W A;  5HV9 A;  2Q9A A;  3Q7L A;  4KNV A;  2EIL C;  3WAQ A;  4OD5 A;  3AGT A;  2VCB A;  2KGO A;  4YK5 A;  2H7B A;  2R7Q A;  5KYY A;  5JRA A;  4R32 A;  1CPQ A;  5KYW A;  4JCH A;  3ABK C;  1M6T A;  1LS1 A;  1YYX A;  2VAS A;  5B1B C;  1GQA A;  1ZHT A;  4EWC A;  2G3V A;  3RH3 A;  2DB4 A;  3K6B A;  4JEA A;  3ZC4 A;  4BJ6 A;  4MTG A;  4EIY A;  4N6C A;  4U5G A;  2GFH A;  2YLG A;  3CSK A;  4DRI B;  2YLD A;  4ULW A;  3S90 A;  1YZA A;  3JSZ A;  2FGY A;  2GAQ A;  3RIP A;  1NU9 C;  1NLX A;  1OCC C;  4MVZ A;  4B6I A;  3B0U X;  2DGJ A;  4MVR A;  1V55 C;  4N6H A;  4CJG A;  1WGW A;  4O6N A;  2Y39 A;  3QVY A;  1TR2 A;  3CZ6 A;  4P6I C;  1ZW2 A;  2DYS C;  3S9O A;  2CGE A;  5L0H A;  3EHM A;  2NUP B;  3NDB B;  4FWV A;  4E7S A;  5HSW A;  4OIQ F;  1ZHX A;  3JRM O;  3JCU Q;  3V5Z A;  4DXW A;  2HKV A;  2A69 F;  4I44 A;  2ASR A;  2D4U A;  2YQY A;  2OEV A;  3JRT A;  1XWJ A;  3SXM A;  4E7Z A;  2Y3B A;  4JTA B;  3CEX A;  3FAJ A;  4JKV A;  1JR8 A;  3DWW A;  1VK5 A;  2PFD A;  2R03 A;  4NTF A;  2WVO A;  5JVE A;  1QPU A;  1M2V B;  2IM8 A;  4N06 A;  3VAY A;  4XEV A;  3KH2 A;  1ORS C;  1LKX A;  4JVS A;  1GGQ A;  2L6H A;  3HNK A;  4MND A;  4AL1 A;  4ZLC A;  4YN0 B;  2W4B A;  3FXH A;  1VB5 A;  1XZQ A;  2EIM C;  3NKD A;  1OW8 A;  4O79 A;  4CX9 A;  4PJN A;  1GS9 A;  1YZC A;  3CQZ A;  5FZT A;  4CIP A;  4YL0 A;  2W4M A;  1D1B A;  3GAN A;  2L6G A;  1QKR A;  2NSF A;  2EPN A;  1ZU5 A;  2Y3G A;  3BRJ A;  3EQL F;  1Y4C A;  3DE8 A;  3O6X A;  1M56 C;  3IPM O;  5L0F A;  4Z9I A;  5L3Q A;  1ST6 A;  2YKZ A;  2LIG A;  3LLI A;  1PCX A;  1UG7 A;  1ZZP A;  1CGN A;  2ZXO A;  1O87 A;  3OWT A;  4KI2 A;  3ASO C;  4U5D E;  1YYJ A;  2C03 A;  4NTA A;  4PR9 A;  3E9V A;  1VMA A;  3FOO A;  1MMN A;  3K1I C;  2QY9 A;  4GYT A;  4UDV A;  2ZXP A;  4G7H F;  4EBJ A;  1WAT A;  1LI5 A;  1A7V A;  2PBE A;  2AWY A;  1HY5 A;  1OW6 A;  4HE8 D;  4F4B A;  1EI7 A;  1A0B A;  3ZDL A;  4U5B E;  2R02 A;  4CIH A;  1SMY F;  1G8X A;  2EPM X;  4FX5 A;  1VLT A;  3KYJ A;  4RDA A;  2L7A A;  2HS5 A;  3NYL A;  3LEV A;  4WJ0 A;  3U9M A;  4KBL A;  1E84 A;  1HE9 A;  2L9J A;  3E70 C;  1BZ4 A;  1ZHY A;  2ZXW C;  3LNR A;  4IWB A;  3RYL A;  2I8B A;  5A6A A;  3AG1 C;  2KC3 A;  1KNY A;  4I1M A;  3TQO A;  2G3K A;  1V4A A;  1K40 A;  2M64 A;  1NFO A;  4IAQ A;  4XWJ A;  2XRH A;  4DVZ A;  4DOZ A;  1WAS A;  2VCA A;  3I5Q A;  4DBR A;  2Q3T A;  3DKA A;  3RKO F;  2XLW A;  4KC9 A;  4CSA A;  3A11 A;  3QW0 A;  4J30 B;  4YJW A;  2CNW A;  3U9J A;  4YT4 A;  3KYI A;  4O6Y A;  3RFY A;  1NZE A;  3O55 A;  4U5H A;  4BJT A;  5A6K A;  5KYU A;  1VYI A;  2R7W A;  2YL7 A;  2XS1 A;  4XLN F;  4YT5 A;  3GEI A;  4O6M A;  1SF8 A;  5T3T A;  4AK9 A;  1FFT C;  3IQ5 A;  1DOV A;  3DJN B;  1H9G A;  3ASN C;  3JTL O;  5K0I A;  3T6J A;  1OCO C;  3NYJ A;  2VC9 A;  3NMK A;  4XEK A;  1Z6A A;  2ZD9 A;  5E3C A;  1CPR A;  2X0C A;  3U5S A;  1FTS A;  4BEM J;  1RJ9 B;  4J7T A;  3QTH A;  2A6H F;  2Q00 A;  4MW8 A;  3S29 A;  3DZA A;  5AC5 A;  5TJ5 E;  3MFN A;  4P9T A;  3EGX B;  3M4B A;  3KMI A;  4PJL A;  1APC A;  3UR3 C;  1SYQ A;  2OKU A;  2J9V A;  3GOR A;  3SXZ A;  5JSL A;  3S27 A;  2XLH A;  2HUJ A;  2GDC A;  3AOU A;  4G78 A;  3Q6M A;  4CJO A;  1VLS A;  5D92 A;  2OJE D;  3LUT B;  3M79 A;  3C8G A;  3DD7 A;  2J7P A;  2OG2 A;  4AE4 A;  4EHP A;  1HW2 A;  2ETS A;  3NG1 A;  4JC7 A;  4OIR F;  4JE9 A;  5KYN A;  1NBB A;  4LAC B;  4QI2 A;  1C02 A;  1TWC A;  3RW0 A;  1OR2 A;  2PX0 A;  1RXQ A;  1YA7 O;  4CS7 A;  4BJ5 A;  4MS2 A;  1LI7 A;  5KYX B;  2EPO A;  1TWA A;  5L0J A;  2KNH A;  4FES A;  5AGF A;  3J06 A;  2VB6 A;  4CS8 A;  3DM5 A;  2R7V A;  1TFK B;  2NSG A;  3C18 A;  4EBK A;  2HMZ A;  3GWL A;  5DS5 A;  1F1M A;  3SXY A;  1JOG A;  3LS1 A;  2J0X A;  3FMS A;  2LFD A;  3FAP B;  2XL6 A;  3IEE A;  4JCZ A;  4W8K A;  2LK4 A;  4IRU A;  2GA0 A;  3KPH A;  3SNH A;  3G4X A;  3IHU A;  1K04 A;  2YVK A;  4MVQ A;  5JP7 A;  2RSE B;  4BEJ A;  3POV A;  3QVZ A;  3L1M A;  4JEB A;  1M2O A;  4U9D A;  4YWQ A;  4NTB A;  5L0C A;  1RKE B;  3NMI A;  1ZHZ A;  3MLG A;  3LJB A;  2P0N A;  3T6G B;  4ER9 A;  4PJJ A;  4XPY A;  3M4C A;  2ICW G;  5A6B D;  5L0G A;  2RD9 A;  3H2V A;  2R7X A;  2XM0 A;  1J8M F;  1UFB A;  1MQV A;  2MYS A;  4MTO A;  5KYY B;  4G7O F;  1I4Y A;  1BDJ B;  3H65 A;  5FCL A;  1Q0M A;  4PFP A;  2EIN C;  1NG1 A;  5KYW B;  2PF4 E;  5CI9 A;  1V54 C;  3TK0 A;  4LDQ A;  2WL8 A;  2R7O A;  2YRF A;  1ORJ A;  4JZA A;  3X2Q C;  4D4N A;  3ABM C;  5JLI A;  1K05 A;  4BJ1 A;  2YEV A;  3N0T A;  4YL3 A;  3TD7 A;  5JS5 A;  3TUL A;  1TQG A;  1L3P A;  3SEO A;  3TOM A;  3DE9 A;  2QNL A;  4FAP B;  1GM5 A;  1RMV A;  2UUH A;  3AG2 C;  3JT1 A;  3MYF A;  2HZ8 A;  1Z3I X;  1B68 A;  1S7Z A;  1WTY A;  3ZQY A;  4X0R A;  3GEE A;  3ECS A;  3K1H A;  1T9K A;  1VTM P;  2IXM A;  1YLM A;  1YAR O;  3K33 A;  3TJ6 A;  2OCC C;  3S28 A;  2KK1 A;  2OOC A;  4C7O A;  3RVZ A;  2MHR A;  1IW7 F;  4OD4 A;  3TJ5 A;  4C3B A;  3K7D A;  2JX0 A;  1MMG A;  1EKY A;  1Q0D A;  3PHF 2;  2XLM A;  2YWA A;  4NCQ A;  3DXJ F;  1BR4 A;  4I1O B;  5BQG A;  3I4U A;  3JSE O;  3SYN A;  2XLE A;  4QI0 A;  3U3B A;  1NFN A;  2PX3 A;  3LS0 A;  3EGD A;  4DRJ B;  1AEP A;  3A9C A;  1A7E A;  3SP1 A;  4WGY A;  1FR0 A;  1WWP A;  2TMV P;  4G7Z F;  2B0H A;  2F22 A;  5F28 E;  1FFH A;  1CGO A;  2PP4 A;  4W8P A;  3CAX A;  1HMD A;  4Q4Z F; 
#chains in the Genus database with same CATH homology
 1OW8 A;  3B71 A;  3AJM A;  3S9O A;  1UFB A;  3RQE A;  1OW7 A;  2KK1 A;  2L6G A;  3C18 A;  3BRJ A;  4EBK A;  4XEK A;  4R32 A;  3K7D A;  2JX0 A;  2HSB A;  2JPU A;  2L6F A;  3L8I A;  4XEF A;  3RQF A;  2YWA A;  4NQF A;  1JOG A;  2Q00 A;  3JYY A;  1KNY A;  3MFN A;  1PV3 A;  1ZZP A;  2LK4 A;  1V4A A;  1K05 A;  1K40 A;  1K04 A;  3GM1 A;  3GM3 A;  3TUL A;  3C8G B;  1KTM A;  3C8G A;  3JZ0 A;  1WWP A;  3L8J A;  4XEV A;  1QVX A;  3U0C A;  2L6H A;  5F28 E;  1WOL A;  3C8G D;  1O3U A;  3RQG A;  3U3F A;  4EBJ A;  1WTY A;  3GM2 A;  3O10 A;  2PBE A;  1OW6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...