4XEKA

Pyk2-fat domain in complex with leupaxin ld4 motif
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
137
structure length
137
Chain Sequence
HMANLDRTDDLVYLNVMELVRAVLELKNELSQLPPEGYVVVVKNVGLTLRKLIGSVDDLLPSLPSSSRTEIEGTQKLLNKDLAELINKMRLAQQNAVTSLSEEAKRQMLTASHTLAVDAKNLLDAVDQAKVLANLAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Basis for the Interaction between Pyk2-FAT Domain and Leupaxin LD Repeats.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
molecule keywords Protein-tyrosine kinase 2-beta
total genus 60
structure length 137
sequence length 137
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2014-12-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 4xekA00
3RQGA 1K40A 1K04A 3C18A 3JYYA 4XEVA 2JX0A 1OW8A 1JOGA 1UFBA 1WWPA 2JPUA 1PV3A 2L6HA 1WTYA 2KK1A 3K7DA 4NQFA 3GM3A 1ZZPA 3L8JA 1OW7A 3GM1A 3JZ0A 2LK4A 3BRJA 4XEFA 3RQEA 3RQFA 4R32A 1KNYA 1K05A 3U3FA 2HSBA 3C8GD 1KTMA 4EBJA 3MFNA 1OW6A 2PBEA 2Q00A 3L8IA 3C8GB 3TULA 2L6FA 3B71A 3O10A 5F28E 1QVXA 3U0CA 3AJMA 1V4AA 3C8GA 3GM2A 4XEKA 1O3UA 3S9OA 4EBKA 2YWAA 1WOLA 2L6GA
chains in the Genus database with same CATH superfamily
3SNHA 1YJGA 4MVRA 3SXZA 3QMKA 2OU6A 3ATPA 4IARA 5A6KA 5JVEA 4AL1A 3MYIA 4YK5A 4YT4A 2D5RB 3KL4A 4CBEA 2HMQA 2KYHA 4E0IA 4GEHA 3DKAA 3R2PA 2Q9CA 2H8AA 3RQEA 3CZ6A 2IXOA 1G8XA 4JVSA 5TJ5E 2IXNA 1EI7A 1G5ZA 4R32A 1KNYA 3RW0A 1K05A 4XQ1A 5KYYB 5COFA 1Q0KA 4GYTA 2A0BA 2ASRA 2XS1A 2O9XA 3MBGA 2OOCA 2WZFA 1T6QA 3B71A 3E70C 3LAYA 4IJJA 4NTAA 1LS1A 3C8GA 4I44A 3ZVRA 3LEVA 1D0ZA 2IYLD 5B1AC 3UMKA 2LFFA 4GQHA 3ZTMA 2C03A 1VB5A 2EPNA 1DOVA 1K04A 4JJFA 5F5HA 3ZSUA 4CX9A 5A6BA 4PFPA 3N24A 3QTHA 4N06A 4U5FE 1D1AA 5L0GA 3V5ZA 3UR3C 5EGYA 3V5YA 5D91A 1ZYRF 3L0IA 2XLHA 4CJGA 4G0HA 1ZU5A 4MW3A 2MYSA 1HE1A 4M63A 2M4EA 1XZPA 2VCCA 5B1BC 1YA9A 3O6XA 3SXYA 5CIVA 3EGDB 1VMAA 2EPLX 2A0UA 4WGYA 2J7PA 5F28E 1JR8A 3EQLF 2V3CC 1S05A 3OWTA 4XEKA 3LS0A 3PDMP 1G4WR 1ST6A 4XWJA 4B6IA 2H7BA 3GWLA 4KBLA 2GDCA 3QVYA 4U9EA 5JS5A 3M4CA 4OD4A 2RD9A 3K1HA 1TWHA 1LE2A 2BE5F 5COMA 4CJOA 5L0DA 2QY9A 1L7CA 1ZW2A 1NU9C 1QQ3A 1YYJA 3HNKA 1AEPA 3O39A 3QW0A 4NQFA 1ZZPA 3L8JA 4YL0A 3BEHA 3H2VA 4PJNA 1OW7A 1GM5A 2VCBA 2WB7A 4MVSA 4U5HA 1HMDA 4HE8D 4LDRA 4AX2A 2DGJA 2XRHA 3LUTB 1QPUA 3W8IA 4QDLA 4UDVA 2DI3A 2YLIA 5DS6A 2H7VC 3TJ5A 3UGPA 4LDKA 4HEAJ 3U9MA 4YWQA 1V55C 5L3QA 2AWCA 1Q0DA 3A9CA 3GM2A 1T6UA 2W4MA 1FMWA 5BQGA 1MNEA 3FOPA 4JW1A 2Y3BA 3S28A 1GGQA 1WOLA 2R7TA 4Q5SF 1AVOB 1FAPB 5AC4A 4PK4A 1WWPA 1VLSA 3LLKA 3NYJA 4E7SA 2H7OA 1WTYA 4J30B 2XLEA 3TOMA 4MVQA 1BZ4A 4MNDA 3M15A 3U8VA 2B0JA 2YEVA 4HFFB 2HV7A 2IOQA 4OINF 2YLGA 3L34A 3CEXA 3KKBA 1B68A 1ZVZA 3OEOA 2NSFA 4IGGA 4N6CA 4ER9A 2HS5A 1C02A 3R7CA 1R5ID 2VASA 3C7JA 3NYLA 1PCXA 1RXQA 1YA7O 2DYSC 4G7HF 2Q00A 3KYIA 2FGYA 2BL2A 2J9UA 3RKOF 4FAPB 2KJGA 2YWAA 3H2UA 5GPGB 2R05A 4W8KA 3EFOB 2GAQA 2BC5A 5JT4A 2HJMA 3UMIA 3JSEO 4P9TA 1AUEA 1Y4CA 1D1BA 3FVYA 2RSEB 3AG2C 1LS4A 3GORA 3JTLO 2WVQA 5BQIA 3S0XA 5KYXA 2HFIA 2Y39A 1ZU4A 1OR2A 2ZPAA 3S27A 3V7OA 2IM8A 4RD9A 4BG0A 4NTFA 3B0PA 3WAQA 2PX3A 1ORJA 3KYJA 3S90A 4XTKA 2MHRA 1HW1A 2R7XA 1LVKA 1M2VA 4O7GA 4G7OF 3GANA 3NYMA 3NMJA 4CDVA 1YVIA 2CDQA 3L8IA 3Q6NA 4O6NA 3PCVA 2WVOA 5L0FA 3L1MA 2R7UA 1FFTC 1V4AA 2J8WA 4E7ZA 3C62A 3EJNA 4PJMA 4DOZA 2NUPA 1N1CA 2F22A 3FOOA 1G4US 4PR9A 4YL1A 4BJ1A 5EHHA 1H9GA 2J0XA 2WL8A 3HJCA 3EZIA 1FFHA 1UFBA 2W4BA 4U5EE 2HSQA 1JPNA 5F5FA 2WVNA 1ZHZA 3DZAA 4NC3A 3AG3C 4BJ5A 4YT2A 4IAOA 4OD5A 1OXKA 4MTOA 3SXMA 1LE4A 3J06A 2I15A 1VTMP 2W45A 2Y3DA 3TK0A 2OQMA 1XZQA 4BJTA 5L0JA 2W9YA 4CS8A 5KYUB 1DOWA 5JSLA 5DQZA 4JZAA 1OW6A 2OEVA 4K7BA 2L81A 4MVMA 4CSAA 4L6RA 3AJMA 4YJWA 2X51A 2YVKA 3WODF 5FCLA 3DE9A 3ZQVA 2A6EF 1Z7Qc 1NSGB 1C03A 1WATA 1U6HA 3B0VC 4LERA 2EIMC 4I1MA 5KYUA 3RQGA 1K40A 3G50A 3IEEA 3U8PA 4AL0A 3JYYA 3U3BA 1LPEA 1EA8A 2LSEA 2Q9AA 3FMSA 3WG7C 1EQ1A 1PV3A 3EHMA 4U5BE 2CGEA 4KI2A 1M57C 4Q4ZF 4C7OA 2R7SA 4DVYP 4OIOF 4U5GA 2Q7RA 1A7EA 2LK4A 5HV9A 4CSAC 4IB4A 1NBBA 5EK0A 4I1OB 4I3MA 2LIGA 1QLEC 4FESA 2R7WA 1J8MF 4BEMJ 4ZLCA 2YQYA 3MFNA 4DXWA 2EILC 1OCCC 2PX0A 2R9RB 3EG9B 5T3TA 4IAQA 4H4KC 1FTSA 1Z63A 4E17A 1RKEA 2LQGA 4JCHA 3GEIA 4ULVA 4AE4A 1RKCA 1JRAA 1M2VB 3C18A 4DBRA 4A2NB 5A6AA 2HJ3A 1ORSC 2J7PD 4U5DE 5L0HA 2WZGA 2R7VA 5JRAA 5A69A 3SXKA 1PD1A 1E86A 1RCPA 3EH1A 4X0RA 3RIPA 1T6IA 3ABLC 3TOLA 1HMOA 4OIQF 2P1AA 3BRJA 1D1CA 3SZRA 4DRHB 1E85A 3KH2A 4FX5A 4XPWA 5E3CA 1YZAA 3K1IC 5KYWA 3EFOA 3F47A 2CCYA 2FFHA 2XL4A 3WHNA 3TULA 4AE4B 3S84A 1A41A 3E9VA 3POVA 1HY5A 3IPMO 3JT1A 3OA1A 4CIHA 1HW2A 1BR4A 3HNLA 4G7ZF 2ZXWC 4YT8A 3HNIA 3DD7A 4Q7CA 2OJQA 4PFOA 4LACB 3MYFA 2LD6A 2OCCC 3AG4C 3TJ6A 2QLAA 1BR2A 3DE8A 2A69F 2CYDA 3SP1A 3LESA 1D0YA 2KGOA 1R4TA 1CGOA 3GWNA 3FXHA 1M2OA 3Q7LA 4NCQA 4XPYA 1NFOA 1TWAA 2XSEA 3HLZA 1LI7A 5L0IA 4LLEA 4N4WA 1JMWA 1FR0A 2YHSA 2QTVA 4O6MA 4EIYA 2J9VA 3M1CB 1LM3B 4W8PA 1QSPA 2AU5A 1I4ZA 3UNGC 2X0CA 4MVZA 2R7RA 1BBHA 1V54C 2KW3C 3DI5A 1BR1A 1GQAA 4KC9A 4RBNA 1A0BA 4PJJA 4G78A 3F46A 3S29A 3VM6A 4C3DA 3ZDLA 5AC5A 1T5OA 2HUJA 4JTAB 1OXBA 3DMDA 1YDIA 2L6GA 3EPVA 4JC7A 4JEBA 2KC3A 1Z6AA 5E33A 1HE9A 2J0WA 3ZG1A 3T6BA 3K66A 1RJ9A 1TQGA 4JEAA 2HKVA 3EGXB 3IQ6A 4MTFA 5E3AA 2Q4FA 4FWVA 1YLMA 1RMVA 1GS9A 2IXPA 3DJUB 3SEOA 2R7OA 2Q3TA 3VAYA 2YLDA 3G4ZA 3LS1A 3DAGA 2XLMA 4DJ9A 3DJNB 3B9QA 3NKDA 3GEEA 4QI0A 3MX3A 2CNWD 4P9FA 5CI8A 4PJLA 2VH3A 1E83A 2OJED 1OR3A 2ICWG 4JIOA 1O87A 3M79A 3U0CA 4EBBA 3PMRA 4N6HA 1O3UA 2VB6A 3ABMC 3CQZA 5HSWA 1JOGA 3NMIA 3EGDA 1NU7D 3IQTA 4BJ5C 3EZHA 2E87A 2M64A 4BJ6C 4BEJA 2EPMX 1OQCA 1Q0GA 3GEHA 4C3BA 4MW8A 4D4NA 2A6HF 3N2ZB 4QI2A 3EH2A 4MQ9F 2J9BA 3GM3A 1Q0MA 5AGFA 3U2LA 4CS9C 3UGOA 3K1IA 2KQ9A 2VCAA 5E2QA 2KNHA 2ZD9A 4KNVA 3T4RA 2GWWA 4E0HA 1UG7A 4JKVA 1V74B 4OIPF 4DVZA 4Z9HA 2VC9A 2TMVP 3AOUA 3RVZA 2OEXA 3K6BA 1A7DA 4EWCA 1LKXA 1TWCA 2G3VA 3UMHA 4A4AA 2XLDA 1CGME 3US6A 2XL6A 2P6VA 3ZIBA 4LDQA 2OG2A 3LEOA 3S9OA 1U0BB 1RKEB 1ZHTA 1VOMA 256BA 2HMZA 5B3SC 2D4UA 3DXJF 3IQ5A 5KYYA 1IW7F 3FDQA 4CIPA 2XLVA 2DB4A 2OKUA 1VYIA 2R25A 3G4XA 4MS2A 5DVWA 1SMYF 2HZ8A 1ZHWA 2AVKA 1WN0A 2CNWA 4JTDB 4D4XA 4KNWA 1T9KA 2LP4A 5B3IA 1H7IA 2XS8A 4XLNF 5A6BD 1T01A 1H9TA 4ONSA 3TD7A 5JUAA 3ECSA 2KSFA 3RQFA 4BPMA 3I5QA 3RF3A 4C7OB 4EKWA 3T6GB 3EGXA 5DS5A 2C04A 2YL0A 4OIRF 2ZXOA 3C8GD 5BUOA 4CS9A 3FAPB 2A1DD 2J45A 3LNRA 2UUHA 3ZC4A 1Z23A 2NUTB 4BJ6A 5DS4A 4RDAA 2EPKX 3X1OA 3AGUA 3RVYA 4JURI 5IY5C 4IRUA 2A68F 4JRZA 3C63A 1YYXA 3JRTA 1C17M 2XM4A 3RFYA 3B0UX 2JX0A 1OW8A 2XLWA 2JPUA 1JPJA 2NSGA 1NG1A 3AQCA 4U5CE 4MVUA 3B29A 3IHUA 3X2QC 3LJBA 4YL3A 1VLTA 3ASOC 3I4UA 1NFNA 2L7AA 3KPHA 2XL8A 2PP4A 3HKKA 2EINC 3ABKC 3PHF2 1H6GA 1YAUO 3U3FA 2QUPA 4ZLDA 2YL1A 3T6JA 1KTMA 2PFDA 2ZXPA 2XXAB 1APCA 1ZHXA 1Z3IX 1NLXA 2GFHA 3QZCA 1NZEA 1QKRA 2B0HA 3O10A 4NTBA 3SYNA 1OKKD 3GODA 1Q0FA 3ZWIA 1I5NA 3Q6MA 1ORYA 1SR2A 2CW0F 1Y6DA 2GA0A 2NUPB 1LI5A 3NRHA 5FZTA 5JP7A 3VF0A 3LLIA 5COGA 4E18A 3RYLA 2XXAA 4J7TA 3TQOA 4NY3A 2R03A 1ZW3A 3NMKA 3U5SA 2LFDA 2DYRC 3HNJA 3NG1A 3QW1A 3W4YA 5DLJA 4O79A 2L6HA 4WABA 4CS7A 5KYWB 2YL3A 4DRJB 5KYNA 3Q7GA 1VK5A 1SYQA 3GM1A 2EIKC 3KMIA 3ITFA 3N0TA 4K1OA 1F1MA 5L0CA 1WGWA 2NPUA 2XM0A 1EKYA 1RJ9B 4JTCB 5KYXB 4U9DA 3IQCA 2QE9A 1ZHYA 3NDBB 4H54A 2Y3HA 2IBFA 2YRFA 4EBJA 1FNTc 1QZXA 2PF4E 1CPQA 4Z9JA 3RH3A 3U2MA 4C3EA 4CS8C 4K0DA 3ZQYA 2V26A 3EHNA 3NKEA 3QVZA 3JYHA 3DM5A 3C8ZA 3ASNC 4YT5A 3AQBA 4DBQA 1MNDA 5A6JA 5L3VA 3ZTZA 2J9WA 2P61A 1MMDA 1JAFA 1SZIA 1U89A 2NG1A 3AGTA 2Y3GA 3T9OA 2YZSA 3DWWA 3W2VA 4JE9A 4JCZA 5D92A 5DQTA 4WGZA 1A7VA 1KU2A 3K7DA 1S7ZA 2MWQA 4DRIB 1MMAA 3LNMB 1TFKB 2Q9BA 4O6YA 1E84A 2L9JA 4IWBA 4J32B 4MTGA 1M6TA 1Z5ZA 4MVOA 1YZCA 4EUKB 2YKZA 2IXMA 2LCHA 1TKNA 3U9JA 3I5PA 4WJ0A 2Z15A 1W2WA 5T1DB 2HSBA 1YARO 1OCOC 4XLPF 1D0XA 4ANJA 2JD3A 2J46A 2P0NA 4YN0B 5K0IA 1CGNA 3K33A 4Z9IA 1OCRC 2ZXRA 4ULWA 1IZMA 2EIJC 2Y69C 2QNLA 5T3WA 4EBKA 3W8HA 2FAPB 3JCUQ 1FMVA 2PNOA 3O55A 4XPXA 1E2XA 4F4BA 1TFOB 3DAFA 4XEVA 4CDAA 2AP3A 2G62A 3JRMO 3M4BA 2ETSA 2R7QA 1TR2A 2KK1A 2XLOA 2YL7A 3H65A 1CPRA 1VYKA 1BDJB 1WASA 4P6IC 1LIHA 2R02A 4AK9A 3MLGA 1L3PA 5JLIA 3JZ0A 3CSKA 4LLCA 3VYWA 2P7VA 4HFKB 4XEFA 3VRCA 1O5HA 1OCZC 3W2WA 2WZLA 2G3KA 3HTKC 5CI9A 3CAXA 4JJGA 1J8YF 1MMNA 1OKKA 3A11A 3JSZA 2EPOA 5BQHA 1SF8A 2PBEA 3FAJA 4PACA 3C8GB 4J7YA 2L6FA 3AG1C 1I4YA 1MMGA 1QVXA 1XWJA 1MQVA 2AWYA 2NUTA 2UUIA 1M56C 2I8BA 4CDYA 3FHDA 2HV6A 4EHPA 3DM9B 1PD0A 3EG9A 3V5XA 1TWGA
chains in the Genus database with same CATH topology
3RQGA 1K40A 1K04A 3C18A 3JYYA 4XEVA 2JX0A 1OW8A 1JOGA 1UFBA 1WWPA 2JPUA 1PV3A 2L6HA 1WTYA 2KK1A 3K7DA 4NQFA 3GM3A 1ZZPA 3L8JA 1OW7A 3GM1A 3JZ0A 2LK4A 3BRJA 4XEFA 3RQEA 3RQFA 4R32A 1KNYA 1K05A 3U3FA 2HSBA 3C8GD 1KTMA 4EBJA 3MFNA 1OW6A 2PBEA 2Q00A 3L8IA 3C8GB 3TULA 2L6FA 3B71A 3O10A 5F28E 1QVXA 3U0CA 3AJMA 1V4AA 3C8GA 3GM2A 4XEKA 1O3UA 3S9OA 4EBKA 2YWAA 1WOLA 2L6GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RQG A;  1K40 A;  1K04 A;  3C18 A;  3JYY A;  4XEV A;  2JX0 A;  1OW8 A;  1JOG A;  1UFB A;  1WWP A;  2JPU A;  1PV3 A;  2L6H A;  1WTY A;  2KK1 A;  3K7D A;  4NQF A;  3GM3 A;  1ZZP A;  3L8J A;  1OW7 A;  3GM1 A;  3JZ0 A;  2LK4 A;  3BRJ A;  4XEF A;  3RQE A;  3RQF A;  4R32 A;  1KNY A;  1K05 A;  3U3F A;  2HSB A;  3C8G D;  1KTM A;  4EBJ A;  3MFN A;  1OW6 A;  2PBE A;  2Q00 A;  3L8I A;  3C8G B;  3TUL A;  2L6F A;  3B71 A;  3O10 A;  5F28 E;  1QVX A;  3U0C A;  3AJM A;  1V4A A;  3C8G A;  3GM2 A;  4XEK A;  1O3U A;  3S9O A;  4EBK A;  2YWA A;  1WOL A;  2L6G A; 
#chains in the Genus database with same CATH topology
 3SNH A;  1YJG A;  4MVR A;  3SXZ A;  3QMK A;  2OU6 A;  3ATP A;  4IAR A;  5A6K A;  5JVE A;  4AL1 A;  3MYI A;  4YK5 A;  4YT4 A;  2D5R B;  3KL4 A;  4CBE A;  2HMQ A;  2KYH A;  4E0I A;  4GEH A;  3DKA A;  3R2P A;  2Q9C A;  2H8A A;  3RQE A;  3CZ6 A;  2IXO A;  1G8X A;  4JVS A;  5TJ5 E;  2IXN A;  1EI7 A;  1G5Z A;  4R32 A;  1KNY A;  3RW0 A;  1K05 A;  4XQ1 A;  5KYY B;  5COF A;  1Q0K A;  4GYT A;  2A0B A;  2ASR A;  2XS1 A;  2O9X A;  3MBG A;  2OOC A;  2WZF A;  1T6Q A;  3B71 A;  3E70 C;  3LAY A;  4IJJ A;  4NTA A;  1LS1 A;  3C8G A;  4I44 A;  3ZVR A;  3LEV A;  1D0Z A;  2IYL D;  5B1A C;  3UMK A;  2LFF A;  4GQH A;  3ZTM A;  2C03 A;  1VB5 A;  2EPN A;  1DOV A;  1K04 A;  4JJF A;  5F5H A;  3ZSU A;  4CX9 A;  5A6B A;  4PFP A;  3N24 A;  3QTH A;  4N06 A;  4U5F E;  1D1A A;  5L0G A;  3V5Z A;  3UR3 C;  5EGY A;  3V5Y A;  5D91 A;  1ZYR F;  3L0I A;  2XLH A;  4CJG A;  4G0H A;  1ZU5 A;  4MW3 A;  2MYS A;  1HE1 A;  4M63 A;  2M4E A;  1XZP A;  2VCC A;  5B1B C;  1YA9 A;  3O6X A;  3SXY A;  5CIV A;  3EGD B;  1VMA A;  2EPL X;  2A0U A;  4WGY A;  2J7P A;  5F28 E;  1JR8 A;  3EQL F;  2V3C C;  1S05 A;  3OWT A;  4XEK A;  3LS0 A;  3PDM P;  1G4W R;  1ST6 A;  4XWJ A;  4B6I A;  2H7B A;  3GWL A;  4KBL A;  2GDC A;  3QVY A;  4U9E A;  5JS5 A;  3M4C A;  4OD4 A;  2RD9 A;  3K1H A;  1TWH A;  1LE2 A;  2BE5 F;  5COM A;  4CJO A;  5L0D A;  2QY9 A;  1L7C A;  1ZW2 A;  1NU9 C;  1QQ3 A;  1YYJ A;  3HNK A;  1AEP A;  3O39 A;  3QW0 A;  4NQF A;  1ZZP A;  3L8J A;  4YL0 A;  3BEH A;  3H2V A;  4PJN A;  1OW7 A;  1GM5 A;  2VCB A;  2WB7 A;  4MVS A;  4U5H A;  1HMD A;  4HE8 D;  4LDR A;  4AX2 A;  2DGJ A;  2XRH A;  3LUT B;  1QPU A;  3W8I A;  4QDL A;  4UDV A;  2DI3 A;  2YLI A;  5DS6 A;  2H7V C;  3TJ5 A;  3UGP A;  4LDK A;  4HEA J;  3U9M A;  4YWQ A;  1V55 C;  5L3Q A;  2AWC A;  1Q0D A;  3A9C A;  3GM2 A;  1T6U A;  2W4M A;  1FMW A;  5BQG A;  1MNE A;  3FOP A;  4JW1 A;  2Y3B A;  3S28 A;  1GGQ A;  1WOL A;  2R7T A;  4Q5S F;  1AVO B;  1FAP B;  5AC4 A;  4PK4 A;  1WWP A;  1VLS A;  3LLK A;  3NYJ A;  4E7S A;  2H7O A;  1WTY A;  4J30 B;  2XLE A;  3TOM A;  4MVQ A;  1BZ4 A;  4MND A;  3M15 A;  3U8V A;  2B0J A;  2YEV A;  4HFF B;  2HV7 A;  2IOQ A;  4OIN F;  2YLG A;  3L34 A;  3CEX A;  3KKB A;  1B68 A;  1ZVZ A;  3OEO A;  2NSF A;  4IGG A;  4N6C A;  4ER9 A;  2HS5 A;  1C02 A;  3R7C A;  1R5I D;  2VAS A;  3C7J A;  3NYL A;  1PCX A;  1RXQ A;  1YA7 O;  2DYS C;  4G7H F;  2Q00 A;  3KYI A;  2FGY A;  2BL2 A;  2J9U A;  3RKO F;  4FAP B;  2KJG A;  2YWA A;  3H2U A;  5GPG B;  2R05 A;  4W8K A;  3EFO B;  2GAQ A;  2BC5 A;  5JT4 A;  2HJM A;  3UMI A;  3JSE O;  4P9T A;  1AUE A;  1Y4C A;  1D1B A;  3FVY A;  2RSE B;  3AG2 C;  1LS4 A;  3GOR A;  3JTL O;  2WVQ A;  5BQI A;  3S0X A;  5KYX A;  2HFI A;  2Y39 A;  1ZU4 A;  1OR2 A;  2ZPA A;  3S27 A;  3V7O A;  2IM8 A;  4RD9 A;  4BG0 A;  4NTF A;  3B0P A;  3WAQ A;  2PX3 A;  1ORJ A;  3KYJ A;  3S90 A;  4XTK A;  2MHR A;  1HW1 A;  2R7X A;  1LVK A;  1M2V A;  4O7G A;  4G7O F;  3GAN A;  3NYM A;  3NMJ A;  4CDV A;  1YVI A;  2CDQ A;  3L8I A;  3Q6N A;  4O6N A;  3PCV A;  2WVO A;  5L0F A;  3L1M A;  2R7U A;  1FFT C;  1V4A A;  2J8W A;  4E7Z A;  3C62 A;  3EJN A;  4PJM A;  4DOZ A;  2NUP A;  1N1C A;  2F22 A;  3FOO A;  1G4U S;  4PR9 A;  4YL1 A;  4BJ1 A;  5EHH A;  1H9G A;  2J0X A;  2WL8 A;  3HJC A;  3EZI A;  1FFH A;  1UFB A;  2W4B A;  4U5E E;  2HSQ A;  1JPN A;  5F5F A;  2WVN A;  1ZHZ A;  3DZA A;  4NC3 A;  3AG3 C;  4BJ5 A;  4YT2 A;  4IAO A;  4OD5 A;  1OXK A;  4MTO A;  3SXM A;  1LE4 A;  3J06 A;  2I15 A;  1VTM P;  2W45 A;  2Y3D A;  3TK0 A;  2OQM A;  1XZQ A;  4BJT A;  5L0J A;  2W9Y A;  4CS8 A;  5KYU B;  1DOW A;  5JSL A;  5DQZ A;  4JZA A;  1OW6 A;  2OEV A;  4K7B A;  2L81 A;  4MVM A;  4CSA A;  4L6R A;  3AJM A;  4YJW A;  2X51 A;  2YVK A;  3WOD F;  5FCL A;  3DE9 A;  3ZQV A;  2A6E F;  1Z7Q c;  1NSG B;  1C03 A;  1WAT A;  1U6H A;  3B0V C;  4LER A;  2EIM C;  4I1M A;  5KYU A;  3RQG A;  1K40 A;  3G50 A;  3IEE A;  3U8P A;  4AL0 A;  3JYY A;  3U3B A;  1LPE A;  1EA8 A;  2LSE A;  2Q9A A;  3FMS A;  3WG7 C;  1EQ1 A;  1PV3 A;  3EHM A;  4U5B E;  2CGE A;  4KI2 A;  1M57 C;  4Q4Z F;  4C7O A;  2R7S A;  4DVY P;  4OIO F;  4U5G A;  2Q7R A;  1A7E A;  2LK4 A;  5HV9 A;  4CSA C;  4IB4 A;  1NBB A;  5EK0 A;  4I1O B;  4I3M A;  2LIG A;  1QLE C;  4FES A;  2R7W A;  1J8M F;  4BEM J;  4ZLC A;  2YQY A;  3MFN A;  4DXW A;  2EIL C;  1OCC C;  2PX0 A;  2R9R B;  3EG9 B;  5T3T A;  4IAQ A;  4H4K C;  1FTS A;  1Z63 A;  4E17 A;  1RKE A;  2LQG A;  4JCH A;  3GEI A;  4ULV A;  4AE4 A;  1RKC A;  1JRA A;  1M2V B;  3C18 A;  4DBR A;  4A2N B;  5A6A A;  2HJ3 A;  1ORS C;  2J7P D;  4U5D E;  5L0H A;  2WZG A;  2R7V A;  5JRA A;  5A69 A;  3SXK A;  1PD1 A;  1E86 A;  1RCP A;  3EH1 A;  4X0R A;  3RIP A;  1T6I A;  3ABL C;  3TOL A;  1HMO A;  4OIQ F;  2P1A A;  3BRJ A;  1D1C A;  3SZR A;  4DRH B;  1E85 A;  3KH2 A;  4FX5 A;  4XPW A;  5E3C A;  1YZA A;  3K1I C;  5KYW A;  3EFO A;  3F47 A;  2CCY A;  2FFH A;  2XL4 A;  3WHN A;  3TUL A;  4AE4 B;  3S84 A;  1A41 A;  3E9V A;  3POV A;  1HY5 A;  3IPM O;  3JT1 A;  3OA1 A;  4CIH A;  1HW2 A;  1BR4 A;  3HNL A;  4G7Z F;  2ZXW C;  4YT8 A;  3HNI A;  3DD7 A;  4Q7C A;  2OJQ A;  4PFO A;  4LAC B;  3MYF A;  2LD6 A;  2OCC C;  3AG4 C;  3TJ6 A;  2QLA A;  1BR2 A;  3DE8 A;  2A69 F;  2CYD A;  3SP1 A;  3LES A;  1D0Y A;  2KGO A;  1R4T A;  1CGO A;  3GWN A;  3FXH A;  1M2O A;  3Q7L A;  4NCQ A;  4XPY A;  1NFO A;  1TWA A;  2XSE A;  3HLZ A;  1LI7 A;  5L0I A;  4LLE A;  4N4W A;  1JMW A;  1FR0 A;  2YHS A;  2QTV A;  4O6M A;  4EIY A;  2J9V A;  3M1C B;  1LM3 B;  4W8P A;  1QSP A;  2AU5 A;  1I4Z A;  3UNG C;  2X0C A;  4MVZ A;  2R7R A;  1BBH A;  1V54 C;  2KW3 C;  3DI5 A;  1BR1 A;  1GQA A;  4KC9 A;  4RBN A;  1A0B A;  4PJJ A;  4G78 A;  3F46 A;  3S29 A;  3VM6 A;  4C3D A;  3ZDL A;  5AC5 A;  1T5O A;  2HUJ A;  4JTA B;  1OXB A;  3DMD A;  1YDI A;  2L6G A;  3EPV A;  4JC7 A;  4JEB A;  2KC3 A;  1Z6A A;  5E33 A;  1HE9 A;  2J0W A;  3ZG1 A;  3T6B A;  3K66 A;  1RJ9 A;  1TQG A;  4JEA A;  2HKV A;  3EGX B;  3IQ6 A;  4MTF A;  5E3A A;  2Q4F A;  4FWV A;  1YLM A;  1RMV A;  1GS9 A;  2IXP A;  3DJU B;  3SEO A;  2R7O A;  2Q3T A;  3VAY A;  2YLD A;  3G4Z A;  3LS1 A;  3DAG A;  2XLM A;  4DJ9 A;  3DJN B;  3B9Q A;  3NKD A;  3GEE A;  4QI0 A;  3MX3 A;  2CNW D;  4P9F A;  5CI8 A;  4PJL A;  2VH3 A;  1E83 A;  2OJE D;  1OR3 A;  2ICW G;  4JIO A;  1O87 A;  3M79 A;  3U0C A;  4EBB A;  3PMR A;  4N6H A;  1O3U A;  2VB6 A;  3ABM C;  3CQZ A;  5HSW A;  1JOG A;  3NMI A;  3EGD A;  1NU7 D;  3IQT A;  4BJ5 C;  3EZH A;  2E87 A;  2M64 A;  4BJ6 C;  4BEJ A;  2EPM X;  1OQC A;  1Q0G A;  3GEH A;  4C3B A;  4MW8 A;  4D4N A;  2A6H F;  3N2Z B;  4QI2 A;  3EH2 A;  4MQ9 F;  2J9B A;  3GM3 A;  1Q0M A;  5AGF A;  3U2L A;  4CS9 C;  3UGO A;  3K1I A;  2KQ9 A;  2VCA A;  5E2Q A;  2KNH A;  2ZD9 A;  4KNV A;  3T4R A;  2GWW A;  4E0H A;  1UG7 A;  4JKV A;  1V74 B;  4OIP F;  4DVZ A;  4Z9H A;  2VC9 A;  2TMV P;  3AOU A;  3RVZ A;  2OEX A;  3K6B A;  1A7D A;  4EWC A;  1LKX A;  1TWC A;  2G3V A;  3UMH A;  4A4A A;  2XLD A;  1CGM E;  3US6 A;  2XL6 A;  2P6V A;  3ZIB A;  4LDQ A;  2OG2 A;  3LEO A;  3S9O A;  1U0B B;  1RKE B;  1ZHT A;  1VOM A;  256B A;  2HMZ A;  5B3S C;  2D4U A;  3DXJ F;  3IQ5 A;  5KYY A;  1IW7 F;  3FDQ A;  4CIP A;  2XLV A;  2DB4 A;  2OKU A;  1VYI A;  2R25 A;  3G4X A;  4MS2 A;  5DVW A;  1SMY F;  2HZ8 A;  1ZHW A;  2AVK A;  1WN0 A;  2CNW A;  4JTD B;  4D4X A;  4KNW A;  1T9K A;  2LP4 A;  5B3I A;  1H7I A;  2XS8 A;  4XLN F;  5A6B D;  1T01 A;  1H9T A;  4ONS A;  3TD7 A;  5JUA A;  3ECS A;  2KSF A;  3RQF A;  4BPM A;  3I5Q A;  3RF3 A;  4C7O B;  4EKW A;  3T6G B;  3EGX A;  5DS5 A;  2C04 A;  2YL0 A;  4OIR F;  2ZXO A;  3C8G D;  5BUO A;  4CS9 A;  3FAP B;  2A1D D;  2J45 A;  3LNR A;  2UUH A;  3ZC4 A;  1Z23 A;  2NUT B;  4BJ6 A;  5DS4 A;  4RDA A;  2EPK X;  3X1O A;  3AGU A;  3RVY A;  4JUR I;  5IY5 C;  4IRU A;  2A68 F;  4JRZ A;  3C63 A;  1YYX A;  3JRT A;  1C17 M;  2XM4 A;  3RFY A;  3B0U X;  2JX0 A;  1OW8 A;  2XLW A;  2JPU A;  1JPJ A;  2NSG A;  1NG1 A;  3AQC A;  4U5C E;  4MVU A;  3B29 A;  3IHU A;  3X2Q C;  3LJB A;  4YL3 A;  1VLT A;  3ASO C;  3I4U A;  1NFN A;  2L7A A;  3KPH A;  2XL8 A;  2PP4 A;  3HKK A;  2EIN C;  3ABK C;  3PHF 2;  1H6G A;  1YAU O;  3U3F A;  2QUP A;  4ZLD A;  2YL1 A;  3T6J A;  1KTM A;  2PFD A;  2ZXP A;  2XXA B;  1APC A;  1ZHX A;  1Z3I X;  1NLX A;  2GFH A;  3QZC A;  1NZE A;  1QKR A;  2B0H A;  3O10 A;  4NTB A;  3SYN A;  1OKK D;  3GOD A;  1Q0F A;  3ZWI A;  1I5N A;  3Q6M A;  1ORY A;  1SR2 A;  2CW0 F;  1Y6D A;  2GA0 A;  2NUP B;  1LI5 A;  3NRH A;  5FZT A;  5JP7 A;  3VF0 A;  3LLI A;  5COG A;  4E18 A;  3RYL A;  2XXA A;  4J7T A;  3TQO A;  4NY3 A;  2R03 A;  1ZW3 A;  3NMK A;  3U5S A;  2LFD A;  2DYR C;  3HNJ A;  3NG1 A;  3QW1 A;  3W4Y A;  5DLJ A;  4O79 A;  2L6H A;  4WAB A;  4CS7 A;  5KYW B;  2YL3 A;  4DRJ B;  5KYN A;  3Q7G A;  1VK5 A;  1SYQ A;  3GM1 A;  2EIK C;  3KMI A;  3ITF A;  3N0T A;  4K1O A;  1F1M A;  5L0C A;  1WGW A;  2NPU A;  2XM0 A;  1EKY A;  1RJ9 B;  4JTC B;  5KYX B;  4U9D A;  3IQC A;  2QE9 A;  1ZHY A;  3NDB B;  4H54 A;  2Y3H A;  2IBF A;  2YRF A;  4EBJ A;  1FNT c;  1QZX A;  2PF4 E;  1CPQ A;  4Z9J A;  3RH3 A;  3U2M A;  4C3E A;  4CS8 C;  4K0D A;  3ZQY A;  2V26 A;  3EHN A;  3NKE A;  3QVZ A;  3JYH A;  3DM5 A;  3C8Z A;  3ASN C;  4YT5 A;  3AQB A;  4DBQ A;  1MND A;  5A6J A;  5L3V A;  3ZTZ A;  2J9W A;  2P61 A;  1MMD A;  1JAF A;  1SZI A;  1U89 A;  2NG1 A;  3AGT A;  2Y3G A;  3T9O A;  2YZS A;  3DWW A;  3W2V A;  4JE9 A;  4JCZ A;  5D92 A;  5DQT A;  4WGZ A;  1A7V A;  1KU2 A;  3K7D A;  1S7Z A;  2MWQ A;  4DRI B;  1MMA A;  3LNM B;  1TFK B;  2Q9B A;  4O6Y A;  1E84 A;  2L9J A;  4IWB A;  4J32 B;  4MTG A;  1M6T A;  1Z5Z A;  4MVO A;  1YZC A;  4EUK B;  2YKZ A;  2IXM A;  2LCH A;  1TKN A;  3U9J A;  3I5P A;  4WJ0 A;  2Z15 A;  1W2W A;  5T1D B;  2HSB A;  1YAR O;  1OCO C;  4XLP F;  1D0X A;  4ANJ A;  2JD3 A;  2J46 A;  2P0N A;  4YN0 B;  5K0I A;  1CGN A;  3K33 A;  4Z9I A;  1OCR C;  2ZXR A;  4ULW A;  1IZM A;  2EIJ C;  2Y69 C;  2QNL A;  5T3W A;  4EBK A;  3W8H A;  2FAP B;  3JCU Q;  1FMV A;  2PNO A;  3O55 A;  4XPX A;  1E2X A;  4F4B A;  1TFO B;  3DAF A;  4XEV A;  4CDA A;  2AP3 A;  2G62 A;  3JRM O;  3M4B A;  2ETS A;  2R7Q A;  1TR2 A;  2KK1 A;  2XLO A;  2YL7 A;  3H65 A;  1CPR A;  1VYK A;  1BDJ B;  1WAS A;  4P6I C;  1LIH A;  2R02 A;  4AK9 A;  3MLG A;  1L3P A;  5JLI A;  3JZ0 A;  3CSK A;  4LLC A;  3VYW A;  2P7V A;  4HFK B;  4XEF A;  3VRC A;  1O5H A;  1OCZ C;  3W2W A;  2WZL A;  2G3K A;  3HTK C;  5CI9 A;  3CAX A;  4JJG A;  1J8Y F;  1MMN A;  1OKK A;  3A11 A;  3JSZ A;  2EPO A;  5BQH A;  1SF8 A;  2PBE A;  3FAJ A;  4PAC A;  3C8G B;  4J7Y A;  2L6F A;  3AG1 C;  1I4Y A;  1MMG A;  1QVX A;  1XWJ A;  1MQV A;  2AWY A;  2NUT A;  2UUI A;  1M56 C;  2I8B A;  4CDY A;  3FHD A;  2HV6 A;  4EHP A;  3DM9 B;  1PD0 A;  3EG9 A;  3V5X A;  1TWG A; 
#chains in the Genus database with same CATH homology
 3RQG A;  1K40 A;  1K04 A;  3C18 A;  3JYY A;  4XEV A;  2JX0 A;  1OW8 A;  1JOG A;  1UFB A;  1WWP A;  2JPU A;  1PV3 A;  2L6H A;  1WTY A;  2KK1 A;  3K7D A;  4NQF A;  3GM3 A;  1ZZP A;  3L8J A;  1OW7 A;  3GM1 A;  3JZ0 A;  2LK4 A;  3BRJ A;  4XEF A;  3RQE A;  3RQF A;  4R32 A;  1KNY A;  1K05 A;  3U3F A;  2HSB A;  3C8G D;  1KTM A;  4EBJ A;  3MFN A;  1OW6 A;  2PBE A;  2Q00 A;  3L8I A;  3C8G B;  3TUL A;  2L6F A;  3B71 A;  3O10 A;  5F28 E;  1QVX A;  3U0C A;  3AJM A;  1V4A A;  3C8G A;  3GM2 A;  4XEK A;  1O3U A;  3S9O A;  4EBK A;  2YWA A;  1WOL A;  2L6G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...