4XEKA

Pyk2-fat domain in complex with leupaxin ld4 motif
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
137
structure length
137
Chain Sequence
HMANLDRTDDLVYLNVMELVRAVLELKNELSQLPPEGYVVVVKNVGLTLRKLIGSVDDLLPSLPSSSRTEIEGTQKLLNKDLAELINKMRLAQQNAVTSLSEEAKRQMLTASHTLAVDAKNLLDAVDQAKVLANLAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Protein-tyrosine kinase 2-beta
publication title Structural Basis for the Interaction between Pyk2-FAT Domain and Leupaxin LD Repeats.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 60
structure length 137
sequence length 137
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2014-12-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 4xekA00
3GM1A 4EBKA 2Q00A 3S9OA 3U0CA 3BRJA 3GM2A 3GM3A 1OW6A 1V4AA 3MFNA 2JPUA 1WWPA 1ZZPA 2L6HA 1WOLA 4XEVA 3U3FA 3RQEA 1WTYA 4R32A 3B71A 2JX0A 2L6FA 3K7DA 2L6GA 3AJMA 1KNYA 1OW8A 1K40A 1QVXA 4EBJA 4XEFA 2LK4A 3C8GD 3TULA 1KTMA 3C8GA 3RQGA 1K05A 1JOGA 1K04A 2HSBA 3JZ0A 3L8JA 4NQFA 3JYYA 3C8GB 3RQFA 4XEKA 1O3UA 3C18A 3O10A 2YWAA 1UFBA 2PBEA 2KK1A 1PV3A 5F28E 3L8IA 1OW7A
chains in the Genus database with same CATH superfamily
2FGYA 4EBKA 3ASNC 3AG1C 5K0IA 3S84A 4PJJA 5JRAA 1IW7F 1FFTC 1ORYA 3LLKA 5BQHA 4K1OA 2R7OA 3UMHA 3SXKA 4XPWA 4MVUA 4R32A 3EGDB 4DJ9A 4YN0B 2ZXPA 3MX3A 3W4YA 2HJ3A 4BG0A 3C7JA 4C3DA 4E0HA 4XPXA 3HNKA 1BR1A 1K40A 2WB7A 5A6JA 4Z9JA 4C7OB 2V26A 4ANJA 2JD3A 4K7BA 5F5FA 5JP7A 1NZEA 1D1CA 4K0DA 3HNIA 1L7CA 5KYUA 4CDAA 5B3SC 1G5ZA 1G4US 5DQTA 3JTLO 3KL4A 3QZCA 1R5ID 2YZSA 5EHHA 2A69F 1MMNA 2F22A 3S9OA 3KYIA 3U2LA 4IJJA 1YDIA 3T6GB 3WAQA 3ECSA 3FHDA 3H2VA 4IGGA 4U9EA 1EQ1A 1AEPA 3TK0A 1D0YA 2O9XA 4BJ1A 1NU7D 2YEVA 4OINF 2VASA 3M1CB 2ZXWC 2I15A 1MMAA 3EGXA 1E86A 1VYKA 4FWVA 3SYNA 1A7VA 1RKEB 4GYTA 2XM0A 4U5GA 4DRIB 1QVXA 2OJED 2EPNA 3EH1A 1JMWA 4IB4A 5L0FA 1O5HA 3W8HA 3G50A 3VAYA 3JYYA 2OOCA 4G0HA 3LEVA 3TJ5A 1OCZC 1SMYF 3V5YA 3ITFA 1CGME 2PF4E 2Y39A 2Z15A 4QI0A 1M2VB 1M56C 3U3BA 2Q9AA 3AG4C 1W2WA 2DYRC 3F46A 2G3VA 4D4NA 3MFNA 2VB6A 2M64A 2UUHA 4KNVA 3EFOB 4Z9HA 4YWQA 3NKDA 1YZCA 3L0IA 2XLVA 2JX0A 3K1HA 4YL1A 4AL0A 3K7DA 4X0RA 4MNDA 1ZU5A 4P9FA 4MW8A 3AJMA 5B1BC 5GPGB 1Z7Qc 5KYWA 4G78A 2P1AA 3K6BA 1LS4A 4LLCA 4U5BE 4G7HF 4YJWA 4M63A 2VH3A 4CBEA 3JZ0A 2YVKA 1LVKA 4IARA 2GWWA 4A2NB 4JCHA 4CSAA 1OCOC 4I44A 2IBFA 4JIOA 5CIVA 1Y6DA 4CS9C 4RDAA 4JTAB 3ABLC 3RF3A 4UDVA 4AL1A 5EK0A 3V5XA 4XTKA 5DS6A 1M6TA 3NDBB 3A9CA 2Q3TA 2XS1A 3DD7A 2XLMA 3QVYA 4EUKB 2G3KA 5L0GA 1QLEC 5AC4A 3V7OA 1HW1A 3B71A 3T6BA 3RYLA 3NKEA 4D4XA 3NMJA 2AP3A 4IWBA 4OD4A 4XLNF 4MVMA 1T9KA 2Y3GA 2YL7A 4CDVA 2MWQA 4NC3A 3HLZA 1GQAA 3N0TA 2P0NA 4EBJA 2PP4A 1YVIA 1D1AA 2ZXOA 3JRMO 5JT4A 2H7BA 1Y4CA 2XRHA 2CNWD 4BEJA 3UR3C 1V74B 1NLXA 4AE4A 4FAPB 4XEKA 1GM5A 3BEHA 4ULWA 2R7SA 1R4TA 4XQ1A 1KU2A 1D0ZA 1NFNA 2NG1A 4LERA 4JTDB 3UMKA 3L8IA 2GDCA 4DRHB 1OW7A 2Q9BA 1GS9A 1HMDA 3IQ5A 2Q00A 1XZPA 3LS0A 4U5CE 3AG2C 1TFKB 3K33A 4W8PA 3U0CA 3ZTMA 1U6HA 1NG1A 3IQTA 4J30B 2Q9CA 3EQLF 3DAGA 2L81A 4XPYA 5KYNA 3POVA 3RVYA 2P61A 5L0HA 4FESA 1EA8A 4KBLA 3WG7C 4BJ6A 4PJMA 2P6VA 1ZHZA 1E84A 3S90A 2YL3A 1G8XA 1YYJA 1ORSC 2W4BA 3QTHA 3C8GD 5JS5A 3Q7LA 1BDJB 4MVQA 1BR4A 3ABMC 4I1MA 1SYQA 2J45A 2Y3HA 1GGQA 3JCUQ 4MW3A 1TWCA 2Q7RA 1AVOB 4OIPF 3S28A 3O10A 2A0BA 4WABA 3ATPA 1VYIA 2KK1A 4Q5SF 2XXAA 1V55C 2KSFA 4XLPF 1JPJA 2OG2A 1SR2A 2NSGA 3DZAA 4YT8A 2QY9A 3GM2A 2X0CA 3I4UA 2V3CC 4XEVA 4P6IC 4N4WA 3AOUA 4LLEA 1DOWA 2H8AA 5L3VA 1E83A 2EIMC 3R2PA 4CSAC 2XL8A 3KMIA 5B3IA 2CGEA 2KQ9A 3DXJF 5BQIA 1LE4A 3DJNB 3O6XA 3ZTZA 3UGPA 3MLGA 3TQOA 3V5ZA 1EKYA 1JRAA 2IOQA 3G4XA 3C63A 4DRJB 5BUOA 1VK5A 4MVSA 5COMA 3EHNA 2LD6A 3RQGA 1K05A 3ZC4A 4RBNA 3L8JA 3B0VC 4OIRF 1CPRA 2H7VC 2XLHA 2A0UA 3FAJA 1BZ4A 4U5HA 5TJ5E 4Q7CA 4CDYA 4O6MA 2NSFA 1I4ZA 4BJ5C 3U8VA 3SP1A 1XZQA 3LS1A 4DBRA 4ZLDA 1HY5A 5KYXB 1Z6AA 4QI2A 3EGDA 1JPNA 3DJUB 3HTKC 3FXHA 3PMRA 1Q0KA 4JC7A 5E3CA 3NRHA 2GAQA 3ZWIA 4CX9A 3EG9B 1Q0MA 2W9YA 3IHUA 4JCZA 1IZMA 3EPVA 4C7OA 4J32B 5T3WA 4J7TA 1QPUA 1PD0A 3LEOA 5A6BA 3CQZA 2C04A 3O55A 3U8PA 1SZIA 2P7VA 2ZD9A 4NTFA 5CI8A 2J7PD 4U5DE 3HNJA 3W2WA 3ZVRA 2IXMA 1OKKD 1YLMA 1ZHWA 2H7OA 2KNHA 3MYIA 3NMIA 2CW0F 2KW3C 2QE9A 2R02A 2X51A 3ABKC 3FOPA 4JVSA 3SZRA 5A6AA 2IM8A 5KYYB 2R7TA 2UUIA 4BJ6C 4C3EA 1QKRA 4DXWA 1LPEA 4PACA 3SEOA 2HMQA 3VRCA 2WZFA 2I8BA 4JJGA 2HFIA 1ZHXA 3FVYA 3T6JA 2JPUA 2WVQA 2J9UA 4O6YA 3E9VA 5L0DA 4FX5A 1RKEA 1MMDA 1NBBA 1TR2A 3DAFA 1Z23A 2OEVA 3SNHA 1ZYRF 2YRFA 2OEXA 3JYHA 2NUTB 3B9QA 1TWHA 2A6HF 2MYSA 4CJOA 2GFHA 1FR0A 4MVOA 2PFDA 1T6UA 5JLIA 1ZHTA 3LAYA 2HSBA 2OU6A 2KJGA 3QVZA 2ZXRA 1VLTA 2MHRA 5HSWA 3GWNA 1O3UA 3VM6A 2HJMA 1PD1A 1M2VA 2C03A 2BC5A 2R05A 3MBGA 1HW2A 1LI7A 3BRJA 2ICWG 2R03A 3EFOA 1YJGA 2LIGA 3H2UA 5T1DB 1N1CA 1S05A 1WWPA 2L6HA 4HFKB 5DS5A 4KC9A 1MMGA 4YL0A 3TOLA 1MNEA 3NYLA 4DOZA 2J9BA 4LDKA 2A6EF 2XLEA 3SXYA 1A7EA 2Y3DA 2Y3BA 3IPMO 4U5EE 1WASA 2PNOA 3H65A 1LI5A 3KYJA 2XLDA 2HV6A 3RVZA 1FMVA 2L7AA 2W4MA 1U0BB 3VYWA 2AWYA 2EPKX 4I3MA 3C8GB 4IAOA 3RQFA 1RJ9B 2OQMA 4MTOA 1BBHA 3FMSA 1XWJA 2J9VA 2YL1A 4WJ0A 3LUTB 5JSLA 1MQVA 1G4WR 1PV3A 3RW0A 1CGOA 1T6IA 3GEHA 1I5NA 4JEAA 3O39A 4G7ZF 3FDQA 2OCCC 2Q4FA 3GEIA 4BJTA 2EIJC 1T6QA 3B0PA 3GM3A 2D4UA 4O7GA 2PX0A 2DGJA 1ST6A 1RKCA 3DM9B 5L0JA 1F1MA 3RQEA 1V54C 2Y69C 5IY5C 4A4AA 1ZVZA 1J8YF 1O87A 2EINC 3DM5A 3EJNA 4MTGA 4PFPA 4C3BA 1YZAA 5DVWA 1T5OA 2WVOA 4P9TA 4W8KA 3S29A 2FAPB 2VCBA 1OQCA 5AGFA 1JAFA 2XSEA 1UG7A 4NCQA 5CI9A 2DB4A 1FFHA 3R7CA 3CEXA 3TULA 2KC3A 1A7DA 1LE2A 2VCAA 1Q0GA 4N06A 4Z9IA 2HS5A 3X2QC 4E18A 2OJQA 4ONSA 5JVEA 2NUPB 3DI5A 1FAPB 1H9TA 1YAUO 2EPMX 2GA0A 1UFBA 3DE8A 1FTSA 2HZ8A 1H7IA 2R25A 4ZLCA 2TMVP 4O6NA 1VB5A 3GODA 4LACB 4U9DA 3DE9A 4YL3A 4KNWA 1FMWA 2YLGA 1L3PA 1WN0A 2J8WA 256BA 1D1BA 2HUJA 5L3QA 2LQGA 4RD9A 3DWWA 2AVKA 3M4BA 3M15A 3M4CA 4YT4A 1AUEA 2LFDA 2ETSA 4CS8A 2L6GA 3WODF 1Q0DA 1YA7O 3C8ZA 3LNRA 1OXKA 3JT1A 4PR9A 3U2MA 1NU9C 3GANA 3JRTA 4ER9A 4YT2A 3CAXA 3K1IA 2B0HA 3HNLA 4E7SA 1YA9A 5L0CA 2YWAA 3U9JA 5E2QA 3ZQVA 2AU5A 1NSGB 4O79A 2PBEA 1RCPA 1C02A 2CDQA 3NYJA 3CSKA 3TD7A 5F28E 1HE9A 1Q0FA 5KYUB 2DI3A 1M2OA 4PK4A 3GEEA 2QLAA 4N6CA 3I5PA 5COFA 3J06A 4CS9A 3EZIA 1OW6A 1V4AA 3S0XA 2R7RA 4LDRA 5A6KA 4F4BA 3DMDA 4NTBA 4DVZA 4EKWA 4EWCA 2HKVA 1FNTc 1M57C 4XWJA 3GORA 3F47A 2YKZA 3E70C 4LDQA 3UGOA 1OCCC 1YYXA 3EZHA 3GWLA 5T3TA 2L9JA 3EGXB 2WZLA 2DYSC 2RSEB 2LK4A 2YL0A 4N6HA 4XEFA 3U9MA 2LFFA 4MQ9F 1RMVA 4AK9A 2J7PA 3FOOA 4J7YA 1OR3A 2D5RB 4BEMJ 4QDLA 4E17A 1T01A 2R7VA 1I4YA 3C18A 1OKKA 2HSQA 2AWCA 3Q6NA 2PX3A 4YK5A 5KYXA 4L6RA 1A41A 2XLWA 4GQHA 2HMZA 1TWAA 3GM1A 1B68A 1QZXA 4AX2A 4NTAA 2WZGA 2QNLA 1VMAA 3UNGC 3EH2A 3DKAA 1ZZPA 2EPOA 1WATA 1WOLA 1Z5ZA 2CYDA 3EG9A 2R7QA 3KPHA 3LESA 3U3FA 1H6GA 4DBQA 1C17M 2EPLX 3AGUA 3NG1A 3EHMA 4I1OB 1ZHYA 2IXPA 5D91A 4GEHA 3RKOF 4E0IA 2VC9A 3T4RA 3RH3A 2A68F 2B0JA 2OKUA 2R7XA 3OA1A 2WL8A 5E33A 2J9WA 4EBBA 1C03A 2A1DD 4CIHA 3US6A 5A6BD 1ZW3A 5A69A 5KYWB 5L0IA 1OCRC 1J8MF 3OEOA 4MS2A 1CPQA 1PCXA 4WGYA 3QW0A 3AGTA 4CS7A 3IEEA 3T9OA 2WVNA 2CCYA 3MYFA 3TOMA 5KYYA 1ZU4A 4HEAJ 1TKNA 5FCLA 2J46A 4H54A 1CGNA 2G62A 1BR2A 1U89A 3PCVA 3UMIA 4CS8C 3ZDLA 4H4KC 4E7ZA 1WGWA 1SF8A 4Q4ZF 1EI7A 3I5QA 3QMKA 3ZQYA 1A0BA 5JUAA 3RFYA 3K1IC 2NUTA 1NFOA 2BL2A 4PJNA 4BPMA 1KNYA 1TQGA 2ASRA 2J0XA 1LIHA 3IQ6A 4JE9A 3NMKA 3G4ZA 1Z63A 4MVZA 1ORJA 3SXMA 1S7ZA 2YLDA 2KYHA 5FZTA 4EHPA 2CNWA 4MTFA 3U5SA 3A11A 2LCHA 1Z3IX 3ZG1A 4G7OF 2XL4A 1OXBA 4AE4B 3S27A 1JR8A 1QQ3A 1VOMA 5DLJA 5DQZA 3B0UX 2YLIA 4IAQA 2KGOA 2R7UA 1LM3B 2LP4A 2XLOA 3HKKA 4HFFB 3RIPA 3ZIBA 3PDMP 3LLIA 2XL6A 2RD9A 3SXZA 2QTVA 4BJ5A 2XS8A 3PHF2 4JZAA 1E85A 4JTCB 2R7WA 2L6FA 3Q6MA 5COGA 3N2ZB 3Q7GA 1YARO 3NYMA 5EGYA 5HV9A 3LJBA 3HJCA 2EIKC 4OIOF 3LNMB 4NY3A 2LSEA 3W2VA 4JURI 1KTMA 2HV7A 3C8GA 3IQCA 3N24A 1RJ9A 5B1AC 3W8IA 5AC5A 4KI2A 3WHNA 2EILC 3C62A 1VLSA 3X1OA 1VTMP 1APCA 2QUPA 4JW1A 4IRUA 4DVYP 1D0XA 1QSPA 3KH2A 3AG3C 1OR2A 4PJLA 4JRZA 1E2XA 2J0WA 1ZW2A 1HE1A 4JKVA 4OIQF 3K66A 2FFHA 3JSZA 2XXAB 4EIYA 3JSEO 2XM4A 3AQCA 1LS1A 2IYLD 2R9RB 1LKXA 2VCCA 1WTYA 3M79A 3AQBA 3KKBA 2IXNA 4YT5A 4JJFA 4CIPA 4ULVA 5E3AA 4MVRA 5BQGA 4CJGA 3ASOC 4B6IA 4PFOA 1OW8A 5DS4A 3TJ6A 1DOVA 3CZ6A 1RXQA 3FAPB 1TWGA 1H9GA 1TFOB 2IXOA 2W45A 4JEBA 1JOGA 1K04A 1MNDA 2NUPA 3L1MA 3QW1A 4NQFA 2YHSA 2E87A 5D92A 2BE5F 3OWTA 5F5HA 2NPUA 2M4EA 4OD5A 3ZSUA 3VF0A 4WGZA 1HMOA 2ZPAA 4HE8D 3B29A 2YQYA 4U5FE 3L34A
chains in the Genus database with same CATH topology
3GM1A 4EBKA 2Q00A 3S9OA 3U0CA 3BRJA 3GM2A 3GM3A 1OW6A 1V4AA 3MFNA 2JPUA 1WWPA 1ZZPA 2L6HA 1WOLA 4XEVA 3U3FA 3RQEA 1WTYA 4R32A 3B71A 2JX0A 2L6FA 3K7DA 2L6GA 3AJMA 1KNYA 1OW8A 1K40A 1QVXA 4EBJA 4XEFA 2LK4A 3C8GD 3TULA 1KTMA 3C8GA 3RQGA 1K05A 1JOGA 1K04A 2HSBA 3JZ0A 3L8JA 4NQFA 3JYYA 3C8GB 3RQFA 4XEKA 1O3UA 3C18A 3O10A 2YWAA 1UFBA 2PBEA 2KK1A 1PV3A 5F28E 3L8IA 1OW7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GM1 A;  4EBK A;  2Q00 A;  3S9O A;  3U0C A;  3BRJ A;  3GM2 A;  3GM3 A;  1OW6 A;  1V4A A;  3MFN A;  2JPU A;  1WWP A;  1ZZP A;  2L6H A;  1WOL A;  4XEV A;  3U3F A;  3RQE A;  1WTY A;  4R32 A;  3B71 A;  2JX0 A;  2L6F A;  3K7D A;  2L6G A;  3AJM A;  1KNY A;  1OW8 A;  1K40 A;  1QVX A;  4EBJ A;  4XEF A;  2LK4 A;  3C8G D;  3TUL A;  1KTM A;  3C8G A;  3RQG A;  1K05 A;  1JOG A;  1K04 A;  2HSB A;  3JZ0 A;  3L8J A;  4NQF A;  3JYY A;  3C8G B;  3RQF A;  4XEK A;  1O3U A;  3C18 A;  3O10 A;  2YWA A;  1UFB A;  2PBE A;  2KK1 A;  1PV3 A;  5F28 E;  3L8I A;  1OW7 A; 
#chains in the Genus database with same CATH topology
 2FGY A;  4EBK A;  3ASN C;  3AG1 C;  5K0I A;  3S84 A;  4PJJ A;  5JRA A;  1IW7 F;  1FFT C;  1ORY A;  3LLK A;  5BQH A;  4K1O A;  2R7O A;  3UMH A;  3SXK A;  4XPW A;  4MVU A;  4R32 A;  3EGD B;  4DJ9 A;  4YN0 B;  2ZXP A;  3MX3 A;  3W4Y A;  2HJ3 A;  4BG0 A;  3C7J A;  4C3D A;  4E0H A;  4XPX A;  3HNK A;  1BR1 A;  1K40 A;  2WB7 A;  5A6J A;  4Z9J A;  4C7O B;  2V26 A;  4ANJ A;  2JD3 A;  4K7B A;  5F5F A;  5JP7 A;  1NZE A;  1D1C A;  4K0D A;  3HNI A;  1L7C A;  5KYU A;  4CDA A;  5B3S C;  1G5Z A;  1G4U S;  5DQT A;  3JTL O;  3KL4 A;  3QZC A;  1R5I D;  2YZS A;  5EHH A;  2A69 F;  1MMN A;  2F22 A;  3S9O A;  3KYI A;  3U2L A;  4IJJ A;  1YDI A;  3T6G B;  3WAQ A;  3ECS A;  3FHD A;  3H2V A;  4IGG A;  4U9E A;  1EQ1 A;  1AEP A;  3TK0 A;  1D0Y A;  2O9X A;  4BJ1 A;  1NU7 D;  2YEV A;  4OIN F;  2VAS A;  3M1C B;  2ZXW C;  2I15 A;  1MMA A;  3EGX A;  1E86 A;  1VYK A;  4FWV A;  3SYN A;  1A7V A;  1RKE B;  4GYT A;  2XM0 A;  4U5G A;  4DRI B;  1QVX A;  2OJE D;  2EPN A;  3EH1 A;  1JMW A;  4IB4 A;  5L0F A;  1O5H A;  3W8H A;  3G50 A;  3VAY A;  3JYY A;  2OOC A;  4G0H A;  3LEV A;  3TJ5 A;  1OCZ C;  1SMY F;  3V5Y A;  3ITF A;  1CGM E;  2PF4 E;  2Y39 A;  2Z15 A;  4QI0 A;  1M2V B;  1M56 C;  3U3B A;  2Q9A A;  3AG4 C;  1W2W A;  2DYR C;  3F46 A;  2G3V A;  4D4N A;  3MFN A;  2VB6 A;  2M64 A;  2UUH A;  4KNV A;  3EFO B;  4Z9H A;  4YWQ A;  3NKD A;  1YZC A;  3L0I A;  2XLV A;  2JX0 A;  3K1H A;  4YL1 A;  4AL0 A;  3K7D A;  4X0R A;  4MND A;  1ZU5 A;  4P9F A;  4MW8 A;  3AJM A;  5B1B C;  5GPG B;  1Z7Q c;  5KYW A;  4G78 A;  2P1A A;  3K6B A;  1LS4 A;  4LLC A;  4U5B E;  4G7H F;  4YJW A;  4M63 A;  2VH3 A;  4CBE A;  3JZ0 A;  2YVK A;  1LVK A;  4IAR A;  2GWW A;  4A2N B;  4JCH A;  4CSA A;  1OCO C;  4I44 A;  2IBF A;  4JIO A;  5CIV A;  1Y6D A;  4CS9 C;  4RDA A;  4JTA B;  3ABL C;  3RF3 A;  4UDV A;  4AL1 A;  5EK0 A;  3V5X A;  4XTK A;  5DS6 A;  1M6T A;  3NDB B;  3A9C A;  2Q3T A;  2XS1 A;  3DD7 A;  2XLM A;  3QVY A;  4EUK B;  2G3K A;  5L0G A;  1QLE C;  5AC4 A;  3V7O A;  1HW1 A;  3B71 A;  3T6B A;  3RYL A;  3NKE A;  4D4X A;  3NMJ A;  2AP3 A;  4IWB A;  4OD4 A;  4XLN F;  4MVM A;  1T9K A;  2Y3G A;  2YL7 A;  4CDV A;  2MWQ A;  4NC3 A;  3HLZ A;  1GQA A;  3N0T A;  2P0N A;  4EBJ A;  2PP4 A;  1YVI A;  1D1A A;  2ZXO A;  3JRM O;  5JT4 A;  2H7B A;  1Y4C A;  2XRH A;  2CNW D;  4BEJ A;  3UR3 C;  1V74 B;  1NLX A;  4AE4 A;  4FAP B;  4XEK A;  1GM5 A;  3BEH A;  4ULW A;  2R7S A;  1R4T A;  4XQ1 A;  1KU2 A;  1D0Z A;  1NFN A;  2NG1 A;  4LER A;  4JTD B;  3UMK A;  3L8I A;  2GDC A;  4DRH B;  1OW7 A;  2Q9B A;  1GS9 A;  1HMD A;  3IQ5 A;  2Q00 A;  1XZP A;  3LS0 A;  4U5C E;  3AG2 C;  1TFK B;  3K33 A;  4W8P A;  3U0C A;  3ZTM A;  1U6H A;  1NG1 A;  3IQT A;  4J30 B;  2Q9C A;  3EQL F;  3DAG A;  2L81 A;  4XPY A;  5KYN A;  3POV A;  3RVY A;  2P61 A;  5L0H A;  4FES A;  1EA8 A;  4KBL A;  3WG7 C;  4BJ6 A;  4PJM A;  2P6V A;  1ZHZ A;  1E84 A;  3S90 A;  2YL3 A;  1G8X A;  1YYJ A;  1ORS C;  2W4B A;  3QTH A;  3C8G D;  5JS5 A;  3Q7L A;  1BDJ B;  4MVQ A;  1BR4 A;  3ABM C;  4I1M A;  1SYQ A;  2J45 A;  2Y3H A;  1GGQ A;  3JCU Q;  4MW3 A;  1TWC A;  2Q7R A;  1AVO B;  4OIP F;  3S28 A;  3O10 A;  2A0B A;  4WAB A;  3ATP A;  1VYI A;  2KK1 A;  4Q5S F;  2XXA A;  1V55 C;  2KSF A;  4XLP F;  1JPJ A;  2OG2 A;  1SR2 A;  2NSG A;  3DZA A;  4YT8 A;  2QY9 A;  3GM2 A;  2X0C A;  3I4U A;  2V3C C;  4XEV A;  4P6I C;  4N4W A;  3AOU A;  4LLE A;  1DOW A;  2H8A A;  5L3V A;  1E83 A;  2EIM C;  3R2P A;  4CSA C;  2XL8 A;  3KMI A;  5B3I A;  2CGE A;  2KQ9 A;  3DXJ F;  5BQI A;  1LE4 A;  3DJN B;  3O6X A;  3ZTZ A;  3UGP A;  3MLG A;  3TQO A;  3V5Z A;  1EKY A;  1JRA A;  2IOQ A;  3G4X A;  3C63 A;  4DRJ B;  5BUO A;  1VK5 A;  4MVS A;  5COM A;  3EHN A;  2LD6 A;  3RQG A;  1K05 A;  3ZC4 A;  4RBN A;  3L8J A;  3B0V C;  4OIR F;  1CPR A;  2H7V C;  2XLH A;  2A0U A;  3FAJ A;  1BZ4 A;  4U5H A;  5TJ5 E;  4Q7C A;  4CDY A;  4O6M A;  2NSF A;  1I4Z A;  4BJ5 C;  3U8V A;  3SP1 A;  1XZQ A;  3LS1 A;  4DBR A;  4ZLD A;  1HY5 A;  5KYX B;  1Z6A A;  4QI2 A;  3EGD A;  1JPN A;  3DJU B;  3HTK C;  3FXH A;  3PMR A;  1Q0K A;  4JC7 A;  5E3C A;  3NRH A;  2GAQ A;  3ZWI A;  4CX9 A;  3EG9 B;  1Q0M A;  2W9Y A;  3IHU A;  4JCZ A;  1IZM A;  3EPV A;  4C7O A;  4J32 B;  5T3W A;  4J7T A;  1QPU A;  1PD0 A;  3LEO A;  5A6B A;  3CQZ A;  2C04 A;  3O55 A;  3U8P A;  1SZI A;  2P7V A;  2ZD9 A;  4NTF A;  5CI8 A;  2J7P D;  4U5D E;  3HNJ A;  3W2W A;  3ZVR A;  2IXM A;  1OKK D;  1YLM A;  1ZHW A;  2H7O A;  2KNH A;  3MYI A;  3NMI A;  2CW0 F;  2KW3 C;  2QE9 A;  2R02 A;  2X51 A;  3ABK C;  3FOP A;  4JVS A;  3SZR A;  5A6A A;  2IM8 A;  5KYY B;  2R7T A;  2UUI A;  4BJ6 C;  4C3E A;  1QKR A;  4DXW A;  1LPE A;  4PAC A;  3SEO A;  2HMQ A;  3VRC A;  2WZF A;  2I8B A;  4JJG A;  2HFI A;  1ZHX A;  3FVY A;  3T6J A;  2JPU A;  2WVQ A;  2J9U A;  4O6Y A;  3E9V A;  5L0D A;  4FX5 A;  1RKE A;  1MMD A;  1NBB A;  1TR2 A;  3DAF A;  1Z23 A;  2OEV A;  3SNH A;  1ZYR F;  2YRF A;  2OEX A;  3JYH A;  2NUT B;  3B9Q A;  1TWH A;  2A6H F;  2MYS A;  4CJO A;  2GFH A;  1FR0 A;  4MVO A;  2PFD A;  1T6U A;  5JLI A;  1ZHT A;  3LAY A;  2HSB A;  2OU6 A;  2KJG A;  3QVZ A;  2ZXR A;  1VLT A;  2MHR A;  5HSW A;  3GWN A;  1O3U A;  3VM6 A;  2HJM A;  1PD1 A;  1M2V A;  2C03 A;  2BC5 A;  2R05 A;  3MBG A;  1HW2 A;  1LI7 A;  3BRJ A;  2ICW G;  2R03 A;  3EFO A;  1YJG A;  2LIG A;  3H2U A;  5T1D B;  1N1C A;  1S05 A;  1WWP A;  2L6H A;  4HFK B;  5DS5 A;  4KC9 A;  1MMG A;  4YL0 A;  3TOL A;  1MNE A;  3NYL A;  4DOZ A;  2J9B A;  4LDK A;  2A6E F;  2XLE A;  3SXY A;  1A7E A;  2Y3D A;  2Y3B A;  3IPM O;  4U5E E;  1WAS A;  2PNO A;  3H65 A;  1LI5 A;  3KYJ A;  2XLD A;  2HV6 A;  3RVZ A;  1FMV A;  2L7A A;  2W4M A;  1U0B B;  3VYW A;  2AWY A;  2EPK X;  4I3M A;  3C8G B;  4IAO A;  3RQF A;  1RJ9 B;  2OQM A;  4MTO A;  1BBH A;  3FMS A;  1XWJ A;  2J9V A;  2YL1 A;  4WJ0 A;  3LUT B;  5JSL A;  1MQV A;  1G4W R;  1PV3 A;  3RW0 A;  1CGO A;  1T6I A;  3GEH A;  1I5N A;  4JEA A;  3O39 A;  4G7Z F;  3FDQ A;  2OCC C;  2Q4F A;  3GEI A;  4BJT A;  2EIJ C;  1T6Q A;  3B0P A;  3GM3 A;  2D4U A;  4O7G A;  2PX0 A;  2DGJ A;  1ST6 A;  1RKC A;  3DM9 B;  5L0J A;  1F1M A;  3RQE A;  1V54 C;  2Y69 C;  5IY5 C;  4A4A A;  1ZVZ A;  1J8Y F;  1O87 A;  2EIN C;  3DM5 A;  3EJN A;  4MTG A;  4PFP A;  4C3B A;  1YZA A;  5DVW A;  1T5O A;  2WVO A;  4P9T A;  4W8K A;  3S29 A;  2FAP B;  2VCB A;  1OQC A;  5AGF A;  1JAF A;  2XSE A;  1UG7 A;  4NCQ A;  5CI9 A;  2DB4 A;  1FFH A;  3R7C A;  3CEX A;  3TUL A;  2KC3 A;  1A7D A;  1LE2 A;  2VCA A;  1Q0G A;  4N06 A;  4Z9I A;  2HS5 A;  3X2Q C;  4E18 A;  2OJQ A;  4ONS A;  5JVE A;  2NUP B;  3DI5 A;  1FAP B;  1H9T A;  1YAU O;  2EPM X;  2GA0 A;  1UFB A;  3DE8 A;  1FTS A;  2HZ8 A;  1H7I A;  2R25 A;  4ZLC A;  2TMV P;  4O6N A;  1VB5 A;  3GOD A;  4LAC B;  4U9D A;  3DE9 A;  4YL3 A;  4KNW A;  1FMW A;  2YLG A;  1L3P A;  1WN0 A;  2J8W A;  256B A;  1D1B A;  2HUJ A;  5L3Q A;  2LQG A;  4RD9 A;  3DWW A;  2AVK A;  3M4B A;  3M15 A;  3M4C A;  4YT4 A;  1AUE A;  2LFD A;  2ETS A;  4CS8 A;  2L6G A;  3WOD F;  1Q0D A;  1YA7 O;  3C8Z A;  3LNR A;  1OXK A;  3JT1 A;  4PR9 A;  3U2M A;  1NU9 C;  3GAN A;  3JRT A;  4ER9 A;  4YT2 A;  3CAX A;  3K1I A;  2B0H A;  3HNL A;  4E7S A;  1YA9 A;  5L0C A;  2YWA A;  3U9J A;  5E2Q A;  3ZQV A;  2AU5 A;  1NSG B;  4O79 A;  2PBE A;  1RCP A;  1C02 A;  2CDQ A;  3NYJ A;  3CSK A;  3TD7 A;  5F28 E;  1HE9 A;  1Q0F A;  5KYU B;  2DI3 A;  1M2O A;  4PK4 A;  3GEE A;  2QLA A;  4N6C A;  3I5P A;  5COF A;  3J06 A;  4CS9 A;  3EZI A;  1OW6 A;  1V4A A;  3S0X A;  2R7R A;  4LDR A;  5A6K A;  4F4B A;  3DMD A;  4NTB A;  4DVZ A;  4EKW A;  4EWC A;  2HKV A;  1FNT c;  1M57 C;  4XWJ A;  3GOR A;  3F47 A;  2YKZ A;  3E70 C;  4LDQ A;  3UGO A;  1OCC C;  1YYX A;  3EZH A;  3GWL A;  5T3T A;  2L9J A;  3EGX B;  2WZL A;  2DYS C;  2RSE B;  2LK4 A;  2YL0 A;  4N6H A;  4XEF A;  3U9M A;  2LFF A;  4MQ9 F;  1RMV A;  4AK9 A;  2J7P A;  3FOO A;  4J7Y A;  1OR3 A;  2D5R B;  4BEM J;  4QDL A;  4E17 A;  1T01 A;  2R7V A;  1I4Y A;  3C18 A;  1OKK A;  2HSQ A;  2AWC A;  3Q6N A;  2PX3 A;  4YK5 A;  5KYX A;  4L6R A;  1A41 A;  2XLW A;  4GQH A;  2HMZ A;  1TWA A;  3GM1 A;  1B68 A;  1QZX A;  4AX2 A;  4NTA A;  2WZG A;  2QNL A;  1VMA A;  3UNG C;  3EH2 A;  3DKA A;  1ZZP A;  2EPO A;  1WAT A;  1WOL A;  1Z5Z A;  2CYD A;  3EG9 A;  2R7Q A;  3KPH A;  3LES A;  3U3F A;  1H6G A;  4DBQ A;  1C17 M;  2EPL X;  3AGU A;  3NG1 A;  3EHM A;  4I1O B;  1ZHY A;  2IXP A;  5D91 A;  4GEH A;  3RKO F;  4E0I A;  2VC9 A;  3T4R A;  3RH3 A;  2A68 F;  2B0J A;  2OKU A;  2R7X A;  3OA1 A;  2WL8 A;  5E33 A;  2J9W A;  4EBB A;  1C03 A;  2A1D D;  4CIH A;  3US6 A;  5A6B D;  1ZW3 A;  5A69 A;  5KYW B;  5L0I A;  1OCR C;  1J8M F;  3OEO A;  4MS2 A;  1CPQ A;  1PCX A;  4WGY A;  3QW0 A;  3AGT A;  4CS7 A;  3IEE A;  3T9O A;  2WVN A;  2CCY A;  3MYF A;  3TOM A;  5KYY A;  1ZU4 A;  4HEA J;  1TKN A;  5FCL A;  2J46 A;  4H54 A;  1CGN A;  2G62 A;  1BR2 A;  1U89 A;  3PCV A;  3UMI A;  4CS8 C;  3ZDL A;  4H4K C;  4E7Z A;  1WGW A;  1SF8 A;  4Q4Z F;  1EI7 A;  3I5Q A;  3QMK A;  3ZQY A;  1A0B A;  5JUA A;  3RFY A;  3K1I C;  2NUT A;  1NFO A;  2BL2 A;  4PJN A;  4BPM A;  1KNY A;  1TQG A;  2ASR A;  2J0X A;  1LIH A;  3IQ6 A;  4JE9 A;  3NMK A;  3G4Z A;  1Z63 A;  4MVZ A;  1ORJ A;  3SXM A;  1S7Z A;  2YLD A;  2KYH A;  5FZT A;  4EHP A;  2CNW A;  4MTF A;  3U5S A;  3A11 A;  2LCH A;  1Z3I X;  3ZG1 A;  4G7O F;  2XL4 A;  1OXB A;  4AE4 B;  3S27 A;  1JR8 A;  1QQ3 A;  1VOM A;  5DLJ A;  5DQZ A;  3B0U X;  2YLI A;  4IAQ A;  2KGO A;  2R7U A;  1LM3 B;  2LP4 A;  2XLO A;  3HKK A;  4HFF B;  3RIP A;  3ZIB A;  3PDM P;  3LLI A;  2XL6 A;  2RD9 A;  3SXZ A;  2QTV A;  4BJ5 A;  2XS8 A;  3PHF 2;  4JZA A;  1E85 A;  4JTC B;  2R7W A;  2L6F A;  3Q6M A;  5COG A;  3N2Z B;  3Q7G A;  1YAR O;  3NYM A;  5EGY A;  5HV9 A;  3LJB A;  3HJC A;  2EIK C;  4OIO F;  3LNM B;  4NY3 A;  2LSE A;  3W2V A;  4JUR I;  1KTM A;  2HV7 A;  3C8G A;  3IQC A;  3N24 A;  1RJ9 A;  5B1A C;  3W8I A;  5AC5 A;  4KI2 A;  3WHN A;  2EIL C;  3C62 A;  1VLS A;  3X1O A;  1VTM P;  1APC A;  2QUP A;  4JW1 A;  4IRU A;  4DVY P;  1D0X A;  1QSP A;  3KH2 A;  3AG3 C;  1OR2 A;  4PJL A;  4JRZ A;  1E2X A;  2J0W A;  1ZW2 A;  1HE1 A;  4JKV A;  4OIQ F;  3K66 A;  2FFH A;  3JSZ A;  2XXA B;  4EIY A;  3JSE O;  2XM4 A;  3AQC A;  1LS1 A;  2IYL D;  2R9R B;  1LKX A;  2VCC A;  1WTY A;  3M79 A;  3AQB A;  3KKB A;  2IXN A;  4YT5 A;  4JJF A;  4CIP A;  4ULV A;  5E3A A;  4MVR A;  5BQG A;  4CJG A;  3ASO C;  4B6I A;  4PFO A;  1OW8 A;  5DS4 A;  3TJ6 A;  1DOV A;  3CZ6 A;  1RXQ A;  3FAP B;  1TWG A;  1H9G A;  1TFO B;  2IXO A;  2W45 A;  4JEB A;  1JOG A;  1K04 A;  1MND A;  2NUP A;  3L1M A;  3QW1 A;  4NQF A;  2YHS A;  2E87 A;  5D92 A;  2BE5 F;  3OWT A;  5F5H A;  2NPU A;  2M4E A;  4OD5 A;  3ZSU A;  3VF0 A;  4WGZ A;  1HMO A;  2ZPA A;  4HE8 D;  3B29 A;  2YQY A;  4U5F E;  3L34 A; 
#chains in the Genus database with same CATH homology
 3GM1 A;  4EBK A;  2Q00 A;  3S9O A;  3U0C A;  3BRJ A;  3GM2 A;  3GM3 A;  1OW6 A;  1V4A A;  3MFN A;  2JPU A;  1WWP A;  1ZZP A;  2L6H A;  1WOL A;  4XEV A;  3U3F A;  3RQE A;  1WTY A;  4R32 A;  3B71 A;  2JX0 A;  2L6F A;  3K7D A;  2L6G A;  3AJM A;  1KNY A;  1OW8 A;  1K40 A;  1QVX A;  4EBJ A;  4XEF A;  2LK4 A;  3C8G D;  3TUL A;  1KTM A;  3C8G A;  3RQG A;  1K05 A;  1JOG A;  1K04 A;  2HSB A;  3JZ0 A;  3L8J A;  4NQF A;  3JYY A;  3C8G B;  3RQF A;  4XEK A;  1O3U A;  3C18 A;  3O10 A;  2YWA A;  1UFB A;  2PBE A;  2KK1 A;  1PV3 A;  5F28 E;  3L8I A;  1OW7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...