2AU5A

Structure of a conserved domain from locus ef2947 from enterococcus faecalis v583
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
133
structure length
129
Chain Sequence
AMLILSPNFEYEEITRSFLSNMLAFTRGHFTGDISHFSPIVLAEMEKDPNWLEEAAGGMQGVIVQSLLEDENFSSVEQLKGELARLIRLYFALAKDNLTENQESLYVDLFDKFTFLLLCSDEFIMYLDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords conserved domain protein
publication title Structure of a conserved domain from locus EF2947 from Enterococcus faecalis V583
rcsb
source organism Enterococcus faecalis
molecule tags Structural genomics, unknown function
total genus 44
structure length 129
sequence length 133
ec nomenclature
pdb deposition date 2005-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11472 DUF3206 Protein of unknown function (DUF3206)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.590 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) EF2947-like 2au5A00
2AU5A
chains in the Genus database with same CATH superfamily
3FAPB 3UMKA 1QPUA 1RCPA 3NYJA 4PJMA 3U3FA 4ULWA 2FAPB 3GANA 4B6IA 4XLPF 1C03A 2HSBA 5KYWA 1OCZC 2IXPA 2HV7A 3MYFA 4HEAJ 4N6CA 1M56C 1NFNA 1J8YF 1Q0FA 3O6XA 1GS9A 2L9JA 3ZTZA 4YL1A 2OQMA 2WVNA 1J8MF 2WZFA 3HNJA 5L0JA 2R7UA 3Q7GA 5HSWA 1WWPA 4EBKA 5BQIA 1O3UA 2W45A 2CGEA 4RBNA 3GORA 2HSQA 3PCVA 3SXZA 3TD7A 2NSFA 1R5ID 3AQBA 3LEVA 1RMVA 2CNWA 3M4BA 1OQCA 5A6KA 1VYIA 2EIMC 1MNDA 3H2VA 3LS1A 4O6YA 3V5ZA 1ORSC 4EIYA 1K40A 1I5NA 2LIGA 5KYUA 3S28A 3U9JA 5JLIA 3EZIA 4FESA 3EGXB 1SZIA 4CJOA 1LPEA 1FFHA 1VK5A 3QW0A 1BBHA 4GQHA 4E17A 5AC5A 2PX0A 1KNYA 4DJ9A 1T9KA 1TWHA 3NYLA 5L0FA 4XPYA 1EKYA 2I8BA 3Q6MA 4U5GA 3VYWA 3IPMO 1RXQA 1YAUO 2HS5A 4JCHA 2RSEB 3HNKA 3U5SA 2DB4A 1ZHYA 2PX3A 3Q6NA 2J45A 5F5HA 2A0UA 1A7DA 5JUAA 1H7IA 3VM6A 1SR2A 1FFTC 4MVOA 1TQGA 2O9XA 3JCUQ 2EIKC 4ZLCA 1E86A 1Z6AA 3EZHA 4JJFA 3L0IA 2NUPA 4IWBA 2BE5F 3C8GD 1RKEA 2YL1A 1IW7F 2H7VC 4BJ5A 1VOMA 2IOQA 1ZU4A 4CJGA 2J9VA 3RH3A 3C18A 3RIPA 3VF0A 5DS5A 3U2LA 3B29A 3GEHA 3ABKC 4U9EA 4A4AA 1ORYA 4I3MA 4IAQA 2XS8A 4MVMA 2J46A 3K7DA 2HZ8A 1NFOA 3OEOA 3DJNB 2WL8A 3AG2C 2GFHA 3K1IC 2HFIA 3DAFA 1H9TA 4I1MA 2OJED 5DLJA 3KYIA 4FX5A 4J30B 2JD3A 3RKOF 4OIOF 1LI5A 1HE1A 4LDRA 3PDMP 3MLGA 1Z3IX 2HUJA 2L6FA 2EPLX 5L3VA 1OXBA 2A68F 3R2PA 5KYYA 1BDJB 4YL3A 2M64A 2Y3DA 3GM3A 5GPGB 1CPQA 2KNHA 1B68A 1M6TA 2ZXWC 3DZAA 2OEVA 5KYWB 4QI2A 2P1AA 5BQGA 1DOVA 1NU9C 4BEJA 4E7ZA 2CW0F 4Q4ZF 1TKNA 2HJ3A 3S84A 2J7PD 3K33A 3RYLA 3ZIBA 2V26A 5E33A 3S29A 3ZQYA 4AL0A 4K1OA 2H7BA 4HFKB 2MWQA 3G4XA 1U6HA 4EBBA 1ZYRF 1I4ZA 3CZ6A 3HNLA 3E70C 4IB4A 3AJMA 2R05A 1Z23A 3QZCA 3FVYA 3F46A 1JR8A 3WAQA 1BR2A 3R7CA 4G7ZF 1UG7A 2IXOA 2DI3A 4JRZA 1RKCA 4O6NA 3M1CB 3S27A 2KQ9A 1U89A 4CS9A 2LCHA 1ZZPA 2AU5A 1Z63A 3B0UX 4JTAB 2R7QA 3B0VC 1QVXA 1BR4A 1JOGA 2AP3A 5T3TA 3RF3A 4BJ6C 1JPNA 5T3WA 4YT8A 1M2VB 1TFOB 5AGFA 3RQFA 3ABLC 1BR1A 1DOWA 2NSGA 5JT4A 1V55C 4OD4A 3ECSA 1MMAA 4Q5SF 4ZLDA 4MVZA 3RQEA 1G5ZA 3X1OA 3V7OA 1APCA 4JURI 4CDYA 1YA9A 3QVYA 3EHMA 3AOUA 2LFFA 3LLIA 4FWVA 5IY5C 1YZCA 1LS1A 2NUPB 4DRIB 1UFBA 1LE2A 2W9YA 1L7CA 1E83A 2IXMA 256BA 3K66A 4MS2A 3RVZA 1D1CA 3EG9A 3AGUA 3DE8A 3ASOC 2P61A 5DS4A 4NCQA 2OU6A 1NZEA 3QMKA 1TFKB 2CCYA 2XLOA 3QTHA 2UUIA 2XLDA 2D4UA 2J0WA 3IHUA 2KW3C 2Y69C 3DD7A 3UNGC 3U0CA 1EQ1A 3G4ZA 2WZGA 4F4BA 3GM2A 1EA8A 2YVKA 3N2ZB 4G0HA 4CSAC 5JVEA 3NMJA 4CS8A 1LI7A 2EPMX 1YYXA 1JRAA 4P9FA 4JCZA 2ZXPA 2XL6A 5COMA 3LJBA 2KC3A 2C03A 2VC9A 3A9CA 4L6RA 2OKUA 1MMGA 4IAOA 4AK9A 3SYNA 4CIPA 5COGA 5KYYB 2HKVA 3O10A 4PJJA 2ASRA 3B71A 3RFYA 1ZHXA 1JAFA 2GA0A 3TQOA 3L8IA 3WHNA 3JSEO 2IBFA 4E7SA 2CDQA 2WZLA 1HW1A 3SXYA 1VB5A 4XQ1A 1T6QA 3UMHA 1OW6A 4E0IA 1R4TA 2EPOA 2IYLD 5FCLA 3EGDA 3GODA 4EKWA 5F28E 3EFOB 2YL0A 5A6JA 1T6IA 2YWAA 1XZQA 1V54C 1QQ3A 4IARA 5DQZA 2R7TA 3GEEA 3POVA 3VAYA 1QSPA 3NDBB 1C17M 4JTDB 1LS4A 3IQCA 3ZWIA 4CDAA 4DBRA 2IXNA 4LLCA 5TJ5E 4YT5A 5L3QA 1D1BA 3C8GA 5EGYA 1FMWA 5A69A 2PF4E 3HLZA 4BJTA 2NPUA 2QY9A 4GYTA 3KL4A 1D0YA 1ZW2A 3FHDA 1LVKA 1YDIA 4XEFA 3AGTA 3U9MA 2OG2A 2OEXA 2YLDA 4XLNF 4U5EE 1YJGA 4CS7A 4LACB 1GM5A 3NMIA 5E3CA 4KNVA 3UR3C 1M2OA 3SZRA 4XPWA 2XLMA 1MQVA 2ZPAA 4K7BA 3K6BA 4MTOA 2XM0A 2L6HA 3FOOA 3IQ5A 1OCOC 1TWAA 2JX0A 4KNWA 3S9OA 3SNHA 2FFHA 2Q9BA 2QNLA 3HNIA 4G78A 4U5CE 3FMSA 4U9DA 3T6GB 5B1AC 3KMIA 4PJNA 1RJ9A 4XPXA 4DBQA 3DAGA 3T4RA 4AE4A 4CBEA 1OW7A 4I1OB 2TMVP 4Z9JA 2Z15A 5AC4A 1Q0MA 2J7PA 1QKRA 1Q0DA 4IGGA 4QDLA 2DYRC 1LKXA 3JYYA 3M15A 4YL0A 1MNEA 2P0NA 2VCBA 2J8WA 1S7ZA 1L3PA 3NKDA 5CI9A 5FZTA 4JVSA 4LERA 4Z9IA 5KYXA 2C04A 4U5FE 3ASNC 3LNMB 1Y6DA 2H8AA 2MHRA 3SXKA 2Q9CA 3GWLA 5L0DA 4D4NA 1A7VA 3EJNA 2R7WA 3LUTB 3NMKA 4FAPB 2XL8A 4ONSA 2R25A 2J9WA 2FGYA 1FAPB 2EIJC 3HKKA 4H54A 4M63A 1KTMA 3QW1A 4YT4A 4OINF 3T9OA 2G3VA 2Q00A 4A2NB 4X0RA 3FDQA 1NSGB 2XM4A 1NG1A 4W8PA 2BL2A 4DVZA 5KYUB 5B3IA 2P6VA 1E85A 4BJ1A 1WATA 1ZHWA 2HMZA 2YL7A 4WGYA 3DKAA 3VRCA 3BRJA 3W8IA 4CX9A 4CS8C 5DS6A 2LK4A 4WJ0A 3DM9B 4DRJB 3UMIA 3CSKA 4WGZA 5BUOA 5B3SC 2G3KA 4RD9A 4OIRF 1HE9A 1I4YA 5CI8A 1FMVA 3GEIA 3NG1A 1JPJA 3M79A 1FTSA 2KK1A 4Z9HA 3JZ0A 1HW2A 2DYSC 3DE9A 3RVYA 1OKKA 1PV3A 2EPNA 2R9RB 3DJUB 4J32B 4DXWA 1NU7D 1T5OA 1OXKA 1IZMA 4MW8A 3T6BA 2OCCC 1H9GA 1YZAA 4JZAA 1A41A 3JRTA 4C3DA 1LE4A 2GDCA 4G7OF 3C8ZA 1RKEB 1WGWA 1PCXA 3JRMO 1OKKD 3K1IA 4LDKA 1LIHA 2ETSA 1XWJA 4DVYP 3FOPA 1SYQA 3GWNA 2YLIA 3SXMA 3U3BA 4MW3A 3US6A 4J7YA 2R03A 4CDVA 1ZW3A 3N24A 4YK5A 4K0DA 5EHHA 4MTFA 1O87A 2H7OA 3E9VA 3C7JA 2QUPA 3C63A 2Y3GA 3DWWA 1D0ZA 2CYDA 3EHNA 1RJ9B 2AWCA 3KPHA 1BZ4A 3OA1A 4P9TA 2X0CA 4AE4B 1HMDA 4N6HA 4PR9A 2QLAA 1G4US 3TJ5A 4N4WA 1XZPA 4EBJA 1ZVZA 1WTYA 2J9BA 2F22A 2AVKA 2KYHA 2KSFA 3B9QA 3AG3C 3CQZA 5EK0A 1OW8A 4HE8D 2ZXRA 3J06A 2R7VA 3W2VA 4BJ5C 2G62A 2XRHA 3L34A 3AG4C 2NUTA 1FR0A 3JYHA 1V74B 3KKBA 2Q3TA 4XWJA 3RW0A 2QTVA 3ZDLA 3FAJA 1QLEC 3K1HA 4YWQA 5A6BD 3U2MA 2VCCA 5JSLA 4R32A 1ORJA 4ER9A 5L0HA 3V5YA 4YN0B 1Y4CA 1AVOB 2HV6A 2L7AA 3NKEA 2KJGA 3S0XA 1OCCC 3EPVA 3JSZA 4MVUA 2VASA 2W4BA 3C62A 5L0GA 2IM8A 2DGJA 1E2XA 4NTBA 3IEEA 3TOMA 4BJ6A 5K0IA 2E87A 1YA7O 3ZVRA 4C7OA 2R7SA 1EI7A 2Y39A 3F47A 4DOZA 1YYJA 4HFFB 2A6EF 4CIHA 3NYMA 2A6HF 2XL4A 2XXAA 3O39A 4MVSA 2LFDA 1U0BB 1OR3A 4C3EA 2A0BA 1SMYF 3GM1A 4JEAA 1YVIA 2AWYA 4KBLA 2B0HA 5JRAA 3PHF2 1K04A 2XLHA 4PACA 3HJCA 1WOLA 4EHPA 3S90A 2WB7A 1A0BA 1CGOA 4JE9A 3SEOA 4NY3A 2V3CC 3HTKC 3L8JA 2EINC 2YEVA 1V4AA 2L6GA 3DXJF 3ZG1A 1E84A 2HJMA 1HMOA 3X2QC 3I4UA 5L0CA 4D4XA 5BQHA 3M4CA 2CNWD 4EWCA 2LP4A 2YHSA 1YARO 4PFPA 1VYKA 1M2VA 2XLVA 4YT2A 4OD5A 2LSEA 4E0HA 3EG9B 3LS0A 2VH3A 3ZC4A 4IJJA 4NQFA 2XLEA 3UGOA 1GGQA 4YJWA 4CSAA 4QI0A 1VLTA 1MMNA 3G50A 4CS9C 1ZU5A 1MMDA 2VB6A 2Y3HA 2XS1A 1D1AA 5JS5A 4MVQA 3TULA 2R7RA 4U5HA 3KYJA 4JC7A 4JEBA 3MFNA 3KH2A 3W2WA 2PNOA 3LEOA 2LD6A 1PD1A 1C02A 2QE9A 3CAXA 3W8HA 1OR2A 2YLGA 3B0PA 3IQTA 2LQGA 4JW1A 4BPMA 1FNTc 2J9UA 4W8KA 1QZXA 5COFA 3WG7C 1WN0A 3QVZA 3LNRA 4MVRA 1Z7Qc 3IQ6A 4H4KC 5D91A 2YZSA 3RQGA 4NTFA 1CGME 1CGNA 3JT1A 4IRUA 2ZXOA 4AL1A 1NLXA 4DRHB 4JTCB 3TJ6A 4O79A 5F5FA 3H2UA 4NTAA 4BG0A 4Q7CA 3V5XA 1A7EA 1KU2A 3H65A 2NUTB 4J7TA 1TR2A 1SF8A 3A11A 4E18A 5A6AA 3W4YA 1D0XA 3TOLA 3MBGA 4ANJA 5CIVA 3MYIA 1Z5ZA 3UGPA 3MX3A 2L81A 2R7XA 2YL3A 4XTKA 1K05A 3EGDB 3Q7LA 4JIOA 1G4WR 2EPKX 5DVWA 4WABA 1ZHZA 1Q0GA 1GQAA 1ZHTA 3ZQVA 4PFOA 5D92A 2PP4A 1TWGA 4G7HF 1TWCA 2KGOA 1LM3B 2PFDA 3EH1A 1W2WA 2B0JA 3DI5A 3T6JA 1CPRA 4KI2A 3L1MA 3O55A 5L0IA 1T01A 2HMQA 3C8GB 4U5DE 2OOCA 4I44A 4XEVA 4OIQF 4U5BE 2XXAB 2W4MA 3NRHA 5B1BC 3AQCA 3ZTMA 3I5PA 4LDQA 3ZSUA 4P6IC 3EFOA 4ULVA 3U8PA 1G8XA 3LLKA 4XEKA 3EGXA 5T1DB 2JPUA 2GWWA 5JP7A 3ABMC 1F1MA 1VMAA 3N0TA 4RDAA 2MYSA 4MQ9F 4C3BA 2XSEA 2Y3BA 4PK4A 3WODF 4EUKB 2GAQA 4O6MA 1VTMP 4LLEA 4NC3A 3OWTA 4MTGA 2J0XA 1N1CA 2EILC 4O7GA 3U8VA 4N06A 2R02A 1PD0A 1JMWA 3EQLF 3BEHA 4JKVA 3ATPA 4MNDA 2M4EA 2RD9A 2VCAA 4BEMJ 1Q0KA 3CEXA 1H6GA 2Q4FA 1AEPA 1O5HA 3LAYA 5E2QA 3DMDA 2X51A 2WVQA 1M57C 5A6BA 2XLWA 3FXHA 4PJLA 4KC9A 3EH2A 2D5RB 2OJQA 2Q9AA 2NG1A 2Q7RA 3PMRA 3TK0A 2YRFA 2A69F 5DQTA 1NBBA 2YQYA 2PBEA 4OIPF 2BC5A 2ICWG 2ZD9A 2A1DD 3SP1A 5HV9A 5KYXB 1HY5A 3JTLO 3I5QA 2UUHA 4AX2A 5KYNA 1S05A 1AUEA 2YKZA 3DM5A 1WASA 4JJGA 1YLMA 2R7OA 2WVOA 1VLSA 3AG1C 3ITFA 5E3AA 4GEHA 1T6UA 2I15A 3LESA 1OCRC 4C7OB 1ST6A 2P7VA 4UDVA
chains in the Genus database with same CATH topology
2AU5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AU5 A; 
#chains in the Genus database with same CATH topology
 3FAP B;  3UMK A;  1QPU A;  1RCP A;  3NYJ A;  4PJM A;  3U3F A;  4ULW A;  2FAP B;  3GAN A;  4B6I A;  4XLP F;  1C03 A;  2HSB A;  5KYW A;  1OCZ C;  2IXP A;  2HV7 A;  3MYF A;  4HEA J;  4N6C A;  1M56 C;  1NFN A;  1J8Y F;  1Q0F A;  3O6X A;  1GS9 A;  2L9J A;  3ZTZ A;  4YL1 A;  2OQM A;  2WVN A;  1J8M F;  2WZF A;  3HNJ A;  5L0J A;  2R7U A;  3Q7G A;  5HSW A;  1WWP A;  4EBK A;  5BQI A;  1O3U A;  2W45 A;  2CGE A;  4RBN A;  3GOR A;  2HSQ A;  3PCV A;  3SXZ A;  3TD7 A;  2NSF A;  1R5I D;  3AQB A;  3LEV A;  1RMV A;  2CNW A;  3M4B A;  1OQC A;  5A6K A;  1VYI A;  2EIM C;  1MND A;  3H2V A;  3LS1 A;  4O6Y A;  3V5Z A;  1ORS C;  4EIY A;  1K40 A;  1I5N A;  2LIG A;  5KYU A;  3S28 A;  3U9J A;  5JLI A;  3EZI A;  4FES A;  3EGX B;  1SZI A;  4CJO A;  1LPE A;  1FFH A;  1VK5 A;  3QW0 A;  1BBH A;  4GQH A;  4E17 A;  5AC5 A;  2PX0 A;  1KNY A;  4DJ9 A;  1T9K A;  1TWH A;  3NYL A;  5L0F A;  4XPY A;  1EKY A;  2I8B A;  3Q6M A;  4U5G A;  3VYW A;  3IPM O;  1RXQ A;  1YAU O;  2HS5 A;  4JCH A;  2RSE B;  3HNK A;  3U5S A;  2DB4 A;  1ZHY A;  2PX3 A;  3Q6N A;  2J45 A;  5F5H A;  2A0U A;  1A7D A;  5JUA A;  1H7I A;  3VM6 A;  1SR2 A;  1FFT C;  4MVO A;  1TQG A;  2O9X A;  3JCU Q;  2EIK C;  4ZLC A;  1E86 A;  1Z6A A;  3EZH A;  4JJF A;  3L0I A;  2NUP A;  4IWB A;  2BE5 F;  3C8G D;  1RKE A;  2YL1 A;  1IW7 F;  2H7V C;  4BJ5 A;  1VOM A;  2IOQ A;  1ZU4 A;  4CJG A;  2J9V A;  3RH3 A;  3C18 A;  3RIP A;  3VF0 A;  5DS5 A;  3U2L A;  3B29 A;  3GEH A;  3ABK C;  4U9E A;  4A4A A;  1ORY A;  4I3M A;  4IAQ A;  2XS8 A;  4MVM A;  2J46 A;  3K7D A;  2HZ8 A;  1NFO A;  3OEO A;  3DJN B;  2WL8 A;  3AG2 C;  2GFH A;  3K1I C;  2HFI A;  3DAF A;  1H9T A;  4I1M A;  2OJE D;  5DLJ A;  3KYI A;  4FX5 A;  4J30 B;  2JD3 A;  3RKO F;  4OIO F;  1LI5 A;  1HE1 A;  4LDR A;  3PDM P;  3MLG A;  1Z3I X;  2HUJ A;  2L6F A;  2EPL X;  5L3V A;  1OXB A;  2A68 F;  3R2P A;  5KYY A;  1BDJ B;  4YL3 A;  2M64 A;  2Y3D A;  3GM3 A;  5GPG B;  1CPQ A;  2KNH A;  1B68 A;  1M6T A;  2ZXW C;  3DZA A;  2OEV A;  5KYW B;  4QI2 A;  2P1A A;  5BQG A;  1DOV A;  1NU9 C;  4BEJ A;  4E7Z A;  2CW0 F;  4Q4Z F;  1TKN A;  2HJ3 A;  3S84 A;  2J7P D;  3K33 A;  3RYL A;  3ZIB A;  2V26 A;  5E33 A;  3S29 A;  3ZQY A;  4AL0 A;  4K1O A;  2H7B A;  4HFK B;  2MWQ A;  3G4X A;  1U6H A;  4EBB A;  1ZYR F;  1I4Z A;  3CZ6 A;  3HNL A;  3E70 C;  4IB4 A;  3AJM A;  2R05 A;  1Z23 A;  3QZC A;  3FVY A;  3F46 A;  1JR8 A;  3WAQ A;  1BR2 A;  3R7C A;  4G7Z F;  1UG7 A;  2IXO A;  2DI3 A;  4JRZ A;  1RKC A;  4O6N A;  3M1C B;  3S27 A;  2KQ9 A;  1U89 A;  4CS9 A;  2LCH A;  1ZZP A;  2AU5 A;  1Z63 A;  3B0U X;  4JTA B;  2R7Q A;  3B0V C;  1QVX A;  1BR4 A;  1JOG A;  2AP3 A;  5T3T A;  3RF3 A;  4BJ6 C;  1JPN A;  5T3W A;  4YT8 A;  1M2V B;  1TFO B;  5AGF A;  3RQF A;  3ABL C;  1BR1 A;  1DOW A;  2NSG A;  5JT4 A;  1V55 C;  4OD4 A;  3ECS A;  1MMA A;  4Q5S F;  4ZLD A;  4MVZ A;  3RQE A;  1G5Z A;  3X1O A;  3V7O A;  1APC A;  4JUR I;  4CDY A;  1YA9 A;  3QVY A;  3EHM A;  3AOU A;  2LFF A;  3LLI A;  4FWV A;  5IY5 C;  1YZC A;  1LS1 A;  2NUP B;  4DRI B;  1UFB A;  1LE2 A;  2W9Y A;  1L7C A;  1E83 A;  2IXM A;  256B A;  3K66 A;  4MS2 A;  3RVZ A;  1D1C A;  3EG9 A;  3AGU A;  3DE8 A;  3ASO C;  2P61 A;  5DS4 A;  4NCQ A;  2OU6 A;  1NZE A;  3QMK A;  1TFK B;  2CCY A;  2XLO A;  3QTH A;  2UUI A;  2XLD A;  2D4U A;  2J0W A;  3IHU A;  2KW3 C;  2Y69 C;  3DD7 A;  3UNG C;  3U0C A;  1EQ1 A;  3G4Z A;  2WZG A;  4F4B A;  3GM2 A;  1EA8 A;  2YVK A;  3N2Z B;  4G0H A;  4CSA C;  5JVE A;  3NMJ A;  4CS8 A;  1LI7 A;  2EPM X;  1YYX A;  1JRA A;  4P9F A;  4JCZ A;  2ZXP A;  2XL6 A;  5COM A;  3LJB A;  2KC3 A;  2C03 A;  2VC9 A;  3A9C A;  4L6R A;  2OKU A;  1MMG A;  4IAO A;  4AK9 A;  3SYN A;  4CIP A;  5COG A;  5KYY B;  2HKV A;  3O10 A;  4PJJ A;  2ASR A;  3B71 A;  3RFY A;  1ZHX A;  1JAF A;  2GA0 A;  3TQO A;  3L8I A;  3WHN A;  3JSE O;  2IBF A;  4E7S A;  2CDQ A;  2WZL A;  1HW1 A;  3SXY A;  1VB5 A;  4XQ1 A;  1T6Q A;  3UMH A;  1OW6 A;  4E0I A;  1R4T A;  2EPO A;  2IYL D;  5FCL A;  3EGD A;  3GOD A;  4EKW A;  5F28 E;  3EFO B;  2YL0 A;  5A6J A;  1T6I A;  2YWA A;  1XZQ A;  1V54 C;  1QQ3 A;  4IAR A;  5DQZ A;  2R7T A;  3GEE A;  3POV A;  3VAY A;  1QSP A;  3NDB B;  1C17 M;  4JTD B;  1LS4 A;  3IQC A;  3ZWI A;  4CDA A;  4DBR A;  2IXN A;  4LLC A;  5TJ5 E;  4YT5 A;  5L3Q A;  1D1B A;  3C8G A;  5EGY A;  1FMW A;  5A69 A;  2PF4 E;  3HLZ A;  4BJT A;  2NPU A;  2QY9 A;  4GYT A;  3KL4 A;  1D0Y A;  1ZW2 A;  3FHD A;  1LVK A;  1YDI A;  4XEF A;  3AGT A;  3U9M A;  2OG2 A;  2OEX A;  2YLD A;  4XLN F;  4U5E E;  1YJG A;  4CS7 A;  4LAC B;  1GM5 A;  3NMI A;  5E3C A;  4KNV A;  3UR3 C;  1M2O A;  3SZR A;  4XPW A;  2XLM A;  1MQV A;  2ZPA A;  4K7B A;  3K6B A;  4MTO A;  2XM0 A;  2L6H A;  3FOO A;  3IQ5 A;  1OCO C;  1TWA A;  2JX0 A;  4KNW A;  3S9O A;  3SNH A;  2FFH A;  2Q9B A;  2QNL A;  3HNI A;  4G78 A;  4U5C E;  3FMS A;  4U9D A;  3T6G B;  5B1A C;  3KMI A;  4PJN A;  1RJ9 A;  4XPX A;  4DBQ A;  3DAG A;  3T4R A;  4AE4 A;  4CBE A;  1OW7 A;  4I1O B;  2TMV P;  4Z9J A;  2Z15 A;  5AC4 A;  1Q0M A;  2J7P A;  1QKR A;  1Q0D A;  4IGG A;  4QDL A;  2DYR C;  1LKX A;  3JYY A;  3M15 A;  4YL0 A;  1MNE A;  2P0N A;  2VCB A;  2J8W A;  1S7Z A;  1L3P A;  3NKD A;  5CI9 A;  5FZT A;  4JVS A;  4LER A;  4Z9I A;  5KYX A;  2C04 A;  4U5F E;  3ASN C;  3LNM B;  1Y6D A;  2H8A A;  2MHR A;  3SXK A;  2Q9C A;  3GWL A;  5L0D A;  4D4N A;  1A7V A;  3EJN A;  2R7W A;  3LUT B;  3NMK A;  4FAP B;  2XL8 A;  4ONS A;  2R25 A;  2J9W A;  2FGY A;  1FAP B;  2EIJ C;  3HKK A;  4H54 A;  4M63 A;  1KTM A;  3QW1 A;  4YT4 A;  4OIN F;  3T9O A;  2G3V A;  2Q00 A;  4A2N B;  4X0R A;  3FDQ A;  1NSG B;  2XM4 A;  1NG1 A;  4W8P A;  2BL2 A;  4DVZ A;  5KYU B;  5B3I A;  2P6V A;  1E85 A;  4BJ1 A;  1WAT A;  1ZHW A;  2HMZ A;  2YL7 A;  4WGY A;  3DKA A;  3VRC A;  3BRJ A;  3W8I A;  4CX9 A;  4CS8 C;  5DS6 A;  2LK4 A;  4WJ0 A;  3DM9 B;  4DRJ B;  3UMI A;  3CSK A;  4WGZ A;  5BUO A;  5B3S C;  2G3K A;  4RD9 A;  4OIR F;  1HE9 A;  1I4Y A;  5CI8 A;  1FMV A;  3GEI A;  3NG1 A;  1JPJ A;  3M79 A;  1FTS A;  2KK1 A;  4Z9H A;  3JZ0 A;  1HW2 A;  2DYS C;  3DE9 A;  3RVY A;  1OKK A;  1PV3 A;  2EPN A;  2R9R B;  3DJU B;  4J32 B;  4DXW A;  1NU7 D;  1T5O A;  1OXK A;  1IZM A;  4MW8 A;  3T6B A;  2OCC C;  1H9G A;  1YZA A;  4JZA A;  1A41 A;  3JRT A;  4C3D A;  1LE4 A;  2GDC A;  4G7O F;  3C8Z A;  1RKE B;  1WGW A;  1PCX A;  3JRM O;  1OKK D;  3K1I A;  4LDK A;  1LIH A;  2ETS A;  1XWJ A;  4DVY P;  3FOP A;  1SYQ A;  3GWN A;  2YLI A;  3SXM A;  3U3B A;  4MW3 A;  3US6 A;  4J7Y A;  2R03 A;  4CDV A;  1ZW3 A;  3N24 A;  4YK5 A;  4K0D A;  5EHH A;  4MTF A;  1O87 A;  2H7O A;  3E9V A;  3C7J A;  2QUP A;  3C63 A;  2Y3G A;  3DWW A;  1D0Z A;  2CYD A;  3EHN A;  1RJ9 B;  2AWC A;  3KPH A;  1BZ4 A;  3OA1 A;  4P9T A;  2X0C A;  4AE4 B;  1HMD A;  4N6H A;  4PR9 A;  2QLA A;  1G4U S;  3TJ5 A;  4N4W A;  1XZP A;  4EBJ A;  1ZVZ A;  1WTY A;  2J9B A;  2F22 A;  2AVK A;  2KYH A;  2KSF A;  3B9Q A;  3AG3 C;  3CQZ A;  5EK0 A;  1OW8 A;  4HE8 D;  2ZXR A;  3J06 A;  2R7V A;  3W2V A;  4BJ5 C;  2G62 A;  2XRH A;  3L34 A;  3AG4 C;  2NUT A;  1FR0 A;  3JYH A;  1V74 B;  3KKB A;  2Q3T A;  4XWJ A;  3RW0 A;  2QTV A;  3ZDL A;  3FAJ A;  1QLE C;  3K1H A;  4YWQ A;  5A6B D;  3U2M A;  2VCC A;  5JSL A;  4R32 A;  1ORJ A;  4ER9 A;  5L0H A;  3V5Y A;  4YN0 B;  1Y4C A;  1AVO B;  2HV6 A;  2L7A A;  3NKE A;  2KJG A;  3S0X A;  1OCC C;  3EPV A;  3JSZ A;  4MVU A;  2VAS A;  2W4B A;  3C62 A;  5L0G A;  2IM8 A;  2DGJ A;  1E2X A;  4NTB A;  3IEE A;  3TOM A;  4BJ6 A;  5K0I A;  2E87 A;  1YA7 O;  3ZVR A;  4C7O A;  2R7S A;  1EI7 A;  2Y39 A;  3F47 A;  4DOZ A;  1YYJ A;  4HFF B;  2A6E F;  4CIH A;  3NYM A;  2A6H F;  2XL4 A;  2XXA A;  3O39 A;  4MVS A;  2LFD A;  1U0B B;  1OR3 A;  4C3E A;  2A0B A;  1SMY F;  3GM1 A;  4JEA A;  1YVI A;  2AWY A;  4KBL A;  2B0H A;  5JRA A;  3PHF 2;  1K04 A;  2XLH A;  4PAC A;  3HJC A;  1WOL A;  4EHP A;  3S90 A;  2WB7 A;  1A0B A;  1CGO A;  4JE9 A;  3SEO A;  4NY3 A;  2V3C C;  3HTK C;  3L8J A;  2EIN C;  2YEV A;  1V4A A;  2L6G A;  3DXJ F;  3ZG1 A;  1E84 A;  2HJM A;  1HMO A;  3X2Q C;  3I4U A;  5L0C A;  4D4X A;  5BQH A;  3M4C A;  2CNW D;  4EWC A;  2LP4 A;  2YHS A;  1YAR O;  4PFP A;  1VYK A;  1M2V A;  2XLV A;  4YT2 A;  4OD5 A;  2LSE A;  4E0H A;  3EG9 B;  3LS0 A;  2VH3 A;  3ZC4 A;  4IJJ A;  4NQF A;  2XLE A;  3UGO A;  1GGQ A;  4YJW A;  4CSA A;  4QI0 A;  1VLT A;  1MMN A;  3G50 A;  4CS9 C;  1ZU5 A;  1MMD A;  2VB6 A;  2Y3H A;  2XS1 A;  1D1A A;  5JS5 A;  4MVQ A;  3TUL A;  2R7R A;  4U5H A;  3KYJ A;  4JC7 A;  4JEB A;  3MFN A;  3KH2 A;  3W2W A;  2PNO A;  3LEO A;  2LD6 A;  1PD1 A;  1C02 A;  2QE9 A;  3CAX A;  3W8H A;  1OR2 A;  2YLG A;  3B0P A;  3IQT A;  2LQG A;  4JW1 A;  4BPM A;  1FNT c;  2J9U A;  4W8K A;  1QZX A;  5COF A;  3WG7 C;  1WN0 A;  3QVZ A;  3LNR A;  4MVR A;  1Z7Q c;  3IQ6 A;  4H4K C;  5D91 A;  2YZS A;  3RQG A;  4NTF A;  1CGM E;  1CGN A;  3JT1 A;  4IRU A;  2ZXO A;  4AL1 A;  1NLX A;  4DRH B;  4JTC B;  3TJ6 A;  4O79 A;  5F5F A;  3H2U A;  4NTA A;  4BG0 A;  4Q7C A;  3V5X A;  1A7E A;  1KU2 A;  3H65 A;  2NUT B;  4J7T A;  1TR2 A;  1SF8 A;  3A11 A;  4E18 A;  5A6A A;  3W4Y A;  1D0X A;  3TOL A;  3MBG A;  4ANJ A;  5CIV A;  3MYI A;  1Z5Z A;  3UGP A;  3MX3 A;  2L81 A;  2R7X A;  2YL3 A;  4XTK A;  1K05 A;  3EGD B;  3Q7L A;  4JIO A;  1G4W R;  2EPK X;  5DVW A;  4WAB A;  1ZHZ A;  1Q0G A;  1GQA A;  1ZHT A;  3ZQV A;  4PFO A;  5D92 A;  2PP4 A;  1TWG A;  4G7H F;  1TWC A;  2KGO A;  1LM3 B;  2PFD A;  3EH1 A;  1W2W A;  2B0J A;  3DI5 A;  3T6J A;  1CPR A;  4KI2 A;  3L1M A;  3O55 A;  5L0I A;  1T01 A;  2HMQ A;  3C8G B;  4U5D E;  2OOC A;  4I44 A;  4XEV A;  4OIQ F;  4U5B E;  2XXA B;  2W4M A;  3NRH A;  5B1B C;  3AQC A;  3ZTM A;  3I5P A;  4LDQ A;  3ZSU A;  4P6I C;  3EFO A;  4ULV A;  3U8P A;  1G8X A;  3LLK A;  4XEK A;  3EGX A;  5T1D B;  2JPU A;  2GWW A;  5JP7 A;  3ABM C;  1F1M A;  1VMA A;  3N0T A;  4RDA A;  2MYS A;  4MQ9 F;  4C3B A;  2XSE A;  2Y3B A;  4PK4 A;  3WOD F;  4EUK B;  2GAQ A;  4O6M A;  1VTM P;  4LLE A;  4NC3 A;  3OWT A;  4MTG A;  2J0X A;  1N1C A;  2EIL C;  4O7G A;  3U8V A;  4N06 A;  2R02 A;  1PD0 A;  1JMW A;  3EQL F;  3BEH A;  4JKV A;  3ATP A;  4MND A;  2M4E A;  2RD9 A;  2VCA A;  4BEM J;  1Q0K A;  3CEX A;  1H6G A;  2Q4F A;  1AEP A;  1O5H A;  3LAY A;  5E2Q A;  3DMD A;  2X51 A;  2WVQ A;  1M57 C;  5A6B A;  2XLW A;  3FXH A;  4PJL A;  4KC9 A;  3EH2 A;  2D5R B;  2OJQ A;  2Q9A A;  2NG1 A;  2Q7R A;  3PMR A;  3TK0 A;  2YRF A;  2A69 F;  5DQT A;  1NBB A;  2YQY A;  2PBE A;  4OIP F;  2BC5 A;  2ICW G;  2ZD9 A;  2A1D D;  3SP1 A;  5HV9 A;  5KYX B;  1HY5 A;  3JTL O;  3I5Q A;  2UUH A;  4AX2 A;  5KYN A;  1S05 A;  1AUE A;  2YKZ A;  3DM5 A;  1WAS A;  4JJG A;  1YLM A;  2R7O A;  2WVO A;  1VLS A;  3AG1 C;  3ITF A;  5E3A A;  4GEH A;  1T6U A;  2I15 A;  3LES A;  1OCR C;  4C7O B;  1ST6 A;  2P7V A;  4UDV A; 
#chains in the Genus database with same CATH homology
 2AU5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...