2AU5A

Structure of a conserved domain from locus ef2947 from enterococcus faecalis v583
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
133
structure length
129
Chain Sequence
AMLILSPNFEYEEITRSFLSNMLAFTRGHFTGDISHFSPIVLAEMEKDPNWLEEAAGGMQGVIVQSLLEDENFSSVEQLKGELARLIRLYFALAKDNLTENQESLYVDLFDKFTFLLLCSDEFIMYLDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords conserved domain protein
publication title Structure of a conserved domain from locus EF2947 from Enterococcus faecalis V583
rcsb
source organism Enterococcus faecalis
total genus 44
structure length 129
sequence length 133
ec nomenclature
pdb deposition date 2005-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11472 DUF3206 Protein of unknown function (DUF3206)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.590 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) EF2947-like 2au5A00
2AU5A
chains in the Genus database with same CATH superfamily
1MMAA 2DYSC 3KPHA 1G4US 5A6JA 3SXMA 3DAGA 2Y39A 3QZCA 3L1MA 3ZIBA 1Q0KA 1D1CA 2DGJA 2HFIA 2P61A 4PJLA 1SR2A 3M79A 5L0GA 4D4NA 1RKEB 4F4BA 4BJ1A 3O39A 2JPUA 1TFKB 2WZFA 4O6MA 3NG1A 2R7RA 5HSWA 1VLTA 4PFOA 3W8HA 3RQEA 1Y4CA 2XS8A 4QDLA 1Q0MA 4IB4A 4XQ1A 3SP1A 4BJ5A 1WASA 2YL7A 2NSGA 3NYMA 4XPYA 1U89A 2R03A 1FFHA 1DOVA 1TQGA 1RJ9B 2AVKA 2YWAA 3JSZA 3DAFA 3DD7A 3GM2A 1R5ID 2Q00A 3LLKA 4U5CE 2IXMA 3F46A 3W2WA 3HNKA 3AQBA 3EQLF 3KKBA 3MYIA 3RF3A 1G4WR 2F22A 1YYXA 1LKXA 2HSBA 1H9GA 2OOCA 3ITFA 4N6HA 5FCLA 1T5OA 5K0IA 3DKAA 3T6BA 1C17M 3PHF2 2ZXPA 2Y69C 4MVQA 2EINC 3DWWA 3ZSUA 2CNWD 2Q4FA 3DM9B 3QW1A 4MTFA 2XS1A 3ABMC 3KH2A 5D91A 3JT1A 3ABLC 4XPWA 1ZZPA 2J9BA 3JCUQ 2WZGA 3K6BA 5E33A 4JCHA 4O6YA 2LFDA 3LEVA 4LDKA 4AX2A 4BJ6C 1XZPA 4EHPA 4EIYA 3KL4A 2AP3A 1LE4A 3GWLA 1YZCA 3N0TA 1V55C 3C18A 2L6FA 1FFTC 3H2VA 5F28E 2J7PA 1O3UA 4BEMJ 4JTCB 1HE9A 4A2NB 1UG7A 2W9YA 1BDJB 5JT4A 2YL1A 2Q3TA 4N6CA 1M56C 4W8PA 3GODA 4LDRA 5B3IA 4YT4A 4CBEA 2UUHA 2AWYA 4P9FA 4Z9IA 1G5ZA 1OCCC 4LACB 2IXOA 3FMSA 3FXHA 4LERA 4W8KA 1E85A 5JRAA 1VTMP 3X2QC 3ZG1A 2OCCC 1JPJA 3JZ0A 4CJGA 4M63A 3DMDA 4XLPF 2HZ8A 1QSPA 4U5EE 1WTYA 3NYLA 2L6GA 2Q7RA 1J8YF 3IPMO 2YLIA 1L7CA 2L9JA 4WGYA 2ASRA 2P6VA 1J8MF 3A11A 3RVZA 2A69F 1GQAA 4IWBA 3BEHA 1Z5ZA 3C63A 4ER9A 1ST6A 3OEOA 1BR1A 4JRZA 3QTHA 4KI2A 1I4YA 2ZXOA 3DM5A 2KJGA 4E0HA 2DYRC 1ZVZA 4H4KC 3IQCA 5A6BA 2H7VC 5TJ5E 2IBFA 2JX0A 4MW8A 2I8BA 1RCPA 2HUJA 2YZSA 1QLEC 1GGQA 3SXKA 3U9MA 4DVYP 1KTMA 1HW1A 2R9RB 5AGFA 1MMDA 3UGOA 5L0JA 1ZU4A 1YJGA 1Q0DA 3G4XA 5F5HA 1Z3IX 2OEVA 2XL6A 1TR2A 3K66A 1ORYA 3FOPA 3K1IA 1JAFA 4MVOA 4OIRF 4CJOA 5JLIA 2HS5A 4XEVA 4C3EA 2NSFA 2W4BA 2WVQA 3EHNA 1MNEA 2A6HF 2GFHA 1OW8A 2EPOA 5E3AA 3ZQVA 5A69A 2V3CC 2XLDA 1OW6A 3O55A 2ZXRA 1LM3B 1LVKA 2QLAA 4XWJA 2R7UA 4FAPB 2YQYA 4PJMA 2LQGA 2M64A 2BE5F 2VB6A 3C8GD 4AE4A 3QVYA 5B1AC 4DBQA 1YAUO 3NMIA 3JRTA 1OXKA 3ZC4A 2I15A 1O87A 1FMWA 4J30B 2E87A 3C8ZA 3DZAA 3UNGC 3NDBB 4PJJA 4G7HF 2P0NA 2CYDA 2OEXA 2EILC 5CI9A 4AE4B 1LPEA 3RQGA 4BEJA 4E7SA 1HY5A 1ZYRF 3AG4C 2D4UA 2L6HA 3EJNA 1H6GA 1TWHA 1ZW3A 4GYTA 4NTBA 2Q9AA 4DVZA 2GWWA 3EPVA 1NSGB 5JS5A 4C7OA 2ZPAA 2OU6A 4I3MA 3PMRA 2A0UA 5D92A 3VM6A 2FAPB 2J46A 1FTSA 4JVSA 2DB4A 5COGA 1LS1A 3L34A 2KK1A 1VYIA 1K04A 3HKKA 2R7VA 1NG1A 3GM1A 5BQIA 3BRJA 4IRUA 4MQ9F 4CS8A 5KYWB 4QI0A 3KMIA 1Q0GA 5BQHA 1RKEA 1XZQA 3MFNA 2R7QA 256BA 2PX0A 3AQCA 1OCOC 1M2VB 3C8GB 2J9WA 5JSLA 2ZXWC 2NUTA 3W2VA 5T3WA 2A0BA 3L8IA 4C3BA 3GEHA 4DRJB 1ZHXA 2CDQA 3NMKA 4MVUA 4PK4A 2KW3C 2B0JA 5E3CA 4AL1A 1RJ9A 4CDVA 1VK5A 1JPNA 3IHUA 3VAYA 4EKWA 4PACA 5T3TA 1D1AA 1Y6DA 1AVOB 2WL8A 4EBJA 1PCXA 4MVRA 3MYFA 5L3QA 1ZU5A 2NUTB 4YWQA 1AUEA 2Q9CA 2MWQA 2KSFA 4P9TA 2OQMA 5EK0A 3UR3C 4DOZA 2J45A 3GEIA 1EI7A 4N06A 4CDYA 1M6TA 3J06A 4Q4ZF 1RKCA 2R7OA 4CSAC 5F5FA 3SZRA 1NLXA 2R02A 2YHSA 4PJNA 1A7EA 3PDMP 1HMOA 1LIHA 3MBGA 2NG1A 3TD7A 4Q7CA 1VYKA 3EGDB 4MVMA 3NKDA 1R4TA 4NTAA 5B1BC 1SMYF 1T6IA 2CW0F 2WVNA 4JW1A 3B9QA 3CZ6A 3OA1A 2W45A 4DRIB 2XL8A 3LNMB 2RSEB 4YT8A 3G50A 4O79A 2YL3A 1UFBA 3HTKC 1PV3A 3JYYA 4MS2A 1E84A 4AL0A 4BJ5C 1BR2A 2J0WA 4E17A 3ECSA 1ORSC 1M57C 2XSEA 4N4WA 1GM5A 2YEVA 4NY3A 4JIOA 4NTFA 4U5BE 4NC3A 3ZQYA 5CI8A 3EFOA 2R25A 1NU7D 1JR8A 3JYHA 4YL3A 1GS9A 2CGEA 3MX3A 2XRHA 4U5HA 2X0CA 3U3BA 2Z15A 4JURI 2MHRA 2WVOA 2G3VA 5KYYB 2G3KA 2CNWA 2Y3HA 4P6IC 2VASA 1OKKD 1WATA 2NUPB 1YVIA 3EFOB 1S05A 3RVYA 3FDQA 1NZEA 5DVWA 2GAQA 1CPRA 4MNDA 4IGGA 3RW0A 2PFDA 3V5YA 3EGXB 3O6XA 3ATPA 4U5GA 2LD6A 2C03A 4U9DA 4XEFA 3V5ZA 3V5XA 3UMHA 2PBEA 2DI3A 3E70C 3Q7GA 3U5SA 3B0PA 2PP4A 2CCYA 3LLIA 4DRHB 3S27A 3HLZA 4ULVA 1XWJA 4MVSA 4CIPA 1U0BB 4WJ0A 1IZMA 2OG2A 3M4CA 1KNYA 3A9CA 4BPMA 3EZIA 2IXPA 1CGME 1YARO 2LIGA 3U2LA 2LSEA 1U6HA 3RKOF 4JTAB 1AEPA 5DLJA 5EGYA 3NMJA 4JC7A 5L0IA 3TOLA 2OKUA 1VOMA 2EIMC 1LS4A 2Y3BA 4DJ9A 3GWNA 1BR4A 4XTKA 2KYHA 1A7DA 1RXQA 2G62A 3ZTZA 1A7VA 3N2ZB 3W8IA 5JVEA 1OCRC 1QVXA 1FMVA 5HV9A 1C02A 2QY9A 1QZXA 3L0IA 4JKVA 2YLDA 3WAQA 3K1HA 5KYUB 3CAXA 1OR3A 3IQ5A 1T9KA 3Q7LA 3RQFA 4OIOF 3I5QA 3R2PA 4UDVA 2HJ3A 3AG3C 2XLHA 4D4XA 3AG1C 3JSEO 4J32B 1W2WA 3S28A 4G7OF 1I5NA 1YDIA 4KNWA 4J7YA 5A6AA 3V7OA 3NKEA 4FWVA 3B0VC 1OXBA 1HMDA 5A6KA 4OIPF 3S90A 1EQ1A 3HNIA 2R05A 3B71A 5DS6A 3IQ6A 3F47A 2KGOA 4CIHA 4EBKA 4E18A 2XLEA 3SNHA 1H7IA 3DI5A 2KC3A 3AOUA 2WB7A 5BUOA 1TWAA 5L3VA 1BBHA 5GPGB 3K1IC 4JJFA 3LS0A 2ETSA 5KYNA 4JCZA 2RD9A 2PX3A 4ONSA 4WGZA 5KYWA 3EHMA 4RDAA 2A68F 3NYJA 1WWPA 3KYJA 4JE9A 2P1AA 1M2VA 3C8GA 2EIJC 1FNTc 1EKYA 3EG9A 1PD0A 3JTLO 1K05A 4FX5A 2P7VA 4NQFA 2KQ9A 2QE9A 3SXYA 2IYLD 3HJCA 3JRMO 3T4RA 4YT5A 2HV7A 3U8PA 4MVZA 5DQTA 3WODF 3ASNC 3LESA 2LK4A 3QVZA 2Q9BA 1SF8A 2M4EA 3EG9B 5AC5A 2PF4E 3AGUA 2TMVP 2ZD9A 4CX9A 2HJMA 1VB5A 2AU5A 2NPUA 3ZTMA 3UMKA 2GA0A 1OQCA 3E9VA 4KBLA 4CS7A 1D0XA 1V54C 3AGTA 4OINF 1ZHZA 2D5RB 2R7XA 3H65A 3SXZA 5IY5C 2JD3A 2XLMA 3C7JA 1VLSA 4EBBA 3EGDA 3T6GB 4ANJA 3U3FA 4BG0A 4J7TA 2A1DD 4CS8C 3LEOA 3GM3A 4YT2A 2GDCA 4RD9A 1T6QA 3LUTB 2IOQA 4I1MA 4HFKB 4MTGA 4OIQF 3US6A 1YYJA 2LP4A 1ZW2A 4ULWA 4WABA 4YL1A 1TFOB 2EIKC 3CSKA 1Q0FA 1BZ4A 2OJQA 3N24A 1NBBA 3IEEA 1OW7A 2LCHA 3ZDLA 2VCAA 4GQHA 3FHDA 4JEBA 2FGYA 1V4AA 4KC9A 3Q6NA 4O6NA 4EUKB 5AC4A 3I4UA 1JRAA 4JJGA 3DE9A 1ZHTA 2XM4A 1E86A 3VF0A 3TULA 3S0XA 3M4BA 4G0HA 5KYYA 3UGPA 1WN0A 5FZTA 2YL0A 4BJ6A 3TK0A 3DE8A 2NUPA 5B3SC 3U2MA 3DJUB 4I1OB 2YLGA 3ABKC 3HNJA 1D0ZA 3T9OA 1FR0A 4GEHA 4R32A 1ZHYA 2R7SA 3EH2A 2J7PD 1QPUA 3EGXA 4X0RA 4YK5A 4U5FE 4K7BA 3GEEA 3M1CB 2ICWG 3T6JA 1TWCA 1WGWA 2VCCA 2X51A 2HMZA 3GORA 4B6IA 1YZAA 4XPXA 3ZWIA 4Q5SF 1DOWA 1SZIA 3UMIA 1A0BA 2LFFA 1MMGA 4ZLCA 4U5DE 1YLMA 2FFHA 3S9OA 1T01A 3QW0A 1G8XA 2VC9A 4JTDB 3EH1A 3EZHA 1IW7F 3VRCA 2PNOA 3DJNB 3TQOA 1TWGA 1APCA 3ASOC 3G4ZA 2O9XA 5JUAA 3S29A 1OKKA 4AK9A 5L0FA 2L7AA 3FOOA 1CGOA 2QNLA 3U9JA 1SYQA 3RFYA 4XLNF 4NCQA 1NFOA 2EPLX 3LJBA 3CQZA 1JMWA 3TJ5A 1JOGA 2J8WA 3CEXA 2XL4A 5A6BD 2XM0A 1F1MA 4U9EA 5KYUA 2H7OA 2XLWA 2VH3A 5EHHA 4PFPA 3WG7C 1NU9C 2EPKX 4O7GA 1I4ZA 5JP7A 2XLOA 3M15A 3Q6MA 1RMVA 4LLCA 4G78A 4OD4A 5DQZA 3K7DA 1T6UA 2QTVA 1K40A 3LAYA 3B29A 3MLGA 4MW3A 2R7WA 1LI7A 2VCBA 1ZHWA 2B0HA 2V26A 5BQGA 3S84A 4I44A 1TKNA 4H54A 5KYXA 1B68A 1E2XA 2A6EF 2QUPA 2HKVA 4JZAA 3GANA 4FESA 2WZLA 2OJED 5COMA 3X1OA 5CIVA 2H7BA 3HNLA 3DXJF 2XLVA 4Z9JA 3O10A 4JEAA 4E0IA 4LDQA 2HMQA 1OR2A 4DBRA 5E2QA 1ORJA 1D0YA 1MQVA 4QI2A 3C62A 3POVA 5L0DA 4YL0A 3FVYA 1M2OA 5DS4A 3KYIA 1PD1A 3I5PA 4HEAJ 1L3PA 2YKZA 5COFA 1HE1A 5KYXB 1QKRA 1HW2A 2W4MA 4CDAA 1Z63A 4K0DA 2C04A 3K33A 3TOMA 4IJJA 1D1BA 1LI5A 2HSQA 2R7TA 3LS1A 4BJTA 5DS5A 5L0CA 2J0XA 3B0UX 4XEKA 1QQ3A 3VYWA 2Y3DA 4E7ZA 2BC5A 1VMAA 1YA7O 4DXWA 4EWCA 1S7ZA 1CGNA 1OCZC 3U0CA 4OD5A 1EA8A 1KU2A 3RH3A 2HV6A 1Z7Qc 3W4YA 4K1OA 1MMNA 1V74B 3FAPB 3U8VA 1MNDA 2EPNA 4HFFB 4L6RA 4CS9A 2AWCA 2KNHA 3R7CA 4G7ZF 2L81A 3NRHA 4KNVA 3H2UA 3PCVA 4HE8D 4PR9A 3FAJA 4ZLDA 4C3DA 1LE2A 3OWTA 1C03A 2YVKA 4YN0B 3WHNA 2XXAA 1E83A 1O5HA 4RBNA 3L8JA 2MYSA 3QMKA 3TJ6A 2UUIA 2IM8A 4IAOA 4LLEA 1H9TA 3AJMA 3RIPA 2Y3GA 2YRFA 4IARA 3ZVRA 5L0HA 1NFNA 2IXNA 1FAPB 1Z23A 2J9UA 3AG2C 4Z9HA 2XXAB 5T1DB 1N1CA 3SEOA 1YA9A 3LNRA 2J9VA 1CPQA 1Z6AA 2EPMX 3RYLA 4MTOA 4YJWA 4A4AA 4CS9C 1A41A 4C7OB 4IAQA 4CSAA 2H8AA 1WOLA 2BL2A 3SYNA 3IQTA
chains in the Genus database with same CATH topology
2AU5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AU5 A; 
#chains in the Genus database with same CATH topology
 1MMA A;  2DYS C;  3KPH A;  1G4U S;  5A6J A;  3SXM A;  3DAG A;  2Y39 A;  3QZC A;  3L1M A;  3ZIB A;  1Q0K A;  1D1C A;  2DGJ A;  2HFI A;  2P61 A;  4PJL A;  1SR2 A;  3M79 A;  5L0G A;  4D4N A;  1RKE B;  4F4B A;  4BJ1 A;  3O39 A;  2JPU A;  1TFK B;  2WZF A;  4O6M A;  3NG1 A;  2R7R A;  5HSW A;  1VLT A;  4PFO A;  3W8H A;  3RQE A;  1Y4C A;  2XS8 A;  4QDL A;  1Q0M A;  4IB4 A;  4XQ1 A;  3SP1 A;  4BJ5 A;  1WAS A;  2YL7 A;  2NSG A;  3NYM A;  4XPY A;  1U89 A;  2R03 A;  1FFH A;  1DOV A;  1TQG A;  1RJ9 B;  2AVK A;  2YWA A;  3JSZ A;  3DAF A;  3DD7 A;  3GM2 A;  1R5I D;  2Q00 A;  3LLK A;  4U5C E;  2IXM A;  3F46 A;  3W2W A;  3HNK A;  3AQB A;  3EQL F;  3KKB A;  3MYI A;  3RF3 A;  1G4W R;  2F22 A;  1YYX A;  1LKX A;  2HSB A;  1H9G A;  2OOC A;  3ITF A;  4N6H A;  5FCL A;  1T5O A;  5K0I A;  3DKA A;  3T6B A;  1C17 M;  3PHF 2;  2ZXP A;  2Y69 C;  4MVQ A;  2EIN C;  3DWW A;  3ZSU A;  2CNW D;  2Q4F A;  3DM9 B;  3QW1 A;  4MTF A;  2XS1 A;  3ABM C;  3KH2 A;  5D91 A;  3JT1 A;  3ABL C;  4XPW A;  1ZZP A;  2J9B A;  3JCU Q;  2WZG A;  3K6B A;  5E33 A;  4JCH A;  4O6Y A;  2LFD A;  3LEV A;  4LDK A;  4AX2 A;  4BJ6 C;  1XZP A;  4EHP A;  4EIY A;  3KL4 A;  2AP3 A;  1LE4 A;  3GWL A;  1YZC A;  3N0T A;  1V55 C;  3C18 A;  2L6F A;  1FFT C;  3H2V A;  5F28 E;  2J7P A;  1O3U A;  4BEM J;  4JTC B;  1HE9 A;  4A2N B;  1UG7 A;  2W9Y A;  1BDJ B;  5JT4 A;  2YL1 A;  2Q3T A;  4N6C A;  1M56 C;  4W8P A;  3GOD A;  4LDR A;  5B3I A;  4YT4 A;  4CBE A;  2UUH A;  2AWY A;  4P9F A;  4Z9I A;  1G5Z A;  1OCC C;  4LAC B;  2IXO A;  3FMS A;  3FXH A;  4LER A;  4W8K A;  1E85 A;  5JRA A;  1VTM P;  3X2Q C;  3ZG1 A;  2OCC C;  1JPJ A;  3JZ0 A;  4CJG A;  4M63 A;  3DMD A;  4XLP F;  2HZ8 A;  1QSP A;  4U5E E;  1WTY A;  3NYL A;  2L6G A;  2Q7R A;  1J8Y F;  3IPM O;  2YLI A;  1L7C A;  2L9J A;  4WGY A;  2ASR A;  2P6V A;  1J8M F;  3A11 A;  3RVZ A;  2A69 F;  1GQA A;  4IWB A;  3BEH A;  1Z5Z A;  3C63 A;  4ER9 A;  1ST6 A;  3OEO A;  1BR1 A;  4JRZ A;  3QTH A;  4KI2 A;  1I4Y A;  2ZXO A;  3DM5 A;  2KJG A;  4E0H A;  2DYR C;  1ZVZ A;  4H4K C;  3IQC A;  5A6B A;  2H7V C;  5TJ5 E;  2IBF A;  2JX0 A;  4MW8 A;  2I8B A;  1RCP A;  2HUJ A;  2YZS A;  1QLE C;  1GGQ A;  3SXK A;  3U9M A;  4DVY P;  1KTM A;  1HW1 A;  2R9R B;  5AGF A;  1MMD A;  3UGO A;  5L0J A;  1ZU4 A;  1YJG A;  1Q0D A;  3G4X A;  5F5H A;  1Z3I X;  2OEV A;  2XL6 A;  1TR2 A;  3K66 A;  1ORY A;  3FOP A;  3K1I A;  1JAF A;  4MVO A;  4OIR F;  4CJO A;  5JLI A;  2HS5 A;  4XEV A;  4C3E A;  2NSF A;  2W4B A;  2WVQ A;  3EHN A;  1MNE A;  2A6H F;  2GFH A;  1OW8 A;  2EPO A;  5E3A A;  3ZQV A;  5A69 A;  2V3C C;  2XLD A;  1OW6 A;  3O55 A;  2ZXR A;  1LM3 B;  1LVK A;  2QLA A;  4XWJ A;  2R7U A;  4FAP B;  2YQY A;  4PJM A;  2LQG A;  2M64 A;  2BE5 F;  2VB6 A;  3C8G D;  4AE4 A;  3QVY A;  5B1A C;  4DBQ A;  1YAU O;  3NMI A;  3JRT A;  1OXK A;  3ZC4 A;  2I15 A;  1O87 A;  1FMW A;  4J30 B;  2E87 A;  3C8Z A;  3DZA A;  3UNG C;  3NDB B;  4PJJ A;  4G7H F;  2P0N A;  2CYD A;  2OEX A;  2EIL C;  5CI9 A;  4AE4 B;  1LPE A;  3RQG A;  4BEJ A;  4E7S A;  1HY5 A;  1ZYR F;  3AG4 C;  2D4U A;  2L6H A;  3EJN A;  1H6G A;  1TWH A;  1ZW3 A;  4GYT A;  4NTB A;  2Q9A A;  4DVZ A;  2GWW A;  3EPV A;  1NSG B;  5JS5 A;  4C7O A;  2ZPA A;  2OU6 A;  4I3M A;  3PMR A;  2A0U A;  5D92 A;  3VM6 A;  2FAP B;  2J46 A;  1FTS A;  4JVS A;  2DB4 A;  5COG A;  1LS1 A;  3L34 A;  2KK1 A;  1VYI A;  1K04 A;  3HKK A;  2R7V A;  1NG1 A;  3GM1 A;  5BQI A;  3BRJ A;  4IRU A;  4MQ9 F;  4CS8 A;  5KYW B;  4QI0 A;  3KMI A;  1Q0G A;  5BQH A;  1RKE A;  1XZQ A;  3MFN A;  2R7Q A;  256B A;  2PX0 A;  3AQC A;  1OCO C;  1M2V B;  3C8G B;  2J9W A;  5JSL A;  2ZXW C;  2NUT A;  3W2V A;  5T3W A;  2A0B A;  3L8I A;  4C3B A;  3GEH A;  4DRJ B;  1ZHX A;  2CDQ A;  3NMK A;  4MVU A;  4PK4 A;  2KW3 C;  2B0J A;  5E3C A;  4AL1 A;  1RJ9 A;  4CDV A;  1VK5 A;  1JPN A;  3IHU A;  3VAY A;  4EKW A;  4PAC A;  5T3T A;  1D1A A;  1Y6D A;  1AVO B;  2WL8 A;  4EBJ A;  1PCX A;  4MVR A;  3MYF A;  5L3Q A;  1ZU5 A;  2NUT B;  4YWQ A;  1AUE A;  2Q9C A;  2MWQ A;  2KSF A;  4P9T A;  2OQM A;  5EK0 A;  3UR3 C;  4DOZ A;  2J45 A;  3GEI A;  1EI7 A;  4N06 A;  4CDY A;  1M6T A;  3J06 A;  4Q4Z F;  1RKC A;  2R7O A;  4CSA C;  5F5F A;  3SZR A;  1NLX A;  2R02 A;  2YHS A;  4PJN A;  1A7E A;  3PDM P;  1HMO A;  1LIH A;  3MBG A;  2NG1 A;  3TD7 A;  4Q7C A;  1VYK A;  3EGD B;  4MVM A;  3NKD A;  1R4T A;  4NTA A;  5B1B C;  1SMY F;  1T6I A;  2CW0 F;  2WVN A;  4JW1 A;  3B9Q A;  3CZ6 A;  3OA1 A;  2W45 A;  4DRI B;  2XL8 A;  3LNM B;  2RSE B;  4YT8 A;  3G50 A;  4O79 A;  2YL3 A;  1UFB A;  3HTK C;  1PV3 A;  3JYY A;  4MS2 A;  1E84 A;  4AL0 A;  4BJ5 C;  1BR2 A;  2J0W A;  4E17 A;  3ECS A;  1ORS C;  1M57 C;  2XSE A;  4N4W A;  1GM5 A;  2YEV A;  4NY3 A;  4JIO A;  4NTF A;  4U5B E;  4NC3 A;  3ZQY A;  5CI8 A;  3EFO A;  2R25 A;  1NU7 D;  1JR8 A;  3JYH A;  4YL3 A;  1GS9 A;  2CGE A;  3MX3 A;  2XRH A;  4U5H A;  2X0C A;  3U3B A;  2Z15 A;  4JUR I;  2MHR A;  2WVO A;  2G3V A;  5KYY B;  2G3K A;  2CNW A;  2Y3H A;  4P6I C;  2VAS A;  1OKK D;  1WAT A;  2NUP B;  1YVI A;  3EFO B;  1S05 A;  3RVY A;  3FDQ A;  1NZE A;  5DVW A;  2GAQ A;  1CPR A;  4MND A;  4IGG A;  3RW0 A;  2PFD A;  3V5Y A;  3EGX B;  3O6X A;  3ATP A;  4U5G A;  2LD6 A;  2C03 A;  4U9D A;  4XEF A;  3V5Z A;  3V5X A;  3UMH A;  2PBE A;  2DI3 A;  3E70 C;  3Q7G A;  3U5S A;  3B0P A;  2PP4 A;  2CCY A;  3LLI A;  4DRH B;  3S27 A;  3HLZ A;  4ULV A;  1XWJ A;  4MVS A;  4CIP A;  1U0B B;  4WJ0 A;  1IZM A;  2OG2 A;  3M4C A;  1KNY A;  3A9C A;  4BPM A;  3EZI A;  2IXP A;  1CGM E;  1YAR O;  2LIG A;  3U2L A;  2LSE A;  1U6H A;  3RKO F;  4JTA B;  1AEP A;  5DLJ A;  5EGY A;  3NMJ A;  4JC7 A;  5L0I A;  3TOL A;  2OKU A;  1VOM A;  2EIM C;  1LS4 A;  2Y3B A;  4DJ9 A;  3GWN A;  1BR4 A;  4XTK A;  2KYH A;  1A7D A;  1RXQ A;  2G62 A;  3ZTZ A;  1A7V A;  3N2Z B;  3W8I A;  5JVE A;  1OCR C;  1QVX A;  1FMV A;  5HV9 A;  1C02 A;  2QY9 A;  1QZX A;  3L0I A;  4JKV A;  2YLD A;  3WAQ A;  3K1H A;  5KYU B;  3CAX A;  1OR3 A;  3IQ5 A;  1T9K A;  3Q7L A;  3RQF A;  4OIO F;  3I5Q A;  3R2P A;  4UDV A;  2HJ3 A;  3AG3 C;  2XLH A;  4D4X A;  3AG1 C;  3JSE O;  4J32 B;  1W2W A;  3S28 A;  4G7O F;  1I5N A;  1YDI A;  4KNW A;  4J7Y A;  5A6A A;  3V7O A;  3NKE A;  4FWV A;  3B0V C;  1OXB A;  1HMD A;  5A6K A;  4OIP F;  3S90 A;  1EQ1 A;  3HNI A;  2R05 A;  3B71 A;  5DS6 A;  3IQ6 A;  3F47 A;  2KGO A;  4CIH A;  4EBK A;  4E18 A;  2XLE A;  3SNH A;  1H7I A;  3DI5 A;  2KC3 A;  3AOU A;  2WB7 A;  5BUO A;  1TWA A;  5L3V A;  1BBH A;  5GPG B;  3K1I C;  4JJF A;  3LS0 A;  2ETS A;  5KYN A;  4JCZ A;  2RD9 A;  2PX3 A;  4ONS A;  4WGZ A;  5KYW A;  3EHM A;  4RDA A;  2A68 F;  3NYJ A;  1WWP A;  3KYJ A;  4JE9 A;  2P1A A;  1M2V A;  3C8G A;  2EIJ C;  1FNT c;  1EKY A;  3EG9 A;  1PD0 A;  3JTL O;  1K05 A;  4FX5 A;  2P7V A;  4NQF A;  2KQ9 A;  2QE9 A;  3SXY A;  2IYL D;  3HJC A;  3JRM O;  3T4R A;  4YT5 A;  2HV7 A;  3U8P A;  4MVZ A;  5DQT A;  3WOD F;  3ASN C;  3LES A;  2LK4 A;  3QVZ A;  2Q9B A;  1SF8 A;  2M4E A;  3EG9 B;  5AC5 A;  2PF4 E;  3AGU A;  2TMV P;  2ZD9 A;  4CX9 A;  2HJM A;  1VB5 A;  2AU5 A;  2NPU A;  3ZTM A;  3UMK A;  2GA0 A;  1OQC A;  3E9V A;  4KBL A;  4CS7 A;  1D0X A;  1V54 C;  3AGT A;  4OIN F;  1ZHZ A;  2D5R B;  2R7X A;  3H65 A;  3SXZ A;  5IY5 C;  2JD3 A;  2XLM A;  3C7J A;  1VLS A;  4EBB A;  3EGD A;  3T6G B;  4ANJ A;  3U3F A;  4BG0 A;  4J7T A;  2A1D D;  4CS8 C;  3LEO A;  3GM3 A;  4YT2 A;  2GDC A;  4RD9 A;  1T6Q A;  3LUT B;  2IOQ A;  4I1M A;  4HFK B;  4MTG A;  4OIQ F;  3US6 A;  1YYJ A;  2LP4 A;  1ZW2 A;  4ULW A;  4WAB A;  4YL1 A;  1TFO B;  2EIK C;  3CSK A;  1Q0F A;  1BZ4 A;  2OJQ A;  3N24 A;  1NBB A;  3IEE A;  1OW7 A;  2LCH A;  3ZDL A;  2VCA A;  4GQH A;  3FHD A;  4JEB A;  2FGY A;  1V4A A;  4KC9 A;  3Q6N A;  4O6N A;  4EUK B;  5AC4 A;  3I4U A;  1JRA A;  4JJG A;  3DE9 A;  1ZHT A;  2XM4 A;  1E86 A;  3VF0 A;  3TUL A;  3S0X A;  3M4B A;  4G0H A;  5KYY A;  3UGP A;  1WN0 A;  5FZT A;  2YL0 A;  4BJ6 A;  3TK0 A;  3DE8 A;  2NUP A;  5B3S C;  3U2M A;  3DJU B;  4I1O B;  2YLG A;  3ABK C;  3HNJ A;  1D0Z A;  3T9O A;  1FR0 A;  4GEH A;  4R32 A;  1ZHY A;  2R7S A;  3EH2 A;  2J7P D;  1QPU A;  3EGX A;  4X0R A;  4YK5 A;  4U5F E;  4K7B A;  3GEE A;  3M1C B;  2ICW G;  3T6J A;  1TWC A;  1WGW A;  2VCC A;  2X51 A;  2HMZ A;  3GOR A;  4B6I A;  1YZA A;  4XPX A;  3ZWI A;  4Q5S F;  1DOW A;  1SZI A;  3UMI A;  1A0B A;  2LFF A;  1MMG A;  4ZLC A;  4U5D E;  1YLM A;  2FFH A;  3S9O A;  1T01 A;  3QW0 A;  1G8X A;  2VC9 A;  4JTD B;  3EH1 A;  3EZH A;  1IW7 F;  3VRC A;  2PNO A;  3DJN B;  3TQO A;  1TWG A;  1APC A;  3ASO C;  3G4Z A;  2O9X A;  5JUA A;  3S29 A;  1OKK A;  4AK9 A;  5L0F A;  2L7A A;  3FOO A;  1CGO A;  2QNL A;  3U9J A;  1SYQ A;  3RFY A;  4XLN F;  4NCQ A;  1NFO A;  2EPL X;  3LJB A;  3CQZ A;  1JMW A;  3TJ5 A;  1JOG A;  2J8W A;  3CEX A;  2XL4 A;  5A6B D;  2XM0 A;  1F1M A;  4U9E A;  5KYU A;  2H7O A;  2XLW A;  2VH3 A;  5EHH A;  4PFP A;  3WG7 C;  1NU9 C;  2EPK X;  4O7G A;  1I4Z A;  5JP7 A;  2XLO A;  3M15 A;  3Q6M A;  1RMV A;  4LLC A;  4G78 A;  4OD4 A;  5DQZ A;  3K7D A;  1T6U A;  2QTV A;  1K40 A;  3LAY A;  3B29 A;  3MLG A;  4MW3 A;  2R7W A;  1LI7 A;  2VCB A;  1ZHW A;  2B0H A;  2V26 A;  5BQG A;  3S84 A;  4I44 A;  1TKN A;  4H54 A;  5KYX A;  1B68 A;  1E2X A;  2A6E F;  2QUP A;  2HKV A;  4JZA A;  3GAN A;  4FES A;  2WZL A;  2OJE D;  5COM A;  3X1O A;  5CIV A;  2H7B A;  3HNL A;  3DXJ F;  2XLV A;  4Z9J A;  3O10 A;  4JEA A;  4E0I A;  4LDQ A;  2HMQ A;  1OR2 A;  4DBR A;  5E2Q A;  1ORJ A;  1D0Y A;  1MQV A;  4QI2 A;  3C62 A;  3POV A;  5L0D A;  4YL0 A;  3FVY A;  1M2O A;  5DS4 A;  3KYI A;  1PD1 A;  3I5P A;  4HEA J;  1L3P A;  2YKZ A;  5COF A;  1HE1 A;  5KYX B;  1QKR A;  1HW2 A;  2W4M A;  4CDA A;  1Z63 A;  4K0D A;  2C04 A;  3K33 A;  3TOM A;  4IJJ A;  1D1B A;  1LI5 A;  2HSQ A;  2R7T A;  3LS1 A;  4BJT A;  5DS5 A;  5L0C A;  2J0X A;  3B0U X;  4XEK A;  1QQ3 A;  3VYW A;  2Y3D A;  4E7Z A;  2BC5 A;  1VMA A;  1YA7 O;  4DXW A;  4EWC A;  1S7Z A;  1CGN A;  1OCZ C;  3U0C A;  4OD5 A;  1EA8 A;  1KU2 A;  3RH3 A;  2HV6 A;  1Z7Q c;  3W4Y A;  4K1O A;  1MMN A;  1V74 B;  3FAP B;  3U8V A;  1MND A;  2EPN A;  4HFF B;  4L6R A;  4CS9 A;  2AWC A;  2KNH A;  3R7C A;  4G7Z F;  2L81 A;  3NRH A;  4KNV A;  3H2U A;  3PCV A;  4HE8 D;  4PR9 A;  3FAJ A;  4ZLD A;  4C3D A;  1LE2 A;  3OWT A;  1C03 A;  2YVK A;  4YN0 B;  3WHN A;  2XXA A;  1E83 A;  1O5H A;  4RBN A;  3L8J A;  2MYS A;  3QMK A;  3TJ6 A;  2UUI A;  2IM8 A;  4IAO A;  4LLE A;  1H9T A;  3AJM A;  3RIP A;  2Y3G A;  2YRF A;  4IAR A;  3ZVR A;  5L0H A;  1NFN A;  2IXN A;  1FAP B;  1Z23 A;  2J9U A;  3AG2 C;  4Z9H A;  2XXA B;  5T1D B;  1N1C A;  3SEO A;  1YA9 A;  3LNR A;  2J9V A;  1CPQ A;  1Z6A A;  2EPM X;  3RYL A;  4MTO A;  4YJW A;  4A4A A;  4CS9 C;  1A41 A;  4C7O B;  4IAQ A;  4CSA A;  2H8A A;  1WOL A;  2BL2 A;  3SYN A;  3IQT A; 
#chains in the Genus database with same CATH homology
 2AU5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...