2AU5A

Structure of a conserved domain from locus ef2947 from enterococcus faecalis v583
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
133
structure length
129
Chain Sequence
b'AMLILSPNFEYEEITRSFLSNMLAFTRGHFTGDISHFSPIVLAEMEKDPNWLEEAAGGMQGVIVQSLLEDENFSSVEQLKGELARLIRLYFALAKDNLTENQESLYVDLFDKFTFLLLCSDEFIMYLDS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords conserved domain protein
publication title Structure of a conserved domain from locus EF2947 from Enterococcus faecalis V583
rcsb
source organism Enterococcus faecalis
molecule tags Structural genomics, unknown function
total genus 44
structure length 129
sequence length 133
ec nomenclature
pdb deposition date 2005-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11472 DUF3206 Protein of unknown function (DUF3206)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.590 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) EF2947-like 2au5A00
2AU5A
chains in the Genus database with same CATH superfamily
1EA8A 2OCCC 1Z7Qc 1L3PA 3NYLA 3BRJA 3V5XA 2B0JA 1NU7D 2L6FA 1YVIA 1ZU5A 4OD4A 3FDQA 4A4AA 2YWAA 1NG1A 2J9WA 1TKNA 3TD7A 4YT8A 3KPHA 1MMGA 2JX0A 4AE4A 2P0NA 3FXHA 3SXKA 3QTHA 2KSFA 2EPLX 1PV3A 4C3BA 3K1IA 1E86A 3AJMA 4ZLDA 1GS9A 1MNDA 2HMZA 2J46A 3ABKC 3NMJA 3TJ5A 2V3CC 2DB4A 2R7UA 1V54C 2OJQA 2WB7A 1TWHA 4GYTA 2ZXPA 2R7SA 3U8VA 1W2WA 3AQCA 1E83A 2LIGA 4JVSA 1O5HA 1WWPA 3JSEO 3RFYA 3N24A 2B0HA 2YKZA 1WGWA 2HV6A 1K05A 2G62A 1FFTC 3S29A 4N4WA 5CI9A 3K66A 4OIOF 1JMWA 2CNWD 2Q3TA 2J9UA 4DJ9A 4MVMA 1T6UA 4XWJA 1SZIA 4CS8A 3O6XA 4U5FE 1LS1A 2G3KA 2KW3C 1Q0GA 3W2VA 4I44A 1V55C 1NLXA 3C8ZA 1YA9A 2P61A 1V4AA 1O87A 1D0YA 4RDAA 3ZVRA 3RW0A 1Q0DA 3JRMO 3EG9A 4CJOA 3IQTA 1E85A 2ZXRA 1EQ1A 3CQZA 4OD5A 5L0IA 1I4ZA 3EGXA 3EHNA 5DS6A 4AL1A 2O9XA 5T3WA 1YYXA 4MVOA 5DQTA 4OIPF 5CIVA 3JYHA 2C03A 2KYHA 3QW0A 4E7ZA 2XXAA 1SR2A 3EFOB 1VYIA 3LAYA 2YL7A 3UMHA 2J9VA 1YAUO 5T3TA 4E0HA 2LK4A 2DGJA 5JSLA 2H8AA 1ZHWA 2A1DD 3RVZA 3DI5A 3S28A 3HNIA 4O7GA 4CSAA 2R7QA 2YL1A 1LI5A 3KH2A 5DVWA 2R7TA 1FAPB 1DOWA 4M63A 1CPRA 2A69F 4MTOA 4HE8D 2J7PD 4JC7A 3AG3C 4KNVA 4YT2A 1BR1A 1WTYA 1TR2A 3LEOA 4WJ0A 2DYSC 3FAJA 3IQCA 3HNLA 4CDYA 1E2XA 2WL8A 2ZD9A 2R05A 1K04A 1OR2A 3GM3A 2C04A 1HE1A 3VAYA 4EBBA 2Q9CA 3EHMA 4L6RA 1AEPA 5KYXA 3ABMC 3ATPA 1NFNA 3S9OA 2KC3A 5JS5A 3JT1A 3PDMP 3QVYA 4P9FA 4CIHA 2PP4A 4LERA 4O6YA 2V26A 4XLNF 4N6CA 2FAPB 1GQAA 1OQCA 1YYJA 3K33A 3L1MA 4WABA 3U9MA 1K40A 1C17M 2XS8A 4U5EE 5DLJA 2HMQA 2IXNA 1HMDA 5F28E 2PF4E 2J0XA 3BEHA 3GWNA 1RMVA 1VK5A 3HNJA 4D4NA 3F47A 3M4BA 4QDLA 4HFKB 4BJ6C 1ZHZA 4E17A 1RJ9B 4ZLCA 2MHRA 2GA0A 3FHDA 5DS4A 3C8GB 2PX3A 2CNWA 2I15A 2R03A 3EPVA 2IBFA 5JVEA 3ZC4A 1V74B 3WAQA 5L0DA 1C02A 1Z23A 4NCQA 1QVXA 5AC4A 2F22A 3DD7A 1Z63A 4JKVA 1O3UA 3CZ6A 3NDBB 2EIMC 2OEVA 2W4MA 1I4YA 2P1AA 2YLIA 3MFNA 4NTBA 4PJJA 3VRCA 3ZTMA 3A9CA 4ULVA 3KKBA 5D92A 4C7OA 4BEMJ 2CGEA 3DZAA 4KNWA 1OW7A 4PJMA 5L0FA 2HJMA 4ANJA 2X0CA 4G0HA 1QKRA 1TWGA 4IWBA 5B3SC 3L8JA 3HLZA 4XPYA 3SNHA 3NMKA 3C62A 2XLMA 1KU2A 1LE4A 4A2NB 2J0WA 2PX0A 2YHSA 4LLCA 1SYQA 4U5BE 2WVNA 1OW8A 4K0DA 3TOLA 3S84A 1TFOB 4LDKA 3ZQYA 1CGOA 4WGYA 2EIKC 3U8PA 1FMVA 3MX3A 1R4TA 1Y6DA 4AK9A 2WZLA 3AG1C 1J8YF 4CDAA 4YT4A 2DI3A 2FFHA 3B71A 5KYUB 4ER9A 2AP3A 2J7PA 1C03A 3O10A 4PFPA 4DOZA 1APCA 3I5PA 1LE2A 3RKOF 1JAFA 2QNLA 3DWWA 3IHUA 4R32A 4DBQA 2IXMA 1ZVZA 3Q7LA 3TOMA 5A6BA 3MLGA 4JRZA 2R25A 2R02A 3IQ6A 5COMA 1CPQA 4XPXA 1T9KA 1A41A 1ORSC 4YJWA 1BBHA 3L34A 3RIPA 3RYLA 5E3CA 1G5ZA 2HFIA 1ORJA 4MS2A 2NSGA 1KNYA 2QE9A 4PACA 2VC9A 2YL3A 4G78A 4PJLA 1U6HA 1YA7O 4ONSA 3RQGA 5A69A 3C18A 4PJNA 5DQZA 2LSEA 4YL0A 5JRAA 2XRHA 1M56C 2XLHA 3T6JA 5DS5A 3HTKC 1VYKA 4PK4A 1A7DA 4BJ5C 2CYDA 1YARO 1OXKA 3SP1A 1A7EA 1BR2A 3UGPA 2EINC 1MMNA 4IB4A 1HE9A 3O39A 3PMRA 4IARA 2KJGA 1TWCA 2LFDA 4K1OA 5COFA 2XL8A 3WG7C 4DRHB 4J7TA 2XSEA 3N2ZB 2BE5F 4JW1A 1FMWA 3NKDA 4G7HF 3AOUA 2EPMX 2GWWA 3EJNA 3W4YA 5BQGA 4X0RA 3EH2A 1RCPA 1N1CA 5BQIA 1D0ZA 2R7WA 3EGDB 3VF0A 2LP4A 1BDJB 3RH3A 2Q7RA 2NPUA 2HSQA 1WN0A 3UR3C 2VCBA 3MYIA 1JR8A 5BQHA 1Q0KA 5A6AA 3JTLO 3EFOA 3TULA 1E84A 2WZGA 4FX5A 4PR9A 2XLWA 3LJBA 2JPUA 2M4EA 2A6EF 3F46A 5JP7A 2X51A 3T6GB 4NTAA 3T6BA 3U2MA 4HFFB 3J06A 3WHNA 1ZHTA 2FGYA 3JZ0A 2H7BA 2XL6A 3JSZA 1LKXA 3R2PA 3NKEA 4K7BA 4W8PA 1UG7A 1ST6A 4JURI 4EBKA 5JUAA 1FTSA 1YJGA 2LQGA 4YL1A 3B29A 4BJ1A 2HZ8A 3MYFA 4JEAA 4MTGA 4EKWA 1QLEC 4NQFA 3N0TA 4JCZA 3E70C 3K1HA 2WZFA 1OXBA 2QLAA 3H65A 5L0CA 3RF3A 1T6IA 3T9OA 5AC5A 1RXQA 1T01A 2WVQA 3RQFA 3TK0A 4Q7CA 5K0IA 3KYJA 1OCRC 1YLMA 3OEOA 1VMAA 2GDCA 1T5OA 3JYYA 2E87A 3KMIA 2ETSA 4DBRA 5EK0A 3UMKA 1A7VA 1QPUA 5A6BD 2L7AA 1M2OA 1OW6A 2ZPAA 1TFKB 2NUPB 1VTMP 3QMKA 1VLTA 2LFFA 4B6IA 3EZIA 3EGXB 2XLDA 3SEOA 2J8WA 4J7YA 2BL2A 1LI7A 3MBGA 3HKKA 1T6QA 4U5HA 2A0BA 4XPWA 1RJ9A 4AL0A 2HV7A 3DM9B 3V5ZA 3C8GA 3EQLF 2NG1A 4GEHA 4JTAB 1PD1A 2HSBA 5KYYB 2Q9BA 3DAFA 2NUTB 2XM0A 4CIPA 4BJ6A 3HJCA 3LS0A 4I1MA 2PBEA 3I5QA 4DVYP 5CI8A 1ZU4A 2J45A 1JOGA 5B3IA 2IXPA 2ZXWC 4JCHA 2RD9A 1PCXA 4G7ZF 1S05A 1ZHXA 2W9YA 1A0BA 3DJNB 1ZW3A 2Y3BA 2VCCA 4PFOA 2AVKA 3H2UA 5F5HA 4CJGA 2PFDA 3GWLA 3SXYA 4DRIB 1SF8A 1LPEA 1U89A 1WASA 1XZQA 2VCAA 3FVYA 3NMIA 1IZMA 4LDRA 3SXZA 2Q9AA 4D4XA 3NRHA 4MVUA 2Y3HA 4OIRF 5F5FA 2AWCA 3T4RA 3H2VA 1GGQA 3ZSUA 3KL4A 4MW8A 1NBBA 1KTMA 4CS9C 5KYXB 3TJ6A 3U2LA 2YLDA 3ZQVA 1JPJA 4WGZA 2YVKA 3OWTA 4YK5A 4FAPB 5L3VA 4NTFA 4RD9A 5TJ5E 3U5SA 3JRTA 1OKKA 1LIHA 3K6BA 3LEVA 4P9TA 4IRUA 2EPNA 4J30B 1TQGA 1YZAA 4IGGA 5KYUA 1ZZPA 3UMIA 5B1AC 1UFBA 4IJJA 2EPKX 4CBEA 3U0CA 1IW7F 3X2QC 2Z15A 3LESA 3OA1A 3PCVA 3CSKA 2MWQA 1ZYRF 2DYRC 2ICWG 3B9QA 3C63A 3QZCA 3HNKA 5FCLA 1NSGB 4QI2A 1YZCA 4LACB 3W2WA 2EPOA 1M2VB 4XEFA 1ZHYA 3GORA 3EZHA 4JIOA 2Y39A 3DJUB 4EWCA 2L6GA 3E9VA 1BZ4A 1Y4CA 2HUJA 4CS7A 1RKEB 2R9RB 3ITFA 4I1OB 1VLSA 2GFHA 2YRFA 3M79A 3L8IA 2CCYA 4J32B 3IEEA 2IXOA 1B68A 2KQ9A 2A6HF 3Q6NA 4O79A 1D1AA 2M64A 3TQOA 1ZW2A 1CGNA 4BPMA 3U3BA 2R7RA 4FWVA 2PNOA 2CW0F 1ORYA 1D1CA 1MMDA 3QW1A 4YL3A 4W8KA 4BJ5A 2P7VA 3U9JA 3AQBA 1MNEA 4Q5SF 3B0VC 3C8GD 2OQMA 1SMYF 2GAQA 4G7OF 5E33A 3NYJA 3FOPA 4O6NA 4P6IC 2XLOA 2A68F 1MMAA 3GEIA 3EGDA 4IAQA 5E2QA 2IM8A 3NYMA 5KYWB 1H7IA 1MQVA 1Q0FA 2P6VA 4Q4ZF 3DKAA 3Q7GA 4YT5A 3ZWIA 3UNGC 2AWYA 2I8BA 1NZEA 3K1IC 3PHF2 1CGME 5L0GA 1H9GA 3NG1A 4I3MA 3M4CA 4KC9A 4AE4B 4XEKA 2XLEA 2QUPA 3ASNC 3R7CA 3S27A 4XEVA 1NU9C 1RKCA 3VYWA 3O55A 2J9BA 1FNTc 5L3QA 2OU6A 1TWAA 4XTKA 2ZXOA 3AGTA 5FZTA 1PD0A 256BA 3S0XA 1NFOA 3DM5A 2Y3GA 1M57C 4HEAJ 2R7OA 1Q0MA 2TMVP 4JTCB 1HW2A 1AVOB 4DRJB 1L7CA 2LD6A 2WVOA 4E18A 4H54A 1HMOA 1EI7A 1OKKD 3SXMA 3ZTZA 1Z5ZA 2L81A 2QTVA 4KI2A 3M1CB 5D91A 4EUKB 3ECSA 2YL0A 1G4WR 4CS8C 4MQ9F 4BJTA 3GM2A 4MW3A 3V5YA 3JCUQ 5A6JA 3UGOA 2R7XA 1DOVA 3DE8A 4CDVA 2L9JA 2MYSA 1D0XA 2CDQA 1H6GA 2NUPA 5B1BC 3ZIBA 4BEJA 1R5ID 4RBNA 1LS4A 2OKUA 2UUIA 2XM4A 3A11A 4OINF 5A6KA 4QI0A 3ZG1A 3ZDLA 2Q4FA 4C3DA 3LLIA 3I4UA 2D5RB 4MVQA 3W8IA 2RSEB 1D1BA 3EG9B 3GODA 4N6HA 3SZRA 3Q6MA 4FESA 3DXJF 4JZAA 5KYYA 1QZXA 2BC5A 2HKVA 2OOCA 2L6HA 2UUHA 5E3AA 2NUTA 2XXAB 1U0BB 1WATA 4CSAC 4JEBA 3K7DA 2YZSA 3GM1A 1XZPA 1S7ZA 4DVZA 1HY5A 1I5NA 1JRAA 4Z9IA 3GEHA 2XS1A 4NC3A 5T1DB 2AU5A 4AX2A 3WODF 1G8XA 1J8MF 4JTDB 2Q00A 3CEXA 3DMDA 3IQ5A 3QVZA 3FAPB 3RVYA 4F4BA 2W45A 3LNRA 4H4KC 2NSFA 4MTFA 1YDIA 4JE9A 3G4XA 4C3EA 1Z3IX 4XLPF 5EHHA 3GANA 3L0IA 4O6MA 3AG4C 3CAXA 2YQYA 3IPMO 4NY3A 5L0JA 4YWQA 4EHPA 2VB6A 3S90A 2G3VA 5JT4A 2EILC 3AG2C 4JJGA 5KYNA 4GQHA 1GM5A 1AUEA 4N06A 4LDQA 5EGYA 3X1OA 4CX9A 4EIYA 2KGOA 3U3FA 5L0HA 1FFHA 3KYIA 2OG2A 1LVKA 2KK1A 4BG0A 4LLEA 4U5CE 4CS9A 2D4UA 4MVRA 1QSPA 3FOOA 4DXWA 4IAOA 4MVSA 4Z9HA 2A0UA 3B0PA 5HV9A 1VOMA 4UDVA 3M15A 3US6A 2XLVA 1JPNA 4XQ1A 1H9TA 3DE9A 2YEVA 3AGUA 1Z6AA 3EH1A 1OCZC 3FMSA 2VASA 3LNMB 2ASRA 3V7OA 2JD3A 1M2VA 2OEXA 5GPGB 2IOQA 1HW1A 2IYLD 3B0UX 4U9EA 1M6TA 1OCOC 1RKEA 5AGFA 1F1MA 5HSWA 4YN0B 3VM6A 2XL4A 2YLGA 2H7VC 2LCHA 4MNDA 4Z9JA 3DAGA 4MVZA 3W8HA 1FR0A 3G50A 4KBLA 5BUOA 4C7OB 1XWJA 2KNHA 3ABLC 1OR3A 2Y69C 3RQEA 5JLIA 3POVA 2W4BA 3LUTB 1WOLA 1BR4A 4E7SA 3ASOC 4U5GA 3G4ZA 2R7VA 1EKYA 1OCCC 2HJ3A 2VH3A 3LS1A 2OJED 3GEEA 1G4US 5COGA 5IY5C 4OIQF 2QY9A 2Y3DA 3C7JA 4EBJA 2HS5A 3SYNA 3LLKA 1LM3B 4U5DE 1QQ3A 2EIJC 2H7OA 4U9DA 1VB5A 4E0IA 4ULWA 5KYWA 4JJFA
chains in the Genus database with same CATH topology
2AU5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AU5 A; 
#chains in the Genus database with same CATH topology
 1EA8 A;  2OCC C;  1Z7Q c;  1L3P A;  3NYL A;  3BRJ A;  3V5X A;  2B0J A;  1NU7 D;  2L6F A;  1YVI A;  1ZU5 A;  4OD4 A;  3FDQ A;  4A4A A;  2YWA A;  1NG1 A;  2J9W A;  1TKN A;  3TD7 A;  4YT8 A;  3KPH A;  1MMG A;  2JX0 A;  4AE4 A;  2P0N A;  3FXH A;  3SXK A;  3QTH A;  2KSF A;  2EPL X;  1PV3 A;  4C3B A;  3K1I A;  1E86 A;  3AJM A;  4ZLD A;  1GS9 A;  1MND A;  2HMZ A;  2J46 A;  3ABK C;  3NMJ A;  3TJ5 A;  2V3C C;  2DB4 A;  2R7U A;  1V54 C;  2OJQ A;  2WB7 A;  1TWH A;  4GYT A;  2ZXP A;  2R7S A;  3U8V A;  1W2W A;  3AQC A;  1E83 A;  2LIG A;  4JVS A;  1O5H A;  1WWP A;  3JSE O;  3RFY A;  3N24 A;  2B0H A;  2YKZ A;  1WGW A;  2HV6 A;  1K05 A;  2G62 A;  1FFT C;  3S29 A;  4N4W A;  5CI9 A;  3K66 A;  4OIO F;  1JMW A;  2CNW D;  2Q3T A;  2J9U A;  4DJ9 A;  4MVM A;  1T6U A;  4XWJ A;  1SZI A;  4CS8 A;  3O6X A;  4U5F E;  1LS1 A;  2G3K A;  2KW3 C;  1Q0G A;  3W2V A;  4I44 A;  1V55 C;  1NLX A;  3C8Z A;  1YA9 A;  2P61 A;  1V4A A;  1O87 A;  1D0Y A;  4RDA A;  3ZVR A;  3RW0 A;  1Q0D A;  3JRM O;  3EG9 A;  4CJO A;  3IQT A;  1E85 A;  2ZXR A;  1EQ1 A;  3CQZ A;  4OD5 A;  5L0I A;  1I4Z A;  3EGX A;  3EHN A;  5DS6 A;  4AL1 A;  2O9X A;  5T3W A;  1YYX A;  4MVO A;  5DQT A;  4OIP F;  5CIV A;  3JYH A;  2C03 A;  2KYH A;  3QW0 A;  4E7Z A;  2XXA A;  1SR2 A;  3EFO B;  1VYI A;  3LAY A;  2YL7 A;  3UMH A;  2J9V A;  1YAU O;  5T3T A;  4E0H A;  2LK4 A;  2DGJ A;  5JSL A;  2H8A A;  1ZHW A;  2A1D D;  3RVZ A;  3DI5 A;  3S28 A;  3HNI A;  4O7G A;  4CSA A;  2R7Q A;  2YL1 A;  1LI5 A;  3KH2 A;  5DVW A;  2R7T A;  1FAP B;  1DOW A;  4M63 A;  1CPR A;  2A69 F;  4MTO A;  4HE8 D;  2J7P D;  4JC7 A;  3AG3 C;  4KNV A;  4YT2 A;  1BR1 A;  1WTY A;  1TR2 A;  3LEO A;  4WJ0 A;  2DYS C;  3FAJ A;  3IQC A;  3HNL A;  4CDY A;  1E2X A;  2WL8 A;  2ZD9 A;  2R05 A;  1K04 A;  1OR2 A;  3GM3 A;  2C04 A;  1HE1 A;  3VAY A;  4EBB A;  2Q9C A;  3EHM A;  4L6R A;  1AEP A;  5KYX A;  3ABM C;  3ATP A;  1NFN A;  3S9O A;  2KC3 A;  5JS5 A;  3JT1 A;  3PDM P;  3QVY A;  4P9F A;  4CIH A;  2PP4 A;  4LER A;  4O6Y A;  2V26 A;  4XLN F;  4N6C A;  2FAP B;  1GQA A;  1OQC A;  1YYJ A;  3K33 A;  3L1M A;  4WAB A;  3U9M A;  1K40 A;  1C17 M;  2XS8 A;  4U5E E;  5DLJ A;  2HMQ A;  2IXN A;  1HMD A;  5F28 E;  2PF4 E;  2J0X A;  3BEH A;  3GWN A;  1RMV A;  1VK5 A;  3HNJ A;  4D4N A;  3F47 A;  3M4B A;  4QDL A;  4HFK B;  4BJ6 C;  1ZHZ A;  4E17 A;  1RJ9 B;  4ZLC A;  2MHR A;  2GA0 A;  3FHD A;  5DS4 A;  3C8G B;  2PX3 A;  2CNW A;  2I15 A;  2R03 A;  3EPV A;  2IBF A;  5JVE A;  3ZC4 A;  1V74 B;  3WAQ A;  5L0D A;  1C02 A;  1Z23 A;  4NCQ A;  1QVX A;  5AC4 A;  2F22 A;  3DD7 A;  1Z63 A;  4JKV A;  1O3U A;  3CZ6 A;  3NDB B;  2EIM C;  2OEV A;  2W4M A;  1I4Y A;  2P1A A;  2YLI A;  3MFN A;  4NTB A;  4PJJ A;  3VRC A;  3ZTM A;  3A9C A;  4ULV A;  3KKB A;  5D92 A;  4C7O A;  4BEM J;  2CGE A;  3DZA A;  4KNW A;  1OW7 A;  4PJM A;  5L0F A;  2HJM A;  4ANJ A;  2X0C A;  4G0H A;  1QKR A;  1TWG A;  4IWB A;  5B3S C;  3L8J A;  3HLZ A;  4XPY A;  3SNH A;  3NMK A;  3C62 A;  2XLM A;  1KU2 A;  1LE4 A;  4A2N B;  2J0W A;  2PX0 A;  2YHS A;  4LLC A;  1SYQ A;  4U5B E;  2WVN A;  1OW8 A;  4K0D A;  3TOL A;  3S84 A;  1TFO B;  4LDK A;  3ZQY A;  1CGO A;  4WGY A;  2EIK C;  3U8P A;  1FMV A;  3MX3 A;  1R4T A;  1Y6D A;  4AK9 A;  2WZL A;  3AG1 C;  1J8Y F;  4CDA A;  4YT4 A;  2DI3 A;  2FFH A;  3B71 A;  5KYU B;  4ER9 A;  2AP3 A;  2J7P A;  1C03 A;  3O10 A;  4PFP A;  4DOZ A;  1APC A;  3I5P A;  1LE2 A;  3RKO F;  1JAF A;  2QNL A;  3DWW A;  3IHU A;  4R32 A;  4DBQ A;  2IXM A;  1ZVZ A;  3Q7L A;  3TOM A;  5A6B A;  3MLG A;  4JRZ A;  2R25 A;  2R02 A;  3IQ6 A;  5COM A;  1CPQ A;  4XPX A;  1T9K A;  1A41 A;  1ORS C;  4YJW A;  1BBH A;  3L34 A;  3RIP A;  3RYL A;  5E3C A;  1G5Z A;  2HFI A;  1ORJ A;  4MS2 A;  2NSG A;  1KNY A;  2QE9 A;  4PAC A;  2VC9 A;  2YL3 A;  4G78 A;  4PJL A;  1U6H A;  1YA7 O;  4ONS A;  3RQG A;  5A69 A;  3C18 A;  4PJN A;  5DQZ A;  2LSE A;  4YL0 A;  5JRA A;  2XRH A;  1M56 C;  2XLH A;  3T6J A;  5DS5 A;  3HTK C;  1VYK A;  4PK4 A;  1A7D A;  4BJ5 C;  2CYD A;  1YAR O;  1OXK A;  3SP1 A;  1A7E A;  1BR2 A;  3UGP A;  2EIN C;  1MMN A;  4IB4 A;  1HE9 A;  3O39 A;  3PMR A;  4IAR A;  2KJG A;  1TWC A;  2LFD A;  4K1O A;  5COF A;  2XL8 A;  3WG7 C;  4DRH B;  4J7T A;  2XSE A;  3N2Z B;  2BE5 F;  4JW1 A;  1FMW A;  3NKD A;  4G7H F;  3AOU A;  2EPM X;  2GWW A;  3EJN A;  3W4Y A;  5BQG A;  4X0R A;  3EH2 A;  1RCP A;  1N1C A;  5BQI A;  1D0Z A;  2R7W A;  3EGD B;  3VF0 A;  2LP4 A;  1BDJ B;  3RH3 A;  2Q7R A;  2NPU A;  2HSQ A;  1WN0 A;  3UR3 C;  2VCB A;  3MYI A;  1JR8 A;  5BQH A;  1Q0K A;  5A6A A;  3JTL O;  3EFO A;  3TUL A;  1E84 A;  2WZG A;  4FX5 A;  4PR9 A;  2XLW A;  3LJB A;  2JPU A;  2M4E A;  2A6E F;  3F46 A;  5JP7 A;  2X51 A;  3T6G B;  4NTA A;  3T6B A;  3U2M A;  4HFF B;  3J06 A;  3WHN A;  1ZHT A;  2FGY A;  3JZ0 A;  2H7B A;  2XL6 A;  3JSZ A;  1LKX A;  3R2P A;  3NKE A;  4K7B A;  4W8P A;  1UG7 A;  1ST6 A;  4JUR I;  4EBK A;  5JUA A;  1FTS A;  1YJG A;  2LQG A;  4YL1 A;  3B29 A;  4BJ1 A;  2HZ8 A;  3MYF A;  4JEA A;  4MTG A;  4EKW A;  1QLE C;  4NQF A;  3N0T A;  4JCZ A;  3E70 C;  3K1H A;  2WZF A;  1OXB A;  2QLA A;  3H65 A;  5L0C A;  3RF3 A;  1T6I A;  3T9O A;  5AC5 A;  1RXQ A;  1T01 A;  2WVQ A;  3RQF A;  3TK0 A;  4Q7C A;  5K0I A;  3KYJ A;  1OCR C;  1YLM A;  3OEO A;  1VMA A;  2GDC A;  1T5O A;  3JYY A;  2E87 A;  3KMI A;  2ETS A;  4DBR A;  5EK0 A;  3UMK A;  1A7V A;  1QPU A;  5A6B D;  2L7A A;  1M2O A;  1OW6 A;  2ZPA A;  1TFK B;  2NUP B;  1VTM P;  3QMK A;  1VLT A;  2LFF A;  4B6I A;  3EZI A;  3EGX B;  2XLD A;  3SEO A;  2J8W A;  4J7Y A;  2BL2 A;  1LI7 A;  3MBG A;  3HKK A;  1T6Q A;  4U5H A;  2A0B A;  4XPW A;  1RJ9 A;  4AL0 A;  2HV7 A;  3DM9 B;  3V5Z A;  3C8G A;  3EQL F;  2NG1 A;  4GEH A;  4JTA B;  1PD1 A;  2HSB A;  5KYY B;  2Q9B A;  3DAF A;  2NUT B;  2XM0 A;  4CIP A;  4BJ6 A;  3HJC A;  3LS0 A;  4I1M A;  2PBE A;  3I5Q A;  4DVY P;  5CI8 A;  1ZU4 A;  2J45 A;  1JOG A;  5B3I A;  2IXP A;  2ZXW C;  4JCH A;  2RD9 A;  1PCX A;  4G7Z F;  1S05 A;  1ZHX A;  2W9Y A;  1A0B A;  3DJN B;  1ZW3 A;  2Y3B A;  2VCC A;  4PFO A;  2AVK A;  3H2U A;  5F5H A;  4CJG A;  2PFD A;  3GWL A;  3SXY A;  4DRI B;  1SF8 A;  1LPE A;  1U89 A;  1WAS A;  1XZQ A;  2VCA A;  3FVY A;  3NMI A;  1IZM A;  4LDR A;  3SXZ A;  2Q9A A;  4D4X A;  3NRH A;  4MVU A;  2Y3H A;  4OIR F;  5F5F A;  2AWC A;  3T4R A;  3H2V A;  1GGQ A;  3ZSU A;  3KL4 A;  4MW8 A;  1NBB A;  1KTM A;  4CS9 C;  5KYX B;  3TJ6 A;  3U2L A;  2YLD A;  3ZQV A;  1JPJ A;  4WGZ A;  2YVK A;  3OWT A;  4YK5 A;  4FAP B;  5L3V A;  4NTF A;  4RD9 A;  5TJ5 E;  3U5S A;  3JRT A;  1OKK A;  1LIH A;  3K6B A;  3LEV A;  4P9T A;  4IRU A;  2EPN A;  4J30 B;  1TQG A;  1YZA A;  4IGG A;  5KYU A;  1ZZP A;  3UMI A;  5B1A C;  1UFB A;  4IJJ A;  2EPK X;  4CBE A;  3U0C A;  1IW7 F;  3X2Q C;  2Z15 A;  3LES A;  3OA1 A;  3PCV A;  3CSK A;  2MWQ A;  1ZYR F;  2DYR C;  2ICW G;  3B9Q A;  3C63 A;  3QZC A;  3HNK A;  5FCL A;  1NSG B;  4QI2 A;  1YZC A;  4LAC B;  3W2W A;  2EPO A;  1M2V B;  4XEF A;  1ZHY A;  3GOR A;  3EZH A;  4JIO A;  2Y39 A;  3DJU B;  4EWC A;  2L6G A;  3E9V A;  1BZ4 A;  1Y4C A;  2HUJ A;  4CS7 A;  1RKE B;  2R9R B;  3ITF A;  4I1O B;  1VLS A;  2GFH A;  2YRF A;  3M79 A;  3L8I A;  2CCY A;  4J32 B;  3IEE A;  2IXO A;  1B68 A;  2KQ9 A;  2A6H F;  3Q6N A;  4O79 A;  1D1A A;  2M64 A;  3TQO A;  1ZW2 A;  1CGN A;  4BPM A;  3U3B A;  2R7R A;  4FWV A;  2PNO A;  2CW0 F;  1ORY A;  1D1C A;  1MMD A;  3QW1 A;  4YL3 A;  4W8K A;  4BJ5 A;  2P7V A;  3U9J A;  3AQB A;  1MNE A;  4Q5S F;  3B0V C;  3C8G D;  2OQM A;  1SMY F;  2GAQ A;  4G7O F;  5E33 A;  3NYJ A;  3FOP A;  4O6N A;  4P6I C;  2XLO A;  2A68 F;  1MMA A;  3GEI A;  3EGD A;  4IAQ A;  5E2Q A;  2IM8 A;  3NYM A;  5KYW B;  1H7I A;  1MQV A;  1Q0F A;  2P6V A;  4Q4Z F;  3DKA A;  3Q7G A;  4YT5 A;  3ZWI A;  3UNG C;  2AWY A;  2I8B A;  1NZE A;  3K1I C;  3PHF 2;  1CGM E;  5L0G A;  1H9G A;  3NG1 A;  4I3M A;  3M4C A;  4KC9 A;  4AE4 B;  4XEK A;  2XLE A;  2QUP A;  3ASN C;  3R7C A;  3S27 A;  4XEV A;  1NU9 C;  1RKC A;  3VYW A;  3O55 A;  2J9B A;  1FNT c;  5L3Q A;  2OU6 A;  1TWA A;  4XTK A;  2ZXO A;  3AGT A;  5FZT A;  1PD0 A;  256B A;  3S0X A;  1NFO A;  3DM5 A;  2Y3G A;  1M57 C;  4HEA J;  2R7O A;  1Q0M A;  2TMV P;  4JTC B;  1HW2 A;  1AVO B;  4DRJ B;  1L7C A;  2LD6 A;  2WVO A;  4E18 A;  4H54 A;  1HMO A;  1EI7 A;  1OKK D;  3SXM A;  3ZTZ A;  1Z5Z A;  2L81 A;  2QTV A;  4KI2 A;  3M1C B;  5D91 A;  4EUK B;  3ECS A;  2YL0 A;  1G4W R;  4CS8 C;  4MQ9 F;  4BJT A;  3GM2 A;  4MW3 A;  3V5Y A;  3JCU Q;  5A6J A;  3UGO A;  2R7X A;  1DOV A;  3DE8 A;  4CDV A;  2L9J A;  2MYS A;  1D0X A;  2CDQ A;  1H6G A;  2NUP A;  5B1B C;  3ZIB A;  4BEJ A;  1R5I D;  4RBN A;  1LS4 A;  2OKU A;  2UUI A;  2XM4 A;  3A11 A;  4OIN F;  5A6K A;  4QI0 A;  3ZG1 A;  3ZDL A;  2Q4F A;  4C3D A;  3LLI A;  3I4U A;  2D5R B;  4MVQ A;  3W8I A;  2RSE B;  1D1B A;  3EG9 B;  3GOD A;  4N6H A;  3SZR A;  3Q6M A;  4FES A;  3DXJ F;  4JZA A;  5KYY A;  1QZX A;  2BC5 A;  2HKV A;  2OOC A;  2L6H A;  2UUH A;  5E3A A;  2NUT A;  2XXA B;  1U0B B;  1WAT A;  4CSA C;  4JEB A;  3K7D A;  2YZS A;  3GM1 A;  1XZP A;  1S7Z A;  4DVZ A;  1HY5 A;  1I5N A;  1JRA A;  4Z9I A;  3GEH A;  2XS1 A;  4NC3 A;  5T1D B;  2AU5 A;  4AX2 A;  3WOD F;  1G8X A;  1J8M F;  4JTD B;  2Q00 A;  3CEX A;  3DMD A;  3IQ5 A;  3QVZ A;  3FAP B;  3RVY A;  4F4B A;  2W45 A;  3LNR A;  4H4K C;  2NSF A;  4MTF A;  1YDI A;  4JE9 A;  3G4X A;  4C3E A;  1Z3I X;  4XLP F;  5EHH A;  3GAN A;  3L0I A;  4O6M A;  3AG4 C;  3CAX A;  2YQY A;  3IPM O;  4NY3 A;  5L0J A;  4YWQ A;  4EHP A;  2VB6 A;  3S90 A;  2G3V A;  5JT4 A;  2EIL C;  3AG2 C;  4JJG A;  5KYN A;  4GQH A;  1GM5 A;  1AUE A;  4N06 A;  4LDQ A;  5EGY A;  3X1O A;  4CX9 A;  4EIY A;  2KGO A;  3U3F A;  5L0H A;  1FFH A;  3KYI A;  2OG2 A;  1LVK A;  2KK1 A;  4BG0 A;  4LLE A;  4U5C E;  4CS9 A;  2D4U A;  4MVR A;  1QSP A;  3FOO A;  4DXW A;  4IAO A;  4MVS A;  4Z9H A;  2A0U A;  3B0P A;  5HV9 A;  1VOM A;  4UDV A;  3M15 A;  3US6 A;  2XLV A;  1JPN A;  4XQ1 A;  1H9T A;  3DE9 A;  2YEV A;  3AGU A;  1Z6A A;  3EH1 A;  1OCZ C;  3FMS A;  2VAS A;  3LNM B;  2ASR A;  3V7O A;  2JD3 A;  1M2V A;  2OEX A;  5GPG B;  2IOQ A;  1HW1 A;  2IYL D;  3B0U X;  4U9E A;  1M6T A;  1OCO C;  1RKE A;  5AGF A;  1F1M A;  5HSW A;  4YN0 B;  3VM6 A;  2XL4 A;  2YLG A;  2H7V C;  2LCH A;  4MND A;  4Z9J A;  3DAG A;  4MVZ A;  3W8H A;  1FR0 A;  3G50 A;  4KBL A;  5BUO A;  4C7O B;  1XWJ A;  2KNH A;  3ABL C;  1OR3 A;  2Y69 C;  3RQE A;  5JLI A;  3POV A;  2W4B A;  3LUT B;  1WOL A;  1BR4 A;  4E7S A;  3ASO C;  4U5G A;  3G4Z A;  2R7V A;  1EKY A;  1OCC C;  2HJ3 A;  2VH3 A;  3LS1 A;  2OJE D;  3GEE A;  1G4U S;  5COG A;  5IY5 C;  4OIQ F;  2QY9 A;  2Y3D A;  3C7J A;  4EBJ A;  2HS5 A;  3SYN A;  3LLK A;  1LM3 B;  4U5D E;  1QQ3 A;  2EIJ C;  2H7O A;  4U9D A;  1VB5 A;  4E0I A;  4ULW A;  5KYW A;  4JJF A; 
#chains in the Genus database with same CATH homology
 2AU5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...