4KNVA

The crystal structure of apo human hdhd4 from se-mad
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
241
structure length
241
Chain Sequence
b'MRAVFFDLDNTLIDTAGASRRGMLEVIKLLQSKYHYKEEAEIICDKVQVKLSKECFHPYNTCITDLRTSHWEEAIQETKGGAANRKLAEECYFLWKSTRLQHMTLAEDVKAMLTELRKEVRLLLLTNGDRQTQREKIEACACQSYFDAVVVGGEQREEKPAPSIFYYCCNLLGVQPGDCVMVGDTLETDIQGGLNAGLKATVWINKNGIVPLKSSPVPHYMVSSVLELPALLQSIDCLVPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N-acylneuraminate-9-phosphatase
molecule tags Hydrolase
source organism Homo sapiens
publication title Design, synthesis, functional and structural characterization of an inhibitor of N-acetylneuraminate-9-phosphate phosphatase: Observation of extensive dynamics in an enzyme/inhibitor complex.
pubmed doi rcsb
total genus 87
structure length 241
sequence length 241
chains with identical sequence B
ec nomenclature ec 3.1.3.29: N-acylneuraminate-9-phosphatase.
pdb deposition date 2013-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.710 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4knvA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4knvA01
2YFYA 1TA0A 2YMLA 3FVVA 3AR8A 5ALTA 2JAOA 4HGPA 4L6AA 2FI1A 1Z4QA 5ALUA 4GXTA 5AKLA 4MWOA 2HOQA 5AM1A 3WK5A 4BX0A 4YCMA 5AI6A 3ZVNA 2P27A 3N8GA 3M9LA 2ZBFA 3WKDA 5IT4A 2CN1A 3DDHA 5AW9A 2HHLA 3ESRA 2RARA 2GHQA 2BDEA 3S6JA 1ZRNA 4BEWA 2FDRA 5AKZA 3WGUA 3SHQA 4YCNA 4Y2TA 2NO4A 2CFRA 2WF6A 2C4NA 4XQ0A 3K1ZA 5AVUA 2AGVA 2R8XA 5ALYA 1ZD5A 5ALZA 4ZEWA 1MH9A 3AR9A 1Z4OA 1T5SA 3J7TA 1EK1A 2OBBA 1U2TA 4G9BA 2Q5EA 1KYTA 3GYGA 2IOHA 3SD7A 2G06A 3ZX4A 5ALWA 4GIBA 3EF0A 1NF2A 3UMCA 1WR8A 4DCCA 3CNHA 3FM9A 3WK8A 2YBDA 1L7OA 2HCFA 3M1YA 4AS3A 4I9FA 3U7FB 5A3RA 5ALEA 2CFSA 2ZBGA 1XVIA 3KDPA 2G1AA 1NNLA 3W5DA 2PQ0A 4E88A 3UM9A 4EZEA 4Y2VA 5AHXA 4KX5A 4L57A 1ZD2P 3VAYA 4OCZA 1CR6A 5AI0A 3WKEA 2IOFK 3ONNA 5AW0A 5AW1A 3EF1A 2YJ5A 3OPXA 2R8EA 3UMGA 3OTQA 3QUCA 3ZUPA 3QNMA 3I28A 2G08A 4KYTA 1Z4LA 2HEGA 3KOOA 5AI4A 3QU7A 1L8LA 2B8EA 4CF4A 2FUCA 3I76A 5AVTA 4NABA 5ALMA 5AW6A 1U7PA 2IOFA 3ET4A 1YMQA 3L0BA 1JUDA 4F71A 4H1WA 2W43A 3E58A 3U7EB 4YCLA 3NANA 2CFTA 4UASA 2AUTA 2I54A 4EX6A 2BY4A 2P69A 4KNWA 2IA5A 2P11A 3SKYA 2R8YA 1TE2A 4Y2UA 5E0OA 4JB3A 3ZX5A 2FPSA 4RESA 3L8FA 2Q4RA 2RB5A 3AR4A 1XPJA 4YIHA 2JGAA 5ALRA 2BDUA 2I7DA 4L6CA 1YDFA 2FEAA 4DWOA 2HSZA 2G07A 3TLMA 1Z4JA 2YY6A 1T5TA 3B9BA 2R8ZA 3PDWA 1O03A 1RDFA 1QYIA 1AQ6A 3B9RA 1ZD4A 3QUBA 5AIAA 4BKMA 3L8HA 1RPZA 4FFDA 1ZOLA 4FYPA 2W4MA 5ALFA 1PW5A 4BX2A 2WF5A 1LVHA 4Y2XA 2EAUA 3QUTA 4UARA 5A3SA 3OCYA 2WHEA 3DNPA 4OD0A 5AI9A 1Z88A 1J97A 4EELA 1RKUA 4YH1A 3W5CA 2HF7A 1IWOA 2Q4TA 1NRWA 3MN1A 4BYGA 5AVYA 5AW7A 2B1RA 3BA6A 4NAVA 2ZXEA 5AKXA 2O9JA 1TJ5A 4Y2YA 2EARA 4OFZA 5AW2A 4OHFA 2OM6A 2FPRA 3MC1A 3PGLA 4IFTA 4CF3A 2I6XA 2ZBEA 4F72A 1RMYA 1Z4KA 3QU5A 3NIWA 1RMQA 1QH9A 3AR7A 5AW4A 4BNDB 3I6BA 5AVWA 3A1EA 4EENA 4KN8A 1RQNA 2C9MA 3A1DA 2B0CA 2OYCA 2PKEA 2OA0A 3QUQA 1Z5UA 3UMBA 5AI8A 3L5KA 3IRUA 2NO5A 3IB6A 1U7OA 1X42A 2ZOSA 3N07A 4C4SA 1U2SA 3ET5A 5ALDA 1RC8A 4KX3A 1S8OA 4Y2QA 5AKJA 3CZ4A 3SMVA 4Y2PA 5ALVA 2YMPA 4HGOA 4AS2A 1RLTA 2GMWA 3OCWA 1L6RA 1YV9A 5AESA 2C88A 3SF0A 2B8JA 4EEKA 3DAOA 5AW3A 5AM4A 1Z4PX 5ALGA 4UATA 5AM0A 4RETA 2DQSA 3FGOA 3QGMA 3KZXA 5ALOA 4NFLA 1SU4A 2C8KA 5A3QA 1RRCA 1ZJJA 4UMVA 3L0CA 2HX1A 1L7MA 2NYVA 3L0YA 4UM5A 1QQ7A 3R9KA 2FUEA 2B82A 3ZTYA 5AKIA 5ALSA 5AVSA 4UW9A 4AP9A 3L8EA 1ZRMA 1RLMA 4UM7A 2P9JA 5AKGA 2QYHA 1Q92A 5AI5A 4IG4A 1RKQA 2QLTA 1QQ5A 2YJ4A 3QLEA 4UAVA 4YGYA 3AR3A 3SLRA 1RKVA 3A1CA 3QYPA 1VJ5A 2HO4A 2JARA 2B1QA 3AR2A 5AVXA 2JAWA 4G63A 2G80A 4HGNA 5AVZA 5ALXA 1L8OA 3ED5A 4UMDA 2O2XA 4BX3A 4Y2RA 2FPUA 2YMQA 3NALA 3D6JA 2WF9A 1ZS9A 2WF7A 3PCTA 3AR5A 3R4CA 2PR7A 3DV9A 4C4RA 4NV0A 3RFUA 2YJ3A 3U7HB 2I34A 1ZD3A 3N1UA 4QJBA 5AW8A 3EPRA 3WK4A 3OCZA 3OCXA 5AKEA 3ZW7A 3W5BA 5ALQA 4HAIA 1L7PA 4Y3UA 2ODAA 2W11A 5AICA 4ZEXA 4EX7A 5AM2A 3SKXA 3ZI4A 4UU1A 2EATA 2HI0A 3L7YA 1LTQA 1Z4MA 3MPOA 2ZBDA 2I33A 4DFDA 5ALIA 1Q91A 1U02A 3QU4A 5ALJA 3L1UA 3KD3A 2MU1A 4Y2JA 2ZG6A 5AK4A 4BNDA 1QQ6A 2RBKA 2WM8A 3KC2A 2G09A 2WFAA 4HGQA 3NUQA 5AK3A 2G0AA 2C8LA 5ALKA 3QU2A 1Z5GA 3WK7A 3FPSA 2HDOA 2AH5A 3E81A 4UAUA 2YMMA 4HGRA 4XPZA 2YN4A 5ALNA 3PGVA 4NWIA 4CF5A 3ZU6A 3OCUA 2RAVA 3HYCA 3ZWKA 1YS9A 1Z4NA 3L8GA 5FP0A 1K1EA 1Z4IA 3EWIA 4C4TA 2B30A 3NASA 5AVRA 2GHTA 3R09A 2X4DA 4I9GA 3FZQA 4UMFA 3RF6A 3U26A 4UMEA 1CQZA 5AKYA 3ZVLA 1EK2A 2I55A 1SWWA 5AIBA 3KBBA 5AK5A 4CNQA 5JJBA 4PNHA 1N9KA 4XOUA 4O8CA 5AW5A 3AR6A 4XE5A 2FPWA 3WK6A 1RMTA 1F5SA 5T41A 3WGVA 1S2OA 2VKQA 3MMZA 1YJ5A 4HYTA 4QQFA 1VFPA 4BBJA 1TJ4A 5AVQA 2IYEA 4UU0A 3A3YA 1VJRA 3QXGA 4BEVA 3NRJA 1J8DA 1TJ3A 3F9RA 4J2TA 4YIKA 3BWVA 3I1YA 4KNVA 1T9ZA 2GFHA 3E8MA 2AMYA 3FPBA 1WVIA 5AM5A 2FPXA 5ALHA 5IS2A 1RLOA 3W5AA 3B8EA 1FEZA 4Y2SA 1WZCA 2GO7A 4DW8A 5AM3A 3HLTA 4CE6A 1O08A 5AKHA 4J03A 5AKKA 2WF8A 3QU9A 1Y8AA 3WKAA 2MSNA 3U7GA 1L7NA 3QX7A 3L1VA 3E84A 1RQLA 3ESQA 5ALLA 5IT0A 5ALPA 5AK6A 3ZWDA 4ZEVA 1SWVA 2HF2A 4B6JA 3P96A 1N8NA 3NAMA 3WK9A 3U19A 1XP5A 3ZTWA 1WPGA 3ZVMA 4FE3A 4JDPA 2D2VA 3OCVA 3WKBA 2YJ6A 2JAUA 3N28A 3WKCA 5AVVA 3U13A 1YNSA 4MUMA 3N5KA 3IJ5A
chains in the Genus database with same CATH superfamily
4K9KA 2AOTA 2PBEA 2YC4C 3AIMA 3I5UA 4Q21A 2OYRA 3RVSA 4BC1A 2IZ0A 2QAIA 4KQEA 4EATA 4PX9A 4X45A 3ELYA 4QUDA 5EJ2A 3GFOA 3GOHA 5C32A 1UH5A 1Z4QA 2LQGA 1L5YA 1ZBDA 3CF4G 2E5LB 2Z1DA 2IZZA 3VR4H 4F4HA 3WOHA 1ZP6A 1WZIA 2GASA 4NKRA 2OLJA 3UT5A 2Q28A 4LXGA 3SG0A 5DTQA 2CKDA 2FSGA 1H0SA 1XEAA 4NP6A 3KMIA 3FCSB 4FYKA 3WKDA 3RG8A 3E9CA 4F21A 1DBRA 1G0NA 4HEA6 2CZQA 4BCCA 1W2WA 4TYPA 1JTFA 3OQIB 2WU3A 5EHHA 2P9FA 2ZKLA 3RIHA 3CQZA 3SBDA 1RCTE 2COUA 2L6HA 3T0FA 4CQLB 3TLEA 3WNQA 2YTZA 4AROA 2D0OB 2O05A 5K99A 5KX5F 2PGOA 5BNFA 2GBIA 3IR5A 3HZHA 2DE0X 1GZDA 2GWRA 3U61B 3T6GB 4XOIA 2KGOA 2NXNA 3A4LA 3H2BA 4FHZA 1MJFA 1OXBB 3SHVA 1ORHA 3RKUA 2VDWA 5FOTA 1SHTX 3SHOA 4MA0A 1UKZA 2I6TA 5FOXA 5KSWB 3GFPA 4MW9A 1M6EX 3HNIA 2R8XA 3FDXA 2HK6A 4F97A 2I99A 2ZBPA 2VYVD 4IF4A 4D9IA 2ZCVA 3GNTA 4L85A 2R6AA 2QUZA 3Q0EA 4ITVA 1HDIA 4O4HB 1EK1A 4UVGA 1JQBA 1RRKA 2ASEA 2X42A 4FR2A 1RAEA 1TD1A 3GYGA 3AZQA 3AJAA 3L0DA 4U1RA 1V4BA 2AYYA 2VH5R 4C2UA 1RP7A 3N7UA 1X13A 5IU6A 1T9GR 4L7VA 1IPFA 1LBHA 1YUNA 4K0DA 1PZGA 1XN1A 2FP4B 4U2GA 1K97A 3SC2A 3SC4A 1YI1A 2BISA 5DQZA 3G2MA 1G63A 5F5LA 1Y3IA 3GGJA 1WOLA 4XPXA 1QLWA 3AJRA 1GR1A 2Z5FA 3OG9A 1DEHA 1YS2X 4OXRA 3WRXA 4F4UA 2C04A 1GKLA 2BFDA 4PSCA 4WFKA 2WWGA 5D01A 1E5XA 4MVXA 1CDOA 1NN5A 1GV1A 1NXQA 2DY0A 2FZ4A 2WJIA 3NYMA 3CSUA 1E6MA 5IY5C 3GW8A 3U4DA 3B85A 4ZAVA 1R8SA 2GPBA 2ZKIA 4OD4A 3LXMA 5I6DA 1R4MA 2AUMA 4E3WA 2YVLA 4EB6A 5CB4F 1AY0A 1O6GA 3ROMA 4AY4A 1LY1A 5T3TA 2YX1A 4TLAA 5GPGB 1RI3A 3AJ8A 2VRNA 2ACEA 4Q1FA 4V03A 4E13A 4DCUA 1D2CA 1Z2EA 1YU6A 4DXAA 3BBPA 3WTBA 4OYLA 2PSFA 2HEGA 5L3QA 1CBUA 3OWTA 1IHOA 2WAOA 4I2NA 4AY6A 2B4YA 1RQXA 4ZLDA 2CLHB 3CUEF 3M7IA 4WOCA 4NR0A 1KDRA 3PRJA 3R7WA 5B4TA 2IOFA 1P3Y1 3O8QB 4OKSA 2ZULA 4I50F 1SR8A 5J2TF 1T8WA 3U7EB 3H2HA 3L43A 3AIKA 2FQ1A 2ZROA 2UYHA 2MMCA 3ILVA 4GWKA 5FNVF 3D4PA 3DWGA 4HNUA 3PHIA 4BGEA 2A33A 1BC5A 3ORFA 3PFIA 3CH5A 2J9YB 5E0OA 2TMKA 1NRJB 4RH3A 5HJ5A 4A1FA 4MQUA 4CQMA 3AONB 2Z2XA 4GMKA 1U7UA 4DF3A 1SUIA 1WRBA 1FUIA 2CLOB 3R3UA 4ACBA 4D43A 5BOSA 5KQLA 2E4WA 2DFKB 1Q0DA 3AKEA 3ZXXA 2A0FA 3KQVA 3DMTC 3S2YA 1ZM2A 1PJAA 1IEQA 2ZRMA 4H7PA 3TSOA 3VNRA 4NU5A 2G8LA 1Z33A 4F56A 4MIKA 1P1HA 2H4YA 2RAPA 3SZUA 4CJOA 2XWPA 4TRMA 5LYJA 1N1MA 5TQJA 3UAXA 2W2KA 3TUZC 4GX0A 2P9ZA 1GPH1 3HEMA 4U5CE 3NRHA 4GH5A 1ES9A 1Z83A 2ZSIA 2XAAA 2JZOA 3KALA 4XQGA 1JI3A 3I4LA 5HE8A 1VLTA 4NJEB 1IG3A 2Q29A 1IN7A 3DZKA 3Q88A 4EUKA 3ND8A 3HN6A 4ZU3A 2A1UA 1SUDA 2PS9A 5IJ0B 1KNYA 3WGYA 3AVPA 4AL4A 3AEUA 3IJRA 4R69A 2YWDA 4RFVA 3R7NA 3S1AA 3WHLA 4C03A 5KNDH 1M9NA 3FF1A 3ZHBA 4CR8A 3VR6H 2X8BA 1ZCBA 4YAFA 2OKGA 2CV1A 1T9AA 1X8KA 2WU4A 2QRZA 4OQNA 1IK6A 1CGNA 4Q7KA 4YUXA 1CXZA 1L5SA 1L8AA 1EDZA 3C0KA 1M6TA 2XUZA 3OOSA 5EQFA 5I3CA 1GADO 4CM3A 4RMNA 4ZV4A 4DHEA 2HF7A 2J5BA 2I3AA 2YQ4A 3CE9A 5DBOA 5BP7A 1XHFA 3HVRA 3LUAA 1Z0KA 1HE4A 3PGJA 1T36B 2JFXA 1GARA 3A6JA 4E5PA 3GN1A 1A2OA 1R88A 2HWYA 1HDRA 4NU6A 4M88A 4XB1A 3JARA 2YZMA 2XBUA 4UHCA 1XEXA 3K09A 2Q62A 2G3YA 1WEHA 1K0UA 3EQ2A 1Z06A 2EINC 1Z6ZA 2QR2A 3JZDA 1R0LA 2GK6A 1RP1A 3TM4A 1J0CA 1R74A 4ZVVA 5ICGA 1UXKA 2VF5X 1YOVA 2A84A 1FLAA 4RIGA 1VBKA 1I8TA 5DM1A 3G8AA 1TEHA 3WLJA 2AE1A 4B83A 3AG1C 3ZD7A 4Y6OA 4H0FA 2QTNA 4WCFC 5JZMA 4HAVA 2BZ0A 2Z2KA 2XRYA 1P4AA 3KEOA 3X1XA 3KETA 1P0IA 1N2CE 3AL0C 1QTIA 2XM0A 3O3CA 2IDJA 4GBGA 3RIMA 1P73A 4V0QA 3I5YA 4RA6A 1GG8A 1MNQA 2QX8A 4XGRA 3RVRA 2VKTA 1OZGA 4GOOD 4RNDB 2DH6A 3LLSA 2KSQA 5EZ5A 3R6WA 2ZB2A 3V7NA 4AK9A 4AKEA 1NNEA 1EWRA 3E2IA 3MT0A 4QHSA 2JIRA 2H1VA 2FXIA 5C2JB 4OMFG 2XTAA 1GG2A 5CX1B 3RTAA 5LA6F 3UMSA 3GNSA 4GGMX 2OB2A 1XA4A 2PN1A 4IJVA 1SXJD 4AS2A 2GVNA 2DFPA 4GVLA 3QVYA 1C1DA 4JBNA 4R2WA 3JVIA 2CHQA 1G20A 2HXYA 1QIMA 2P78A 2X8LA 2YNMD 2I3DA 4IILA 4YB8A 4JJAA 1KKUA 2B8JA 3JZAA 4Q4JA 1JBQA 3L6RA 4BIIA 2E7ZA 3UGJA 2GUWA 3NRBA 4GBMA 3PQ2A 3DZCA 3AFHA 3SDZA 2XLDA 1GCIA 4RETA 2QJTA 3FSGA 3GA0A 2VWHA 1U4OA 4CM7A 2CVQA 4IGKA 2C2MA 2QVCA 4PG8A 2JLXA 1MEOA 5ALOA 1YB5A 3CUWA 1ILWA 1TKAA 2E6KA 2V5AA 3L1HA 1XK7A 3ORRA 4JH0A 3NR2A 3OEED 3LCJA 4AUNA 1E66A 1M2OA 1TVCA 2V03A 5KWJA 4XWJA 3AF6A 1JTVA 2BE7A 2W2LA 3PI6A 4UM5A 2OXFA 1E9VA 3KJXA 1CZUA 2ZZKA 2WK1A 1F0YA 1FFEA 4G07A 4FZVA 4IJQA 1MA3A 5EJAA 2ECQA 1U28A 2OHXA 2GK7A 3AUYA 3DEIA 3L41A 3HXLA 3BX1A 2OR3A 3L8EA 3Q2OA 1H9AA 2IYRA 4NRDA 3K5PA 4GXQA 1P9WA 5B36A 1KQNA 3EPLA 1XMSA 2NIPA 5AKGA 4ABTA 4YT8A 4AMYA 1SAYA 1V95A 2HREA 2QT0A 2LNDA 4U5XA 2QV7A 2F55A 1NVBA 1U0EA 2BKLA 3N9IA 3FVWA 4QEKA 3D2AA 3JTMA 2H9IA 5JUAA 1YK0A 2C58A 4G4IA 2J85A 4IG4A 1YWGO 4OGGA 3TZQA 3OIYA 3RRXA 3TM5A 1TZJA 3WDLA 3R5FA 3FPEA 5FPSA 3JD4A 4F5EA 3U7RA 4LJLA 3N0VA 3HDJA 4WN3A 1LRKA 1ZVVA 3FNHA 4D3SA 3Q12A 1LE4A 5L6LB 3IBTA 4PYMA 3V3TA 3AJDA 3KT0A 1KEEA 1R8QA 2WB2A 3OZIA 2MHCA 5CAEA 3N8IA 5KMGA 3THXB 3DE4X 2CDNA 1V16A 3NDPA 3VRHA 4E11A 2FZCA 2I8BA 1FVFA 3HVKA 4U6SA 3PWKA 2DPHA 1C3EA 4UHJA 3TKAA 1C7RA 1THGA 5LQMA 3F4BA 5DVWA 1N36B 5L7WA 1YARO 3VO8A 3DV9A 4MKGA 5IUKC 1E6KA 2XUPA 2Z98A 4G0MA 3W06A 4K2AA 5TRTA 1EFPB 1ILEA 5K0IA 3M83A 4H7IA 4JI6B 3QW0A 4XTKA 1SBQA 4S1WA 4ALKA 5AW8A 2VDQB 3EPRA 4RBNA 2BFBA 4LOIA 1L3CA 5EPEA 3BTUA 3CBGA 3SSOA 5ECWA 2GYVA 2MWMA 3EAFA 1YASA 3HSYA 5EIAA 3SZ3A 1SVUA 5BW4A 1CV2A 1JFFB 4EGAA 1Q11A 1Z6PA 5AICA 5BYKA 5F5HA 4R32A 2FFAA 4M1QA 2A9JA 1S0UA 2GUGA 3E7PA 1Z68A 3WWPA 1N0UA 2JRCA 3PL5A 4HGZA 1AZLA 2ZJ3A 1UKBA 2Y4NA 3ZCSA 2WEKA 4D74A 5KREA 3O8RA 4LHYA 2AOUB 3MLAA 2O3QA 1FDUA 1T3TA 1Z4MA 5K0JA 1T10A 3P9YA 1QBKC 4EGQA 2QNLA 1DKMA 1RJGA 1ZLYA 5K45A 2DPLA 3F6SA 3OZEA 4P3KA 1HQCA 3CLTC 5KOHB 3HXPA 2GDCA 1A04A 1E1RA 4RVOA 1N2GA 2LSEA 3ZQVA 4TRNA 4OX9B 1RJWA 3JPYA 1TM3E 3FZGA 4IH4A 2VTBA 2DT8A 2WM8A 2XQIA 2DHRA 3PVCA 4NPHA 5KNCA 1G8YA 3ORYA 2IZ6A 3NVKI 3E05A 1V4NA 2RG1A 4YP9A 2FKAA 1BRMA 1ZJWA 1FFCA 3UOAB 4H9GA 4TN5A 2VLIA 1G20E 3EARA 5EJ4A 3DMYA 4PIPA 1OFUA 2PNFA 2O6LA 3VR6A 1J8YF 1IZ7A 1B4DA 1QYRA 1VGQA 1YOBA 3AZPA 2W6PA 3HRKA 1TLFA 2UDPA 3N7TA 3UO8B 2YN4A 5ALNA 4YMUA 1RZUA 2OCYC 1HL7A 1D2GA 5F2NA 3FVYA 2P9EA 2Y93A 1V47A 4V2UA 4KC0A 3DTYA 1K6MA 1NBMD 3KXKA 4JUAA 4UHKA 3SJZA 1BDMA 3JXEA 2KS6A 1Z2NX 4QUIA 2A9RA 4HQ6A 4JT2A 1AX9A 4N3GA 4U2CA 2GM4A 4R2JA 4TMTA 1U9ZA 1DXYA 1T2FA 2L17A 3MGGA 2W7TA 3FZQA 3R09A 4DMKA 2PO7A 1C14A 1BNCA 3VR5D 5AKYA 1QHYA 4DZRA 4FDLA 4R2HA 5DNCA 2WLTA 3QE4A 1XSEA 4KV7A 4MB0A 4O8ZA 2W83A 4K26A 5EPUA 1QGUB 2C5SA 4BZPA 2FY8A 4TZ0A 1VRWA 3A70A 1G20B 1JZQA 1UBCA 2KB0A 4DVZA 3CFYA 3DE7X 1ENPA 1NULA 2VUHB 4LYYA 3TL2A 3ZE0B 1IB6A 4TWBA 3GUZA 1N9KA 5EMLA 1GTZA 2P2DA 3JQBA 5L0GA 1ZNXA 1VCHA 2C4MA 2E89A 2OE2A 2OVBA 3UMFA 4JLWA 3NTUA 2AOWA 4NESA 3DE6X 3DFKA 3HKDA 1DVRA 3Q10A 4ALIA 1TEZA 3VPGA 1K6XA 2QN8A 1G8KA 1V7PC 2Z8YM 5A5GA 1XAGA 4LHVA 4GI7A 2VLBA 4H6VA 5J2UA 1KJZA 4ND8A 2XL4A 1SU6A 2EFCB 2QHXA 4Z0NA 4MICA 2JKYA 4TOIA 3LW8A 2R1VA 2PJDA 2J3DA 1UAGA 3BRSA 1BKYA 4Q1DA 3RHSA 1DGQA 1IN8A 2YQZA 2EWVA 4QM6A 1LK0A 1FP1D 2KQ9A 4MOWA 1NQVA 1IZMA 2Q8NA 4N40A 3V4SA 1UFKA 5AVQA 2H2WA 1NBAA 1OV4A 3FWKA 4OYHA 2QMUA 1JH9A 1U0GA 1YU9A 2FW0A 2CL0X 2X40A 4GPD1 4CG1A 3U1TA 4RKQA 3B1ZA 4DGSA 3LNCA 1LPMA 2QLBA 2TMDA 2G3VA 5G1PA 4KE9A 1DCFA 3E8MA 1KYXA 2IU6A 4PCAA 4MW2A 3GANA 1XO1A 2PZGA 4M0UA 4G4GA 1LC0A 2FWMX 3SXYA 3AC0A 3HN7A 2OQVA 1MMNA 4D4HA 5FOWA 4NZ9A 2ZWMA 1NY5A 1O6BA 2MR5A 1N9GB 3F1LA 1XA3A 4H4EA 1B76A 4A03A 2AD5A 4JCHA 2DR0A 2BEJA 2F8MA 1G2OA 2MSKA 1SPBS 3SXMA 1JPVA 5TR9A 1G8XA 2H7XA 3MPUA 5CDHA 4UEWA 4I36A 5K0TA 4TVKA 1RAHA 5IUNC 4RW0A 1NRIA 1PTJC 2BGNA 3DBVO 3GT0A 4KNYA 2J3QA 1NJ2A 1VLMA 4JRZA 1RRFA 4XIYA 4XARA 4BNVA 3K9HA 1CF9A 4AZ0B 1G5RA 4ZEVA 1SC4A 4JEIA 5E2AA 2BEVA 4B6JA 2QT1A 3QY0A 4V3CA 2LVBA 2MINB 5EKXA 3WK9A 3LYAA 1DZIA 4N8DA 2JH3A 2MYPA 2CDAA 2Q2NA 3E3AA 2DUJA 4WNAA 1I0IA 4DR2B 1Y81A 4Q3AA 5BSMA 3IX7A 4KODA 3CSDA 1ISHA 4HRYA 3P9QA 4IF6A 3TQIA 4BGDA 3LC2O 1NT4A 1UC4B 3EIWA 2HNKA 2WG2A 2P1AA 4IARA 2RGXA 1BR1A 1MIHA 2V1XA 3NAQA 5DTIA 1NVXQ 4UNPA 3BXXA 4HBZA 4OJYA 3OM8A 1CF4A 2R11A 4R3UC 3V8EA 4LZJA 5IYZB 5IMSA 3AL3A 3ANTA 4IJ5A 5LWQA 2UUAB 4GE0A 4G0WA 3C3BA 1ODSA 2QW8A 4CLDA 1DQSA 4NBNA 4CUZA 3L34A 1Q19A 1XX6A 1B0ZA 3GCDA 3EVNA 1KMMA 1PKXA 3IELA 3ETEA 4HVTA 3IT1A 1K5PA 1QE3A 3NHAA 4WY8A 5EKSA 1YIAA 4ZU1X 4GT1A 3UJDA 4RZXA 5CD1A 3DMNA 3WV4A 1Y3AA 1IUKA 1X0XA 3LCRA 5AKLA 4IJJA 4D9BA 1K5HA 4DDKA 2Q7OE 4QG3A 4BNXA 4AD8A 3EEIA 3LK7A 4QDTA 3U4HA 1CQIB 4XLLA 5JAQA 3HKCB 3TDKA 5SY6A 4RY8A 4GPEA 4GP9A 5HZMA 2JJYA 3CRNA 3KT6A 3VZCA 1MX9A 1TU3A 2VPTA 5F76A 1GSIA 4BJ6A 2J45A 2A4KA 3RNOA 2APJA 1K06A 4CIPA 4AQYB 1BBHA 1BGVA 5DT9A 1CZRA 4LMBA 2JCVA 4H7KA 5FTNA 1ZHZA 1R0XA 4IRMA 2PKRA 3AOGA 5K0SA 3TRDA 1CJBA 4JUCA 3TTWA 3ANMA 4LGMA 3AQBA 2EX0A 1NVVR 2FUKA 4OUDB 1IU9A 2Q27A 1ZHFA 2F3SA 4X3OA 1VKNA 5ALZA 3VV3A 3GT7A 1TWHA 3AR9A 4OG2A 1UDBA 3AETB 2PA0A 1I4OA 2XCTB 1Q50A 1Z4OA 5EIBC 1N2OA 1P4JA 3MWDA 1WETA 3C5EA 3DCIA 3GRPA 4RK4A 4F8JA 1DBVO 2OGZA 3AF2A 3PJDA 4TTAA 5EUQB 5FTJA 3UC5A 3DM9B 2I8AA 3O8BA 4QU8A 1RLUA 1DSSG 4RPCA 2BT4A 4UDNA 2YXPX 1E6UA 3UMCA 4CCWA 4Y6PA 1IY2A 2NP6A 4QZVA 3ZUGA 1RWOA 4AS3A 1EP3B 4BZZA 1IY9A 4D9NA 1MNAA 3C7TA 2CFSA 1NQOA 3JAWA 3IP9A 2Z2YA 4NMWA 2G1AA 5DH9A 2DQKA 3C43A 4LI0A 2BEUA 4QSHA 1R6UA 4HAXA 3K0AB 3MVEA 1QNLA 3TGPA 4Y2VA 1XZGA 3DMGA 4LY0A 4M9XA 2Z6QA 1MPTA 4CT0A 1U2DC 3PS9A 4MQEA 3HFGA 4XEFA 1W59A 1J21A 5AW0A 5AW1A 4L5IA 3WICA 1TJYA 2BFPA 3HDGA 4U6QA 3HHPA 3OPXA 2ZB7A 4YJKA 5KJEA 3U62A 1MMFB 3OTQA 5T4BA 3UWSA 3SIRA 2WKSA 1I0LA 4ND8B 3A6HA 2NN3C 3R5SA 1PQUA 4DWJA 4KYTA 2B4RO 1HDEA 3JX9A 5JVDA 4A4AA 3EDOA 4KHPB 2XYQA 1P8JA 3KDAA 1ECLA 2FZKA 3M5DA 3NNNA 1NNI1 1PZHA 5FBLB 3WTCA 4R68A 3S2IA 4CF4A 4YGXB 2ETSA 4EPYA 1X7ZB 3KLNA 1AF4A 1Z62A 4WGFA 1Y1SA 1JDBB 4X71A 4DUZB 4OQMA 1JUDA 4HATA 1W0JA 1MJGM 1Q0FA 3FYUB 5TV2A 1XTUA 1V45E 3K33A 3QXCA 4LMRA 4PE5B 4XUGB 4B09A 5LR6A 3TCXB 3PQFA 4CNBA 1O77A 1FMLA 3JAWB 3PRHA 5CK4A 8AT1A 3O0DA 3DYIA 1DJPA 4OI4A 1W2WB 5I5EA 5GJVC 3AB3A 3C85A 4I1MA 3DCYA 3UV7A 1ORDA 3I73A 1FP6A 1GRCA 3GUHA 4M36A 4WH0A 4C0QC 4DM3A 2XYGA 2X9GA 3PDCA 1WX1A 1NMQA 4QOFA 3CYFA 1HNZB 1T25A 2J0WA 1E1MA 4IFEA 4P31A 1MXFA 1P19A 4Q1AA 5B4UA 4C0AC 1CJKC 1R8JA 1R9GA 2J0UA 4E5VA 1QJ4A 2FEAA 1O5HA 1VZ3A 2AC4A 2IUTA 3IBFA 4HRAA 1HDYA 5TJ9A 3BH0A 3RE1A 2D5RB 2QUPA 2C99A 2XT0A 3CE6A 3SOPA 4RQTA 1RDFA 1SOAA 4R8RA 4I4LA 4DR3B 2H2FA 1UOPA 3IE1A 3ZTMA 5UKDA 1VE9A 3FYSA 4IWYA 4MRRA 4YCJA 3ZE1B 2J0VA 4DDMA 4JLNA 2NYUA 3L0ZA 4PFSA 3KKZA 4UUOA 3ZGXA 4MVYA 4IMJB 1ZOLA 2A92A 2AFIB 4FYPA 3WNCA 2XE8A 5BQ3A 2DVMA 1T9KA 2X5OA 3HDQA 4R1LA 2ZSEA 1P91A 3AY7A 3ZY4A 2GZAA 1A88A 2GN1A 4FBGA 2R7KA 3PDUA 4OQXA 4PBTA 5JBIA 1MMGA 5L0HA 4OHWA 4MTOA 1YA8A 2HBRA 2XVXA 1ZPDA 3ZE7A 4LACB 1JAZA 1J5EB 4OD0A 2PKYX 1V1RB 2Y9PB 1MTOA 1RWXA 3IDSA 5CLGA 1J97A 2YJNA 4K6HA 4B3SB 3KR0A 3DUWA 2PMWB 3L93A 3ZHYA 5J5VA 1XFDA 5EMMA 3WIDA 3TG2A 3BEDA 3GZ4A 3KQSA 3LHSA 4I1SA 3U4GA 1QXSA 2JCXA 1A1VA 4UDVA 4M1OA 4QBTA 3L0OA 5BYJA 1AUQA 1C4KA 1Z7BA 4JBGA 2QRGA 1VLLA 3N53A 1KNXA 1Y6QA 2J9UA 3OU6A 4NE2A 4QUAA 3A58B 1S3GA 2BZGA 3BAZA 2J5QA 3BFXA 5IBRA 1PLJA 1E1NA 3MC1A 3G50A 1KA9H 3PQ4A 3CJQA 2PX6A 3DQZA 1YZUA 1ZISA 3FX2A 1MO6A 4QKQA 4A2PA 4U5BE 2QLNA 4KR2A 3TZLA 2BUAA 3SFZA 1U7DA 4TLMB 4CKBB 2IYYA 4F91B 1AHIA 5JCJD 2B8NA 2DU8A 1BE8A 4ZT4A 4L02A 1L5NA 1IQUA 4IVQA 2CMDA 5BN3B 2PT9A 1E61A 1U2QA 3F47A 2PWPA 3DKPA 3ECCA 4HDNA 4M8SA 4RIIA 4Z0HO 2I2WA 5KSPA 3CX8A 1YRQA 3MXTA 1GPUA 1WU7A 2WWFA 4N0QA 2ECPA 5EY5B 1RQNA 5PGMA 2P90A 4OU4A 3TX2A 3FHJA 3H2SA 1VL6A 3A6EA 3F0TA 4F6CA 4NAHA 1DLIA 4JUFA 4LK2A 1XTKA 2DQZA 3VSCA 3GJZA 3KTAA 3VX3A 4BNIA 4YK5A 1UXJA 3EGXB 4N6HA 1JU9A 3QVOA 2DMRA 5JMPA 5EHXA 3GM2A 2GLUA 1GKIA 2IM8A 1ZKMA 2FQQA 2M1XA 4MITA 3IOMA 3B0PA 4MJ7A 3SEQA 4AULA 4PN7A 2Y0CA 5BQPA 3SBOA 1U1GA 3UJCA 3EAQA 4GI1A 5ALVA 1DWQA 4A92A 4BWVA 1Q7GA 1W19A 2C7BA 2VDVE 1FLDA 4O6MA 3DBIA 1RQ7A 1YK1A 3LT1A 1PUXA 5DW0A 5F7ZA 4D4KA 2WT9A 1ULZA 2V7GA 4LZPA 1EXDA 2B1JA 2X6TA 5AM4A 3E4CA 3HA3A 2IYTA 3VSAA 1QZUA 2CXQA 4A2WA 4CIDA 5M29A 3FYCA 3KJIA 4JTDB 1VYKA 1GZ7A 4JEUA 5F78A 4E6EA 5CTAA 3KLPX 4LPSA 2V7TA 3UK7A 2JAQA 1OTXA 2WJJA 2V7QA 4NFLA 1EP1B 3EDYA 3I9NA 3NYLA 3GUUA 3WL8A 2WVJA 1WUKS 1RKEB 3DLIA 3GRRA 3DTNA 3PX3A 3Q0IA 3VYTB 2C0CA 1PP4A 5A9TA 3LWDA 1RYEA 4DLUA 3L0YA 3ZDYB 3RRYA 5JS7A 1BN7A 3K35A 2FK7A 1G7RA 1KK1A 5SICE 1NV8A 1XZJA 2V0CA 1S7GA 3AVQA 4MI9A 3ONWA 1Y6RA 2GF0A 2G9VA 4DCMA 4KXUA 3EMVA 4PSVA 1CUHA 1JKJA 1J5PA 2H0AA 5FX2A 3OE7A 4DCJA 3QIVA 4PYNA 5KTRA 1E4VA 1J49A 5AI5A 3IQIX 2QVXX 4HX5A 5EE3A 3LC0A 2IODA 4B7UA 4CHTA 5FUMA 2C7RA 3RBXA 5BR7A 1Q1AA 4BWGA 4FUQA 1N2HA 1SVLA 2BMWA 4YBZA 1YL7A 2Y1XA 3IO3A 4F7WA 1NM5A 4LKRA 4B40A 1JKJB 3PRKE 4NCJA 3PHJA 3SQXA 5FA5A 4ASUD 1FJ2A 4PINA 2X14A 5DX0A 3GVCA 1C7QA 3FOOA 1E5LA 2F1IA 4LERA 5ILGA 4C9BA 3MCAA 2Q4OA 2R60A 4LMAA 1R18A 4RNCA 4XR9A 4E08A 2XITA 4RZIA 2GD2A 1V4AA 4ZIRA 2NYRA 4Q16A 5HYVA 1FJXA 2O2XA 3U8VA 3LLMA 3IQDB 1JR4A 3WLLA 3URKA 5A9RA 2CZCA 4JJKA 3EXAA 1ULSA 1B1CA 2J4DA 4B3RB 5LLDA 4B84A 4KMMA 3LESA 4PANA 4QLAA 2FPKA 2I8LA 2FOLA 1E2DA 1XV5A 2ISCA 5CCEA 4XI9A 2NXWA 3PP8A 3O84A 2BTQB 4L5AA 2G9RA 3N1UA 4M7OA 4M99A 4YMWA 1YE3A 4Y6GB 1H93A 4QJBA 4J43A 4ZQIA 3RT1A 3EQZA 3MSCA 4WZBE 2EFDB 3WK4A 3GUYA 3OCXA 8GPBA 1B0PA 3ZW7A 1P6QA 3KAJA 3O82A 4UU7A 5D2CA 3ETJA 3FDZB 3JYHA 1B8NA 3AF0A 3T5DA 4DR6B 3DVLA 1A7JA 1UJ2A 2EJCA 5M3BA 3MJDA 1EMDA 1W0KD 1LE2A 2CXSA 1E3MA 2TSYB 3HB9A 2W45A 1NVUQ 1BX1A 1T0UA 2AVDA 2M2IA 3ZE2B 4UUQA 1U8AA 1M5RA 1VA4A 1UEIA 1HDCA 2HTFA 1T6BY 2HMVA 3B13B 3FG9A 2WOOA 3PLRA 4MPTA 2OPHA 2VJYA 3TOMA 3SQNA 4M83A 5JS1A 4JXKA 1A2BA 5HDBB 3VR0A 2OOKA 5BRNA 3DFMA 4LWZA 3W2FA 5EQJB 5J5AA 1Q6ZA 2EKDA 4BS9A 5CVDA 3HKBA 3LGAA 1JEEA 1RWWA 4ZC1A 5A5DA 4ZT6A 2XGJA 1SY7A 1UBEA 4O0MA 3PXCX 2FKNA 1V2GA 2R47A 1SURA 4R51A 1JN0A 1GPJA 2BWJA 2PAAA 3M0EA 1SXIA 4GLBA 2B4TO 4HAYA 4HNHA 3KOMA 3A1UA 4ZOLF 3JRWA 5EIWA 3WAQA 3QTTA 5EJ8A 5KSOA 1KAGA 1SXJC 2VHCA 4OLAA 2R7OA 3HB5X 1XF1A 2O5RA 2VWPA 4H3HB 3ZS8A 3HY3A 2PZ8A 1FYDA 3QU2A 1JA0A 2FOXA 4RVUA 4U5QA 4HSEA 2PV7A 3SIPA 3UOWA 1N0IA 2AH5A 2ZDQA 1VSQA 3GNLA 1P1FA 1NVKA 2BJWA 3VU1A 1ACMA 3K4PA 1NVMB 2FK8A 3GAMA 2BL2A 2J09A 3F1KA 3MMSA 4WZBA 3E22A 3A1NA 4PTLA 2AN9A 1GAJA 1E4EB 2H1SA 2X1MA 1YGYA 1XRRA 1GTG1 2AN1A 3N2NA 4TZKA 4INPA 3TUJC 1FMVA 1BD3A 1EJ0A 4IYRA 4D45A 5LIPA 5LZ2A 1EESA 1E1RD 2VPPA 1H2AS 4YRRA 4KOEC 1E77A 2QN2A 4JOBA 4RTMA 1RXIA 3HHEA 1VOMA 1UOEA 5TT1A 3GQBA 2JGNA 1MHPA 2QW1A 4P7GA 3O26A 5FP0A 1X1SA 2FCRA 3A28A 4C7XA 4FHDA 1ZCAA 1A0OA 1AMOA 3SM3A 1G21E 4DB2A 1I30A 3U26A 1QH0A 5EIXA 4YRKA 1EVYA 3OZUA 1ZIOA 3TPCA 1P0QA 3EEOA 3QFHA 1I2DA 3NIGB 1JAFA 2FW6A 3DGFC 3Q9LA 4HFRA 2B36A 4QJ4A 5JO0A 5C1PA 1V5IA 2RH8A 4YJ3A 5L3SA 5LSAA 1Q0MA 3IEIA 5AK5A 4R1QA 3KKKA 3S27A 1JW9B 3VC2A 4LX0A 3IULA 4IGEA 4BGIA 3KQLA 4DV5B 1RIIA 1FA9A 1IXYA 1S1MA 1MORA 2ONJA 2G04A 1IM8A 4Q4HB 1M2NA 4CJGA 1ZOIA 2FPWA 2VJQA 1HE8B 1LWNA 2ACKA 2HMUA 1USGA 1QM5A 1Y6ZA 3C39A 2DYKA 4BKQA 5JNVA 1BCRA 1FLNA 4MSUA 1NLFA 3N6RA 1O95D 4WN9B 4LXHA 4XCXA 2D5AA 1V8FA 2I0FA 1Z8DA 2EX4A 4JEMA 4XSHA 1X94A 2VTEA 4D0GA 1GSAA 4DUGA 2GNPA 3CZAA 1S2MA 1QX3A 2JLCA 5JCPA 4XDYA 2GNAA 2ACVA 4EY7A 4AKHA 2OAGA 3IVGA 4Y9SA 1JMYA 1CU1A 5DCWA 3AUSA 1WS6A 1XXHE 5DSZA 5J1TB 3GDWA 6ABPA 1BS9A 5I4IA 3GK3A 2PZLA 1SC1A 3LUJA 4J7XA 4KNVA 3RODA 4D8YA 2PT6A 4LJAA 4FKBA 4LJ7A 3LCUA 2VK2A 5KQPA 2IP4A 4CDGA 3GLTA 3HMQA 4IMRA 1Y8ZA 4BQEA 3NWJA 2JLVA 1HE5A 1EEXB 5I9MA 2AJDA 1DX6A 1FEZA 3B8EA 3MTIA 5HGJA 4W82A 2PGIA 3HLTA 4MMZB 2FU5C 4CHGA 1TKCA 3OD5A 1Y6DA 2P7VA 3CHYA 3QA9A 2Q3EA 4TXNA 3U6BA 2OUKA 1W88A 1Z28A 3U7GA 1W0CA 2OCIA 1XTQA 2OAEA 1Z2DA 3USZA 4AJ4A 1CY7A 5LPNA 1L4NA 2NUBA 2GFIA 1TUGA 1MC4A 1RE1A 1VHTA 1FTWA 3DC7A 1U3WA 3ES9A 1OLOA 3MJTA 3OETA 3P8ZA 1KVRA 5FADA 5KUTA 2X9LA 3HU1A 3JRNA 3R77A 2EQAA 2QZJA 2HV9A 3PC4A 3HR7A 4PLTA 1UBSB 2Z9BA 2FF5A 1M1NB 3RVKA 1OXKB 2OFFA 4MVJG 5A04A 4P8RA 5BMOA 3LRTA 3TMAA 2VDKB 1CJVC 4GYWA 3LO5A 1JTEA 2XGSA 1C3JA 2FVXA 3QPCA 1ND6A 3STYA 3TZBA 1JDBC 1OXUA 3M5WA 3I42A 1LM3B 2AW3A 1S8AA 1L5KA 5CW2A 3TO5A 2PYDA 1VG8A 1T4CB 2A3NA 1Y4SA 3LQRA 2PQMA 5G0SA 2LCQA 3RSCA 3WKCA 3DOCA 4I6GA 4Z8YA 4PG5A 4D82A 4H4KC 5AVVA 1N75A 3CNEA 4TMFA 3BGDA 3NVAA 3P45A 3U13A 3U31A 2GZ2A 4DV7B 1RXEA 5FLKA 1U2PA 4MRNA 1OI3A 1PTKA 1TVKA 3Q5EA 3JR7A 1PFWA 1GUYA 4OXNA 3VXKA 5GV7A 2OZEA 5HPYB 4LNHA 3DOUA 4R16A 2A9OA 2H8GA 2NZ2A 3K32A 5ALTA 2WUDA 2EF0A 5EP1A 4NATA 2BM9A 1J0BA 1I6MA 1KO7A 3A3KA 4MGYR 4HFNA 3HUUA 4QAJA 5CA0B 2GH1A 2ZI3A 4LVCA 5ER6A 1X7WA 4NEQA 1SCDA 2JD1A 3G2HA 5HM8A 1BFUA 3CUVA 3G8BA 1YAUO 2ZXWC 1GU1A 4QREA 4D79A 4E33A 4HLQB 1DC8A 2OOSA 4FNMA 1D1SA 2WFMA 2H48A 2WTNA 3R3XA 4U8GA 1ZONA 4FCWA 2ZBFA 2A9VA 2RGEA 3QJYA 2A68F 3KQNA 3G0BA 2REQB 3A4YA 2R65A 4LDZA 1TAQA 1YIOA 3ESRA 3QKWA 4K3VA 2O2IA 4EL5A 1Q12A 2Q0SA 3IQ5A 1EWTA 4DSZA 4O7GA 2TYSB 5C3UA 5AKZA 2LFFA 2HIHA 3MUFA 3C62A 3PQ7A 1ODCA 3FOBA 1IJFA 1UOOA 2CF5A 2ZUVA 5LA6A 4B4DA 2FR1A 3MW8A 4LNUB 4C08A 1DEXA 3VSBA 4BFUA 2WKWA 1WUJS 2G72A 3NVDA 1UEJA 4X8HA 4BN0A 3UMMA 4QRHA 2BH2A 2C2GA 3S84A 1IIBA 4LQLA 4ML3A 2J32A 2C4NA 1GFWA 4G1BA 5JP7A 2FV8A 1XHEA 3LX8A 2QL9A 2HQRA 2BFFB 3GCZA 3G2IA 3TD2A 2HYIC 2OC4A 3I5AA 1IVNA 3U80A 4I4TF 1XWIA 3RQIA 1DZ3A 3AUKA 3IPMO 5FJIA 3L7NA 3ZE9A 1QFMA 2JHAA 3WLTA 4DABA 5EJGA 3K66A 4NTAA 1BW9B 1QVVA 3FFWA 4YP1A 5M04A 1CUJA 1QR2A 1Y7TA 2C4VA 3JQ9A 4U7HA 1ZUNB 2GFQA 3A9WA 5HF6A 3E9EA 1DV2A 3LUKA 2NO9A 1S3IA 2JC3A 4ER9A 3BIWA 4IJUA 1M66A 2AQHA 2H2DA 1B93A 2FW8A 5HQ3B 2QL7A 1UMBB 1LPNA 1QQBA 1Q17A 4ZYVA 1EFDN 3KDPA 2QSUA 2BTOA 2I4NA 3JQ8B 3TW0A 1WMDA 1U3GA 1Y9AA 5KYUA 3UM9A 2P2SA 2PRYA 1JKIA 2ZIFA 5I7WA 3SJ7A 3P9RA 1YQXA 3HU2A 3AKCA 1V35A 3FCXA 2Z04A 4O4IB 3PT5A 4ZVKA 4EG1A 4RVFA 3FFBA 4JBIA 2X0DA 1QU3A 3H1FA 3NHLA 3SQLA 3W8RA 2I6QA 3LP5A 4ZOLA 4PZCA 3UMGA 4C7OB 4ER5A 3TFOA 1Y4ZA 1SXHA 3QUCA 4AP6A 1JJVA 3H0CA 1CRPA 4MVUA 2G08A 1QVAA 4KFUA 5A4KA 4CIWA 3WLRA 1DNPA 3EXIA 2OB1A 4B6OA 2EQ5A 4TSFA 2Y1WA 2C2OA 2FUCA 3SFVA 2CL5A 5AUNB 3GROA 4NJOA 3ZBPA 1F4LA 4J1TA 3FPCA 4P1ZA 2NZYA 2QQ0A 3TGWA 5BV8A 3IKMB 5BSKA 1E92A 4B8YA 3JCUQ 1G291 1KMIY 3E58A 3KOZA 3AHGA 1JLKA 3U3DA 2I54A 4R3NA 3T34A 1EBUA 1FNDA 5IZCC 4QRIA 2D1SA 2Q9AA 4UM8B 1WXQA 4XAQA 3LLVA 2AQIA 2P11A 1MB3A 2IA5A 3JQAB 4C76A 1G98A 1AN9A 1N0HA 2AFHE 2PMCA 5GWXA 3B71A 4C1NA 4NG4A 3RPEA 1T5IA 2WTEA 4KQFA 4KI0A 3HCBA 3OVMA 2IDMA 4L51A 3VR5H 1JIXA 2AKEA 2AIRA 4N65A 1U1FA 1LLQA 3DAGA 3DBHB 2H4XA 3L79A 1C1HA 1DAHA 3H04A 2IV3A 3CGGA 2BDUA 2HLNA 4IQFA 3UYKA 1IN4A 3BB3A 5LP6B 4BBAA 3O74A 4HQKA 1CUAA 2R1VB 5HKLA 2ZB4A 1Y9DA 3TOZA 1Z4JA 4G4SP 4I99A 1BGWA 4PHHA 4D3YA 2WQ7A 2OO7A 2YQ5A 3VNUA 3GQBB 2OMKA 1YFLA 3IQXA 3JVDA 1QYIA 3ZHSA 3IKTA 2POQX 4UNIA 2Q6IA 1ISGA 1AQ6A 1ZLXA 2QY6A 1XVLA 2PGDA 3M9WA 5D3MA 4E4YA 4D1YA 2NZXA 4DRXB 1UWVA 1NI4B 1FUKA 1ESMA 1L4BA 1J42A 1XU9A 1XZFA 2AZDA 2IEAA 3IPYA 5CGQB 4DQDA 4W5RA 1RPZA 2PUBA 3R3JA 4W8OA 3A0RB 3M6WA 3MM4A 3HCFA 1Z6XA 4J91A 3HXMA 2RI6A 1JHDA 3LAYA 3OCJA 2JGRA 3UMVA 2C97A 2WF5A 2ODQA 1T6YA 1VTKA 4IMIB 4OF4A 4TSKA 2C2WA 5EP2A 1V7ZA 1E2HA 4ZAGA 4CM8B 3HUEA 2RGNA 5CDYA 2VJLA 1X8JA 1XZNA 2PT5A 5A1JA 1E79A 1XKQA 1XTIA 2GCOB 1JG3A 2ZAYA 1NFRA 4Q3EA 3RFTA 3RS3A 4AG3A 1ORJA 2JG3A 1AKTA 2I65A 2NSYA 2JHCA 4R7TA 3TQFA 2YL3A 3OPNA 5B7GA 3AHHA 3ZV4A 1MO4A 4YH1A 3U44B 5FF9A 1EM8B 4KBLA 3O73A 2CWDA 2YJTD 3V7OA 2OP0A 4G23A 3ZCPA 4CQJA 5AVYA 2MSEB 2XUJA 4X1OA 3COSA 4B3FX 3AB7A 3SI7A 1J2UA 3AJMA 4PFOA 1QG4A 2ZXEA 3CTMA 5ECDA 3SM9A 5KCZA 3O4GA 2WZGA 1OTYA 2FX3A 4J0DA 4CIHA 1ACJA 2W2QA 1ZI8A 4IOMA 3NS7A 2L69A 4RK1A 3DVAB 1JAXA 3P2JA 1OH7A 2JFPA 1F7UA 2AVKA 1Z25A 2BM1A 3G79A 2WU0A 2H52A 2NU9A 1CQIA 2IDKA 1CR0A 4RAQA 1XDSA 2ZBEA 3IOYA 5E2IA 1OQCA 2P6VA 1E0DA 6ADHA 1HWYA 3LFTA 1RMQA 1EZ1A 2PBLA 1DX9A 2ZTHA 2TMYA 5H3LA 4OIQF 1LS1A 3G1UA 3ZXUB 4BG0A 2KYHA 4LHXA 1TAUA 2X3FA 3RHFA 2A67A 3E2MA 3JTEA 1E0SA 1V1MB 1XTZA 2HCBA 3DULA 3E23A 2XV1A 3DZFA 3K4HA 2NZ8A 1AHHA 4GZ5A 3NBXX 4IWNA 4K40A 4X3CA 3WRYC 1AO0A 4YDHB 3D7SA 3PXXA 1JFSA 1WTYA 1PJRA 1EVKA 1Y1LA 3DLTA 4KN8A 4MS3A 4QASA 4TTRA 5DCYA 2V59A 1ZUWA 3N0RA 5D91A 3H0KA 1NIPA 2PKEA 4QX6A 5EUMA 2HUNA 2GM5A 3O03A 2FMTA 1X3LA 4ZYUA 2VNJA 1HFWA 1VIMA 3PQDA 5ALDA 5IPFA 3R7LA 3TTVA 2TMVP 1NUQA 4KO4S 1Q0SA 1T1GA 2V7BA 3GD5A 1BGXT 3OLQA 3IVCA 4JP1A 5E8RA 4FN4A 3BQ9A 4RK5A 1MX3A 1ESDA 5D5QA 1GKKA 4FD2A 4G8JA 2HCJB 4K9PA 4ULWA 3OCWA 1RW4A 4JJ8A 3D3EA 4P4NA 1EQ1A 3JD2A 4A15A 1H0KA 1L9KA 3MG9A 4IV8A 2X0EA 3DAOA 2QAGB 1EE2A 2XECA 1GA4A 3NGXA 2AJTA 4Y6QA 3T7SA 3WMWA 1N7IA 2V8BA 4M1TA 4XH9B 3W4YA 4UHHA 1KDTA 1QP4A 1JXAA 2R96A 5BW8A 2ZUTA 4ZV7A 4I4TA 3HNPA 2PH3A 5D7NA 3GFFA 3CLRD 1W85A 1D4ZA 1N6RA 3G9XA 3LECA 1NBIA 4L9RA 1TTQB 3W6PA 4IUYA 5GZ3A 4IZIA 5GGXA 3EPHA 5C35A 1SU4A 3W3ZB 1ESCA 1EXVA 2GZHA 4M1YA 4OI1A 5FWXA 1UAAA 3DHEA 1GPMA 3PL1A 4KXFB 3D5QA 4AJ9A 4JITA 1W7AA 3BN3A 3SEAA 3TNJA 3ADBA 3JYPA 1A4UA 2O1XA 4KCGA 2B82A 1SPXA 2WIGA 4R7ZA 3ZD6A 2XLWA 2JAHA 3BA1A 4MEJA 3A1FA 4TLDA 5G4LA 1TZMA 2WMOB 4WMLA 3GP3A 3WQRA 1ZHXA 5D00A 1Z8HA 1ZHWA 3NTRA 1GZHB 1U0LA 4K87A 1L4LA 2JIBA 5EHQA 3ZIDA 3CIOA 1H2XA 1A7KA 3VVBA 4TROA 5EJIA 1OB5A 2XLOA 2VPYA 3TQRA 1KYYA 3T6JA 2H57A 2HM7A 4UBKA 4HXYA 4W1PA 4GKAA 2AWOA 4HNRA 4P7JA 4TM7A 1T2AA 3ZK8A 5EP4A 5JU6A 5KTMA 2UYCA 1U4NA 1K98A 3H2KA 4KRXA 2QA5A 1MNDA 3W8IA 1DHTA 2A69F 1WV0A 2EGGA 2GOYA 2H9YA 4N4AA 5YASA 2P6OA 2VDWB 1R6TA 5GONF 2R5NA 3H9QA 4F92B 4FJ1A 3ZKWA 4AN1A 4TS3A 5IFLA 3EVTA 1TM7E 2ODTX 4G63A 3G89A 3MCZA 4QBKA 3Q6MA 3BMCA 4PYKA 4WAUA 3PR2B 2ECFA 2OFXA 5DI3B 5AXAA 2Z6VA 2HMAA 1O1YA 4D97A 2W2PA 3ZDBA 2FG5A 5TPZA 3ACBA 2DBVO 4ND1A 3TMYA 2OKUA 9GPBA 2FQYA 2WF7A 5IJAA 3EISA 1VIDA 2BKVA 4BNYA 4KN5A 1L5HB 1RKBA 4C21A 1PGNA 3NKFA 4NV0A 4PM4A 1A8UA 1B0UA 1TUBB 4BAUA 2YJ3A 5EEGA 1VLJA 5A3QA 5IKXA 5IVKA 3LVRE 5CD9A 2I34A 2ZR8A 3ZZUA 1G8AA 4KMRA 5L8VA 1QLEC 5AC5A 1JFRA 2ZI6A 2XXAB 4G8DA 4NS4A 2WE7A 1N5RA 2EJWA 3I5MA 4DSUA 1PLLA 3EX7C 3DZGA 4FYHA 3SKVA 3FFTA 4PYQA 2HCRA 1B3BA 5SY9A 4P0QB 1EG7A 2A1TR 2R7QA 1M8JA 3DF9A 4YCDA 1LSJA 1GQ2A 2AS0A 3C6MA 5DS4A 4LXYA 3ZPXA 2A1DD 2JJ8A 1CRLA 3NMKA 5DOZA 1MXHA 4IRUB 3V48A 1V43A 4GE3A 3JZFA 5FUXA 1L5VA 4HTAA 3S8EA 5ECGC 4IZ6A 4FHCA 1NQWA 3I2YX 4RJ2A 3P9IA 3EZ7A 4ZYWA 2H31A 4UUMA 4CR6A 4LRUA 2BVNA 4DFDA 3OTGA 1K5GA 3O4VA 2ZTVA 1DAEA 1N6KA 4BEMJ 4LK3A 4LEIA 5A7GA 3PQ6A 3SPXA 5IAAA 1U65A 3H2UA 4LGVA 1P1KA 2Y76A 2R4TA 4XDZA 2O0MA 3KD3A 5BV2P 2MU1A 3TQOA 2BGRA 3WZ2A 2VH3A 1E2BA 2E1PA 3VR2A 4DADA 4ZO7A 3QVGB 5FPHA 2H3HA 1ISIA 1G9XA 5TGZA 5KVAA 4P5PA 2G0AA 2GF9A 1GYRA 1PR1A 3EGIA 3URMA 2V3VA 4PAQA 1TCBA 3MFNA 1GGVA 2A0XA 1HFKA 1EJ6A 2RSEB 5CJPA 4ZZ1A 1D7OA 1ZN9A 3GFTA 3T9FA 3JRXA 5MN5A 1TX4B 1VMDA 3DR3A 4RHYA 5KEIA 3O95A 4W6QA 1W1UA 3M4CA 1RLIA 3NB0A 4HB3A 4MEBA 5FAKA 1E84A 2NACA 4ZIRB 1PHRA 1VHQA 1PWZA 3D7NA 4CG0A 1ECBA 1ONSA 2QLMA 1RHKA 4O4IF 5JAHA 2EX1A 3JASA 1Z17A 4OFXA 1T8UA 4RJLA 2ZYUX 3EIUA 1I01A 1ZESA 3ETLA 4HQFA 4RFSA 3HDHA 3OHPA 1W8DA 3WBFA 4GOJA 2Y3IA 3LE8A 3KQUA 2FZ5A 3L8ZA 4DCOA 5JNWA 2IXFA 2J9BA 2RHWA 3DC2A 4N6OA 3KYIA 1XQWA 1VHWA 1DUIA 4FFLA 8MHTA 1V3VA 4B3DA 3BRJA 3F3YA 5FWYA 1B2RA 1Y3BE 1M1YB 1ODFA 1RWMA 4FMPA 2W70A 2RHOA 4TTIA 3NP7A 4Y2HA 3MQFA 2L42A 2HHHB 2C96A 1RXVA 1DQPA 1Z56C 2QAGA 4PACA 3GZNA 4FE7A 4KSCA 5KWVA 2JVJA 4IHQA 1KI4A 4AF6A 3KSBC 3JQFC 1ZOPA 3EBOA 5LMNB 2P4QA 5D5PA 5E3HA 2BUBA 2G1KA 4YJDA 1P3DA 2W6OA 3LY8A 3OFND 4Q00A 3RQFA 3F3MA 4LRTB 5M5BA 1AM4D 4WEOA 4E31A 2B61A 4YJFA 4LF4B 2PZBA 4Q34A 2O54A 3A1TA 2N47A 1KEZA 3RIPA 1I6LA 2CGEA 1NP3A 1TJ4A 2C5LA 3VR2D 1QGED 2BPOA 4X66B 4QUJA 5L53A 2ORYA 4YPOA 2E21A 1K89A 3EH2A 4JI4B 1EINA 3QU4A 4C01A 2WHXA 3RVDA 3NX4A 4RZQA 1QC5B 2XHEA 3TE6A 3BWVA 1H9TA 1U6KA 1VP9A 1QPBA 3G5TA 3Q9NA 4KN9S 2GFHA 4N54A 1AUVA 5HTOA 3V1NA 2F1HA 3HNKA 3T15A 4O08A 1NAIA 5IS2A 1E1QD 1RLOA 2WPDA 2YWEA 3CWZA 4Z6KA 5BQHA 1O95A 3HVUA 4C2AA 4CMEA 2KE5A 1D2MA 3A32A 1IE3A 1JSCA 1SGWA 1SFRA 1VA5A 1JS1X 2B7LA 3IAM1 3RC3A 1LKXA 3BJZA 2HO5A 4IRXA 1L4KA 2EIMC 1XRPA 4LE1A 4OQPA 1Z8NA 1XEWY 4BN4A 4BNUA 4HDAA 3VPBA 5MDHA 3K1AB 3L1VA 4HEA1 4PC7A 4ZWNA 3UNGC 5JNUA 3K7DA 1MQVA 2VDJA 4K9MA 1HH4A 4O6YA 1E3LA 5EERA 5G3ZA 1WB5A 2BUCA 2Y2UA 1R5BA 2QRHA 3ESDA 4RSRA 1DKRA 5AK6A 2OHJA 4AWXA 3U3RA 4A2QA 4QULA 3VFDA 1XFAA 3VUEA 4PFQA 1P17A 4WL0A 3V2UA 4XVCA 1J1IA 3JD3A 5KTTA 3A4MA 3AI7A 4BMOB 5KYUB 2R4QA 3QWHA 2C31A 3L40A 3W7VA 4RZ3A 4LC9A 3HKKA 1T9BA 2JCGA 2Q3BA 2WKQA 1KK3A 1QLHA 2QRJA 3F9IA 3OCVA 3P0RA 4MUBA 1TMGE 5F5NA 1CZLA 2EZUA 3LCCA 4ZODA 2C2ZA 1NBMA 3FXHA 2O2YA 2V0NA 2ZAMA 3M8KA 3QBEA 2J7PD 3F5DA 3GLIA 1D0SA 1GL6A 3GLGA 3CONA 4FDTA 2ODBA 2ZYIA 3E7XA 3RS7A 4DEXA 1JIUA 4G1MB 1RCPA 3R41A 5IJ0A 3OIFA 2LTAA 3P9CA 4YRSA 3PB3A 1FX0A 4ZAYA 3ADDA 4F4BA 2O52A 4J1NA 1GRVA 1ZHTA 1DT3A 1ODLA 1DIBA 1RLJA 3FDZA 1JR8A 3EEFA 2P7IA 5BYBA 2DETA 5PNTA 4O1MA 3I01A 2PUCA 1SVIA 3FCCA 3B1FA 3FLEA 2EJVA 3K1IC 3LLUA 4W9RA 3UV6A 4P4SB 3ZBUA 5JS6A 3RD5A 3ETHA 2CNLA 5AM1A 2G0NA 5H4GA 4YCMA 1WXGA 3DL0A 1I5EA 4AJLA 3UMYA 2GRAA 3VYUB 4P0PB 3E9NA 1YVIA 3AUFA 2H7BA 2X76A 5KJCA 3V5ZA 1T8TA 4MI3A 3CH7A 3LXXA 1WHTA 2IPXA 4Q7QA 2RD2A 3DKKA 2QN3A 3DL4A 4MCJA 4X44A 5CG2A 3EAGA 4TSRA 3ZBQA 5DBHX 4JU9A 1NJ8A 4GS5A 1EB9A 2OGUA 2PFKA 3ODPA 1SRRA 4YCNA 3U44A 1KOGA 1JR6A 4DLZA 1JOGA 3AJ9A 2B37A 2CFRA 1SC3A 3QVVA 2F90A 4NAUA 1RM5A 3O2QB 1TT5A 3L8YA 1F8FA 3GLQA 3ZHOA 1GFIA 1P4RA 2YINC 4I19A 3SZGA 3ABRB 3Q98A 1ZD5A 1ODTC 4PHCA 1XQ9A 4CM8A 3J81k 1CVLA 1NW7A 1ZHYA 3JQBC 3BD8A 1NE2A 4FNAA 1VYIA 2CLEB 5DLDA 4E51A 4PYJA 3ZHTA 1T6QA 1OGIA 1CUGA 1PGQA 3ENNA 3TB4A 2OEVA 4NZZA 2WJYA 1KYTA 4AKGA 1FQKA 3V2HA 2G06A 4KWHA 4KFRA 5JVDF 1ZDMA 4Q15A 2VUTA 3EMBA 3NBQA 1C8KA 4CKWA 3EIEA 2MCFA 4PYIA 3CPHA 3K2BA 1T5LA 1O7JA 4E1BA 5E8JA 3BK2A 4KDCA 5D3KA 1HLFA 1X1TA 4J2HA 1NVEA 3FCEA 3CVYA 1F1JA 5C3MA 1EFLA 4EHAA 4LLCA 4EJSB 5JYDA 4AZ3A 5DNWA 3DTTA 3L06A 4F85A 5BR4A 5B1EA 2BFDB 4OJNA 1OLUB 5E6RA 4ZCIA 2PUGA 1EAYA 2HDNB 4PO3X 1Y89A 2VZ0A 3KV3O 4AG5A 3QOFA 4XYBA 3JATA 5IKOA 2AJBA 3IUSA 3T7TA 2YJ5A 2A1IA 4L28A 1ML3A 1H1DA 3J06A 1BX0A 2PEYA 3AIIA 1ZSYA 4YQEA 2HYDA 4RX1A 4TTQA 3RVPA 3VZRA 4AQ7A 3IAM6 4X1KA 4M60A 2PYIA 5IC5A 5AI4A 1DADA 4XGQA 4YJFB 5J63A 4CS7A 1O54A 5BVGA 1K86A 2ZE5A 2PT7A 3RU2A 5TQ0A 5ADVA 2PY6A 4H6XA 1WHSA 3NMIA 2SCUB 3NHFA 2BFFA 4FSDA 4RK0A 3LEOA 4RLHA 3G85A 1QBGA 1YVPA 3NANA 2CFTA 4XB6B 4QU0A 1E83A 5KHLB 2REBA 1WQ1R 4BLRA 4YRIA 4MYRA 5LMZA 4HNAB 3OP4A 3SKYA 3AGQA 1PR4A 1GTVA 3WYFA 2R9RB 4CV0A 4RKYA 4HXEB 5EJ7A 3TECE 3OQOA 2BL4A 3PVZA 2WD9A 3DLAA 3HJCA 3PE3A 4FZ3A 1LVKA 1PL7A 2Q5HA 1A9RA 4PO1A 3RIYA 2G83A 4DLAA 2OESA 4WLNA 1U0NA 2VP9A 5JLIA 1R66A 1Z0SA 1Z07A 2I7DA 5AJTA 4P35A 3BWCA 4C78A 1Z73A 4ZMBA 1N1GA 1PJQA 3ML1A 3ICEA 2CHEA 2CNBA 5G53C 3N8KA 421PA 4C7JA 1TCVA 2M9MA 3FSRA 3TKLA 1VC2A 4IGFA 4RMHA 1E2XA 4MI6A 4ZOCA 3O4RA 1DCKA 2RKWA 4ZQCB 4HN2A 4RMJA 4YXWA 4JA2A 2P4UA 1DINA 1SUWA 2FP4A 3BXZA 4MX8A 2H85A 1SCIA 1XAJA 3I58A 1EFTA 4WKPA 3QOWA 1QH1B 3KUDA 1NBOA 4R41A 2VR1A 3EY9A 3OEHD 2F17A 3Q3IA 3S8MA 1ISSA 2DY1A 2H1LA 2QB5A 1RM0A 5TGDA 3QYAA 1DOWA 4LZWA 2O1SA 4O4JB 3CQ9A 4MUIA 5IHPA 5EZYF 3N8NA 3F9CA 4H3VA 3OE4A 4HS4A 1EFRA 1IRXA 1OXTA 1UQTA 3FVQA 4NBWA 4DM4A 4YNBA 1K2VN 1W5BA 3ZQ6A 1E6LA 1HKHA 3PJGA 3E15A 3AKDA 2Q6VA 3TOXA 3RYFA 4RZSA 4WOBA 4JIGA 1V1RA 3TLXA 3CX7A 2G77B 2P6MA 4YV1A 5K03A 1DHRA 3F5SA 3PSAA 1FDVA 1OXVA 1QTRA 1AXRA 3OE5A 4WLOA 5DM2A 1AJEA 1QCDA 1XHLA 2YOFA 2B1RA 3WOVA 3D31A 2GA8A 2QR3A 3WFJA 4BN5A 4MHSA 4CKEA 1HTTA 3CN9A 3KPYA 4HEJA 4QPZA 4DLRA 3C63A 1BEEA 1OZFA 2B99A 3LKZA 3UJBA 1G7TA 4J0JA 2NOAA 1J2EA 2INGX 3CGWA 1MU0A 2VQ6A 1E9FA 2H5JA 3COVA 3PGLA 1EE1A 4PLZA 4YAOA 5DXFA 2WUGA 1YYJA 4EDHA 4LXXA 2ZIUB 5LLTA 3E18A 2ZR9A 4R31A 2X2PA 5HSWA 3NGMA 3QEMA 1Z4KA 3HJHA 3ONVA 5IDVA 2RIRA 1A5BB 2IYZA 4L72A 1Y5RA 1V48A 1YRAA 4ALMA 2GGSA 4UU8A 2ZVJA 1VLQA 2OQMA 1BD4A 3W8DA 4M3NA 4C4ZA 3K6BA 1C7EA 3QF7A 2J87A 1TVKB 4MVOA 1JQ3A 1PWXA 2DSTA 2QUIA 3HA2A 3HV2A 4EQ6B 4XGKA 2NUPA 4LXIA 1AEPA 1TT5B 2AK2A 2EGUA 3WBKA 4AC9A 2BFAA 2QD5A 1KIFA 3NI2A 2KK1A 4M76B 5CPFA 1CEYA 1TW3A 3OH8A 3OQBA 5JRAA 1JZTA 1TPZA 1R27A 4QDKA 5HKKA 3FKSD 1MD9A 5FTKA 3A9TA 1JH8A 4G8BA 5CNIA 3NBUA 4C3DA 5U1PA 2ICWG 3UK0A 1KFKB 4DQVA 1WKVA 1TVEA 3IUEA 4MB6A 3HB1A 5LQJA 1J56A 1VMAA 1FRFS 1Q0ZA 3GRKA 1L5LA 2B2NA 1C03A 1N2ZA 2OG2A 1U3CA 2FLVA 5FJJA 2O5CA 5FH9A 2AV6A 1Z4PX 3AO0B 2HPAA 1U89A 1XRMA 2LIVA 2QPOA 3UFBA 1KBQA 2EP8A 1J33A 4II2A 3UICA 1EIWA 1TFOB 5D6OA 5CLHA 3NHZA 3H7AA 5JADA 2QYOA 2R85A 3UHAA 5KIAA 1M8FA 1XZ8A 2JJ1D 2R8OA 2Z2IA 3ZXSA 5LC1A 1AC5A 5HS4A 4OBBA 4E5MA 1KEWA 3I1IA 4J3FA 3QXXA 1DB3A 1XVAA 1Y5NA 4JSYA 5HTKA 1ZN8A 3V7UA 2EQBA 4HNVA 3ME5A 4BP1A 4UMVA 2XGGA 2B92A 4KK3A 4MRMA 1BCSB 1CQJA 4DSTA 4ZZIA 2HX1A 3E9DA 3NJRA 1GCGA 1CX9B 4O5AA 2Z6UA 1QG0A 1OGJA 1IOZA 2AZ4A 2MJLA 2W6NA 5ABPA 3GAFA 4EPVA 3GLIB 1PUJA 2JKVA 5EMKA 5JI3E 1N5OX 4B9EA 4HH0A 1OYYA 1LTKA 5J2UB 3ADCA 1MC8A 1VE5A 3AZOA 3EC2A 3PHBE 5HMLA 1LWOA 5FUQA 2OJED 4Q9DA 2WB7A 4CBEA 2IZ5A 3IGFA 3LQ2A 1XEWX 2HJHA 4MCHA 4UM7A 2JFGA 2I7XA 2R25B 3RUEA 3RT9A 2KI5A 4WX2B 2PJUA 5IMBA 3U4AA 3FSGD 1C3XA 2BF4A 5KWEA 3TQCA 4BLPA 5CA0A 5ED0A 2I1QA 4ESOA 1UPAA 4G3XA 1T4DA 2QD1A 3ENVA 1K4KA 3GXOA 3WJAA 4BB0A 4L4ZA 2DR2A 3I72A 2HGSA 2G1PA 1GNVA 1GLNA 1L7XA 1U1EA 4U9IS 4EJFA 1OCEA 2NQ8A 4YRPA 4JLOA 2UZ1A 3DMTA 1DBPA 4EVSA 1YYXA 1KU0A 3AUAA 2FF7A 5CDSA 2VSNA 3OZAA 5HBGA 1I4YA 3ELUA 2ZJAA 3HSKA 5JYEA 1YCDA 1L8OA 4ZVUA 1A7DA 3RFVA 1WUTA 3VOTA 9ABPA 4PS0A 1T2UA 3IEUA 5KQMA 1DJOA 1MRSA 2G70A 2GPJA 4IS3A 4JEBA 3DLHA 3OC6A 4LA4A 3PCTA 3TLAA 5K0BA 5KC9A 3IMFA 1HQKA 1L5ZA 2QY9A 3PCXA 2NTNA 2B6HA 4XCVA 4F2HA 1TUIA 1FW8A 3RREA 3BRWD 1LQUA 4XWWA 2JB9A 4MUYA 4IIEA 4QDUA 2ZSJA 2VP3A 3Q7SA 5I8WA 3MEQA 1AHPA 3EPJA 2HPVA 1H1LA 3IMKA 2G1JA 4NY1A 4TV9B 3LBYA 4FGSA 1PS9A 3BXEA 2QRUA 4CVNA 1H9GA 4NE7A 1KP3A 1NVVQ 4RKEA 4B7XA 2QP9X 4E4TA 5CHEA 3W5BA 3KQMA 5IVPA 3T5PA 2KLHA 1D0IA 1I13A 4PYRA 4WT7A 4KQIA 2L81A 1UP6A 1P7WA 2EL9A 3T1TA 2VP6A 4X65B 1HRDA 4JOSA 1L9XA 5DYIA 2JIOA 3QPDA 3ILXA 2VF7A 3D0KA 2ZIEA 3HZOA 2HI0A 2XEXA 2HLPA 3JQQA 4OA5A 2LD4A 4PCLA 4TSFD 5L3ZA 2A94A 1T9GS 4DV0B 3H2IA 1R5NA 4CT5A 3R0IA 1J9ZA 1CUUA 3IPXA 4RXUA 3A1WA 2XKJE 2ZBDA 3UF0A 3GFRA 1GUFA 2PPVA 3DV2A 1YR6A 4QRDA 4M9RA 4D3XA 1PV4A 3TTUA 1UBKS 4UE3S 3PC2A 2FSSA 4FB4A 1NP7A 1U7ZA 2G9UA 2QTAA 3EQ7A 5L0DA 1UT8A 1QQ6A 4R8MA 1M0TA 3IEPA 4TT3D 1WPXA 4ARIA 4W8KA 5GQSA 5DLJA 2A3RA 1JSRA 3OQPA 3UTDA 2J0EA 3R6TA 3TSWA 3KHTA 2QIOA 3PI7A 3HUFA 4K2HA 1Q57A 4NNPA 4OHZA 1I9CA 4OL0A 4X7PA 3ZJYA 2AWCA 4BGVA 2XB2A 4GXNA 3QBVA 3T1VA 2YVAA 3V4VB 4HDQB 1GDHA 3K6SB 1ULUA 1KJ9A 1VPVA 1DDIA 3UIEA 4HDSB 3A3OA 6REQA 1L3IA 2AKYA 5F3RA 1S02A 2K87A 2M4EA 3UUFA 4QBFA 5B7PA 4N9QA 1ZHHA 2GARA 4LY6A 4RH0A 2GLXA 4PZLA 4QYIB 4B6FA 2IS4A 1A9YA 1LSOA 4NWIA 2QROA 1V16B 1TWCA 4KXLA 2WZFA 4O79A 2EKBA 2O3UA 1YJ8A 3TEFA 3A2MA 3C98A 1M2JA 1ZW3A 2GN2A 2QF7A 4WCFA 3KLBA 3W9BA 3L8GA 4MW8A 3F7NA 2HRBA 3NHWA 1VJDA 2P41A 3D3WA 4FZ5A 5IH3A 1O5TA 3WHIA 2ZIAA 4Z9HA 4TWIA 1DT5A 2QG9A 3TH5A 1OR2A 4JVSA 4LJ4A 2J6CA 2FMFA 1CQZA 2QTFA 1E9SA 3FWNA 1IPHA 1KIAA 2C9ZA 2G9QA 3GPBA 5LP6A 1XMJA 4NULA 1QE0A 2VHZA 5LVAA 4MDYA 2JD0A 3NBKA 4C4YA 5A62A 5LXTF 1OXKA 3C3CA 1RJDA 2FPLA 3G7UA 3IUPA 2RMKA 3N2EA 1LTHR 3IHUA 2ZYVX 4D9EA 2GESA 2YZNA 5IM4A 2A9FA 4OM7A 5D6NA 5KOJB 3CEHA 3ILSA 2R8RA 3KJEA 5FCDA 3N3AC 3MXOA 3F6RA 1A8PA 2VTKA 2J8WA 4TTJA 2GVZC 4XE5A 1BE1A 1PJTA 3M6VA 3INTA 2JHGA 4MQ5A 5T41A 4PJLA 2IXAA 2AQKA 4BEBA 3GUCA 5IYZA 4ERXA 2R7XA 1QU2A 4JV5B 2H2IA 4MTCA 1F20A 1LX7A 5FEUA 1U9YA 5DM70 1IK4A 2AZMA 3QFRA 621PA 4UM9D 2AYXA 3VPXA 4AXXA 3MFYA 2CFCA 3NJ4A 2MSWA 5DE3A 2ZJ2A 4TS4A 4MYSA 4NI5A 1G1MA 3ZHVA 4E5UA 3A3YA 1PV2A 1B6GA 5LMUB 3T5CA 4W1RA 3P2IA 2PS3A 4S1PA 3F2IA 3LBHA 4DG8A 2RFLA 3BFVA 4M1WA 5H80A 4CODB 5P8WA 2E55A 3ZWOA 4BKUA 4ER0A 2I2FA 1G3IA 2GSDA 3M1CB 1L4GA 1Q16A 1XI2A 2LDXA 4YHBA 3VVCA 4LXQA 4R1MA 5C8YA 3VYVA 2F22A 3M4XA 3K1AA 4BDSA 5DNUA 1YF3A 2O8DA 1MT3A 3RYLA 3V1YA 2AR0A 2XYPA 2ZSAA 1XXHA 5FQOA 4DW8A 5KVSA 3PNBA 3KK0A 3FPLA 4RGBA 3DSRA 2Y71A 4JXZA 2XNDD 4ZANA 4A8HA 3NKVA 4IAOA 3MAAC 2WI8A 5L51A 4F4JA 1BR2A 4J94A 4ZALA 3RC7A 4J30B 4ZKDA 4MVJD 3VZSA 1VE7A 4IINA 3IIMA 5EEHA 1Y8QA 5TB5A 4GC5A 1IM2A 4F2WA 1UPBA 5ALLA 3MRTA 1ZIDA 3CLUD 1Q0GA 3PHF2 3FAJA 1UK7A 2C2YA 3U4MA 1J0AA 4JUBA 4LWQA 4WBNB 1P5FA 3LCVB 4Z9YA 3V4FA 3OFVA 3QVKA 3OX2A 1LW6E 3ZQ4A 4DVJA 1I9GA 3NAMA 1YSCA 4CFZA 4HUQA 3IFSA 3M4JA 3SP1A 1DOAA 1TFRA 3E2PA 3LJBA 3NHRA 3UJ8A 3K0AA 4XEVA 3AB8A 4ADSG 2QX9A 3JTLO 2G4VA 4PSUA 4O25A 3FLAA 2FPIA 1U2GA 3VSDA 5HJ7A 2QRNA 5F77A 1RBMA 4N7BA 2G0TA 2A5DA 3IA7A 4I55F 4D44A 4M38A 4BO1A 5KOIA 4MVMA 1G2QA 3O90A 5H7XA 3WMRA 3ZIAA 3WWZA 5JBQA 5LP1A 4EYSA 4EP1A 2G4LA 2WL8A 1WXHA 2VT7A 3PF8A 2R6GA 5JCZA 1VE1A 4MYCA 3OQIA 3VR1A 1PDVA 1PSDA 2Q6LA 3KYBA 4ZVTA 1M2WA 2XM4A 4BTVA 1MW8X 4BGUA 5CA0F 2J9ZB 4KQMA 1BHSA 2CE2X 1ZK4A 5BSWA 2DT5A 2FFJA 2ORIA 3Q41A 1RZ3A 4XLNF 4IVNA 3QXHA 1H2WA 1ATZA 1N5DA 1U8TA 1U3VA 2W0MA 5CJJA 1X0VA 5FUBA 4AP5A 4BX0A 1U8EA 3L7DA 4YXFA 1XJ0A 2EIKC 3ITDA 3VRCA 3KPUA 2R1ZA 3PVSA 5J23A 3ICWA 4I5DA 3QMKA 4UVEA 5D3QA 3B70A 3C14C 5CNKA 4BFWA 2HIGA 2QTHA 3IOBA 3WGUA 1UJ6A 3KE8A 2Q2QA 4J4BA 4Z1MD 2OCCC 4E7SA 3D6HA 3FKJA 2Z9DA 1X7XA 2F3RA 1WU8A 1Z22A 4PTYA 5C37A 3FDQA 3RSZA 4D9GA 2PZFA 3JCZA 1PQYA 1SHLA 1RC0A 1H4TA 1YI8A 1WCV1 2PJZA 1Z26A 5T3WA 4KXQA 3WP1B 4MV8A 1ST3A 2X0IA 3MJEA 1OILA 2MYSA 3GRYA 5HFJA 4MUEA 4JI5B 3EG9B 4RA9A 4HPWA 3F78A 3A4VA 1C7ZA 1EX6A 2IYVA 3X1JA 4BO5A 1MH9A 4DDUA 4E4RA 1V1MA 4DXDA 2BYTA 4DHWA 1JQJC 3TB6A 1GQAA 1A9TA 4IWXA 1PK9A 1JQKA 3ASNC 1T5SA 2YH2A 3B48A 4FFBA 4DLLA 4F3YA 2DF8A 2ZRFA 4ODIA 5JVDB 1GO2A 3SD7A 1ORYA 3L7OA 3WA6A 3ZV6A 3GEPA 4CU2A 5DXJA 2AJ8A 4NEHB 1UIRA 3OJFA 3O2JA 1NBBA 2ZUFA 4L0DA 4EA9A 5EWLA 1RQRA 4AX4A 1H22A 2Q21A 2G82A 2UXCB 4M0DA 1JDPA 2I2DA 2G17A 3IAAA 3KKQA 4OXKA 3IUNA 1N2CA 4FCCA 2IKQA 3EXG2 4JQZA 4IIBA 5DFAA 3W5IA 2BMJA 3KJHA 3IUBA 5EGNA 4DSNA 5JAMA 4ND3A 1KI3A 4JJFA 2E48A 2GR9A 1IULA 3E35A 3JQGA 4J8PA 2BEUB 1OA0A 2PGAA 1GD1O 3EXFB 4JAVC 5HEKA 4AIIA 4EZEA 5BSVA 3ZVKA 1QUFA 2C54A 4X24A 5AI0A 5CI9A 2ZATA 2V3CC 4MMXB 3X1OA 1ULAA 3TTTA 1VLZA 4D98A 3D4NA 1VFNA 3EF1A 2QENA 4XRGA 3AQCA 5H70A 4ZYZA 1OF1A 2GTHA 1XNRB 4BQPA 1JYFA 1ZA2A 2JH8A 4JY7A 3AYXB 4QXQA 3DE0X 4N5HX 4XPWA 3KOOA 4BVLA 1JWAB 1JHXA 3JVEA 4BB5A 3VYWA 3PKZA 3QU7A 2I03A 1ZGZA 2QQGA 3W04A 1XN4A 4I14A 5DP1A 4BCDA 4DDVA 1E86A 5JPCA 3K31A 1G6Q1 2XYHA 3RJTA 1B8UA 2EW1A 1MCZA 3MA0A 1SHZA 3Q7LA 2L82A 4GOLD 4E15A 4MGZR 1NU7D 5DOVA 2GXAA 4Z0TA 4K6OA 3IAHA 3MMPA 5BQOA 4KNWA 1I3OA 4RD2A 4RKRA 3A6ZA 3ANXA 2FX5A 1ADBA 3CA8A 3MGBA 4MWGA 1CUXA 4XCQA 3U3BA 2JFZA 4RESA 1B15A 3SYLA 5HIAA 3L04A 3D3QA 2A1TS 5H59A 4WWHA 3CEJA 3QWAA 4L4RA 1AK2A 4Y0VA 3COJA 3DDUA 1DOZA 3I2KA 4TL9A 1L4UA 4OB7A 1UJ5A 4M0LA 1XK6A 2VQEB 3PXBA 4DWOA 3RLIA 3CX4A 4E2XA 3WGMA 4DCNA 3OOHA 2XL8A 4JLVA 4DGQA 5CGZA 1KU6A 1RVV1 4JGBA 4MLCA 1T5TA 1OVGA 1UKAA 1V5FA 4B85A 4ENUA 3LF1A 2Z95A 2VJOA 5MGBA 2Z09A 3K6RA 1YZAA 4C0XA 4OL9A 1IM5A 1WABA 1GEGA 1SC6A 3GRUA 2BKAA 1ZD4A 4KZKA 5LQUA 1DPGA 3IE2A 3OOJA 1DMSA 4FMDF 4DNFA 3BHIA 1A9OA 1NJ6A 4Z1MA 4ZYLA 1T5BA 2E85A 2J7KA 1YRWA 4UPDA 5EE5B 3QKSB 2V4ZA 4MVJI 5JXJA 2AP3A 2H1HA 4US1R 4S05A 3JPWA 3SXKA 2P4HX 1FSFA 3B38A 1F9AA 2EDCA 1JHMA 1TO6A 4MQLA 4Q02A 1EH5A 2G8NA 5KYVA 4TT3A 3R44A 5A3SA 1QRSA 1HG1A 1L7CA 1GZ4A 3RRMA 2I80A 3G2KA 5ARCA 4AYXA 2C29D 3QMMA 1QDLB 1Z88A 3KAKA 4DG9A 3BDAA 3PGA1 3T12A 3BWEA 4MWTA 1IC6A 3EQ9A 3V4RA 1QYWA 3JQFA 5EIEA 4C2TA 1CUYA 3KXIA 3TE7A 2VNAA 1JT9A 4LRWA 4ANFA 1NF8A 3GPLA 4MPPA 1IEXA 2X6RA 1TQHA 3U8PA 1FDWA 2VCAA 3H3FA 2YN2A 1CD5A 1FFGA 1ZO8A 3QF4B 4GLLA 2F64A 5EFZA 3H16A 3S8YA 4BNMA 3DXJF 1CGME 1CY4A 1BMFD 2OCDA 2H2AA 2QPTA 2V74B 2X5NA 3QW2A 4J16A 1SHJA 3C5VA 4GMXA 3U4QB 2CMFA 2I6UA 3NXKA 5K6TA 4MV3A 4CF3A 3RU3A 2XW6A 1P2TA 4AUKA 3I0MA 2DX7A 2H1FA 1VKZA 5C7LO 5ELXA 4BFZA 1BH2A 1XJWA 3AV3A 4UHBA 3FTQA 3V2GA 2JKZA 4I0WB 1DELA 1HT0A 4IIUA 4D80A 3NIFB 5G1NA 1T8SA 2Q5FA 4BVHA 1O97D 2CMKA 4JP5A 4G36A 3HLYA 3HS3A 5FPPA 1YKGA 3PEFA 1RM3A 2C1XA 3BHNA 4DC0A 3QPUA 2M6LA 3TXXA 4KLRA 4BBZA 2Z6AA 2QE9A 1KDPA 2BBSA 3I2IA 3OTWA 1VYHA 1YA7O 2W8BA 3CW8X 4K1LA 4RJJA 5EZYA 3IXMA 2PMEA 3U9TA 1APBA 4E2ZA 1J70A 1YJQA 1Z5UA 4BLQA 1N6HA 4YFYA 4EKIA 1DBWA 1IB0A 2G40A 4R0NA 4XUEA 2OBLA 2AL7A 1SQ5A 4AXBA 1QGYA </