4KNVA

The crystal structure of apo human hdhd4 from se-mad
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
241
structure length
241
Chain Sequence
MRAVFFDLDNTLIDTAGASRRGMLEVIKLLQSKYHYKEEAEIICDKVQVKLSKECFHPYNTCITDLRTSHWEEAIQETKGGAANRKLAEECYFLWKSTRLQHMTLAEDVKAMLTELRKEVRLLLLTNGDRQTQREKIEACACQSYFDAVVVGGEQREEKPAPSIFYYCCNLLGVQPGDCVMVGDTLETDIQGGLNAGLKATVWINKNGIVPLKSSPVPHYMVSSVLELPALLQSIDCLVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N-acylneuraminate-9-phosphatase
publication title Design, synthesis, functional and structural characterization of an inhibitor of N-acetylneuraminate-9-phosphate phosphatase: Observation of extensive dynamics in an enzyme/inhibitor complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 87
structure length 241
sequence length 241
chains with identical sequence B
ec nomenclature ec 3.1.3.29: N-acylneuraminate-9-phosphatase.
pdb deposition date 2013-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.710 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4knvA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4knvA01
3DAOA 3GYGA 3QXGA 2FI1A 2P27A 4Y2XA 1TJ3A 1Z4OA 4OFZA 2O2XA 2X4DA 5ALGA 1NF2A 2B1RA 4UMEA 4HGOA 4NAVA 3ET4A 3L8FA 5AW3A 1WVIA 1L7OA 1VJ5A 1ZD5A 2G1AA 4EELA 3IRUA 1L7MA 5AM3A 2I34A 2CFRA 1MH9A 2NYVA 2YJ4A 3CNHA 3WKDA 5ALSA 4NFLA 1Y8AA 3FVVA 5AHXA 3ZTWA 3K1ZA 1QYIA 2IOFA 3L0CA 4AP9A 3PGLA 1WR8A 4L6CA 5AI8A 3DNPA 2C88A 1RDFA 5AVXA 5AVWA 4E88A 2HHLA 2RB5A 3AR8A 3ZVNA 4Y3UA 3DV9A 3WK9A 1F5SA 2RAVA 1S8OA 3KZXA 2EATA 2IOHA 2CFSA 5AI6A 1J97A 4QQFA 1XVIA 5AI9A 3SLRA 3B8EA 3QLEA 3WKAA 2D2VA 3FGOA 1IWOA 1ZRMA 4DFDA 2GFHA 2I33A 4BX2A 3KOOA 2R8ZA 4KX5A 1AQ6A 2MU1A 5ALNA 4EEKA 5ALEA 1QQ7A 5ALOA 5AW9A 3SD7A 5A3QA 2P9JA 2CN1A 5AVTA 1S2OA 2VKQA 4DW8A 4JB3A 2I54A 3N28A 4KNWA 4IG4A 3R4CA 4JDPA 2B30A 1Z5UA 3U7FB 4NABA 2GO7A 3HLTA 4HAIA 3MN1A 2B0CA 3W5CA 1Z4KA 4Y2JA 2FEAA 5AW4A 1RC8A 3ZX4A 1SWVA 3L8HA 5ALUA 3UM9A 1PW5A 4BEWA 1J8DA 4XQ0A 3UMCA 2W11A 5AM5A 4KX3A 3HYCA 4CE6A 2I6XA 4QJBA 2YN4A 4G63A 4YGYA 2AUTA 1Z4JA 3UMBA 5AW6A 1NNLA 3NIWA 1RMQA 4BKMA 3QUTA 3U7GA 3EWIA 2PKEA 4F72A 3ESRA 3WKCA 4Y2TA 5AI0A 1O08A 3AR7A 4XPZA 3A1CA 3NAMA 2HX1A 2YJ3A 3U13A 2W43A 3QUCA 1T5SA 4H1WA 2AMYA 5ALRA 2BDEA 5ALZA 1LTQA 2G08A 3ZVLA 4ZEWA 2ZBGA 3QU9A 3VAYA 5AKJA 2HF7A 2GHQA 3L1UA 4HGPA 4DCCA 5AI5A 5AKKA 3A3YA 2Q4TA 3OCYA 3I1YA 1RQLA 3I28A 4FYPA 1YJ5A 3WK6A 5AM2A 4UARA 2R8XA 2CFTA 1Z4PX 2G07A 1N8NA 1U2TA 2OYCA 3NALA 4MUMA 3FPSA 2I7DA 3EF0A 2YJ6A 3IB6A 5AVQA 3WK4A 3ZVMA 3U26A 4XOUA 2G09A 5AVRA 5A3RA 2I55A 3PGVA 5AK4A 5ALIA 5ALFA 3E84A 3RF6A 1CR6A 1NRWA 1ZD4A 3B9BA 4XE5A 1Q91A 4EX6A 2YMPA 1TA0A 2BDUA 4KN8A 2HI0A 2HOQA 5AKGA 2C8KA 3N8GA 3WKBA 1Z4QA 2OBBA 4AS3A 1QQ6A 1LVHA 2BY4A 3DDHA 5AM0A 5IT4A 1FEZA 4MWOA 3RFUA 3B9RA 5ALKA 2RBKA 3N1UA 4EENA 5AK3A 3L0YA 2C8LA 3SKXA 3CZ4A 3SMVA 2RARA 4F71A 1RMYA 4ZEVA 3PCTA 3KBBA 3A1EA 3WK5A 2P69A 5IS2A 2FPUA 3AR5A 5ALPA 4HGQA 2O9JA 4HGRA 5ALQA 1Z5GA 5ALXA 1RLTA 2B8JA 4Y2VA 5IT0A 1ZS9A 4GIBA 5AW0A 5ALLA 1VFPA 2PR7A 4YCNA 1L8OA 2FPWA 1VJRA 3AR6A 3M9LA 3OCUA 4UM7A 4NWIA 4B6JA 5ALVA 2DQSA 4O8CA 3NUQA 3OCXA 5AVSA 3MC1A 4CF5A 2AH5A 4ZEXA 5AVZA 2GMWA 3SKYA 4OD0A 2JAUA 3M1YA 1K1EA 4Y2SA 1U2SA 2P11A 3J7TA 2HEGA 3QX7A 5A3SA 3QU2A 3KDPA 4UAVA 2Q5EA 3L8GA 1Q92A 1RQNA 3U7HB 2IOFK 3I6BA 2G80A 1EK1A 2EARA 1T9ZA 2ZXEA 1RPZA 4KYTA 3AR4A 5AVUA 2B82A 3QGMA 1TE2A 4RETA 1SU4A 2JAOA 5AVVA 4Y2RA 1L6RA 3AR9A 5AW2A 1RKUA 5AM1A 5AKHA 5ALTA 4L57A 1RKVA 3OCWA 1N9KA 2YY6A 2JGAA 3BWVA 4BEVA 3ZW7A 3KC2A 4UASA 1YDFA 3MPOA 3OTQA 3QNMA 3QUBA 4BNDB 3FZQA 2R8YA 3ESQA 1EK2A 2FDRA 3AR3A 1L7PA 1QH9A 3L8EA 3L0BA 4YCLA 2ZBEA 3L5KA 2ZG6A 3ZWDA 4J03A 1YMQA 3ZI4A 2FPSA 3KD3A 3OPXA 4HYTA 1RRCA 2YMMA 4EX7A 4UW9A 4YIKA 4I9FA 2C9MA 4FFDA 3EPRA 4UAUA 3WK8A 1YNSA 2FUEA 2WF9A 3E81A 2JARA 1SWWA 5AICA 5E0OA 2WF5A 3L7YA 3ZU6A 4Y2PA 2YMLA 4I9GA 1Z4NA 1TJ5A 5AK6A 2FPRA 5ALYA 3WGUA 3F9RA 1WPGA 2EAUA 3P96A 5AKXA 3OCVA 5AKEA 3AR2A 2GHTA 5T41A 1RMTA 2HDOA 4YCMA 2B8EA 1ZOLA 3WK7A 3ZUPA 5AESA 1L7NA 5ALHA 2NO4A 3FM9A 2G06A 3TLMA 3U7EB 3E8MA 4C4SA 1ZRNA 2WF7A 4L6AA 3W5BA 4CNQA 5FP0A 2G0AA 3MMZA 5AKZA 5ALMA 1XP5A 4PNHA 3WKEA 3A1DA 3U19A 3N5KA 3ZX5A 1ZD3A 3PDWA 5ALJA 4C4TA 1ZJJA 1U02A 2AGVA 1RLOA 1RLMA 2HCFA 4BNDA 3E58A 2PQ0A 5AK5A 5AVYA 1U7PA 3ED5A 5ALDA 3D6JA 1TJ4A 3ONNA 5ALWA 3NASA 4UMFA 2OA0A 2ZBDA 3QU4A 2ODAA 3ZTYA 1XPJA 2R8EA 5AM4A 2B1QA 4RESA 2ZBFA 4G9BA 2ZOSA 4Y2UA 2JAWA 5AW7A 2C4NA 3SF0A 1YS9A 3IJ5A 4BX3A 3OCZA 2WF8A 4YH1A 4UM5A 3I76A 1X42A 2YJ5A 4YIHA 3R09A 2WFAA 1YV9A 1Z88A 4UU1A 1T5TA 3NANA 3QU7A 4EZEA 3QU5A 2WF6A 2YFYA 3UMGA 3R9KA 1QQ5A 4GXTA 5AIAA 2YMQA 5AI4A 1O03A 3L1VA 4BYGA 4HGNA 4IFTA 2HO4A 2QYHA 4Y2QA 5AW8A 3WGVA 2HF2A 1Z4MA 3BA6A 1KYTA 3W5DA 1JUDA 2WHEA 2QLTA 1L8LA 4FE3A 4AS2A 1Z4LA 2IYEA 2NO5A 2WM8A 4UU0A 1CQZA 4BBJA 2HSZA 2W4MA 4Y2YA 5AW5A 1ZD2P 2YBDA 4OCZA 3QUQA 5JJBA 1RKQA 4KNVA 3QYPA 3N07A 1Z4IA 2FUCA 3FPBA 2MSNA 4UMVA 4DWOA 5AW1A 4OHFA 1WZCA 5AKYA 2FPXA 2IA5A 4UMDA 3NRJA 5AKLA 4CF3A 5AKIA 3W5AA 4NV0A 3SHQA 3ZWKA 3ET5A 2Q4RA 3S6JA 2OM6A 4C4RA 4UATA 3EF1A 4J2TA 5AIBA 1U7OA 4BX0A 4CF4A
chains in the Genus database with same CATH superfamily
4HH4A 2J5KA 3R8FA 3QXGA 4R8MA 2JJ8A 4A0SA 3I6YA 3OEED 5JAQA 3I58A 2ZDGA 3X1MA 4IIDA 2G1AA 3QQ5A 2C2GA 3GJTA 4I19A 2C5SA 1JHYA 4WY8A 1FNMA 1DAGA 3HL4A 3C7KA 1JZSA 3EBLA 5EHZA 3AUKA 5K01A 1FFDA 5FIUA 2P40A 4ER3A 3F4KA 4BPRA 3PJDA 1PUXA 3EOBI 4DB4A 3O4IA 5B6IA 4QD3A 4I9UA 2JBHA 4LRTB 1U4SA 2ZJ4A 1DAMA 4OHWA 5M3BA 5EKTA 4GKVA 3QPBA 2WQZA 1EP9A 3P9YA 3VDXA 1J21A 1U2DA 3KR1A 1Z5UA 3PXUA 2IU6A 1JDPA 4KXNA 5BW6B 3TBHA 4OQZA 4EO9A 4JB8A 2CMHA 2PRKA 4AN1A 2IZ7A 4XQ0A 3UMCA 3UMBA 5GV7A 1XJ0A 3QV1A 3O93A 3EWNA 1TAGA 1CBUA 3ESXA 2XLOA 2R4TA 2ZU6A 3OICA 4XH9B 3IQFA 5KJEA 2EL7A 3HLKA 3P26A 1GPKA 5ALZA 2P65A 5LZ9A 2Q1UA 5CEJA 3JWEA 1PT6A 2Q0HA 3N2IA 3NRHA 4E1VA 2V26A 3R7FA 2PUHA 4RJIA 3SZUA 2IP2A 2ZWIA 1Z8FA 3QBDA 3SZMA 4TMYA 4EI7A 4HWPA 3F74A 3CB2A 3KVRA 4R9NA 1L3BA 4NS1A 4EPYA 4JLPA 1GPJA 4UKDA 2XMPA 4KXUA 1CF4A 1GS9A 4DVGA 4G01B 2I8BA 4Z1MD 3LX4A 4E33A 3C3YA 3LFHA 1L4HA 3O2NA 3NAQA 3ZDYB 2ZXFA 1TF7A 1PP4A 5H68A 3GLIB 1VCOA 2QG6A 5IASA 3EXFB 1T5BA 4GUDA 5C4IA 2P9TA 4AN0A 5F1KA 4AMBA 1Z5GA 3ZWPA 3KR2A 1F1JA 3C8UA 1ZUD1 3RWOA 1XZCA 4KE7A 1KRHA 3CFYA 4IBOA 1SUFA 2WK1A 3GEEA 4YJHA 1UBUS 3GUUA 4L7VA 5L7WA 3LUGA 4LERA 3KDPA 4NEQA 2PUWA 1BDMA 2I4OA 3AR4A 4CJGA 4JLOA 5JAMA 2RGRA 2EKZA 1OR2A 2YV4A 1DC7A 4M0LA 3C39A 1OXKB 1OLXA 1E64A 2ACKA 2PAAA 5JSLA 3TIXB 1T3ZA 2G72A 4HQOA 1F7UA 3MINB 4EPXA 3CZQA 3RLFA 3TZBA 1PZGA 3GGSA 5BV1A 1W5FA 3A1WA 3OPQA 2ONJA 1AO3A 2F1KA 1G6HA 1L7CA 4BVLA 2GPTA 5J4LA 2YMLA 2FPRA 1DDGA 1ZR2A 1BD3A 4ZPJA 1LE2A 1E1CA 4WERA 2CD9A 3UAZA 1IE3A 1NUHA 3ORSA 1CUZA 3U0VA 5A9SA 3QW0A 2AEEA 2Y1OA 1OJLA 2H4HA 4M1KA 1O97D 4HPJB 3D6HA 4GI3A 5AUNB 3DMDA 4CT5A 2WJ3A 2OAEA 3HHPA 1ZHOA 3VPCA 1XDBA 2XNJA 4H7HA 4II7A 3C4JA 1VE9A 1IN5A 3GQBA 4LZLA 5CCEA 4LHWA 4N6HA 5KTYA 3JAKA 2I7VA 3PXEA 4FN4A 1XKQA 1IK4A 4EBBA 5EJ9A 2G67A 4TYQA 2PLWA 4U3JB 5AHWA 4F7DA 5DBEX 2CXSA 1KP3A 4FZ5A 4K03A 4BJ6C 1KOJA 2HJ9A 4MYCA 2NPOA 1BYUA 1BE8A 1YC5A 1IBRA 5LQJA 5C5CA 2MT9A 4WK2B 3VZPA 5AKLA 4CLOA 4Q03A 4PYLA 4DR2B 3G8DA 4M86A 1OTHA 3IXMA 1CUIA 2IS1A 3FNRA 4N8SA 2C2KA 3CX4A 1HLDA 3B7GA 4TXJA 2C83A 3DF9A 3B2QA 1M8PA 4IDDA 4QEKA 1YHYA 1HOXA 3Q3EA 2DF8A 5CR9A 2GJSA 3U3JA 2A0XA 4FB4A 2CFOA 5IANA 2GSDA 1IHDA 2GUGA 3LOPA 3BXOA 4X20A 2AG0A 4N0DA 1QF7A 4RY2A 4FYKA 3TTVA 1MTOA 4C07A 3HUDA 4EEKA 2MU1A 2FYTA 1XMIA 1SHUX 4OHMA 4X3OA 4MVOA 5F7OA 2MOKA 5GJVC 5BW4A 1CVRA 3T7TA 3OT4A 4QREA 3FY4A 4BMSA 4FDVA 1PDWA 4HRAA 3T0IA 4GX0A 2WM9B 2ZT8A 5EKDA 4NBKA 1ZGHA 3BCSA 5FTMA 2F1HA 1PR0A 3PTZA 4WA7A 5THXA 2X14A 1FUEA 3TW6A 1MU0A 3E48A 3ENKA 5E9WA 3BH7A 2R7QA 4UPDA 5THKA 3VR6H 1Q0QA 5EUQB 3AYZB 4OIFA 2O0JA 4XSHA 2YH2A 2WWVD 2OUKA 1E7SA 4Q7KA 4EA9A 4Z99A 1ZP6A 3KQUA 3DBOB 4WZAA 4IKOA 4Z2YA 4DYDA 2ORWA 3VZDA 3Q3VA 1QM5A 5EIWA 3BEOA 5CDGA 4D8UA 2GCNA 4E5KA 1F0YA 4ICIA 1F48A 2G1KA 2Y9PB 4QYIB 2V5AA 2R48A 3IMCA 3K92A 3W1WA 4EL0A 5IM4A 1E92A 1AHIA 1F2TA 2QORA 4IHKA 3SGLA 1NSGB 1IPHA 1MO3A 2G5PA 3TX2A 3WL3A 2XAUA 2ZE6A 2P5UA 1SPBS 5DNWA 1P72A 1R4TA 5BYBA 5JS2A 1X7GA 3RYFB 1JTEA 3RV4A 4NE9A 1M5TA 1U1GA 5HNKA 4J07A 1JFFA 5LIRA 3S90A 1EMDA 1UKBA 2DKNA 2YS6A 3L6EA 1YVRA 1KI7A 4L08A 1C4KA 1TIPA 1K63A 3V7FA 3G5UA 4EA8A 3FXHA 5BP7A 4LYJA 3BULA 1SELA 2PKCA 3LI2A 3X1DA 4N7JA 4B6QA 2GZAA 2XUFA 1L8AA 3WO1A 1FDVA 4PX3A 3SLKA 1QQTA 4BLWA 3U61B 4GR5A 1RWOA 2YCLA 4II2A 4UVIA 1EM8A 2HPZA 4H16A 1HMPA 3ZLBA 3ACCA 2DPMA 3WRYA 2DXIA 4QHYA 5PNTA 3V5NA 3WLQA 1OA0A 2HO5A 3TGLA 5FEUA 1QH9A 3TVYA 4O79A 1DMRA 3O2SB 5K9ZA 2ZYUX 4FEAA 2FMUA 1PJQA 3HYNA 2WLTA 4UNSA 2DLDA 3IMFA 1UAYA 3NKVA 1GZSA 2TMVP 4Q01A 5H8WA 1JPVA 3DB2A 2K2QB 2AL7A 1QIFA 3WMFA 4HFNA 1YOBA 3ESZA 3AB3A 1YJXA 4FILA 3VM6A 3K31A 1DG1G 3SQOA 2JFBA 1LK7A 3K8ZA 4PPGA 3AFNA 1G2QA 1U0BB 4BE9A 4RFSA 2WG1A 3CYFA 2NUTB 1U02A 5BPHA 3R5XA 2Y1EA 5D2CA 4F1JA 2NUAA 5KBYA 4ZDWA 4Q4CA 1U7PA 1GQYA 1KDTA 2OBNA 4Q4HB 4MCJA 4HWTA 4W8PA 3HADA 4S1TA 5D5HA 1UZUA 4KI7A 1FSPA 1J0DA 4URXR 3TM5A 2A7XA 1H6CA 5CA1A 5K0BA 3E5NA 3WQHA 2FZEA 1YK0A 3CZ5A 5HQTA 4NBUA 5KQGA 5TR9A 3Q9UA 2W2PA 2CYBA 1EFCA 1ENOA 3WL5A 1YJAA 3BSSA 3K1YA 3U37A 4UE6A 4UMVA 3PNOA 2FSHA 2DRIA 3IBCA 1N7JA 1GV0A 1E8NA 1RTTA 3OZFA 4LGMA 5KX5F 2GB4A 1BVRA 4UBIA 3ABOB 1Z4OA 3AFOA 3TLAA 4UZFA 2AC2A 4BLRA 4U7DA 4P7FA 4OLFA 4HLUA 2OZLA 2OHIA 1YXMA 4AQDA 4H31A 2X8BA 4IV8A 1SC3A 3IVMA 4X62B 3RVOA 4CUZA 4TZKA 1UPUA 2WVQA 3AUJB 1SOVA 2REQA 2XE8A 1D0VA 1XVIA 2YFKA 3WKAA 3CRVA 4Q9DA 4MX8A 5IHXA 2Z4TA 1ZD9A 3WAGA 2JC3A 4CQLB 3DMPA 1JGTA 3UJPA 4U5HA 1XJWA 4D9NA 4DW8A 2GEKA 1S2MA 2HWWA 6REQB 2DFDA 3JX9A 1CJKC 1D4OA 2DBVO 1KFKB 4K86A 1N6IA 4Z9BA 4REOA 2EEPA 1Y6ZA 3CZ6A 3O84A 2VS1A 5AI0A 3AR7A 4IGGA 1SHJA 1SHKA 3VPXA 2AMYA 4RKWA 3QVOA 2ZS8A 1XQWA 4MS1A 1LSJA 4KAAA 1QHFA 1GYPA 3VU0A 2Q4TA 2QEQA 5JDCA 4GQHA 1DC8A 1RHKA 2FCRA 3QLTA 2QDXA 5LLDA 3PEYA 1KQPA 3DTVD 1GOTA 3U26A 4MVJI 3NGLA 4I5IA 3NYMA 1Y3DE 4B5LA 1I4DD 4UXJA 1L7XA 3H9CA 4J1SA 2WIGA 3N8GA 3CNBA 4G7OF 1VLLA 4I3FA 2IHZA 2C4WA 1N2EA 3SHVA 4EHDA 3B9RA 2OM2A 1G20E 3NOVA 3ONEA 5I45A 2H0QA 4LDNA 4JTAB 5E2IA 4U02A 1UT5A 1JPUA 3PXDA 4FEEA 4NXMB 3BKXA 1A95A 5HCIA 2JKVA 4I1SA 3LBHA 1G8AA 1AX9A 4H1VA 1UBHS 4EKGA 3H5WA 5IRCD 1MEJA 2WAMA 4F85A 2W2KA 2JAUA 1YARO 1KK3A 5AQ1A 1NM5C 3HO6A 4HZIA 3MLBA 3EVZA 1SD1A 3RNOA 3WICA 1X1TA 5EZYF 3LWNA 4GWKA 3TNJA 5G2OA 1L4BA 2J9WA 3H99A 4ZMBA 4FOLA 2HU8A 3P20A 1NZFA 3EYWA 2WT9A 5C1BA 5EIHA 5HJ5A 1I3OA 4BIIA 2W8BB 3QKWA 4DC9A 3S8MA 4EA6A 4H7FA 3FWNA 1V9CA 4QUHA 1XQVA 5IKXA 1NXOA 2QLMA 4IUYA 3IDOA 1X1SA 1F2DA 4M98A 5FUQA 5IW8A 4EARA 3R5TA 4HRVA 3K8QA 4LF6B 1IFXA 4CYMA 2IPNA 2QNBA 1U3UA 3WLOA 3OMWA 3KK0A 4EY5A 5JCOC 2QZ9A 3CG4A 1C3XA 1HPLA 4ZT3A 1QFXA 2FF5A 1QH8A 3R23A 2OA0A 4CR8A 2HUJA 4QATA 2ZZNA 1JG6A 3IJ5A 3MA0A 1Q0MA 2CLEB 2K6GA 1GR1A 1RCPA 2ZXOA 3HN7A 2B61A 4BYGA 5U1PA 4WSOA 5AWFC 2ANBA 4E31A 1U8TA 1F9AA 2Y0CA 3A9UA 2A0BA 5LZ5A 2XV1A 4AQ7A 1LRLA 3G2KA 3FOOA 3W2EA 1BDHA 1KKLA 1KDVA 5IU6A 2RGAA 3DAFA 2E7ZA 1BVHA 4BO2A 5ECYA 1UBGA 3VYWA 4NR0A 1YL7A 2WYVA 4UMDA 3I42A 4YR7A 2A68F 3LPLA 4K0DA 5IKEA 3JQ9C 7ABPA 2X19A 2Q62A 2HR1A 1K8ZB 5C1OA 4XQEA 1H8HA 2A3NA 1N6PA 3RDPA 2X4DA 2VZ0A 1GL9B 3WNVA 3AZOA 4DIUA 2FOXA 4YECA 2C9ZA 4G4SP 1PYGA 2FW9A 2E9SA 3FHOA 2G76A 3PVCA 4X94A 3FYHA 1GTMA 3K8OE 1L5YA 1GYQA 3EBOA 3S8YA 1P2VA 3VDNB 1X9HA 4KR3A 3FAKA 1Y42X 4Y3UA 4HNTA 1A9RA 3TJRA 3O8RA 3OUZA 1YTUA 2GM5A 2P7IA 1FPQA 2R6DA 3A58B 4BGIA 4X95A 1Q1EA 5G1NA 3FJOA 5EZYB 1LQUA 4TTSA 2D5IA 1E83A 2CN1A 1Y7LA 2HDNB 4UEKA 4J0HA 1LS1A 2X0FA 1KXZA 5AW4A 1N5RA 1K6IA 5F33A 2VHXA 2P6UA 4R8SA 3AUAA 2C4VA 3DV0B 2IF0A 3PC4A 3G7SA 3BYZA 3FTPA 3R5HA 2ZRAA 1LPOA 1RACA 4TQGA 2XI4A 1T5SA 4CMHA 1PNVA 2R7RA 3RT9A 4Z9XA 3REGA 4OI4A 1VBKA 3KQOA 5G3YA 4H60A 1GD1O 4HP8A 2YN2A 2Z2IA 1VGQA 2X5JO 4C6HA 5HE8A 3A37A 2ZBRA 4H4CA 3I37X 1K5GA 2HW8A 1XTZA 3UK1A 4PAWA 3VOSA 4R98A 2AOXA 4QXOA 2CL7X 3PEUA 4GMKA 2QGFA 5HF9A 2PX4A 5BSEA 4ZEMA 3WI7A 1QQ6A 3RT1A 2Y1CA 3EGOA 3IULA 1T01A 4EENA 2J9UA 3IR7A 1SUWA 5EQFA 2SCUB 2JL1A 1C14A 1PT9A 3VSBA 1OOEA 3VQTA 3LP6A 3JQEA 3AR5A 4GMDA 4ZYVA 3AHJA 3NXKA 5BYKA 3GUCA 4J7CA 4CCAA 4D8WA 1O7JA 3NMJA 1XRSB 1FVOA 1LDGA 1FNBA 1EKYA 3GCZA 3GROA 1C8LA 1ZM4A 4L4YA 1QRUA 3OURA 4YLYA 2V03A 1JRAA 2IDMA 5EKUA 5EEHA 1RM5A 2YOGA 4BJ3A 1AMOA 2Z5VA 2Y77A 1M2WA 3I01M 2GWWA 3TM4A 1EQ2A 1ZOSA 3KVYA 2DAPA 1Y7PA 2FSGA 2YLIA 2EWWA 2WEKA 2YY6A 3AC0A 4A8HA 1QHEA 4X93A 3QPDA 5BSGA 4GSKA 3GN1A 2ZJ7A 1FFCA 2GETA 1YONA 1FXWA 4ZCPA 3QPUA 4P0PB 2PCLA 3DJUB 1PJ2A 4N0PA 3QHAA 1I24A 5IVHA 4EB3A 4G0ZA 3BBPA 3BSYA 4MVUA 2M64A 2Y92A 3GM3A 1R15A 5JH7A 2F8LA 2QVYX 2VPWA 2FW8A 4UNIA 3C45A 3S5JA 3I9MA 4LVNA 1NQVA 4EVQA 3UMIA 2IYVA 4FSDA 3DMGA 3X44A 2GYVA 4Y67A 4PHTA 2G88A 2ZJOA 3KQPA 1NBME 4OA5A 1DJQA 3ZWCA 5I7RA 1LJ8A 3RTBA 3ORRA 3IIIA 1JR3D 1C3OB 1JKJA 1YQXA 5DEIA 4E13A 2Y4NA 2Q4EA 3M2TA 5BN4A 2IYYA 3SBDA 5AW7A 1YRAA 2GF9A 4MR9A 3AQ4A 1VTKA 2CDNA 1IAQA 4PSVA 5EUMA 4ZYYA 2W00A 2F1JA 3MMPA 3EB9A 4WNIA 4EIYA 1DGQA 3M1LA 3PNMA 5IXSA 4YP7A 2PJZA 3S70A 3OJ0A 2NSLA 1HQYE 1SBQA 4MJ3A 3CXRA 2FPPB 2QN8A 4U9EA 1OY1A 1H9TA 3OEHA 1OHHD 2BONA 5KVSA 3HDVA 4ND8B 2AW3A 3RG2A 4JBIA 4OFZA 1VFNA 4RY9A 4MINA 4XVHA 4ZZIA 3RBZA 5GZ6A 1HE1A 4FC7A 3SNHA 3QIVA 5GJBA 5AM3A 3G13A 2IUFA 3W04A 5BQHA 5ILQA 2FEWB 3K9NA 1WAMA 3VX3A 2X15A 5A4AA 1T0JB 3DS8A 3M5CA 1IG0A 2IXTA 3LT1A 4ONEA 1HQCA 3OOSA 3WY9A 1AK9A 1IJFA 3HDYA 4BNLA 3BL8A 3PNSA 3V4SA 3ZCPA 1O5TA 4ENTA 5EFZA 2YOHA 1SIOA 2RHDA 2JFPA 3UH0A 1NKTA 4AJOA 3BFVA 3HTXA 3KEMA 4ALJA 1LC3A 1M7BA 5JJ5A 1XEXA 3K0KA 3R3JA 1VA5A 1H6BA 1KTVA 4OHKA 4BUCA 1B2LA 1TDJA 3LGXA 2WIJA 1Q7TA 3PX7A 2GXUA 1JAZA 1MOSA 3RSZA 5KEIA 1HTBA 2A0FA 1CQJA 3ICOA 2ZR8A 4QFCA 4ZKEA 3EMVA 4HAUA 1O77A 2XD4A 4Q5IA 1DT5A 3DH0A 4LK3A 5K2MA 1JYFA 4DQKA 2FNAA 2A4MA 1NDQA 4ER0A 5FPYA 4DKXA 3VR5H 3ZE8A 4CKZA 4W4TA 3Q12A 4D45A 3OZCA 3ZY6A 3IS3A 1MA3A 5HWSA 2KQUA 3H2VA 3WSVA 3GJ4A 4MVJF 5DGIA 1UPBA 3HKCA 1DWOA 3H4IA 3BMNA 2PU7A 5DK4A 4JHLA 3LYUA 2XOKA 4U0JA 4EW6A 2LV8A 4KV9A 2WJAA 3VR4D 3TLGA 4YL0A 1MV8A 5A9RA 1J7KA 1T9HA 1XU7A 5IJ9B 2PT5A 4G0PA 2NNWB 4CQJA 1V4AA 5DS6A 1JEAA 5A4FS 1NNEA 1ZKMA 1C81A 3FN4A 4BWYA 1SKMA 1LQTA 4K9RA 4TLEA 1H94A 3RRJA 4UTPA 3Q7PA 2GD0A 2QVLA 1EI7A 4BFWA 3ZWDA 4CKYA 3ZI4A 2WFMA 2YN0A 3EAGA 3B20A 3MOIA 2ANCA 1G5IA 1L3PA 4EJ2A 3FUCA 1PG5A 2VT6A 3O2JA 3MB8A 3EZFA 3SBEA 2H1OA 1KJ9A 1PJTA 2BD0A 3QXJA 3ZH2A 1T6YA 5DWQA 1ZVVA 1WCWA 1RM3A 1NVAA 4LDKA 1B68A 3KAJA 3N59A 2GEJA 2BSAA 3LJBA 5JT1A 5BY2A 1O89A 3BK2A 2B4YA 4BZQA 3AP1A 2AGVA 3ETNA 3H2ZA 1FAPB 1A5TA 4JCCA 4WWHA 2FRXA 2W9YA 5ALWA 2C0CA 3ILYA 3QLUC 3O94A 5I47A 4N5IX 4HNHA 4IQ0A 1I33A 4MW4A 2F1OA 1LVUA 4ND3A 4UTRA 1OPXA 1MLDA 5DVWA 2PSSA 3RVDA 2WC1A 5K3FB 1WTCA 3PC3A 4MDEA 1EFPB 1JECA 3D8SA 4NDNE 1ULZA 1C7QA 3ZKAA 5KINB 3R8XA 2YNMA 4XX0B 4ENUA 2IK8A 3D6VA 1Q74A 4DMLA 4CL3A 1IY0A 3T6GB 4W5JA 4GPAA 4AY5A 4LVUA 1NW9B 1RKQA 1EBBA 1FIUA 4N41A 1MVOA 4H7DA 4B34A 3NTUA 1SC1A 1QPGA 2J3EA 1MOQA 5AOAA 1CY6A 2GBGA 1S2NA 3HRIA 3WDKA 3AVWA 3WDLA 3NRCA 1N8TA 1MNEA 3P2JA 3A6ZA 4DIDA 2OMEA 1ZHHA 1NT2A 1K5PA 4KWHA 4LOLA 5DF1A 1NPDA 1UJCA 4FCTA 2W6IA 2NPUA 5B4UA 1AKNA 3WGLA 2IOFA 1YNOA 1R12A 4AP9A 2CDBA 2I2CA 4LCEA 2NLOA 1YK1A 5COFA 3UKOA 1C9DB 4MEJA 4AKGA 2HC9A 3NBYC 4F7WA 1YRYE 4EATA 4Q24A 3E7PA 4GZ6A 3PYXA 5HF5A 3WG7C 3ONWA 2W2OA 3BILA 4CIVA 5AW9A 2EGUA 3U3RA 3SIXA 1TLTA 3DKPA 2P8JA 3H2JA 1TL7C 3CBQA 4UNPA 3SR3A 2WAOA 2VRWA 1BHJA 3MJHA 2R751 4M1ZA 3UTCA 3FI9A 3E7FA 3K35A 4POAA 3UT5B 2IHNA 4PTYA 4DG5A 1RWQA 2JEZA 2A92A 1LWOA 4EYKA 1W34A 4R1TA 4EG7A 4NEGA 2IUEA 1XVLA 2J41A 1RBYA 3DMHA 4OHYA 2ZYVX 1R9GA 2R2GA 4HLQB 1WHTB 2AFVA 4C0XA 4ZI7A 4AE4B 1DKRA 3FPHA 3FSJX 4X1YA 1XCOA 3DE0X 3H1GA 5BUCA 1SGWA 3IDQA 1A9PA 3HFSA 3E84A 3RF6A 3ZWMA 4YRPA 2BFFA 3IHWA 4DSNA 4QO8A 1S96A 4JUCA 2BY4A 1XE3A 1ZSYA 4CODB 3RVBA 3DDNA 1RMYA 4GXQA 2JHFA 2QBYA 5K99A 3OOEA 1AUOA 4ZAFA 3EFOB 1RU3A 5DI3A 1N0WA 3VSCA 4GP9A 4R1LA 3M3DA 4AKTA 5TQ0B 1SC6A 3TD7A 1UFOA 2XUIA 5TT1A 2CCKA 3ASUA 3NCTA 1WVGA 4Q3BA 2G1PA 4JI4B 1U2SA 3R3XA 1E2KA 2W5UA 4QTTB 2VQ6A 5JYBA 4ND7A 1CRPA 4BZWA 1M6HA 1W85B 2P6PA 2H1IA 1S7ZA 2XRZA 4IDQA 4OHRA 2PS0A 2C8JA 4GUAA 4RSGA 3JVDA 3LD9A 1RKVA 2A94A 6NULA 1YRLA 1V9LA 4ZQIA 3JQAB 1GAWA 2F3UA 4MEAA 1NQOA 3Q15C 4MQEA 4LPKA 3RHTA 4YYZA 4YCLA 4A3SA 2CDAA 2MTBA 3ZIDA 1UADA 4URUR 4GKAA 2Z5FA 1P7WA 4JJZA 1P74A 1QOPB 4W5OA 5F5LA 3OTGA 3OZVA 1S1CA 3NC0C 3VBCA 3ZNPA 4BNUA 5ALYA 3CEJA 2XNSA 2BFEB 2B8EA 3O8QA 1AMUA 1VHDA 1FYEA 4Y1RB 3AU8A 2GRUA 3WYCA 4PICA 5ALMA 1QZZA 4JH0A 1G1MA 4BGEA 2VPQA 2OFXA 3C6QA 1XB2A 1MDFA 1RC1A 1XD9A 3GZJA 4ZCLA 4L3WA 3MJEA 3RFTA 5FHQA 1VPDA 3PLAE 5F5HA 3OCZA 2BCGY 3U09A 5G02A 1UXKA 5EJ4A 3IP6A 3VOBA 1D0SA 2ZM6B 3AFHA 4Y1EA 3R9KA 2FZVA 3DDZX 1GNPA 1JE0A 5JSZA 4YL3A 2BTQB 1NONA 3EH2A 2XMQA 5CIVA 3GZ4A 1H93A 1E9RA 1TD9A 4TRNA 5EMKA 1GZ5A 1WBDA 1PDVA 2C99A 5AXBA 3ZWKA 3AM4A 3RS2A 3SJZA 1SIUA 1R6DA 5JUWA 5C5IA 2P4UA 2YCBA 3HKBB 1OJ7A 2C7OA 4LXYA 2VKTA 2X9GA 4CTKA 2PBZA 2R7TA 3KEQA 4D9GA 1W19A 3DEZA 3DMTA 4G84A 1N2JA 4C7BA 1ZD5A 2H4WA 4OXNA 2L9JA 3W7AA 5A4JA 3BJRA 1TCVA 3HXKA 2Q3CA 1WB9A 5FX2A 1M6EX 1E1YA 1CQPA 2ON6A 3K05A 3PCVA 1ENYA 2NTNA 4FR2A 3STWA 4HDKB 4B3CA 2JDIA 1OW6A 4CX9A 2PMFA 1B2RA 1IWOA 3KOOA 4BJ1A 4ZXPA 1P2FA 2RAFA 2GCEA 4L5AA 4O02B 1PR1A 1G16A 1B6RA 4PY2A 3NHBA 4P54A 4PGMA 1EE9A 3TTYA 1JG2A 1U0LA 4U9HS 2YXBA 2EGGA 1WQ1R 4OQ4A 1Z4JA 1RYDA 3U7GA 4OQMA 3GM2A 4LBYA 2QL7A 3QYJA 2G63A 1EFAA 4R01A 5KPDA 4KPUA 3OCCA 3T7JA 3GGGA 1JU3A 2L81A 4DDMA 3NVKI 4WKBA 1UKZA 3NBFA 3M7IA 2I71A 1VLJA 3L4BA 1YJ5A 2MR5A 1JKXA 1UJNA 2L7AA 4G1BA 1UINA 4IV5A 4EY6A 1XVVA 4GPZA 3REQA 1YB6A 1Z0AA 4PU0A 3ZWQA 4JC4A 2GBFA 3B70A 5BSHA 3CZMA 2ZYSA 3P4XA 4JJIA 2I2FA 1ELOA 3ABIA 3GJXC 4RS3A 4KFRA 3B1YA 1MMGA 4M22A 4C06A 4QGAA 1QUEA 4OD4A 1QDUA 3HNIA 3CN7A 3SSNA 1E1MA 1IZ8A 5FUVA 4AQYB 2J3LA 2RB4A 4DSAA 3UC5A 2B1JA 4PR9A 4JY7A 2VK2A 2VR1A 3PICA 2WHXA 3DV2A 2W2LD 1DFHA 2BL2A 2D3WA 2EKDA 3JATA 2IHTA 4NSNA 1RP7A 3I2FA 1CZLA 4M55A 1ZVKA 4J16C 3I01A 3T1TA 1QAOA 2G36A 3G2OA 1UC8A 3K7EA 4XDZA 4KLAA 3M6LA 4ZZ0A 4EHJA 4EYGA 4E03A 2OV6A 3BG5A 1XYVA 4YRMA 4C2AA 2Z8ZA 2R7MA 1RKEB 3U6BA 2YIMA 1WGWA 1Q7EA 3TB6A 2GNOA 4MIOA 2ROQA 2Q3JA 1RYMA 3QKSB 3LTEA 4CCYB 5EK0A 4OGWA 1FUKA 2C00A 1Z9BA 3WNBA 1P75A 5JXIA 1XZEA 1NSTA 5CVEA 1I4OA 2ZJAA 1MHPA 3C5EA 4A8TA 1BS2A 3VI4B 1XXHB 5JCZA 3G7UA 3GPLA 2HCFA 4E5YA 1V4VA 2I1LA 2VHCA 1H9GA 3K6SB 1FCJA 1UWVA 4G9BA 1XIVA 2EKBA 3ZJ5A 1P17A 3T3DA 1JR6A 4IIXA 2H0AA 1X2EA 3W4JA 1Y9ZA 1KOLA 3KYBA 4OK6A 5AI4A 1E6WA 3MLEA 3D3JA 1IN6A 1QDLB 3NWOA 2H2WA 5JAHA 4CG3A 1YQEA 3OETA 1I0ZA 3IJRA 4IXWA 3EVFA 2WHEA 3H9JA 3L1IA 4J0KA 2IDJA 2WTXA 2JLUA 3PUYA 3A6JA 3AOEA 2H2FA 4OU4A 4UCWA 1ATZA 3DNMA 2D8MA 5CVVA 2QR3A 2FUCA 1SG6A 3FPBA 3BTUA 3GORA 4GZMA 3TD9A 1Q0TA 1E61A 4XM1A 1N78A 3VX4A 5ICSA 1VB3A 3JTMA 4OXXA 4PYQA 1X7XB 5AIBA 2O3SA 1Y9AA 3K7DA 3ICQB 5DQZA 3E61A 4G86A 2O05A 2PR2A 2PS1A 1LGYA 3SHFA 1ZNQO 4UBMA 3D0QA 3E9RA 1WSWA 4URWR 3GY0A 3IBFA 5I3ZA 4N12A 2DUMA 1TOAA 1VI2A 4BMZA 4ZVOA 4O2BA 3IUSA 2AOVA 5F35A 4UNNA 1EWYA 2Q2QA 1GGMA 3P0IA 3Q7QA 3P1JA 1OFGA 3TLEA 1YKGA 3SM3A 4TTAA 3QKTA 4RDCA 3BEHA 4V0NA 1TI7A 1RHUA 1YZCA 3E70C 4LDPA 1OSNA 3EZ6A 1IN4A 2HSDA 1MN6A 1RABA 2CHEA 1QP0A 3CXUA 4IRXA 3C3JA 3GJZA 3O74A 1IY8A 4RHUA 1PL7A 3KT8A 2DKOA 3P9PA 2KSQA 1G5HA 1W30A 1KE2A 3EX7C 1DAKA 1M6VB 2P30A 1ENPA 4E5DA 3BXXA 3IESA 3LKBA 3TDKA 1HKUA 3I2YX 2H52A 1AV7A 4KH0A 2RKWA 2ZYGA 1I8TA 4K1XA 4PHHA 2JFVA 3PC2A 3B6KA 1W4AA 4MW7A 5FJJA 4P9FA 4TKVB 4XGRA 4YACA 4YAJA 3VZCA 4A03A 2B7CA 4ZAZA 3KL2A 1LPMA 3G23A 1N25A 3A3NA 4U8GA 4PZEA 2A0YA 1DKOA 3VR2D 2B98A 4E2ZA 2PZGA 4CM9D 5CRIA 1FYXA 4WABA 4M1MA 1G21B 3OUTA 5COAA 2WZQA 5CLQA 1V8OA 5JCJA 3RKOF 4C3BA 4RTRA 1P0CA 1EUZA 3C4VA 1EEXB 1QU2A 3GLHA 3WBFA 2P69A 4CDMA 3IQCA 2AQKA 3KQVA 3D4PA 3NDJA 2G70A 3SOZA 5DM60 5EL0A 2GCPA 2F48A 3QLJA 4C3DA 4IINA 4R7ZA 2APJA 4CWAA 4ESEA 1IJKA 1Q3TA 1W4LA 4DTCA 3OPYA 1IN1A 3OA1A 5IT9A 1RPZA 4PX5A 1F2VA 2O3JA 3WFJA 5FWYA 2PNJA 4DBVO 1BQ4A 2HJRA 1JIJA 4AY4A 1F0KA 1SXQA 2QROA 5ALTA 3DGEC 4GHWA 3L6BA 1P4HA 4II3A 3DUFA 4YXWA 4F4IA 1GUBA 2WD7B 4RVCA 1Y81A 5HOQA 1UQUA 1EK2A 5FO0A 5JNLA 3MTGA 4R3UC 1T36A 1UT8A 3O31A 3K6JA 3NP7A 2ZUSA 2ZIWB 3OA2A 1RRMA 2QB5A 1XCPA 4NK5A 1MXFA 3V3TA 2ERCA 1CUXA 1R6AA 3BF7A 4PAOA 4L72A 4V0LA 4FDTA 4C1BA 2QG4A 3FVTA 1JVBA 1NVMB 5AD1A 3RUCA 3AF1A 1SRRA 5BQPA 2GEVA 1M7GA 2YQZA 1DHRA 2NTEA 5FLKA 2QP3A 3LKDA 3JQ7A 3RRFA 4FFBB 3EA4A 3W2HA 2ZU0C 1KRWA 3UBMA 3VU3A 2PVSA 2Y1LA 3KUKA 3EC7A 1CJBA 4I7EA 1KC3A 3UJNA 2W98A 5ESRA 1K05A 5AUPB 1GGFA 4NJEB 4OB7A 1RLMA 2FPIA 3NASA 4IPTA 3HP4A 2O7VA 4K6CA 3TOVA 1MC8A 3HC7A 3UPDA 2R8EA 3DG9A 1LBTA 4MIEA 5CVJA 3AJ8A 1A71A 2JKYA 4X63A 3MXOA 3COVA 2X5NA 2WV7A 1RWWA 1UFQA 3HL0A 1T6QA 5D85A 1R0CA 2NV6A 1GQFA 4NZNA 4WZZA 1QE0A 2ONZA 5I9SA 4OUDA 1HL7A 3KS9A 1D09A 2RGNC 3W8EA 2OL4A 1HZJA 1N6OA 2H7XA 3DVQX 3HXOA 4DPLA 4OFBA 4YBRA 2JIDA 4AX4A 3Q5DA 1JFRA 4CF4A 2VHQA 3F3KA 3JQFA 1EDZA 1I14A 2OZPA 3A6GA 1T8WA 3RAFC 3PXXA 1UBLS 5LDHA 3BREA 4M1YA 3LIIA 2IEBA 3BZBA 1E2EA 2DKFA 3GG2A 2DR2A 4A6PA 3BFPA 2BBOA 1V5GA 4KFSA 3BSFA 1NI4B 4U6NA 2CMGA 3DV9A 4GRIA 3KKEA 4NDAA 2EATA 3DLBA 2R5WA 5AI9A 4Z4CA 1ZIYA 4QOHA 2CE2X 1VIYA 2A1DD 4EB6A 2MSEB 1V1RB 3C74A 4IEFB 2O8CA 5AVTA 4GGPA 4F86A 4P4SB 1XUOA 5BQGA 3MK31 4OI0A 3OJWA 3LS0A 3RC7A 3NONA 1J8VA 1F8XA 3PSAA 4H9GA 2CL5A 3EE6A 4XEFA 3GFQA 5IAAA 4Q3AA 3W8NA 4AMGA 4OA8A 3S2EA 1WKVA 3FBTA 4NAUA 5H80A 5GAJA 3WZ2A 1Z07A 2AK2A 2XECA 4BLSA 1I3LA 3DKVA 2K7ZA 1KS2A 4JNKA 4JVSA 5A4IS 1GZDA 2PGIA 4YRCA 3T15A 2YYAA 2OOSA 2QLNA 2XPCA 1PQPA 4C5CA 3UWOA 2RDMA 3D0RA 4MRRA 4HFMA 4EPRA 2OORA 1A88A 1W5EA 3ORQA 4JJ4A 4TRMA 3EEOA 3B12A 4FE4A 4K28A 5CAEA 3VYTB 4TUYA 4QUGA 1EEHA 4DLPA 2B8JA 4GM1A 1U63A 4QOIA 4GIBA 4IH9A 4FYJA 3OH8A 4YR9A 5FAXA 1IUNA 4Z9JA 2P35A 1A8IA 5JQGA 2FRDC 4GC9A 4XEVA 1DAPA 3CH7A 1Z82A 3L4SO 5TNXA 2AOTA 5GY7A 1N5OX 2C97A 3TFQA 2JI7A 3H8SA 5KUTA 3NGMA 5JPDA 2JLWA 4Y9UA 2YOFA 2IY9A 2XA1A 4Q34A 2Z9CA 2Z1DA 1CUFA 2FSFA 2V7QD 4D9FA 1GU0A 1U0SY 4U1RA 4HY3A 3DGFC 3G0OA 3P0JA 5KDLA 3HP1A 3FZQA 5G1OA 4C4XA 1T9AA 4QBIA 3MCZA 3CIOA 1HDZA 3PKZA 2J5BA 4F8YA 4CMEA 1HYHA 4B71A 1I30A 2UVDA 2G7ZA 1NW6A 1V96A 3S44A 3L7KA 3DXFA 3EIHA 1GTSA 2OCIA 2HA7A 3KR9A 1RXSA 4EM6A 4I1OB 4HMPA 4YCMA 2VYND 2K2WA 3PENA 1XNGA 1X0XA 2ETSA 1DKLA 3QELA 2H65A 5ALHA 4B76A 1FXSA 1VLVA 4Q39A 5K4HA 1HDOA 5EJEA 2Q3BA 2BMDA 2YIJA 2VUTA 3H8WA 1JZQA 1L2TA 4XDGA 3AVPA 3UCEA 1H1TA 4GQBA 1M7HA 3ZTYA 3I62A 3W6PA 3F0TA 721PA 1HDEA 1XTRA 2G5TA 4HSEA 3I04M 1PJ3A 4AZWA 5KSWB 3G1WA 1VDMA 3PPVA 3JASA 1Z5PA 4GBGA 1XD2A 3G0DA 1NMSA 1USWA 3LFTA 4KQHA 2ZQZA 3STHA 221PA 3QF4B 3CRMA 5CVCA 5BMVF 1P73A 3V2UA 4AS2A 1W2WB 3EHEA 4DZZA 4X66B 4IIUA 1FTGA 1H4SA 1CUWA 1NQXA 1KTMA 4Q9IA 1L9XA 4MVJP 5FQNA 1N2CE 1EZZA 1FFYA 4JC7A 3GJ5A 3U9SA 2OHFA 1JAFA 2BW0A 1TFOB 1WHSA 3N53A 5ALGA 4WXHA 4NAVA 3WBKA 1EHYA 5K5EA 4B3SB 1XQYA 4GBJA 4RM3A 1Q57A 4NVRA 3DZBA 3U3KA 1QGUA 4OQNA 4C30A 4JS0A 4LTDA 4EWLA 2CXTA 1V6AA 3LXUX 4ETIA 4DBRA 3DOOA 4GVPA 1EUCA 5F51A 4NNPA 4U63A 3WGYA 1QO9A 5DYWA 1ZCZA 2WPDD 5LXTA 2KSFA 2WFZA 1G9SA 4QBHA 1GZ7A 3UMKA 1DLIA 2H29A 2DGDA 1R0YA 1FR0A 1SKUA 1P9WA 2BMJA 1RM4A 5K8VA 2LFDA 1BGXT 1EP3B 2FEAA 1NFRA 3CS3A 1QNLA 2YUTA 1EGHA 3SK0A 2X0NA 3OG9A 1LPBB 4BNVA 2Q4OA 1NC1A 4D79A 8MHTA 3MCUA 2W2TA 3DPIA 4OAQA 1ZSNA 2YHAA 2HA5A 2W43A 1OB2A 4LHEA 3RSCA 4PSCA 5C0OE 2XM0A 1IOZA 1BTOA 1M2VB 2IXFA 1U8YA 1OW8A 5L0FA 1EGQA 3CLUD 5KYYA 3CVWA 1KO1A 1YTLA 2I87A 1LD3A 4C6RA 1Z4PX 3RS9A 4KAJA 3LLCA 3EPVA 5A3JA 1BCRB 1U5AA 5T1DB 1AS3A 1V54C 1MF7A 2OBYA 2XE6A 1IY2A 1OH6A 5AO9A 4FZ3A 1KETA 1QVRA 4B43A 4PPQA 5F64A 3N1UA 2FGKA 2G7MC 2HMVA 1KFEB 3FUWA 4V39A 3WLIA 1JIUA 3ZR4B 3EA0A 5D84A 3Q7TA 2O4CA 1ZXLA 3HZOA 1A76A 4KQ9A 1BX1A 2BBWA 4OJYA 3BHIA 3VA7A 2I2BA 3UHOA 2G0TA 3NG1A 2ECFA 1I0IA 5L3SB 4CF5A 5BMVB 3ZTMA 1G66A 2Y71A 3MFQA 2IDKA 2O23A 1FU7A 4YAGA 4N06A 3OLXA 4Y2SA 3DZFA 4M99A 4I4NA 2O48X 1RWXA 4JVNA 3MBGA 2W4BA 3FETA 4HATA 2IV2X 1UAAA 3R44A 4YRIA 1D1CA 5KOHB 3TL6A 3O91A 1NJ5A 3FUTA 3GIDA 1TE2A 5FL3A 4AG5A 5AW2A 2JLQA 3REOA 4PQRA 5C1PA 4FGKA 2JGAA 4ROSA 5I9BA 1ULBA 3SFZA 4QLBA 5E3AA 2LFFA 4WKPA 4JT4A 2EYQA 5FOSA 3U4CA 5DKFA 1QRAA 3I05A 6PFKA 3ESBA 5JRZA 2JAHA 1WP9A 4RGVA 1RI3A 4NZPA 3DP7A 3TR5A 1ADYA 1ISPA 1E1RD 1TIBA 4J0FA 3FTFA 4IGAA 1YASA 4Y9TA 5ES3A 1H22A 5BWOA 2FVXA 3A6EA 3IPCA 2AMFA 4DCPA 1W9HA 3DVAB 5BNZA 2NXEA 4IGIA 1L4GA 3RNLA 2ZULA 3D8HA 5T5QA 3P9QA 1U9CA 1IRIA 1J0CA 1QYRA 1WMEA 1KI4A 1RAAA 3OQBA 2CJPA 2XL4A 1SA0B 4AJHA 5DASA 3HV2A 1E4EB 2OB2A 5TF0A 4RQUA 4EG6A 2QZ4A 4K0RA 1DBIA 2ZI6A 3P4YA 2DPGA 3A4LA 1QKJA 2HM7A 1ULUA 1YDMA 4BRSA 4BNIA 2WFAA 2KC3A 1NMQA 2ZYWX 3PHHA 3IOCA 2A69F 1PVVA 2Q6TA 3OT1B 1QAQA 3KM0A 3QXHA 4CM7A 2VCYA 3P27A 1E0DA 5IEBA 3COWA 5LOVA 2ADMA 1TYAE 2WVHA 1DVRA 1NRIA 5B1YA 1U28C 3GOQA 3V9PA 4ZQHA 1ZW3A 3T41A 3AL2A 1CJSA 2HRRA 2MSLA 4JL6A 4BVBA 4UATA 3PYMA 3AG6A 4Q7QA 5EMNA 3SEOA 3C41J 1PS8A 2VYCA 2HXGA 5FFMA 2JBWA 3C3KA 4ASUA 1S3IA 4FFVA 3OM1A 4JMLA 2X0DA 3VC3A 3I0MA 2JH3A 3PJGA 1PGQA 4CMIA 3BFXA 1S6YA 4S0XA 2C88A 1XTJA 3CSDA 5E7QA 3X1ZA 1LH0A 5FNZA 2J1LA 3KZOA 4KKXB 5MF6A 4XASA 1W46A 1A1SA 2NXJA 4WECA 2XDAA 1T5LA 1J4AA 4Z6KA 2C94A 4RHXA 3BOSA 2WAXA 3BXEA 1W36D 3ZQUA 4AULA 2Q2NA 3I5YA 1NVVQ 1DPFA 1Y9DA 2ZAYA 3QKRB 1Z28A 4P4TA 4W9NA 4H7EA 4Z2AA 4OD5A 1ZBQA 1Y1PA 4H6WA 1YAHA 3OZXA 2PUEA 2OGSA 4EG0A 4CMKA 1VJ1A 2MSKA 2PZ8A 4FWIB 4PWZA 4HVAA 4RAQA 3S28A 4WNYA 2PMEA 5HS4A 2QUAA 3QU9A 2O5RA 2ZJ0A 3DTNA 5CXQA 3D5EA 4CM8A 1UZMA 2JI8A 2PE5A 2ECKA 2OVBA 3DULA 1JLLB 4K6GA 4C7MA 1PTJA 4NBNA 4K9LA 3KRTA 1G4WR 1ZJ5A 5F2EA 2VA9A 1U7WA 1HZZC 1BN7A 1EK5A 2ZRKA 2JFGA 1VIMA 1JL3A 3WNDA 2CJYA 3F5SA 2CLSA 4FHDA 4JEBA 3T95A 4JU9A 4QOJA 1LVHA 3ZLTA 4OLHA 4RZIA 2O8DB 1GA4A 3MMSA 2QNIA 2VAMA 4ZV4A 1GG8A 4WBNA 3KDSE 4FQ8A 3W6NA 3TULA 1DSSG 4DHWA 2V45A 5ALLA 2OGZA 1SCNE 1XV5A 4IJQA 4C22A 2C61A 4IJUA 4YN3A 3RYIB 1FTWA 4UNQA 2C4KA 5TXGA 4WLVA 1XLTC 1A4IA 1EE2A 4E4YA 4FT4A 2A1TS 2R11A 3SY8A 2OHGA 3ZEAA 1QVAA 2G5GX 2GRJA 5JFOA 3QFCA 5K3EA 3SXMA 1JEQA 4GLJA 2GVDC 3T7IA 2FU5C 5B3JC 1ZJZA 3ESQA 2JHCA 3WMWA 4G0QA 1QP8A 5JZVA 3FG9A 4QOGA 1KAQA 1T15A 3LP8A 1WRBA 3DHYA 5B3SC 1LDMA 5A2GA 1V55C 2ID4A 1TECE 1Y1RA 3S81A 2W2QA 5IJZA 1KSGA 1OAOA 5FUMA 2ZQYA 1TUGA 2HBQA 3GDWA 4ABYA 3HYTA 2FQ1A 3KFLA 2GESA 1AB6A 2W6ZA 3BPSA 3K0FA 4IFEA 5J63A 3KQLA 2PWYA 3RS5A 3HBNA 4FXOA 1W4RA 4P5DA 1VRCA 1DAIA 3QVLA 1JG1A 4FBLA 1ZITA 4I5EA 2WTEA 2PSJA 4O1IA 2KLBA 4N8EA 3LX5A 4YRQA 3U0CA 2QXTA 1D2NA 3SLGA 1CLUA 2PY6A 3LC7O 5JD5A 1E99A 1QXSA 3WG9A 4DABA 3HR7A 3HZZA 3WDSA 3RU2A 2ZT7A 5I51A 4KN5A 2AFIB 4HQ6A 3N8KA 4LRXA 5BR4A 5B7QA 3BB3A 4JBXA 3GUYA 4CM1A 3LX6A 1E1QA 2PYIA 3AM3A 1R8XA 3ID6C 2A5DA 3T1YB 2DBQA 5A2QA 1ZDMA 2CXUA 3VNVA 2WNHA 2AKEA 3SZRA 4LECA 5K8IA 2CXRA 1HLFA 3PBKA 1SB9A 2NU6A 5AW5A 1NXWA 3IT1A 4V0QA 5JR3A 2X0RA 1PSDA 1YO6A 5AKIA 5JT4A 4Y7DA 2EBFX 4NCBA 4RZ3A 1XQ9A 2YWCA 4PX9A 3RW9A 4WXRA 3WJ2A 1U0HC 3UWMA 4K9QA 5JY1A 1Z73A 4BZPA 3QKUA 4R83A 2XS8A 2ACWA 3WGOA 2ZBQA 3L8JA 2CBXA 3ZCXA 5FBWB 1Z7Qc 2XYGA 4HDAA 2I34A 3FOZA 4D96A 3JWHA 2WVJA 4FP9A 4PM4A 3EDRA 1NU7D 5AI8A 5BNIA 3R8CA 5EIFA 1MVLA 2RB5A 3EEQA 4CPDA 2C7BA 1RHMA 1SULA 4FOSA 3E3MA 3QOWA 4FS8A 3ADPA 1IM2A 5FFNA 2JLZA 2XMDA 3HJBA 3TNFA 1F2UB 2HCBA 1A9OA 1KGSA 1H2XA 1OQCA 3CJRA 4RMIA 3HSKA 1N3BA 4XLPF 4YJWA 4HNRA 4BMPB 3B53X 3RTEA 1E77A 1QCDA 3PT5A 1W35A 4XLNF 1XO1A 1E79A 4GYYA 5ESWA 1L4FA 2O4UX 2AXQA 4B3FX 2PKEA 3QX9A 3UWPA 1U8UA 3KUCA 2EWVA 1X1EA 4B3XA 4J76A 1LKZA 4YJ2A 3SPXA 2YWRA 5EZ6B 1D2EA 2XUPA 3GZTB 3DO8A 3JQGB 2Z6UA 4WCFA 3G59A 1BN6A 4TKLA 4GPTA 4TT3D 2J6BA 2V7GA 3P9XA 3LHSA 4D56A 3N9IA 1SM4A 4ZOQI 1KI8A 2OLJA 1Z29A 5KNDD 5SYMA 3JSXA 3LC0A 2FN4A 3HB5X 1Y7IA 4DLYA 4DKJA 3Q40A 3RRYA 4D9JA 2HA0A 1P2DA 3PCTA 2WG0A 4NYMR 1JIKA 4BS9A 5ENDA 2G9RA 4FIZA 3EH1A 2J45A 4H77A 4RPIA 4C6SA 4RE6A 3JYOA 3SF8B 4G9GA 4UHHA 1WPRA 4WDRA 2PR7A 1E4YA 2FAPB 1AZTA 3QZUA 4OKSA 4AWAA 2Q7DA 5HKAA 2NZWA 2PFGA 1P3Y1 3AGUA 2TMDA 3LSYA 3WSTA 4AY6A 3L7NA 4DA6A 2IVFA 2AG6A 3PDJA 4ZC8A 1ODTC 1XMJA 3JD3A 4ZREA 2HHAA 4IFBA 2HBYA 1D6MA 1HFEL 2VQ3A 3RS7A 2AVDA 1UPTA 2GVZC 2ZIZA 2D5RB 2R7VA 4BASA 1WTAA 3L5KA 1A9XA 1PNTA 4X7PA 4D99A 2UUCB 1NBEA 2XMRA 4HX2A 2WVAA 3OIDA 2H7VC 4NCHA 4PZCA 1VLTA 1N92A 3LTNC 5HS6A 1OWPA 3AKDA 4H18A 1JB9A 5B3IA 3ZD7A 4D3DA 1BBHA 3ED1A 2WF5A 2EKLA 4J3JA 5TMEA 3JQCA 1SCBA 4CIDA 2NXCA 1K8XB 1K5DA 2JCXA 3BH0A 3HNOA 1RBMA 1I5EA 4Y8VA 4MWCA 3BM5A 1P7VA 3NOQA 5HR5A 4DLXA 3VMMA 3ZE0B 4P5PA 5J2UF 4PRLA 3W8RA 3D2CA 3PQEA 1EDBA 4TZ0A 4JNCA 3V4ZA 3KQWA 3A1NA 1B6GA 1JSCA 1AQJA 4C43A 1BG6A 1Z6XA 1B0AA 4D46A 4G2TA 3D4OA 1MRZA 1N9GA 3ETGA 1IHXA 3QU5A 4NPAA 3A6KA 2RGYA 3K1IA 5FA5A 5IC6A 3TI9A 2JHAA 3UA3A 4RA9B 2PUJA 4OIOF 2OQVA 5M34A 4PBRA 4JHXA 3OF2A 3OQIA 5T67A 5JJIA 2ZJ8A 2A1UA 1ZLYA 4DM4A 1QO0A 2JASA 3OLZA 1PFVA 4GQAA 4M54A 1ZN8A 3ZIUA 3IR5A 1NZJA 1RXIA 3QE2A 1TAUA 3OM8A 4L4XA 1R6TA 1KDRA 2OCPA 3NH6A 5EXXA 4DMRA 3DFUA 1YS2X 1E3WB 3QVKA 3CY6A 4QJ3A 2Q3DA 4QX6A 5L3VA 2A9OA 4KGVA 5L40A 2F43A 2ZUFA 3OEYA 1B73A 4PLFA 4NF2A 3F98A 3CZRA 3IA7A 4ERXA 2WM2A 4JKIA 5L6MB 2QMUA 3WGTA 2WSYB 4MJLA 3PQ6A 1M8JA 1TT5A 1SO8A 1E60A 3CEPB 4XJSA 1E66A 2BUBA 2X0EA 1Y3BE 1SXJE 3WLPA 3WMRA 4YMSA 4R2LA 3K9WA 5FNVA 4KUHA 3ZY5A 2DYSC 3CLTC 2YRFA 2RC6A 1KNYA 5IDQA 4CF7A 1YQDA 3TEMA 3HKEA 3L41A 3DPSA 4B6FA 3FPCA 5KYGA 1GG2A 1UDWA 2F3TA 4RVHA 2CNLA 4DCTA 1FOEB 2Q3EA 1JQBA 2XH8A 2GZ3A 3ZWWA 3DE5X 2FXIA 3FWHA 4Z49A 5J2UB 3IBGA 4BTVA 2QTCA 3E2MA 2QLBA 5M29A 1VL8A 5DMXA 3OU7A 4UVEA 1ONBA 3GUHA 4R0MA 3DO5A 2GLXA 3M6FA 4DBZA 3RVLA 2NSGA 2HBZA 1HG0A 1HQKA 4WKCA 1R3UA 1EVJA 4H0CA 1BFKA 4G5FA 2O1SA 1OWNA 2E4ZA 4IDAA 1G5TA 3ZGLA 3F4LA 2ZSKA 3N58A 4LYEA 3HXQA 5TC4A 2HJMA 2C3YA 4PLGA 5KVVA 4F46A 3CLKA 4GLFA 1CZKA 4DR1B 3N6VA 2QVZX 2H1LA 1CHDA 4HDSB 3A4IA 4JXJA 3DC2A 1OXBA 2GCOA 3L0SA 3SBOA 2AF3C 3R6LA 3ECSA 3HA5A 4Y6GB 3HJTA 4HDMB 1VG1A 1YDFA 3I9OA 3FNBA 4K9OA 1G6Q1 1MAAA 1MQAA 1TQGA 5C8DA 2FG7C 2PSFA 3W8IA 1T34A 2J6IA 3EVCA 2IEGA 1OYOA 3ABLC 3D6UA 4JN6B 2J4CA 5JMOA 4RIHA 4Q3LA 1U7ZA 2BCJQ 1A2QA 1YZLA 4D3ZA 2P0NA 2DH6A 5KDDA 3U39A 3T6KA 3KYDB 1GXSB 1RIFA 2EJUA 1W96A 2G06A 4HQRA 1OGYA 2WF7A 2ZIAA 3VPGA 3R9WA 2DCUA 1KMIY 1YDWA 2AI3A 4S35A 5CEEA 3W5SA 4TMFA 1PNOA 2J3DA 3D6JA 1T13A 3UA4A 1XPJA 3RB8A 1USUA 4JK3A 2JLAA 3VAZA 2X1HA 1FYWA 4MGKR 4FCVA 2PMKA 2HO4A 5EP1A 5LZ4A 4L22A 1T9CA 4DIOA 3G2HA 4P0TA 1IPFA 4TYPA 1MTZA 4IUDS 1G6OA 1EQ1A 2X3FA 1F3OA 4TYWA 1KGDA 4FOPA 3FGZA 2ZRMA 4ZT4A 4IRUB 1BEUB 5E6UB 2V9PA 5T4EA 4U8HA 4OSOA 3SZLA 4OH1A 3DBVO 1YQWA 1TM3E 2YZ7A 3PPYA 1YHNA 4Q3EA 1P44A 2LKCA 1AH2A 2HL6A 3GNTA 4AT1A 2CLFB 2I9PA 3U7QA 2VK8A 5TPZD 1JE1A 2O50A 4TKUA 4GWLA 2JAPA 1IG3A 3KE8A 4QARA 1MJGM 3DW1X 3EAFA 5IKOA 3F7MA 2OB1A 3KYIB 3IE0A 3KPVA 5JDIC 3DMRA 1XLUA 1LX7A 2G4LA 4FUQA 3KOWA 3L1KA 5JISA 1EAYA 3L7DA 3NIGB 2IITA 4FMCF 2UUBB 4QTYA 1XKXA 4BQRA 3CF4A 4FR5A 3PQ3A 2HF9A 4OK5A 3COYA 5K20A 5WRFA 4TTQA 2BHNA 1HEIA 3U9LA 2X0CA 2WD8A 4C2UA 1Y6DA 1WDTA 4HNVA 5DS4A 4LYFA 2JIQA 4DDUA 1J7JA 4L28A 5EZSA 1AK1A 3ZU2A 2XUJA 4C08A 2B5WA 5BYJA 1E5LA 3LC1O 3D8BA 1BZ4A 5HGJA 3OY2A 4JI0B 4I5GA 4BHTA 2ZBGA 1K7FB 1B76A 1PZFA 5T4HA 1LTHR 2BEUB 4DCCA 4LRSB 1G20B 3DQPA 4ZDJA 2NW6A 3EIFA 3D2LA 4Q4AA 3BRWA 2BELA 3EZ7A 4OB8A 4WN9B 3TTTA 2UUIA 3JRNA 2PLRA 4KQJA 4EKYA 1M34A 4MWOA 4FCWA 4EECA 4FDMA 1Z13A 1QF9A 4TVOA 1THGA 1KWKA 4C3OB 3DFIA 3ZZMA 1NHGA 5ISMA 2VPXA 2X58A 1WPXA 3EXHA 1WBJB 4A8JA 1V1MA 3UNGC 4DCVA 4DY6A 2FSUA 2VJMA 2Y3BA 3OLYA 2FPMA 2QUKA 3O21A 1H4QA 4UFOA 4PO9A 1QRRA 2AYZA 3OZWA 3EPJA 1DKQA 2BFBA 4X1KB 2A9VA 5TMBA 2LR0A 1GLVA 4DJFC 3ITFA 1KJZA 4ZZ3A 2HREA 4L9WA 3WZLA 3VO2A 1G6KA 1D0XA 4FLMA 2F22A 3GGCA 4RU1A 4M76B 3JD0A 2DYRC 2OV2A 1X1RA 3VU1A 2BFCA 3B13B 2FZ4A 1WZ2A 2RFLA 5IZ4A 1A3CA 2YV2A 3JYNA 2ATIA 2QW1A 1XPOA 1YDGA 4RTOA 3L8ZA 3ONDA 1C41A 1FYFA 4CI0B 1GCGA 4FFDA 3AGTA 3OHMA 1Q0SA 3W2VA 1VZ2A 2PN1A 3AWIA 3PQFA 5KC9A 5EYPA 4FKZA 5EA2A 4MDHA 3H9GA 1A4RA 3OQNA 4CHTA 3N87A 2Y1KA 4EDHA 5C80A 1KJNA 5F78A 5DJ5A 5CJ2A 4FMCB 1SD5A 4U2CA 3FPFA 4F1KA 4TXNA 4CKBA 2A0UA 3BB1A 3U81A 2PO5A 4MWBA 1O9BA 3ETLA 3SHTA 3FIUA 1XN1A 2GHRA 3BWEA 1OZGA 4ZYWA 3A2NA 2RHLA 1WU7A 1VPTA 1CS0A 4HGZA 2X9VA 2VEDA 5FI1B 2BMFA 1TZ2A 3I39X 1GPYA 1C4WA 4PLTA 3HG7A 2D2XA 3X0DA 5L0CA 4W5HA 1YZHA 3GODA 1VBNA 2QMEA 5CI8A 3ZJ4A 4DV2B 2P0AA 4PXAA 4BC1A 4NMMA 5I5GA 4BRZA 4U7FA 2G8LA 4AUNA 1DX9A 4RTLA 2H7YA 1F8YA 4M9QA 2P4SA 3NW9A 7REQB 1NKSA 1X2BA 3AP3A 1Q2XA 3VPSA 3BXZA 2QAJA 3NYLA 2IYFA 4JJFA 4NDZA 2VYVA 4F5WA 5E2AA 4IJMA 2OHOA 4ZU6X 1AHHA 4CIYA 4NBWA 3L2OB 4BKOA 5JYDA 3UXHA 1Y33E 3AWDA 1F0NA 4HUTA 3IHLA 1U2GA 3KETA 4PYMA 1O94C 2PG3A 5CNMA 2PWPA 1DXHA 3A28A 2WBLC 2VF8A 2PS3A 1X80A 5IH7A 4AJEA 2ZW9A 2WE8A 4O2LA 5KZMB 4PCUA 3F90A 1S8OA 1HTTA 2WJHA 4KSYA 1YA4A 2AFHB 4UDOA 1RPNA 5DN9A 4ES6A 5LIPA 2UZ1B 3FGOA 4J7AA 1QK3A 1VHQA 3F6SA 4BX2A 2PGAA 3WHLA 2EBHX 1NP3A 3JZAA 1GQ2A 5BSWA 5BN1A 3SD7A 1T2EA 1OASA 2ZFUA 4L5JA 2VF7A 2GAJA 5B55A 4NABA 2WZFA 4CL2A 5IAJA 1OV6A 5HZGA 3TRJA 2PVCA 4M6WB 2W11A 1FQOA 1WSAA 3Q6IA 1BWQA 4NU0A 4BJTA 2HZBA 2AIRA 5ELMA 4F72A 3ILVA 4IIVA 4ED9A 1CIVA 4AZ0A 5D3MA 3V7UA 3W9YA 2VHVA 3DNFA 4NL4H 3U1BA 3L7OA 4IQGA 5ULLA 1C2TA 1SXGA 4N65A 1Q20A 3OFNA 1MKYA 1HDRA 3I1JA 4KL8S 2ZRBA 2BEWA 1NBAA 1Y4ZA 2W42A 2OYCA 1P1IA 1H65A 3CNEA 5B12A 4ZJZA 1OBVA 2LKDA 1PWYE 4YRKA 2FPLA 4CKEA 2H1CA 1P6QA 4LJSA 1I1NA 4UTVA 4OQEA 3T0FA 3QVWA 3JARB 3H7AA 2F55A 4M9UA 1V16B 1W49A 3LA8A 2J5QA 3T3NA 2DBZA 4RENA 3HLYA 3WK5A 5BOSA 1H0KA 2PMCA 4TV8A 5KYUB 2HNBA 1YJBA 1ZS9A 4K2HA 3UJ7A 4CW7A 4NQRA 1GCOA 1OU4A 3CUKA 4QQ8A 2FR8A 3F78A 1CY8A 1E18A 1SR2A 2C1ZA 1HE5A 3PNPA 4L4SA 3PJFA 1S0UA 2OBXA 4IJWA 3VPHA 1ISMA 4EH1A 1OIXA 5AJVB 2B82A 2YKGA 1T2AA 1FA9A 3LX8A 1PBTA 3C48A 4BJ5A 1P2GA 2JANA 2GS9A 1FB5A 5COGA 5DMHA 3HPRA 2ISCA 4PPNA 4H08A 1L7PA 4GR4A 1G0OA 1KBOA 4X84A 4ON9A 3HB9A 2QRQA 4HEA1 4UE2A 3EMBA 3EGXB 3CW9A 1DP4A 4X6LA 1PT8A 4GAEA 2JK1A 1M6NA 2ZJ3A 2BUCA 4HF7A 5TGTA 3O26A 5L3ZA 4FU0A 1SH7A 4CIBA 2TECE 2XVAA 3JTLO 2GWRA 4RTNA 1E6LA 4AUMA 1FS5A 1NU9C 3V4RA 5BWBA 1QWSA 4KPEC 2LQGA 2X1LA 3K53A 2Z15A 2R25B 1AZSC 4GMHA 3C6KA 5F2NA 1ZJJA 4C20A 2TS1A 2PQ0A 4G6ZA 4H3VA 4HH1A 2BP7A 5TJHA 2OEPA 3IUJA 3E9MA 2JB9A 2XAAA 5CLLA 2I6GA 3FHCB 3KNZA 4RORA 3TXYA 3I12A 2PM8A 4HX5A 1JR8A 5CLFA 1O96A 1T4CB 1L7AA 2JBAB 3JU3A 2UYGA 2ORED 4HLNA 4UDVA 2IM8A 1EFLA 1N36B 3TW8B 3L84A 1WVMA 3LXXA 2JPDA 2J0QA 2ZQ5A 3Q85A 3JD1A 3OLQA 4DIMA 4MS3A 5FWXB 2D7DA 3T5PA 3IJEB 4HEAJ 1I6LA 2W4MA 3DDUA 2F59A 2VBCA 3LUDA 3D0OA 1JQ3A 5LQCA 1WTYA 1W7AA 3WQQA 2AWNA 5AW1A 3UY4A 1Q1AA 2EJBA 1OH5A 5FYQA 4RULA 4NI5A 2GEBA 4NBVA 3T3HA 1XWFA 1P4RA 4EQ6B 2FLWA 1AM4D 3IXLA 1YUNA 2Q1XA 4GG1A 3NFRA 2FSSA 3PC8A 1ZZPA 1N8KA 3T7AA 3AF6A 5K51A 3IH5A 4LY9A 5FD8A 2X4LA 2BKXA 2BR4A 5KCMA 1MH9A 4MTCA 3CN9A 3C7DB 4EG3A 1ZN7A 1PX0A 3D6NB 4HNGA 1CDEA 2QD2A 2XT9A 9ATCA 3HXTA 3QTTA 4UZEA 2YXNA 1VP3A 2ZPTX 4ZKDA 4KC9A 4U0KA 4BZXA 1R8QA 1BCSB 3FF1A 5B3AA 1Y3HA 3QLVC 1NN0A 2R8ZA 3GJ7A 1V45E 3AUXA 3CKKA 2IOYA 1OCEA 2XGOA 4JDPA 2R0QC 1EI9A 4R9SA 2KS6A 1XL0A 1DCFA 1G8JA 1V5IA 2IY7A 1Z7BA 3QVGA 4Z54A 4DNFA 2JX0A 4B44A 3UOAB 4BMYA 2MYUA 1H8EA 2V58A 1QF6A 2NMVA 3B52X 1KDZA 2CKMA 5I7OA 4AJIA 4OBXA 4MQUA 1A8QA 2P4HX 2PPLA 3OPMA 4HH0A 3V3KA 5FXMA 4O0LA 2GPYA 1HSOA 1KERA 1U2QA 2QTBA 3AK4A 4KQFA 4OVKA 3DBLB 3KTDA 2JI4A 3TPFA 4BQIA 2WT8A 2FHSA 3CPJB 4PIMA 3JSEO 4AX2A 3EXIB 1H9BA 5IT5A 1F8FA 5AKGA 2ID8A 1ZWKA 1ML3A 2NX2A 4EK9A 2O8BB 3P2MA 5F98A 1N0HA 4KKVA 3RPEA 4JYPA 2JNWA 1HLPA 1C3EA 2XVYA 3NTQA 1SQ6A 5E6RA 3VNBA 5H9VA 4MVRA 3TZCA 3VRHA 4D0SA 5TSDA 1TLLA 4N0QA 1G64A 3IIKA 2Q5JA 3EAQA 3KB8A 4UBKA 4XGQA 2BIFA 3OEEA 3NWPA 2QJTA 4PZUA 3GG9A 3LO8A 1M1YA 3JALA 3CSUA 3A1VA 4OL0A 1Z45A 3N2NA 1M6TA 4ZO8A 4RTJA 2Q2WA 1HNNA 1KOGA 3C2QA 2Y1WA 2JLYA 5JW6A 4V0RA 3OCWA 2ZROA 5ECDA 2C3MA 1XZDA 2PU5A 2HPHA 3HA3A 4QUAA 2HWXA 4D8TA 2HK9A 2CLKB 2VWGA 2N46A 4MVCA 4KR2A 2GM4A 4F60A 2IW3A 3AG2C 2D5AA 2QRPA 3C5VA 3E81A 3RJ5A 3MRXA 5LD2B 1TIKA 5BOVA 4WT7A 1E6KA 1GFSA 3RJMA 1EXWA 3F6EX 3WRXA 3OQJA 3LW7A 3RR2A 3IBYA 1UBKS 5HZMA 4R8LA 4F5DA 1KKMA 1TO6A 4E22A 4YRJA 1GAJA 4G41A 5F3DA 1PZEA 3EZNA 3ZCUA 1JFLA 5F7JA 2GN4A 5JVDA 1ZD3A 4LNUB 1SOUA 5TX7A 2SHKA 1K4YA 3EF3A 3IV6A 2C4UA 3HI4A 2P1ZA 5A04A 2P9BA 2PF4E 2QNRA 4P98A 2IFTA 4GFDA 1G8MA 4BEJA 4IJJA 1J5XA 1QQ5A 4Z1MA 3R0IA 3ZHSA 1T3LA 4MLCA 1L5LA 4NE2A 1R9NA 5EJ6A 4KAXA 1NXPA 3C3DA 5KSOA 1EWQA 2NZ8A 3MPUA 3TAUA 4KNVA 1RJ9A 1Y6JA 2CSXA 1TVMA 4HUQA 2A59A 4J94A 3IMGA 4WOJA 1SMYF 4JEIA 3LY5A 1DJPA 4URHA 2OO3A 3IUQA 1ZKDA 5FAKA 1UDCA 1B8PA 4RVNA 2IBTA 2DR0A 3RSHA 2YHIB 1KQGA 4E30A 2O2XA 3NOOA 3OA0A 4I36A 4I4TF 1HY5A 2XADA 2R6HA 4DIEA 2BBTA 3UPTA 4ZOBA 4BWFB 4QDZA 4Q5SF 1WOYA 3E9QA 5F9MA 5DU2A 2JAXA 2VUSA 1V8ZA 1SVOA 4LY6A 2HMTA 1L7DA 2ECQA 1CUHA 3ZD9A 5DLQC 4DT1A 1MJGA 5G1PA 2IYPA 4L2IB 1MGPA 4LX0A 1VSTA 4DS3A 2E89A 4S1VA 4Q37A 3EQLF 2I78A 3O3MB 4N1AA 5ALEA 4JCOA 4RF2A 3MLAA 3U80A 4KGXA 5BVHA 3VR2A 3GFVA 3IP1A 1VLZA 4F3KA 1GAXA 1TPZA 5JIBA 4DLKA 5JRJA 1N5KA 2PQ6A 4BO4A 5DSXA 3BRCA 3LAYA 5DTJA 4DEXA 4TRJA 3GBSA 4BO1A 1SVLA 2NSHA 1KAEA 5FORA 4I55F 4YONB 4BN4A 1OKKD 2MYSA 2XL6A 1EIWA 2X5XA 1QIGA 4P5EA 1RXWA 1B1AA 2W2VA 2GXQA 5EHHA 1RXCA 2DTEA 3E35A 3SYMA 1MAUA 2C59A 4MAAA 2AJTA 2A58A 4FDLA 4K6FA 3ZZTA 4RTPA 5CX1A 3I0NA 3V4VB 2IVZA 1N1CA 5A06A 2C42A 2VHTA 3QHPA 1UODA 2I55A 3QNUA 1TAHA 4PNEA 3F6PA 2OR3A 2C96A 1LZLA 1CTQA 3KYJB 3L9XA 3EUFA 1A0BA 4A16A 1HR0B 1CW2B 4E14A 2V8OA 1G3MA 1FFSA 4Y2VA 1EJBA 2D4HA 3K1AA 1I51A 3MJ4A 3X1YA 2AP3A 1AOXA 5JYEA 1YI0A 2A33A 1MQ9A 2EOAA 3MJRA 4Q7JB 4XPIB 3IEVA 2WTUA 2OCBA 3IE2A 5AVZA 1IUPA 1D2MA 5TQ2A 5DHQA 1T1SA 3AH8A 3E7WA 2ZRIA 2BGGA 3GWZA 1JG7A 2FPOA 2O2YA 4PV7A 4R2XA 3OBIA 1IEQA 2O3UA 3OO1A 4IB4A 1P1JA 1ZUIA 1BWPA 2FWPA 3PGA1 2IXPA 4FMBB 4I4TB 5MGNA 3QSYA 3QMMA 3NDIA 3ERCA 2ZRJA 1LPAB 2HK8A 1DTEA 4Q1FA 1NY6A 1X8XA 2ZSDA 1SWWA 2WW8A 4MKHA 3LUBA 1IXYA 4RQAA 3LBNA 3DBRB 3WGKA 2CDCA 5L9AA 3CRZA 1T6XA 3W5IA 1OV4A 4FAPB 3ZW8A 3CX3A 3DE6X 5I4BA 4JMPA 3BGIA 5E9AA 2G0AA 4O6VA 4XQCA 2OC4A 1N3LA 1SD2A 3OI7A 3MX3A 5CB6A 1DOWA 1JAIA 2FP3A 2DUWA 1XMOB 2PSDA 4CJOA 2IV3A 3UICA 1KVTA 2XYPA 2BKVA 3Q8MA 4F6RB 4RK0A 1WJGA 5CFRA 3WB2A 1ORSC 4I55B 4D74A 3SC4A 2FGJA 1EUDA 2ZJ5A 3I76A 5JARA 4BQNA 2R00C 1W0CA 2CHQA 3OQ6A 4MQMA 3MOSA 5HFJA 4CFZA 1L9KA 1OA1A 3E18A 1PJAA 2QLTA 2G9VA 1LPSA 1ENZA 2JD1A 3THYB 4EFKA 5IJAA 3SE0A 1KYXA 2I1WA 2AN4A 1K7EB 2IT1A 5IJWA 3T61A 4C5BA 1PF7E 2VDOB 3S6JA 4HPWA 2AEJA 2COEA 3L0DA 1BDJB 4LYDA 2FI1A 3L0IA 4LDQA 2CVZA 2WHYA 2HCTA 3A4TA 4HGOA 4RD3A 4HRYA 5LD2C 1IBLB 3AVQA 3RRBA 1VECA 4M1WA 1KAOA 3VUEA 2JJ1D 4L5CA 2IOHA 2FLKA 4WJZA 3S2YA 3BF8A 2FW1A 2C9OA 8AT1A 1Z8DA 1JEDA 3FOFC 3UJHA 1LLQA 2ZR0A 3T3PB 1DCKA 1I5OA 3NDPA 3DQQA 2YLDA 4LE2A 3DOHA 1WCIA 1JQDA 4RIIA 1SWVA 3H9EO 2VDQB 3AEZA 5AM5A 3IEUA 2WRZA 1T5HX 3GFSA 4DILA 5A4MS 2GN8A 3TN7A 4AG6A 2JGMA 2UUPA 5EGNA 1EDEA 3QUCA 3NKFA 1HMOA 3JAMA 1P1KA 2D5BA 1IXSB 1EQAA 2PSEA 4OMUA 5IDXA 1EGAA 4DDVA 3PPWA 4WUTA 2H57A 2R8XA 1H85A 1W6UA 1EESA 2XNDD 2VJKA 1JU9A 3OIFA 5EWLB 3LCCA 2D59A 2Z08A 5MGBA 1ZM2A 1E3MA 3I2JA 3QENA 2Q1WA 1E63A 4F4BA 5KO2A 5C7YA 4ZVRA 2G1UA 4ER7A 3U17A 2QRVA 1HYGA 1NVBA 4RPGA 5LNK6 1S7GA 1Z0IA 2J67A 2O7RA 4Z9AA 1L5HA 2VRBA 5E1MA 4PGAA 4XB1A 1H2YA 5EHQA 3ILSA 3R7AA 1ODFA 5A5DA 4S05A 1HETA 1U8AA 1AE1A 2VYNA 3QU2A 2OSVA 4CS9C 3H42B 4XB6B 2YVKA 1IDN1 1ODCA 4BV2A 5CGQB 3CNOA 2R1TA 1AG9A 1VHLA 4IOKA 2I7CA 5EWJB 4YVFA 3I8XA 4NYJR 3M15A 3G6KA 1GKLA 1HH4A 1HT1E 4M1EA 2X7XA 1ODSA 1V4NA 3CC8A 3RVNA 2JATA 3W8DA 1QS0B 3UMJA 2LPMA 3IEMA 1F4VA 5E38A 2D0DA 2C9MA 1Z4NA 4UEWA 1WXFA 4IJ6A 4C5AA 3M4YA 4CM3A 1T35A 5KKNB 1UAGA 2QJWA 3W7VA 4X1IB 4FFSA 4BNGA 2O8FA 5JNTA 3N8NA 1NJ6A 1PEKE 2ZTLA 2NPFA 4PNHA 3BL6A 3B3FA 4Q4DA 1M72A 4DCNA 4LMRA 3DL4A 2F67A 3I9V1 3AOGA 2QJFA 3IV9A 2CLCX 1YBAA 1IJEA 1JKIA 3U49A 2ZBVA 1V9SA 2NYRA 1D6NA 4MQ9F 1XD8A 1A04A 3V8MA 3GEBA 3DTVA 1FZTA 2X3UA 1K7SN 1NOKA 5DX1A 3F9CA 2XDQB 4KXYA 3DUWA 4ZCRA 2XOXA 3AESB 4RSHA 3W5UA 5AW8A 2CCJA 4OBEA 4DV6B 2V6GA 1XZMA 2MJLA 2NVWA 2Y0EA 4ZQEA 3IUNA 3HNPA 1UMDB 2OQ2A 4YYEA 3SHQA 2WWHA 4ZAYA 3TNYA 2F4VB 4DNXA 5L0DA 1I7DA 3A2KA 1JDTA 2HV6A 2Y0PA 4B8ZA 3CRRA 2D1QA 4KI2A 5LMCA 4TL9A 2B9VA 2X2PA 2J46A 2Q00A 2FW0A 3H1BA 4HMOA 3DMFA 3CAXA 1NFNA 4H0FA 1F1MA 4A1FA 3QITA 2BHTA 1B15A 4TVSA 4V24A 4ENWA 2YWHA 4PYKA 3OF3A 4Q3KA 3GYBA 4JKOA 5JSQA 5G0TA 3GEPA 5K4AA 4O4IF 4YHHB 3E8XA 4O4JA 3QLEA 3L07A 4XVRA 4LLCA 3PQ8A 4CG1A 3GFOA 3GV0A 2QPTA 4QFMA 1EFVB 1IVSA 2JAQA 3W5HA 3L7IA 4U4AA 3WX0A 1STOA 5ALOA 3TQHA 4BVJA 4UJ5A 3MYYA 1ESCA 3DD5A 2JD2A 2QRUA 2VDPB 3W5CA 1TAQA 1LIHA 3U8VA 2FQYA 2EILC 5ALUA 2DR3A 2H7BA 3TVDA 1QJCA 3H4VA 4HTFA 5HQ3A 2RD2A 1O95C 1Y4UA 1ISJA 1GL6A 2AG1A 3F96A 4BNWA 3TSYA 5I9IA 2IUSA 2B2CA 1ZNYA 5ALRA 1NW4A 2EFDB 1CDDA 4LC0A 4WOKA 1OZAA 1U9IC 3RHFA 2FFHA 4PZDA 2TRSB 1MPTA 3OT5A 3ZJYA 1ZMXA 2ZB2A 3JD4A 4ZYXA 4YL1A 3W2FA 3RTCA 3C97A 2FOIA 3VC7A 1CZUA 1KI1A 2G6BA 1YZNA 1G4HA 2LUOA 1XFDA 3ETHA 1ADFA 3ZLUA 1ID8A 2PEYA 1SUDA 1J0BA 3VU9A 1H6GA 2C77A 4GYJA 1HK7A 3PPIA 3LXMA 3PK0A 3OWTA 5ALKA 2B9EA 1DBVO 4NECA 1N3YA 2VPZA 2XT6A 4INPA 4ISCA 2WWIA 1ZXBA 2PD4A 4R32A 1LNQA 4QBTA 1UKCA 3O2QB 4PJLA 5EMHA 1D4F