4KNVA

The crystal structure of apo human hdhd4 from se-mad
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
241
structure length
241
Chain Sequence
MRAVFFDLDNTLIDTAGASRRGMLEVIKLLQSKYHYKEEAEIICDKVQVKLSKECFHPYNTCITDLRTSHWEEAIQETKGGAANRKLAEECYFLWKSTRLQHMTLAEDVKAMLTELRKEVRLLLLTNGDRQTQREKIEACACQSYFDAVVVGGEQREEKPAPSIFYYCCNLLGVQPGDCVMVGDTLETDIQGGLNAGLKATVWINKNGIVPLKSSPVPHYMVSSVLELPALLQSIDCLVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N-acylneuraminate-9-phosphatase
publication title Design, synthesis, functional and structural characterization of an inhibitor of N-acetylneuraminate-9-phosphate phosphatase: Observation of extensive dynamics in an enzyme/inhibitor complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 87
structure length 241
sequence length 241
chains with identical sequence B
ec nomenclature ec 3.1.3.29: N-acylneuraminate-9-phosphatase.
pdb deposition date 2013-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.710 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4knvA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4knvA01
1TJ5A 2P9JA 3SF0A 2O9JA 5AVRA 1Y8AA 3F9RA 3L0BA 3BWVA 4Y2SA 4KX5A 5AK5A 5AVVA 4DW8A 3D6JA 2MSNA 1YNSA 4O8CA 1SU4A 4OFZA 5ALOA 1VJRA 2AUTA 4HGQA 1QQ5A 1U7OA 4NABA 2RBKA 3WK4A 3ESRA 3L8GA 3ZU6A 2FPXA 3NAMA 4DCCA 3I76A 5ALHA 5E0OA 4AP9A 3U7HB 1Z5GA 2AGVA 3SLRA 3ONNA 1NNLA 1NRWA 3AR9A 5AHXA 2FPRA 3AR2A 2PQ0A 4BX0A 2WF5A 4UU1A 4CF5A 5AKHA 5AW4A 1XVIA 3KC2A 2WM8A 4OCZA 1QH9A 1MH9A 2B1QA 3R09A 5AKXA 5ALNA 1K1EA 1RLMA 4YIKA 3OCXA 2Q4RA 1PW5A 1RMTA 3TLMA 1RQLA 3QU7A 4YCMA 4JDPA 3ET5A 5ALMA 4C4RA 5AW9A 1U2TA 5AI6A 3MPOA 1RC8A 4BEWA 3E58A 2YMQA 4YH1A 2ZG6A 1VFPA 2CFSA 3SKYA 3OCUA 3M9LA 3QU5A 2YJ4A 3OPXA 1Q92A 2JAWA 2W43A 3PGVA 4DFDA 3RF6A 3U13A 2IOFA 5AKIA 3S6JA 4EEKA 4UMEA 3L1UA 3ESQA 5AKJA 1ZD3A 3WK8A 3FZQA 3GYGA 1YJ5A 2CFTA 1XPJA 3NASA 3ET4A 4UAUA 1O08A 1QYIA 1ZRNA 3IB6A 2FEAA 3ZVMA 3RFUA 3KBBA 2CN1A 3A1EA 4Y2UA 5T41A 1SWVA 3QUTA 4HGNA 4NFLA 4QQFA 2HHLA 1WR8A 4EX7A 2HI0A 4IFTA 2P11A 3A3YA 3PCTA 3FPSA 2QYHA 4HYTA 5AVWA 4E88A 3SKXA 5AESA 3DAOA 4BX3A 3QXGA 2HF2A 3L5KA 1RKUA 3L8EA 4Y2YA 4F71A 3N28A 3OCVA 3DV9A 1Z4MA 1Z88A 5ALVA 2YN4A 3SD7A 3MN1A 1Z5UA 5AKKA 1RPZA 2HO4A 4Y2XA 2R8ZA 1S8OA 4JB3A 1VJ5A 4L57A 2C4NA 5AK6A 4F72A 4Y2JA 1CQZA 5AK3A 5ALGA 5ALZA 5JJBA 3WK5A 3QLEA 3ZUPA 2CFRA 1N8NA 3NIWA 2R8YA 3ZWDA 5IT0A 4KNVA 2GO7A 4UARA 3ZTWA 4UM7A 5ALUA 3SHQA 4AS3A 2WF8A 5AI9A 5AVSA 4GXTA 5AKEA 3WKCA 3KZXA 5AIAA 3K1ZA 1YV9A 4KYTA 2D2VA 5ALEA 1TE2A 2BDEA 3WKEA 2DQSA 2IOHA 2GHQA 2ZBGA 3L7YA 4FFDA 1TJ3A 3VAYA 3WK7A 4RESA 2PKEA 1O03A 5ALRA 1X42A 4G9BA 4KX3A 5IT4A 3AR4A 5AVTA 4XPZA 4BBJA 3B9BA 3M1YA 3NUQA 5AVYA 2YJ3A 2BY4A 2HF7A 4NV0A 1RQNA 3N5KA 2G08A 2ZXEA 2HEGA 2HOQA 4CF4A 5AW5A 2OYCA 3SMVA 4ZEVA 2ZBEA 3FPBA 3ZTYA 2Q5EA 3IJ5A 4OD0A 4CE6A 2HX1A 4UASA 4YGYA 5ALLA 3U26A 4B6JA 2WFAA 1Z4QA 3WK9A 2JGAA 2WF6A 4HAIA 2YFYA 1F5SA 2FUCA 3ZVNA 3U7FB 2I7DA 3E8MA 1CR6A 2OA0A 4BEVA 4GIBA 2C8KA 2RAVA 4HGOA 3NALA 1ZS9A 2C8LA 2YY6A 3MMZA 5AKLA 1RMYA 5ALXA 3J7TA 3QU2A 2WF9A 2I34A 3A1CA 5AICA 1Z4NA 2YJ5A 3ED5A 5AVQA 2EAUA 3KD3A 5AM5A 3ZX5A 4AS2A 3AR6A 1RKVA 3L8FA 3UMGA 4L6CA 5AKGA 5ALSA 5AW6A 5AKZA 2WF7A 3FM9A 3A1DA 3N1UA 5ALFA 1Z4LA 1Z4IA 4UATA 5AVXA 5ALPA 2G80A 2I55A 2YBDA 4J2TA 4ZEXA 4EZEA 1WZCA 4XE5A 5AW2A 1KYTA 3PGLA 5AI4A 2NO5A 4QJBA 1L8LA 1RDFA 2B82A 3QX7A 2JARA 2O2XA 3KOOA 1YS9A 1L6RA 3R4CA 5ALDA 5FP0A 2MU1A 3I1YA 4I9FA 2ZOSA 3OCWA 3QUQA 3U7GA 2OBBA 2IOFK 4EENA 4I9GA 1T5TA 2BDUA 1SWWA 5A3RA 3AR3A 1S2OA 3QUBA 2GMWA 4XOUA 2IA5A 5AKYA 1ZRMA 4C4SA 3EWIA 5ALKA 3B9RA 1QQ6A 3MC1A 1LTQA 3QU4A 3NRJA 1Z4PX 1WPGA 2HCFA 3UMBA 2R8XA 5AI5A 4G63A 1EK1A 3WKAA 1T5SA 2WHEA 5AM3A 1RMQA 4BNDB 3AR5A 2YMPA 4YCNA 3R9KA 2W4MA 4KN8A 3FGOA 3WGUA 2C9MA 3CZ4A 3L1VA 5ALIA 3N07A 2FI1A 5ALYA 1Z4OA 4Y2RA 3ZW7A 1RKQA 4YCLA 2ODAA 3QYPA 1EK2A 1L7MA 1WVIA 3WGVA 2EARA 2G06A 3P96A 2RARA 3IRUA 4DWOA 4KNWA 4UAVA 1RRCA 2P27A 1ZD4A 5AW3A 5AW7A 5AW1A 2I33A 3WKDA 3L8HA 5AW0A 3EPRA 5A3SA 2JAOA 3L0CA 4OHFA 1L8OA 3W5BA 5AIBA 5A3QA 2AMYA 1U7PA 5AI0A 4UU0A 4Y2TA 3ZVLA 1Z4KA 2FDRA 3OCZA 1LVHA 2B30A 4UM5A 1YMQA 2I6XA 2R8EA 4EELA 4IG4A 3QUCA 2YMLA 1L7PA 1Q91A 4BYGA 1L7NA 4BKMA 2B1RA 3EF1A 3I6BA 4UMDA 3AR7A 3UMCA 4EX6A 3I28A 3QU9A 2YMMA 3U19A 5AM2A 2EATA 3EF0A 4NWIA 3QNMA 4HGRA 2ZBFA 3E84A 4BNDA 3WK6A 4C4TA 2B8EA 1AQ6A 4Y2QA 5AI8A 4J03A 1U02A 4CF3A 1ZJJA 1XP5A 5AM4A 5AW8A 2HSZA 3WKBA 4BX2A 3KDPA 2G07A 4RETA 1RLOA 2FPSA 1U2SA 3UM9A 4YIHA 1Z4JA 4FE3A 1TA0A 1RLTA 2X4DA 2I54A 4CNQA 2NO4A 3N8GA 1FEZA 2GFHA 1N9KA 3BA6A 4L6AA 5AM0A 3PDWA 4NAVA 1T9ZA 3E81A 3OTQA 1JUDA 4Y3UA 1L7OA 1TJ4A 3ZWKA 4UMVA 2RB5A 2ZBDA 3W5DA 5ALWA 3DDHA 4UW9A 2YJ6A 2G0AA 2G1AA 3ZX4A 3CNHA 5AVZA 2GHTA 2P69A 3W5AA 3NANA 2IYEA 2NYVA 3AR8A 2OM6A 3DNPA 1ZOLA 4MUMA 4PNHA 2G09A 2C88A 1IWOA 1NF2A 2B0CA 5IS2A 5ALJA 2HDOA 3U7EB 4MWOA 4Y2PA 4HGPA 4H1WA 4XQ0A 5AK4A 2VKQA 3FVVA 4ZEWA 1ZD5A 2Q4TA 2QLTA 2JAUA 2W11A 5AVUA 5ALQA 2PR7A 3HLTA 3L0YA 2AH5A 3OCYA 3W5CA 3QGMA 1QQ7A 3B8EA 1J97A 5ALTA 1J8DA 2FPWA 2FUEA 3HYCA 2FPUA 2B8JA 4FYPA 5AM1A 4UMFA 1ZD2P 4Y2VA 1YDFA 3ZI4A
chains in the Genus database with same CATH superfamily
1ZEJA 4F9FA 1GT6A 3ZXIA 4WCVA 1QK3A 2PL9A 3E22B 4IRUB 5E7QA 3ZNNA 4DXHA 3K05A 4HI0E 1G1MA 5E0OA 5DHRA 3ONNA 2I4RA 1P9WA 4O2AB 4OHUA 5DLYA 1RPJA 4AQYB 2XUZA 1I1OA 2PH1A 2FMIA 3AH8A 1YASA 1FP6A 3IP7A 4G8CA 4GC9A 2QYSA 2FX5A 1U7XA 1KI9A 1P0IA 3HSSA 1NE7A 3CNBA 3WR5A 4DDUA 4IIDA 2BFDB 1JTFA 1BR2A 4XEUA 2D2IA 4U63A 4EPYA 1FSGA 2CFTA 1E92A 4W5NA 1DAPA 1E0SA 1KEUA 5IM4F 2XODA 4HYTA 4GAEA 3WQHA 3L5KA 1GFSA 1YQDA 1P72A 1G5QA 5EWJA 2XB4A 4QJIA 4DE5A 3MB8A 2GBFA 4I5EA 1G59A 1LLQA 2OZEA 3AK4A 2NUPA 4NI5A 4MTLA 1X0XA 1I5OA 2ECFA 3G9UA 4G5HA 2LKCA 4X9XA 4TLAA 4K9MA 4FZ5A 2WP0A 3RG8A 2ZWAA 4KZKA 3WICA 1USWA 3TLCA 5FI5A 5BW5A 4HAYA 4JSTA 4IY1A 1HQYE 3L41A 3O1LA 3L1HA 4UHKA 1S5PA 2VWPA 5FO1A 2QTZA 5INTA 3N6VA 3IBTA 3QPBA 1QRTA 2W42A 2RG7A 3BAFA 2WU4A 1EQUA 1UBGA 4GI3A 4OD0A 5BW6B 4KB5A 4LFBB 2D7DA 5DNYB 4AT1A 3U7FB 2QLAA 4MJ7A 3E3OA 5CT4A 3OZAA 1E64A 4H3SA 1BCSA 1DL5A 3W3AH 1N0HA 1BQ3A 4DMHA 5AVQA 1RM5A 2NWQA 3FX2A 4I5GA 3SEOA 3MLGA 4QODA 4FEEA 4X7MA 5B58T 2DP4E 2C4MA 2VDOB 1KJZA 4PW0A 4HUQA 3T3HA 3FUVA 4B6PA 4HX2A 2VWHA 2P7IA 3TOCA 1JBKA 4ZVNA 4NVRA 4RD9A 4H7EA 3UR3C 2PA0A 3R77A 4NE9A 2B4AA 2FMKA 5DN6A 3CJTA 3VMFA 2NNWB 2ZJ0A 3A9UA 4DV3B 4I3MA 1I2AA 3LZCA 5FWXA 4F38A 4P35A 3ZV4A 2IU4A 2RK6A 3BEHA 2DHDA 4BRWA 3LQRA 1M6VA 4K9LA 1YUMA 2O8FB 2FR0A 2BMDA 3FE2A 1OXBB 2DJIA 2JZCA 5IZCA 3N75A 4YBZA 4NU5A 1FFBA 1GAXA 5SYAA 2HV7A 1QV7A 3P97A 2FKNA 2IEBA 3ZH2A 5BUSA 2VK8A 4XM0A 4HFKB 3H99A 4P4TA 4OKIA 4MA0A 5K9ZA 2HREA 2QAJA 3A3PA 1C9KA 3S4YA 3EX7C 4PRZA 4CG2A 3GD5A 4GOMD 3V5ZA 1RXVA 2OR3A 4AG3A 5C37A 1OH6A 2X76A 3LXUX 4MGHA 2NNLD 4J91A 2C1XA 1CUWA 4LK2A 2EQBA 3PHF2 1BCRA 2BM0A 3DBHB 2IXBA 4XR4A 3R3XA 1DINA 4LY9A 4OINF 3RKOF 2HYDA 2Q4TA 4N82A 3KEFA 1HNZB 1U6JA 3RV4A 2KK1A 4DSUA 3GWLA 1ZGZA 4X6UA 1WMBA 2YWXA 1MH1A 5K6RA 4KXVA 4J0CA 4Z9FA 2YIMA 3GCWA 1U7OA 3KVOA 3WK4A 3IAS6 5EG5A 2ZJZA 2NZXA 5BSFA 4GOLD 2XHZA 2YYAA 4XIFA 5AHXA 4B6EA 1OFUA 1PEAA 1K06A 3IQDB 2HK8A 1NYLA 2GRJA 4NC9A 1G55A 2PMEA 1A0OA 4C3EA 2QTHA 4N9QA 4S0XA 1UEJA 2E4UA 4YJ2F 3U7IA 1LX6A 5AI6A 3D3NA 1XTSA 5DMHA 2PGAA 1YZHA 3FI9A 2FMFA 2EBFX 5I8WA 3RF6A 2P3LA 2V4MA 2PBLA 1V45E 4IMPA 4JQOA 5CD1A 4Q9KA 4PG7A 4UAUA 1V6SA 1JHOA 1XTRA 1JWLA 1CUBA 3U4IA 3KSRA 3CPJB 3V5NA 3QVSA 2DCUA 1WATA 1IL0A 3G8AA 1AHPA 2DUUA 2X0FA 1HNXB 4E5SA 2N0SA 1GL9B 2FHSA 1YA9A 3LX4A 1YE5A 3NR2A 4KHZA 4HYYA 2V7XA 3G1TA 2FGJA 2OFXA 3US6A 2QB5A 3AHGA 1E2BA 3UWMA 4QPJC 4XD7D 5TE9A 1DKNA 2BM1A 1HBJA 2HRBA 1UKAA 5T1DB 4H7JA 1E4EB 4NE2A 3RJ9A 5BRJA 4YA6A 4PFQA 1GWNA 2C8JA 2PAAA 3PD0A 3NOXA 4PN3A 3FNHA 1Z2CA 1M1ZA 3Q9SA 4C6SA 3I61A 1Q83A 3HMQA 1DKLA 3E61A 4P3OA 3G9QA 5EZ6B 3IKTA 3H84A 1YE3A 2AWYA 5KU7A 4MB2A 3DBLB 2VP5A 4MWEA 5KDDA 2GSDA 3PQEA 4BQEA 1T3HA 2DC1A 5KPJA 1E4OA 3JQ8A 2C54A 2VOEA 5FCLA 3RK1A 1OCOC 3W4KA 3EQ8A 4MRNA 4YASA 4G86A 4DOZA 5CT6A 1G8XA 2X8LA 2FVYA 3FBWA 2DY0A 3IPYA 2J0XA 1A50B 1F4VA 1VHQA 4ND8B 4NECA 4HNUA 4NG4A 4M2LA 4G25A 3FGNA 2OLEA 4IB4A 4PBRA 2LIGA 1KU6A 2WPDA 3HVHA 3HG7A 1TZJA 3I34X 3KOOA 1DRVA 3QPDA 2PZ8A 3EGCA 2O4CA 1MFZA 3EZ9A 4ENQA 1S2OA 3NLLA 2ZTMA 3PQ6A 1ULHA 2ZPAA 3WHPA 1PL0A 3NS7A 3LEVA 4HEHA 3NUGA 3KUCA 2GSWA 2AFVA 3OQ6A 2HMVA 2O3TA 1GNLA 1Y1TA 2W8BB 3WL5A 2M64A 3AI7A 4O8ZA 1DB3A 3SAJA 1WE2A 3BMQA 1P2SA 1C14A 3AIKA 4BP1A 1NV9A 1DQSA 3INYA 3WB1A 3E3NA 4GPTA 3WL8A 3L6CA 1HE1C 3ZU3A 1ADJA 3U16A 2X1LA 5TGDA 1M8FA 2BFAA 4G1UC 2BHLA 2CMHA 5IKPA 2Z4RA 1TAHA 4AN4A 1CRZA 1KZ7B 3SDSA 1O5IA 1TXGA 3L4BC 4E5MA 4CIVA 3AKZA 1WIWA 3BAZA 3HE3A 5KDOA 3K70D 1UK7A 3W04A 3QF4B 2ZREA 1M0TA 1V25A 2DHCA 4QXPA 1XEXB 2HPVA 3U81A 3B36A 2FW7A 1EI7A 2ZIFA 3NH6A 1SHJA 1JDSA 2OV4A 4DA4A 1ZLYA 4FD3A 5AXCA 2Q4EA 4IIEA 2JFYA 5JDIC 5A6BA 2B94A 5HPYB 5KNLA 2GEKA 1T36A 3MLEA 2X6RA 2FDXA 2F3RA 1JKJB 2IY7A 5E4FA 3QENA 4DC9A 4HWTA 1LI5A 4NCIA 4DLBA 3HJBA 2FXIA 1MX1A 3GVPA 3FCAA 3RVYA 3GLRA 3O92A 4N1AA 4WX2B 1NV8A 3KALA 4ONEA 4JOCA 4N48A 4MVJE 2HFJA 3QBJA 5TMPA 2B8JA 4ZHQF 1YZCA 3LC0A 4O4JA 3WLSA 4EMSA 3GFOA 1DO2A 2K2QB 4ZT7A 1P5RA 2DBQA 4FP9A 1J8QA 3LCRA 5GVSA 4D98A 4YAOA 1WSWA 1YOVA 3TVDA 5EJ7A 3RJZA 2FLWA 5IHPA 1ZGCA 3CJRA 3RIHA 3BRSA 3A2LA 5IK2D 4I1SA 4GMKA 1Z08A 4PPYA 2V97A 2JH8A 1GAEO 4BATA 2QROA 2HIMA 1XL0A 3WLJA 4Z51A 3ORRA 1ZXBA 2ZI5A 3DLTA 5FL7A 5FQNA 2CDRA 5LNK6 1ZW6A 5JXHA 2J46A 3JQGA 2ZRFA 1AKMA 3Q1LA 4N7BA 1L7DA 3QP9A 4HN2A 1V54C 3P9SA 4C2UA 3CUTA 3AUKA 2AHRA 2FMHA 5C8ZA 2QLJA 3RVJA 3L8DA 1VKRA 3HY6A 3MELA 1BXRB 3GJZA 5A2QA 3EVTA 3ET4A 1O96B 3HR7A 2FEAA 4EIWA 1ZSNA 2WJWA 3EW7A 3LF1A 4JBGA 2Y92A 1RKEB 4H3KB 2O48X 4CBVA 1GG5A 1NLMA 4LMRA 1QTRA 1WXDA 4EUSA 2B6NA 2FE4A 1ZPDA 3V1YA 5JH7A 3REOA 4B85A 1SQGA 3W5IA 2WIKA 1ZYRF 3PDCA 4XQCA 1GG9A 3QOFA 4WK6A 3PWSA 2AJDA 1E6KA 2F4VB 4OIQF 4Y6OA 5FAKA 2I8BA 1XTIA 2HU7A 2PMBA 1C1XA 3AB3A 5LOVA 1YI0A 2QENA 4RHEA 2Y1EA 1X42A 4A2NB 3Q7IA 1ZOOA 1KMHB 3MUOA 2JFVA 4B6SA 3EAQA 4CTOA 3TW4A 4E5KA 4WGFA 2IYWA 2MDTA 4KWIA 1UWLA 4MVJD 4EKIA 3PNSA 3JASA 4WUTA 3K7DA 5CNMA 4RPKA 4J0FA 2YZNA 1SB9A 2C7PA 3TLGA 4QU0A 2PX6A 1G9TA 4YRBA 3FJ1A 1SC9A 1P5JA 5B2ZA 1QORA 1DP4A 1NSFA 3T1YB 1EQ1A 4WJKB 2C4TA 1B16A 1B2LA 1AGNA 2VLIA 1GTRA 1G21A 4EGAA 5AUQA 4HLQB 3OETA 5DTIA 3CEXA 2GLTA 4QHYA 1IN5A 5H16A 1RACA 3FPJA 4AJJA 4ZVUA 1VG1A 5L45A 2PU5A 5CB4B 4RA9A 4QUDA 1D0ZA 1FJ2A 1UT6A 1UXHA 2CL5A 1NDQA 4CMEA 3D2AA 1V1MB 2JAXA 1O0CA 3S44A 2CNBA 5L0CA 3WIEA 2CXUA 3LESA 1KPGA 4M99A 1JEOA 1FZQA 3GGSA 1TQ8A 4C3OB 3ZVKA 2VUIB 3CAXA 3VM6A 2WE8A 1EXDA 2H16A 9MHTA 3R40A 5HRUA 1Y1LA 3LLVA 1QGZA 5HQ3B 2ISSD 1O54A 4U2DA 3ROQA 4DA9A 5CDTA 5COGA 3EEQA 2PBZA 4JC5A 5JAOA 5DYIA 4BAGA 2PK3A 4WLUA 2JLCA 1NNI1 4R2IA 4NTBA 1OPXA 4EY7A 3DFIA 4RJLA 3L1KA 5E6UA 3GG2A 2VPYA 1KYWA 2GBGA 1BGWA 1Q0HA 1RHJA 2ZJYA 2WZFA 5TMBA 3HVRA 1CUEA 2QPTA 4D44A 4ENTA 3DTYA 4ENRA 3DZFA 3WA7A 4B74A 1Z82A 5HXAA 1MMAA 1Z5PA 3PKIA 5EA2A 4J3JA 1L5FA 3U7QB 1RWOA 5JTTA 2CK3A 3HKCA 5E9WA 5CYFA 4OBBA 1VL8A 4LJ4A 2Y99A 5LSAA 5ALJA 1KAMA 1TCAA 1C1HA 4QQRA 4EUKA 2TMDA 3RK4A 1EJ0A 1QKKA 2WI8A 2I03A 3WRXC 1ZINA 3CIFA 1B6GA 5ALQA 3IHWA 2ATIA 2BF7A 2FSSA 2DUMA 1Y9AA 1N2HA 2J9FB 3BHJA 5PNTA 4K6HA 4Y2VA 1UADA 1JFTA 4Q1BA 2P6MA 1JJIA 2J07A 3U3RA 1BH6A 5H82A 2NU7A 1ZCAA 1MX9A 3LVFO 2Q2WA 2TSYB 3AEKB 4MW3A 2VQSA 2EFCB 4DRXB 3F7NA 1PR0A 3PITA 4NPHA 3A9CA 5CU7A 3PDIA 4GLOA 4LYAA 4JYMA 2GVZC 4HN9A 3EVBA 4E0IA 1OLUA 2YINC 3TRJA 4RK1A 2HZ8A 2QL6A 3TLZA 1F4LA 1P7YA 3USES 3O90A 4M9QA 2RHDA 2KI5A 4O4IB 2EKQA 2QA5A 3UC5A 3JSZA 4U5XA 1W5TA 5CH3A 2HU2A 3KZKA 4Y18A 2EC5A 2A14A 4HB0A 3MIIA 4AXBA 4EUFA 4NFHA 1UJMA 5C8XA 1MC5A 2C61A 4GOKA 4JFAA 4C6RA 2XWBF 2MSDB 4OP2A 5JPCA 1WHTA 1Y81A 4Z9IA 2I1VB 1HWYA 2Y6UA 9GPBA 3BFPA 2O06A 5EJAA 1AK2A 2P2ZA 1GOTA 1JPUA 4OH1A 1QAOA 3AF2A 3JVUA 4GRIA 4XVUA 3R0QA 4EQ6A 1J2JA 3BK7A 4DG5A 3H83A 4F3CA 3AG5A 2I6UA 1ZN2A 3OPYA 4FEGA 1NURA 2BP7B 3AU9A 4US0R 3HKDB 1ECBA 2WWRA 4ZU3A 1ONNA 3S1SA 2NZYA 2GBCA 2PKRA 3C3PA 4G7OF 1IH8A 1TW3A 4JI6B 3GPIA 4AUMA 4HD8A 2ACKA 3TRHA 5JW6A 3Q9UA 2PRJA 4GECA 2Q00A 1BJRE 3BE4A 1Y3HA 1YAHA 5LQRA 2HX1A 5JY6A 1MMNA 1E5XA 1QPBA 1E3SA 3ESAA 3K71B 3MUNA 5LQMA 4WBNB 1MRZA 2ZAGA 4KXQA 1NQ5A 4XX1A 3KHUA 1HM5A 2GN2A 3S70A 3ZR4B 5IABA 5SZHB 4UCQA 3JWEA 1QHEA 2V9PA 3W8HA 5BXQC 3LBHA 2JGRA 4KHPB 4NYIR 1N2ZA 3ESDA 3JTMA 2QV7A 2V7QD 2RHRA 2WWVD 2PLRA 5EJFA 2EX0A 5A6SB 2DZDA 5CM9C 3PXEA 2P6PA 1N6KA 4G0WA 3L8CA 2R7OA 5F5HA 4LYFA 3MJEA 4ZK6A 3HZZA 1KNXA 4E03A 5F7ZA 1WUTA 1RZRA 4B84A 4PSUA 1WU8A 3LWDA 1NVTA 3H65A 1SXJD 1JDJA 4C22A 4DC1A 3QG1A 3QU4A 3PFKA 1X74A 5L9AA 1XZEA 2EU8A 4Z49A 3TI7A 1OD6A 4C6TB 5J2UB 1J22A 3BXZA 4JLPA 2HMUA 4BEMJ 4OJYA 1T6NA 5TQ0A 5KREA 2H65A 2NPIA 2ZYTX 4MVUA 1E8MA 1ETUA 1TT5B 3ORYA 2XM4A 1T2VA 4Q6BA 4BQQA 1ZD4A 5AW3A 1DLJA 5AP9A 4EVIA 4CN8A 3RAEC 2NN3C 3I30X 1TEXA 1TWAA 1F8GA 3NOQA 1ODLA 1A5AB 4E22A 3VSEA 1G3IA 4IWBA 2EBHX 1KU0A 5FI1B 1YS1X 4DR6B 2GUGA 3JTLO 1YS6A 3K70C 4D1YA 3AEUA 4LERA 1NAIA 1R66A 4LV6A 3CNNA 4E7PA 1IJKA 5D51S 3UM9A 1QLHA 3VX4A 1ZX1A 1ZITA 4JCCA 2HJWA 5AHRA 2R6JA 3U0CA 1KNQA 1LNSA 3AR8A 1AS2A 2VJYA 1DO0A 1GGQA 1M56C 1RBZA 3EB9A 3IUQA 3NDRA 1TZKA 4BFUA 4LDKA 1YL7A 4Z4GA 2H4WA 4JI4B 3FKQA 4BB0A 4OQLA 2IIQA 5ARCA 3L1MA 1BDJA 5GOZA 1POXA 2QNRA 3VJMA 1E2QA 4DJFC 1Q7EA 2JJYA 2Q3LA 4RHUA 5AVRA 4W6ZA 1L7VC 1Y1RA 3TAUA 4TXLA 2Q1TA 2O3QA 4W5QA 3GPLA 3PDJA 1ZHXA 1Y5NA 1SY7A 4PYKA 4G5SA 4YJKA 4A8JA 4RD6A 1OBCA 1MIOB 5DYNA 4YIKA 4G0VA 4OFXA 1YI8A 4YR9A 1RJ9A 1WDKA 4FW9A 4BZPA 4IIGA 5FUYA 2X8JA 1EUCB 1UZAA 3PF8A 3L01A 1PHRA 4KU4A 5K3SA 1AGPA 3JQBA 3L0SA 1YB1A 1ZRNA 2JFUA 1YL6A 5JZSA 1ECGA 3B2NA 5JNVA 1KJIA 2REBA 4JDUA 5HYVA 3WL7A 421PA 1TO1E 2NSLA 2GAFA 3T1TA 3H9EO 1H0KA 4L78A 4XUCA 3L1IA 3ACDA 2PUHA 4IRMA 2C92A 3P0EA 4L3WA 4N54A 2GX6A 2QMUA 4BXOB 1D04A 1TAQA 4HY3A 2N75A 4YJFB 1IZ9A 2QBYA 5IMBA 4BO8A 3Q41A 3IAUA 1CZKA 1NN0A 8AT1A 3T3DA 3KRTA 2RKOA 1ZBQA 5EZYA 1QP0A 3UFXB 2A0UA 1IOZA 3LHSA 5G1PA 4K9NA 4B3GA 1M73E 1ADBA 4GG1A 3O8OB 2RGAA 4CIBA 5B6JA 1TDJA 3C1TA 2FZVA 5TC4A 2JCYA 4KPFC 2V3VA 4GZLA 1SG6A 1SHKA 2NAPA 5E9QA 4N4WA 2P78A 4KRYA 2I87A 2J48A 2IELA 3LCCA 1O4WA 4DDMA 3FAZA 1L4FA 4Q7MB 2BI7A 3FYUC 4HG2A 5CFOA 1YDMA 4QHTA 1QHHB 5J59A 1FFCA 1J1IA 3P0RA 4ZYTA 4P7JA 3UCFA 4WK2B 1J07A 1Y4AE 4LQLA 3VH1A 3WYDA 3RANA 3AQIA 3SQOA 4EA8A 2OBBA 5ILGA 3ZHTA 4RD2A 1Q17A 1XNQB 4O2BB 4AECA 1X7GA 1PFKA 3I05A 1BN7A 1C80A 1D0IA 1PGJA 3IHUA 2GCPA 3P4XA 1QC5A 4ZIRB 2BGRA 1RD4A 1GQOA 4X7PA 2IDMA 1SUCA 4MVJM 2O2GA 2W6PA 4MQEB 4TTJA 4YCLA 3EH2A 2GTIA 1YTUA 2JJMA 1WEKA 2QLMA 4I36A 3BRQA 2DYSC 2OCBA 1EZ4A 2EIKC 5AW0A 3VPBA 3BN3A 1Y7TA 1DKMA 1GFIA 3EMKA 2GFIA 2ZYSA 2IUSA 3GRCA 4P4GA 2FSVC 3RFCA 1FQWA 4HPXB 4W5RA 3QUCA 2Q3BA 1RADA 3AEXA 3AEQA 2QYOA 3J7AC 5J5AA 3HH8A 3I6BA 1E59A 2CBGA 1W73A 2IDJA 4ZWNA 1P2TA 1IC6A 4G36A 4DR3B 3TPFA 3KT3A 1P80A 5HEKA 3K73O 3CX4A 3QA9A 2P1ZA 4MW4A 1XQXA 2WUWE 3ROPA 4FKZA 3K9LA 2PX2A 4LNHA 1G3MA 1NP6A 1RCFA 2WRZA 4MUAA 4YJGB 1OOEA 5IF3A 5CDHA 2PX3A 1E20A 2FN4A 5DI3B 5IJ9A 1DWOA 4NESA 1H3NA 2IC5A 2V6GA 2XQFA 3TSZA 3B38A 1PJ8A 2HIGA 4AZTA 4WESA 2EXXA 5REQB 2HLHA 1EEXB 4N39A 2A86A 1IPHA 1J0BA 1A5BB 3HUUA 3F90A 3ZCQA 1UINA 2PZGA 3TG2A 5EIXA 4EKGA 4URXR 3O21A 4RIIA 3VHXB 1T0PA 3MWYW 1WSAA 3C6YA 1FTWA 1V9LA 5G4KB 2MSEB 2Q8QA 2JASA 5GINE 2EX1A 3ZGXA 4WGYA 1ZAKA 2X0DA 2B8TA 2X9GA 3F1KA 4NZ9A 4OHWA 4UU8A 2ZTHA 2VTBB 1DGQA 2ZI9A 2VQEB 1IUKA 4ER6A 1EVKA 4JAVC 4L1KA 1N6HA 1O0BA 3H7IA 5A4DA 1UAGA 3DNFA 3FXHA 5EINA 3LFTA 2RAFA 3CO0S 5AFSA 1Q7CA 4PZZA 2DRIA 2BE7A 5FWAA 5H3CA 4BMPB 2OGZA 2CEAA 1VE5A 4JP3A 5B1SA 1PFYA 1RXQA 5C7LO 4B17A 2QMQA 3WGKA 2BEWB 4HKTA 2QRUA 3YASA 3I1FA 3EF3A 3A37A 1XVVA 2G1JA 3OCVA 3GOHA 2V65A 5LD2B 2C4WA 2CXSA 2O8NA 2DU8A 5ESDA 5CXUA 5EHGA 1L8XA 2XA1A 2PWZA 3U7RA 4IIUA 4D46A 4OJKA 3L18A 2JEZA 3X1MA 2XTNA 2QUAA 4GM1A 4U7HA 5LQKA 2YDYA 2NU8B 4Q82A 3WQQA 5K8JB 2CHUA 3DEHA 3KVVA 1PW7A 4CS9A 2O2YA 3HRKA 1VJGA 1ZM3A 3H5OA 2PXHA 3HCCA 1OX5A 1H1LA 2R5WA 5H8WA 1EVQA 4UDVA 1M1XB 3T9AA 3IJ5A 2I1QA 4F3RA 3IV7A 1X3LA 1E9SA 3MBIA 1CQJA 2NV6A 3WYNA 2Q2QA 5B3SC 4EGCB 1QVXA 1CR6A 4E5UA 3T52A 4LDPA 4IGGA 4MV9A 5DKFA 3MMZA 3SM3A 4NEHB 2DETA 4I19A 5H4GA 3OE7A 3S2SA 4GEGA 5DBHX 2C2BA 4DCSA 3UJAA 5AM5A 3NYMA 2BC5A 3JALB 3VO1A 1PP4A 1ZM7A 3WQRA 3WGHA 2XKBA 5CYGA 3WAKA 1LBSA 3ZDFA 5EMJA 4I9FA 5AH0A 5F73A 4BE9A 3SIRA 4IL5A 4G6ZA 4M6WB 2AFHA 1O94D 4CG1A 1TCVA 5TJHA 4TRRA 4PC2A 4CM5A 3N7UA 2XTAA 2D1SA 5J63A 4I55F 1KK2A 4N8SA 2A9RA 1UDRA 2G9ZA 4YCNA 4CL8A 4H1VA 2X0EA 5LIPA 1T2EA 3WYEA 2VDKB 1DXOA 3UCXA 1IJBA 3TUZC 3PU6A 3IJEB 5G1OA 2XNDD 3G9TA 1BX0A 1PZMA 3KU1A 4DLKA 2AMFA 1V8BA 5DGXA 3I9OA 1VLSA 4GLJA 3G8BA 3H5TA 4BMYA 1G8YA 3T5PA 2JFXA 2P4SA 3LCJA 2MR6A 1I4DD 2VUTA 1QQ3A 1JQAA 2CE2X 5BUZA 3I28A 3OI7A 3JRMO 3AF0A 2IHTA 1W5AA 1JEDA 5K3EA 5KYGA 2FG5A 2SNIE 2IHVA 3EHMA 4EDHA 2B3TA 2H5JA 4A73A 2YZSA 2PX5A 1Z5ZA 4I4IA 2H4XA 3BGOS 4RZIA 2I4IA 1NN5A 1N9KA 1X1EA 3BXGA 3U17A 3O8BA 4BQPA 5KKCA 1XWWA 3BA1A 1U28C 2Y68A 1WMFA 3TZHA 3BRWA 3W2WA 3U3DA 2Z43A 1DJLA 2A9QA 3S81A 2Q4FA 3LY9A 5JI3E 4KR6A 1ORHA 4PLWA 2A6HF 4B40A 2IU6A 2ID4A 2FSPA 1T1RA 4EI8A 3IBGA 1TFRA 3IDFA 2W9XA 1HYHA 3ISTA 1H6DA 5BURA 4MJ3A 4MLCA 4CR7A 4IHJA 1TMGE 2O8EA 2G67A 4R1QA 1U5AA 256BA 9ATCA 3NMKA 3D5TA 3Q6IA 4RABA 5CXXA 1PSDA 4JX8A 3V4RA 3U09A 3IOEA 1Y3FE 1QQ5A 4AZ0B 1P7PA 4UNNA 1QU3A 2Y1KA 3NKEA 3D0RA 4WXYB 4HS9A 1CDOA 1HURA 1OR2A 1TKCA 3KT8A 4JEHA 3GAFA 4RNCA 1QE5A 5TDHA 4P31A 3EASA 4X63A 2ACVA 3GP3A 4ZRMA 1GSHA 5GIPE 3GR6A 1LA2A 5JNTA 4MEBA 3O8NA 1C8LA 5DT2A 4B2PA 2BFEA 2FFAA 2H92A 2IPAB 4MAAA 5FBLB 3SR4A 3O03A 2Z8ZA 2HW8A 3CQ9A 4MS1A 5IDVA 5MFZA 2XV1A 1VLHA 3A1FA 4QQFA 2IHJA 2YZKA 1U81A 1TCBA 1N6IA 3L0IB 4AMGA 1FMLA 2I22A 1X7XB 4U5BE 4URFA 3QJYA 5ILOA 1SCAA 2P9ZA 3WDSA 3PC8C 2ZI4A 2QM8A 2ACEA 2HRZA 721PA 1OXMA 1Y6FA 4MLPA 3FNEA 3C3KA 4NARA 4Z0PA 3R7WB 1Z2PX 1PO7A 2WVOA 1J23A 4JJ7A 2IBTA 1GQFA 4KWEA 3TLKA 4FUTA 4NXNB 2FWAA 1L1QA 1NBMD 1U2GC 4BLOA 4NJMB 2FP4B 5LBTA 1YQEA 4J49A 2AJBA 2PEYA 4TMFA 4BBPA 4FOSA 4U9UA 5JWOA 4AY4A 3CF6R 5DSTA 1OYYA 3DP9A 2HA5A 3IUYA 3TI9A 1OWLA 2OBLA 3SDZA 3MT7A 1JHYA 4BFVA 4A1OA 4MQFB 1YIAA 3GUHA 4RTPA 4CF7A 5K7SA 2LDBA 2P9CA 3LGAA 2F43A 5G3YA 3KFVA 3GNTA 2D5RB 5BQIA 5TMEA 4KIWA 1FTSA 5EESA 2BKXA 4BNZA 1XEFA 1UDCA 3VSBA 4KACA 4F4UA 3NEAA 2H9AA 3BD9A 1MX5A 4DJ5X 4PLTA 4E12A 6PFKA 5JSFA 3RBXA 2IS1A 4AJ2A 1H4VB 2H7VA 3QVMA 3QHQA 2Z8XA 4HB2A 2YHIB 1F8YA 1TQ6A 3BD6A 5ELLA 3B6ZA 3HNPA 5FPSA 2Y93A 3HBLA 5DRTA 4NATA 3CLSC 2EPOA 5DLPA 4KUEA 3DCYA 4JJ4A 3SGLA 3SEFA 2NU6B 1DS6A 5KEIA 1VE9A 1F8FA 1OX4A 2PFKA 3IRUA 1XZIA 3CR7A 4BKOA 2CW0F 1CTQA 3EPJA 1ORVA 1ZC3A 1HFJA 4UFOA 1YDEA 4J30B 4IR7A 4BV8A 4IF6A 4N65A 2R7VA 5IYZA 3JRXA 1LVHA 3FZYA 1HE2A 1NR1A 3WRVA 1VRVA 4J7YA 3QWHA 5C1IA 4J1QA 3X2FA 3C7TA 1OH8A 5FA6A 2PL1A 2WWTA 1AO3A 5KOYA 2JJ2D 1XRMA 4KDCA 4HAOA 2HDWA 2F00A 3RTBA 2QLNA 5DBOA 1P4HA 4OSEA 4OUKX 3H4IA 2PT7A 4XYBA 5B55A 5FNZA 4P93A 3ZPXA 1L7OA 1I0IA 4V0LA 1Q57A 3UGQA 5DNDA 1Z23A 3MWEB 4J0DA 4CJGA 3F8SA 2V4ZA 3A6JA 4NJEB 4BJTA 5CPFA 4Y2PA 4ZVSA 1XAJA 2FR8A 4QT0A 4ZKEA 1NXPA 2J9WA 2VYCA 2G1UA 1UZLA 3QKIA 4TKZA 2A30A 5LB2A 1L4BA 1VSQA 4RH0A 3A7EA 5I51A 1ZD2P 2QTVB 4B9EA 3TL3A 3MVEA 5JARA 3NKDA 5L8VA 1DU4A 1QH1B 3N8NA 2QE9A 1TTTA 2R25A 3EHDA 4J9UE 4JYZA 1T2DA 1GPKA 4Q19A 4R9SA 3FWNA 1W75A 3FTDA 4YRNA 3HU3A 4J90A 1M2VB 2R65A 3I9V1 1O6ZA 3B5EA 3TLXA 2OEVA 2AOWA 1O1YA 1VE1A 2WJJA 2XWPA 4JBHA 3AESB 1LI7A 3Q5DA 3H2JA 4G97A 2VJBA 3DQPA 3Q11A 4P53A 3ZE0B 3MPOA 4LZLA 3NM6B 2ZVQX 4II7A 3O8QB 5HUJA 3VZRA 3DDOA 4RF2A 4JKOA 3CEPB 3CLTC 4FGJA 3C3JA 4D25A 2Z9DA 3H42B 4ZHSA 1HLGA 1LDGA 1NQOA 2ZR9A 4IKPA 3ZYCA 3EYWA 4ITUA 4EKWA 2RI6A 1T4BA 1RT9A 4QXRA 4DEYA 3I2JA 1OZGA 1RPZA 4MIEA 2RHJA 4P86A 3DFFA 4YYZA 1O5HA 2GJKA 4JHXA 2GZAA 3K4HA 3KSBC 1N32B 4V0ME 5CT8A 2CHEA 2C5FA 2HEIA 2E3JA 5LL6P 2BKUA 5FLKA 5T5QA 3R7NA 5FBZA 4ZYVA 1LC0A 4LAFA 3MTJA 2C29D 1ZIYA 4BNYA 3NVMB 4JYCA 2FF7A 5CLQA 3GW8A 4CLOA 3WVNA 2QUBA 1I2MA 4OQNA 3I58A 5IKXA 3AOGA 1VBFA 4Z5XA 1M2WA 1O6BA 3CZ9A 5DM2A 4FU0A 2FW6A 1MOSA 3WXMA 3E9ZA 2YS6A 5LZ7A 1LY1A 1TB4A 4E5VA 4QSMA 4YGXB 1EXVA 1NMXA 4LDRA 3QIAA 3NHPA 3Q5EA 1KDYA 3F3SA 1H2HA 1U2DC 4U2CA 3KLPX 4P5EA 3KKOA 3SXJA 1KORA 5J3JA 1REQB 3UGKA 3LKBA 3F1LA 1P4JA 1R9GA 4JEUA 4OKSA 2OXCA 1MB2A 3ER6A 4QRDA 3EWNA 1I4TD 2AC2A 4DS3A 3R44A 1R4NA 5JXIA 3NHUA 1U2QA 2RKBA 1VP9A 1C29B 2CLMB 3PRJA 5BWMA 2ZZKA 1N5LA 4J0KA 2BSAA 2OORC 1GIAA 1BX3A 4D9EA 3LY7A 4A03A 5DYYA 2DQYA 2B4RO 3KB1A 3R24A 4DLUA 4GL2A 3IMCA 1SZCA 2X3YA 4Q9IA 4MCHA 1DAEA 1GGJA 3N2IA 4WCFA 1T0HB 1BS2A 3G8YA 2JLVA 4MB6A 1LGYA 3OQVA 3OPVA 4XAQA 4M9UA 3U3XA 5COBA 3ADDA 1VHLA 2ORVA 2X15A 1I3OA 2IGBA 1W5FA 3D8RA 4D9GA 3DUWA 3NBUA 8MHTA 1OH5A 4GICA 2HJ9A 3LDFA 3EF0A 1M33A 2GD0A 2WFLA 4B3SB 2OILA 1F2TB 4DKXA 1J8YF 2X4IA 4ZO9A 2BDTA 3WHKA 4RIFA 3W8IA 2WICA 4X7RA 3MUEA 1M6WA 3F6PA 3VOAA 3KO8A 3T1QA 2BJHA 1FLVA 3I9JA 2RHTA 1AGXA 2Q3HA 4E15A 3ZDRA 1N2CE 4UOQA 1H05A 3DLAA 4HBGA 1PQWA 4GI7A 1EG7A 1JKIA 1PT8A 2XA2A 5JAZA 5K2OA 1T6YA 4ZVKA 2G7MC 1IWOA 1NVBA 3GL9A 3P9NA 3JZ0A 1J8VA 4H1WA 2VHJA 2H17A 3C1OA 5D86A 3W79A 1Y1QA 1FSPA 3VZSA 3QGMA 2E4VA 2HJMA 2WSIA 1R6TA 5EWLA 1JA1A 3H5AA 1AZSC 1IY2A 1NF8A 2NYRA 2WZGA 2C5GA 1V96A 4R84A 3BXPA 4TRNA 3GJ3A 1DOAA 1KA9H 4UBLA 4ENWA 2CBZA 1KOGA 3PQCA 1PL7A 1N25A 2XZLA 2IP1A 3UHOA 3CISA 4U5EE 2SKEA 2WJHA 2WWWA 1IM8A 2JIMA 4ZVMA 3CKMA 1Z9BA 2YV1A 1QRAA 4AJOA 1YRWA 1YRYE 3OOYA 3SU8A 4EO9A 3FHOA 1PJCA 2HDHA 2JLBA 2QMYA 2XMCA 3RVSA 1IEQA 2VFAA 2NXEA 3PCRB 5D6OA 3RJ5A 2CLDX 2G3KA 2R7NA 2H1IA 2NXWA 4S12A 1DIGA 3BE6A 1GNPA 4MVWA 1YZTA 2FOIA 4DXDA 3L34A 1LPBB 1AVTA 2Y9PB 1VB3A 2IZOA 5DS6A 3URMA 4BX3A 4CEJB 1SEVA 3O10A 2XI4A 2OCAA 3VHLB 1HEIA 3SHOA 4B3FX 3V1MA 5E7MA 2ROQA 2RK4A 4GI2A 1WCYA 2Q8PA 4MWTA 2HF9A 3ZD8A 3JRNA 4CQMA 4YAGA 1VYHA 1UPBA 4RJKA 4BMXA 5IVHA 1PD1A 3OM1A 2YWAA 5IT0A 4B76A 3AUAA 1E7QA 2YHBA 1IOWA 1JSZA 3WKCA 3U61B 3C18A 4YUWA 1W29A 2PH3A 3RUDA 2QAGA 1K4KA 1T1EA 4AE4A 1FNSA 3DMPA 2QRVA 4AB1A 3Q3IA 4HUJA 4Y6QA 3MWDB 4ZAGA 2YV4A 4MA4A 2ZIXB 2PP4A 3N8KA 4B0PA 2BSQA 1L5HA 2QJOA 4OYLA 1CHNA 3VRCA 3X0DA 1ZGAA 2QX6A 2IBMA 1O4VA 3HADA 1DFIA 2UZ1B 3M6IA 1QCYA 1MO2A 1GXSA 2O2EA 3FDQA 1W34A 1ID1A 1L2TA 3NO4A 5DFAA 2YS7A 1Z33A 1YDGA 3BCSA 3QV1A 4H7KA 7REQA 4RKYA 3JZFA 2F1IA 2IXPA 1GN8A 1T4CB 4YAJA 1T8RA 4CFSA 1PN3A 1Q14A 4RWEA 1MDBA 4AJNA 5TV2A 1AVOB 4M0DA 5EQDA 2C0CA 4JLSA 3URKA 4NCQA 1FUEA 3S90A 1P2BA 4KQWA 3HA5A 5BVHA 1GQRA 2H8AA 4CMCA 2Z9BA 4DQUA 3DXFA 5ICFA 3W34A 4RAOA 4EF4A 2L69A 1CR2A 1BWRA 2GK3A 2QF7A 3W8EA 1NJ2A 2C59A 1ZD8A 3H86A 5HF9A 1X8JA 2CJWB 4BGEA 3MJ4A 1ENYA 1QHGA 1WXIA 4YMGA 1ZQ1A 4KH1A 1A8SA 5DO9A 1MRSA 2RARA 1TUGA 2G72A 5EIAA 4MI3A 3EPRA 2BMFA 1LXCA 2IEYA 4XGNA 5EYPB 1X38A 3JARA 1T43A 1PTJC 2GBLC 1Z8HA 2B1RA 3KPYA 4BTVA 3H3JA 3D7KA 4ZVQA 3EIUA 4PC7A 4K05A 3USZA 4QEDA 4MVJF 3ML1A 4ZHQB 4D8YA 4RGVA 1ZVMA 2JGDA 5I3ZA 4JGBA 1UWVA 1RZVA 2CJXA 1KZHA 4W7HA 1XALA 3ROEA 3RSSA 1W4LA 1M2OA 3LBNA 4FFBA 2Q28A 4CIYA 1C7RA 3CNHA 3KYIB 1N4DA 1JRLA 5CFLA 4MUMA 4NJOA 2ISCA 1TK2A 3RFXA 1JNXX 3RS4A 2AG8A 1Z68A 2P61A 1Z8NA 1L5GB 2XMGA 2AZMA 5AK4A 3W5HA 2J33A 2ANCA 1J8DA 3PHHA 1R3UA 2IY9A 3WV5A 3MQ4A 2QSYA 5HHTA 3LWBA 1D1BA 4JXJA 4KX5A 1WTAA 1MQSA 4Q7EA 3FYUB 2EPNA 3GGCA 3OLWA 1B6RA 3G89A 3UJCA 4MKFA 6GPBA 1N33B 1GNSA 1F6WA 5KS2A 3P9RA 2XVZA 3PB3A 1Q6YA 1IN8A 1AXGA 5HJ7A 1ILWA 1C30B 3D9QX 4G5GA 4RY8A 1PV3A 1LDMA 1NHGA 1FB5A 4DDVA 2QN2A 3GM1A 1V1RA 3A32A 4Y1EA 3E7PA 2G76A 3CE6A 3T7CA 5CA1A 4JLKA 3MG9A 2VYND 4OI2A 3WK8A 4X8MA 3KJXA 1TF7A 3CTMA 2E21A 1GKYA 1EESA 3BX1A 4F6RB 4HDNB 1VI5A 1N7JA 5DDIP 3NVKI 3TE7A 1LBTA 1XE3A 5DHPA 1EK0A 1Z37A 2F6RA 4L8GA 4ZDJA 1ONBA 4BVHA 3PK0A 5EJ6A 4MRMB 3EZNA 3RNOA 4ZICA 1QX4A 4JI0B 1KXZA 4AYXA 3ROZA 1ARZA 1VDZA 3O31A 5AK6A 1G7TA 4ACAA 2AF3C 4Q00A 2EWWA 2P9EA 3IJRA 1NOKA 4JITA 1V5FA 1Q3KA 4U6QA 1N8NA 1LBEA 1VJ1A 1ZICA 4UARA 1FFYA 2YZGA 2GM5A 1N75A 3K66A 1D1CA 1FOEB 3GGGA 3HM9A 4B7CA 3CB4A 4RVUA 3INGA 1E7MA 2RFLA 3WK7A 1PJAA 2P9YA 3TUJC 3DDZX 3OIUA 4FNAA 4KPUB 3UN1A 3HZOA 5DULA 2FK8A 1CJCA 4YCJA 1VJ0A 2FRDC 3P0IA 1QE0A 4FXOA 5LZ9A 1QM5A 4FFWA 3E4CA 1FLDA 1ADYA 3E23A 4DLNA 4LZAA 1JJFA 7ABPA 4CEHA 1TFKB 3RU7A 1BDBA 1E3WB 5AGFA 3MCWA 4BCBA 2NVOA 3QVVA 5ENDA 4LZNA 1VE3A 3J7TA 4L28A 1CS0B 2CMKA 3P71T 3EH1A 1A2QA 5CURA 5AXDA 1ABBA 1MUUA 4ND7A 4IFEA 2Q41A 5EUQB 3DHVA 3C7CB 5JSQA 3N05A 3SJZA 2GILA 1IWPB 1UQRA 1QG2A 2CF6A 1EFDN 4ZT2A 1XD2B 3DM9B 3AETB 1I7NA 1XCOA 1UKZA 2XAUA 1OAOA 4IAQA 3R4CA 1YJBA 1WWPA 1UXIA 3BMOA 3KXDA 4LWZA 4PXAA 4OEHA 4NENB 5A0FA 3A4LA 1AV6A 1TEHA 2FZWA 2EZ8A 3TQCA 1ND6A 5CG2A 1H2XA 4B5KA 5HE9A 4B79A 4RUKA 1YA4A 1MT3A 3BH0A 4QICA 2M98A 5EE5B 2RGNA 4R16A 1YLMA 2G5PA 5BMVA 3T4RA 1LW7A 2IGTA 2FN8A 2WD7B 3UAXA 3NDBB 4BFYA 3FN4A 1MMFB 3MINB 3DTVA 1M2JA 4UAVA 4IPTA 2PJRA 3GLSA 3CCCA 3ELYA 3SSMA 4ZO8A 3F5FA 3KNZA 1ZC4A 3NFYA 1VRWA 4NNJA 2QVBA 5K3BA 2AOXA 3BL5A 4PCAA 3BIFA 5ENZA 4N6HA 3THSA 4DZRA 3WLFA 1YJQA 5GGYA 3FGZA 5EC8A 1XIVA 1USKA 1YFJA 2QE7D 3QFCA 3BTUA 1ULBA 2EJWA 4L75A 3H2SA 3HCFA 4JUBA 1I32A 1P73A 3JVIA 3HP7A 1A9RA 3ODGA 2VXOA 5KNCH 4LVOA 2YLIA 3AHHA 1MOZA 1TYBE 2FPKA 3E9MA 1UFRA 4JVOA 4Q3LA 1E0AA 1KI6A 1T3ZA 1RAAA 2YWEA 1GZ3A 1AQIA 4FZJA 1EDOA 4KQ9A 2GEBA 5HDQA 4JASB 3EDCA 3DKPA 5EP4A 2GQ0A 1HDCA 4C0BA 1D2HA 3FFAA 5GZ6A 3AW9A 1APCA 5J9FA 3WJAA 3COPA 4H7IA 4ALLA 2Q5CA 3AG3C 2VDVE 1ISJA 2EL9A 5I01A 1TYCA 4WFQA 2OGUA 4GT1A 5FUMA 4AKIA 4BLWA 4RVCA 2BGWA 1A1SA 4Q05A 1FU7A 1DRJA 4FYHA 5CHEA 1Z07A 4GKKB 2CMFA 3TJ5A 2JK1A 3ZDCA 1ZNWA 1COWA 1KY3A 3DVAA 1RNLA 4N06A 3MGBA 2VT2A 5JFTA 4IGEA 4YH1A 3PVCA 4EAAA 1HMDA 2OL4A 3LS0A 1XEWY 4XWJA 4DANA 1RABA 5BRAA 1KDPA 3O0TA 4TTRA 2QZSA 2H0QA 1BKDR 3IB6A 4LWQA 2XMSA 4OFWA 2OZLA 4NFLA 2CD9A 1IG3A 1Y8RA 2RGGA 3OUTA 3QPWA 3D7SA 1VLTA 3DAOA 5E8JA 1PG0A 1GPBA 2CD7A 1RKUA 5KNBD 1T4GA 1URPA 2HWYA 4FW8A 3RS0A 1NJ1A 1ZU5A 3WG7C 5JD6A 2WKSA 2YQYA 2A8YA 2ZE5A 3K6RA 1GKIA 4I1IA 3TOLA 3IALA 4C0KA 4HTFB 1H23A 2Z5LA 1T26A 3CUEF 4FK8A 4XVRA 1Z5NA 4YWQA 4JI1B 3EGXB 1GV1A 2CNWA 3LOPA 1R5BA 1D4AA 4UPEA 4DV5B 4JKIA 3CX8A 4M55A 1QCZA 2IEIA 5ICMA 4V0RA 1KI1A 3M6WA 3ENKA 4FEAA 4YAWA 4XX0A 3BBLA 4PR0A 3I8SA 4FKMA 2JIDA 3C41J 2J5RA 1BWPA 2G77B 3A14A 1Z4QA 2WIJA 4RPGA 1P61B 2Q5OA 3ICVA 3R74A 1HMYA 1KPHA 3QMPA 4HAVA 2NACA 5A71A 3NALA 4TKVB 1YTLA 2VP0A 4TYWA 1QCDA 2AEEA 5GVRA 2FLKA 3VUFA 4DV6B 4AZSA 2DFKB 1RKVA 2O2SA 4MDEA 1PYGA 1Q1QA 2ACWA 5K0JA 4E94A 1P33A 1P9RA 4K6GA 1QGDA 5DN6D 2VC9A 1A4IA 2W6NA 4KIJA 3NQ41 1MKYA 4MP8A 2AN4A 1ISIA 4HFJA 3STYA 4XYEA 1Q1NA 4KDFA 4H7HA 3O8CA 1E98A 4DWWA 4GYTA 2JLAA 2FPIA 2W6IA 1EWQA 3E3MA 1O6CA 2H2DA 4QUGA 2AVKA 3UKDA 2QG9A 1XAGA 3CJQA 1DDIA 1DQNA 5JO0A 2PLFA 3H16A 3INNA 2JBAB 3LL4A 5BV2P 4OXQA 3GCDA 3ZBQA 2AJ8A 2LDXA 4RU1A 2R6CA 2XXJA 4DLVA 1HFWA 3B13B 4MS2A 3FKSA 2WWHA 3AIIA 3ENQA 3PXGA 3DA8A 1SMYF 4EATA 1QIFA 1YARO 4IYRA 3QEMB 1LU9A 3U5TA 1G16A 1PZEA 2BI8A 3RRXA 5C8DA 2Q46A 4K8OA 4NF2A 2HHCA 3DFUA 4UE6A 5H02A 3OWTA 4EG5A 3L7DA 3KDSE 3QPUA 3D8TA 3BDVA 5J4HA 3UGPA 5D5PA 1O9BA 2HJSA 1NPDA 3VNQA 3SJBA 4WZ6A 1MFPA 4WXHA 4LJ7A 2IZ0A 3MD9A 2B0JA 3D54D 4OA8A 5CD9A 3TIFA 1E69A 1L4MA 2VHWA 4J6FA 2Q7DA 4FCCA 2OAGA 2VHCA 4S1WA 5K4HA 1T8YA 2AG6A 3BQNB 3WHNA 2HN9A 3F3KA 1YIDA 3PI7A 3L8YA 3WYAA 5K09A 2D2XA 1NX9A 1V8FA 2HXSA 2ICAA 4BO6A 4O8CA 4BO5A 4W8KA 1UEXC 3NAMA 5CFNA 1EGAA 1KYIA 1AHIA 1KIFA 3KM0A 1I8TA 2CXQA 4TQGA 1C9YA 4NOMA 3E5MA 4EG0A 1XA4A 4OGWA 2OM2A 3TTYA 3OKFA 5K20A 4LZOA 3FPAA 2CFSA 4IQ8A 1TZBA 2CKDA 1U31A 3PGVA 1WPQA 3K0BA 4Q9LA 1Q1BA 3VISA 4PVDA 3HKBA 1UBHS 1T1JA 3QBEA 2H5EA 4NBRA 1T2FA 4EW6A 3NBAA 3R76A 2O2DA 1ZW3A 6NULA 4P2BA 1NTRA 2A4KA 4JC8A 3PEEA 4JLVA 2AVNA 5L7WA 1Z4MA 3N58A 2YW9A 5EHNA 1XTBA 4KJXA 5M7EA 4GQHA 4OUDB 4JT8A 2B78A 2Z2ZA 4D9BA 3IO3A 1S8FA 3K33A 1DKPA 5BV7A 2BJWA 3KXLA 1SCNE 4KLNA 5FXMA 5FTKA 1LB1B 2ORIA 4LSMA 3DD5A 5AVKA 1R6VA 4UM7A 2VZ9A 2O3UA 4JVSA 1NT2A 1PBTA 4DR7B 3JAKB 2PX0A 4M4SA 1NYTA 1VKNA 2J9BA 4IH4A 1PGQA 5E2QA 3M3HA 3FRHA 1NBEA 4DVYP 1KVSA 1MB9A 5K8LA 1V4VA 2JCGA 4Y1RB 3C8GB 4ERNA 1GZHB 2AI1A 1NKVA 2VP3A 4MR8A 1BVHA 1Z0ZA 2K6GA 1XNRB 1YRBA 5DM1A 2YWRA 3V4OA 4ZCRA 5BUOA 1RP1A 3V2HA 3G85A 4DAEA 4ZO6A 4FOPA 4PFKA 1JVSA 2R00A 2SKCA 3E5RA 1GCUA 1JV2B 4KFSA 4RZUA 3ZJ5A 3GRVA 4EFNA 1H9TA 1H8EA 4EHHA 5EY5B 1IDN1 4GVXA 1H93A 5SICE 4GM0A 1DAFA 1RI4A 4ZGGA 2G1PA 1CBUA 1YDWA 4REQA 1DHTA 1M2FA 3OX3A 3SXMA 5HQJA 3TTSA 1W6UA 5FEMA 4ZJUA 5DCWA 5TF4A 3LMKA 4CJOA 3UG7A 3E27A 4RZQA 2R1TA 4LE1A 2CYCA 3HA3A 4MPTA 1HNWB 1KJWA 3RFYA 4MVXA 4JMLA 1G8HA 3T06B 4CM8B 1FFXA 4QDKA 4E1VA 1HDIA 3RQEA 4MVJI 1KO4A 3U5SA 1UBUS 4P34A 3LHFA 4XJVA 3HBAA 2AWNA 4TYYA 5LWQA 1I3CA 3I0MA 4PO3X 3GQVA 1I4YA 5KTKA 5JP7A 4Z54A 2D1QA 1DOHA 3DYBA 4ZYLA 3Q7LA 1JDZA 2XGJA 3O4RA 3I2IA 4G5YA 1E0JA 3K0CA 3JZIA 3ONVA 1J99A 1JQ5A 5A6BD 1E6MA 3HNKA 5SY9A 4U2FA 1D6NA 4II3A 1HOXA 3THYB 2RBEA 5DGTA 2Z8YA 4PJMA 1TA0A 4UKDA 1RLTA 4DQXA 1FR0A 3M6LA 3T7KA 2ZBDA 4TYNA 3DDHA 1JIVA 4IDQA 1D1TA 4DNOA 1TYDE 2NYVA 2RB4A 5LQCA 1U6KA 3AVQA 3AFNA 4MW9A 5EUBA 4B31A 4WKCA 1BS1A 4A0HA 2WFZA 1FQKA 5E33A 4LE0A 4UUAA 2F48A 3MZ0A 4RJ2A 3ZI0A 4ZQHA 5COAA 4QTZA 4RVFA 3K1AA 4IHAA 4FKBA 3AVTA 1U80A 1WZIA 1HDRA 2HBQA 1JHZA 4WY2A 4KQJA 4JU8A 3U4HA 1Z56C 2GARA 1G7RA 2GERA 4KVGA 3CX7A 4DIMA 1KIAA 2JRCA 3UPTA 4OFZA 1G21E 4DNQA 1U94A 1T6IA 1QO0D 5DSXA 3CRW1 3HU1A 3A9VA 2HMTA 4UXJA 1DC3A 1PFWA 4CLRA 3QKRB 2HRDA 4RQAA 1Q0DA 3RS3A 4JQSA 4ZQFA 2JVKA 3C4VA 1V8DA 1FDIA 1Z8FA 4L72A 3L02A 1U1FA 3U60B 1WCWA 5BUQA 4TMWA 4GO1A 1WMAA 2OC9A 4HQRA 2BEJA 3BMXA 3WI7A 2BW0A 2ZRGA 3PVSA 3PNOA 2YCBA 3MTEA 2D5LA 2F1OA 1SMKA 1CNMA 1D1PA 4IEIA 3GIWA 1IXZA 5JAHA 4Q4LA 1MPXA 1WXEA 1XRPA 1IBSA 5HF8A 3NTRA 1DKRA 4CRWB 3QTHA 3IE2A 3L8EA 3KTDA 1EAYA 2O6LA 5HUHA 4HDKA 2GCOA 4W9RA 4F0JA 3OIDA 4CM1A 5HRCA 5CBPB 1FY2A 3GDFA 3PG5A 2QGZA 3PC4A 3ZOZA 1NBWB 10MHA 1SXJC 1P2FA 1PNQA 1GTSA 4TL7A 2G82A 3IPAA 2QJTA 2DPXA 4IS3A 2D2VA 3N8IA 5ALEA 2GHQA 3D7NA 1DRWA 2QAIA 3JQDA 4TTTS 3HCPA 1N9GB 4DY4A 5AVTA 2AI2A 2YL7A 2O5CA 7ADHA 3GQBA 5EMKA 4QYIA 3W4YA 4F9EA 3PQDA 2K2WA 3OX2A 4W8OA 1JNYA 4LTDA 4KRXA 5F5NA 3SJ7A 3FBTA 4ZCPA 3RVNA 2EKDA 3ZWQA 1NVVQ 3N0RA 1OFIA 2XOXA 3KB6A 3KHSA 4GIBA 4WLVA 2FUG1 2GYVA 5B2FA 4RQUA 2WMYA 4EZBA 4DUYB 4Z7OB 4NQFA 1MD9A 2B8NA 4YRAA 5CA0A 2B92A 5KWEA 1PZGA 1XK7A 2R7MA 1AH2A 3U9TA 3IDZA 5E4JA 4EZEA 7YASA 4Y7DA 4FMDF 4LFAB 4RWZA 1B93A 3KQVA 5ALDA 4RJTA 1KQFA 2NUAA 3FAJA 3LNRA 4CG0A 1FNDA 1R4ZA 2QYTA 4XOUA 3AJMA 1YJ8A 2CB9A 3EOZA 4YRRA 1NI3A 4O4HA 4EZIA 1B1AA 4JJEA 4Z86A 3LO8A 2WHEA 3T41A 3GFSA 1JQEA 5FV4A 1C0IA 2XWJI 2DTDA 3CSKA 2VF2A 2F3TA 2YUIA 4MW1A 3X2SA 3DBRB 4IMJB 1QKIA 4QYSA 5EXPA 4PF1A 4MPJA 4NNPA 3D59A 5CG1A 4RA6A 3T3OA 1V95A 2QR2A 3PT9A 4PC1A 4X64B 3W2EA 3ZHOA 3GEEA 2ZRAA 3TR5A 4YCCA 2OZKA 4I4NA 1KAQA 1A77A 2QN9A 3KWJA 5EGYA 4FBGA 4G1FA 2NU9B 2WVAA 3GEPA 3U4QB 3TXAA 1XZAA 1Y42X 1BMQA 4FCVA 1T6ZA 3MRSA 4OOEA 1E7WA 4O6VA 4H7FA 4YTEA 5CVVA 2OFOA 1RTKA 5H68A 3ZX4A 2C0PA 1D7OA 5CW1A 1ZR4A 3VH3A 5HCUA 1DG9A 1B8NA 4OVKA 2GYYA 2BMAA 3DUFB 2WWIA 2IYNA 4P33A 4BFLA 5EGNA 1WNFA 1HY3A 4HWOA 2P9HA 4GXQA 3B70A 5TNXA 5FTLA 2AYXA 1YZYA 3SF8A 4XIJA 2R1ZA 3VOBA 2JLUA 5DPMA 4OOFA 4R1TA 3EODA 3N2KA 3FOFC 1QHSA 5A5DA 4M0KA 3IQIX 5AK5A 3UMVA 5KWJA 1R10A 2D1TA 1UQUA 1Z6GA 3WL3A 3OEHA 4FFRA 3UXHA 3T15A 4U7WA 5H9VA 1GQSA 1NF3A 4UD2A 1QZUA 3JQCA 3PPVA 3U4GA 1NLUA 2B2CA 4EY8A 1DEKA 2OYSA 3FDXA 1R0LA 1Y4ZA 1DO8A 1AA9A 1D03A 1Y7LA 5LN1A 4OL9A 1VFPA 1VMIA 1HQDA 5KYUA 3CNOA 3OM0A 2HH9A 1NSTA 4AF7A 1KKUA 1PGPA 1V2HE 4D4KA 2D6FA 1OIWA 1F1MA 4N8DA 5BSUA 1PWXA 1JMVA 3EPVA 4ULVA 1HORA 1SR2A 3S68A 3RRFA 4IQ0A 5ECWA 1PT5A 3K0SA 4AJEA 3KX2A 3THXB 4C4OA 1II0A 3ZK7A 5EE9A 1S8OA 2SKDA 2NT4A 4D4MA 1U4OA 2VAXA 3GAAA 4F8YA 4FYYA 4BAUA 1XFDA 2ZB3A 4NCNA 1FYWA 1FP4A 2F8TA 1T9BA 3WNBA 4U8GA 4FIZA 2Q0QA 4CQJA 3VR5D 3GEBA 4QLBA 5K6AC 1OAAA 4IAOA 4QNNA 3K94A 4PLZA 3LAYA 2FETA 3PUXA 4FGUA 5PGMA 3R6WA 3MWJA 2M6RA 3DE5X 4XWTA 1BE8A 1B6SA 1IQPA 3NUQA 2ILVA 2R6DA 2JLYA 1YI1A 1CNFA 4RKQA 2C7RA 2NXNA 4MVJH 3RYIA 3DJUB 4HAIA 3BWMA 4DMMA 2XXAA 1UIMA 3LUCA 1QOZA 3U8VA 1RHQA 1Q0MA 1B00A 1GCOA 1ZR2A 1JAXA 2ENWA 3H2IA 1EU1A 5DXFA 4J0EA 1G2IA 1ZHTA 3BJEA 1NW9B 3ZCVA 2NYAA 3ZHUA 5EP1A 3U9LA 5F2OA 1YHYA 5CVCA 1MAHA 3RGWS 1NI4B 4V24A 3Q87B 2Z1MA 4LKRA 3CGGA 2VUHB 2W90A 2JDIA 4FSXA 1KY4A 3GUUA 2XSEA 5DXAA 3EFEA 5JZVA 2ZCUA 3L7JA 1KSHA 4ZDWA 4ZVPA 4AWBA 5CUQA 2OOSA 4G23A 1E1NA 3B1YA 4HWKA 3RSZA 3IXMA 3U2LA 4NZNA 1U7WA 1FNTc 5KMGB 2LGJA 1U5CA 3KOUA 4HV4A 1CEXA 2D8MA 5CDFA 5BN4B 3VO8A 3VPGA 1QHFA 3C2QA 1SKMA 3M6MD 1NFOA 2QUZA 1QNFA 2ASRA 1THTA 3IQEA 1JH8A 4CM9A 4BKMA 1XXLA 3L40A 4L6RA 3HJUA 2H7YA 1C3OB 1WMEA 1EE9A 2AOTA 4IILA 5KJCA 1VP3A 4PX2A 1M8PA 3N2EA 3QVYA 1JAYA 4RHTA 3JV7A 4YL1A 3FD8A 3P52A 1YF3A 2OBYA 2XNCA 1P9NA 4EPWA 1SZJG 3HVIA 5LKRA 3OZFA 2VDWB 1CPRA 2H07A 3NGMA 1N1EA 3RRNA 4UUNA 1Z36A 1VL0A 1JJ7A 3F4BA 2FXVA 2QUKA 1XU4A 5EEGA 4GS5A 3NONA 2WR8A 2XS1A 5E2AA 1C03A 1FDUA 1G42A 5FOSA 1U3TA 4KDRA 4Q93A 1MOQA 3EDMA 3L4SO 3IQCA 5D3MA 3V55A 2UZ4A 4RPLA 2C2XA 2F64A 4QU8A 3SSAA 1RYNA 4IFIA 4P92A 2QNBA 5FR1A 2PAFA 4ZZ0A 4E21A 1ZWKA 4CS7A 4R8KA 2C3MA 2H2AA 2Q8NA 4AP9A 3USCS 3IIIA 4G67A 4E4RA 3T5AA 1CDEA 3ZKWA 5C9ZA 1Z0SA 4F85A 1RQLA 4TPKA 3UAGA 3HACA 5ALMA 3KLMX 5J43A 2ZRHA 2G4VA 2GGSA 2I2FA 2ZSKA 3TGWA 3NWJA 4G5RA 3RM3A 2QR3A 4EEXA 4X84A 3OZWA 3C6QA 1VL2A 3ZDDA 5FNVF 2VN8A 5KYYB 2IZ7A 1HRDA 4ITRC 3DE1X 1EKYA 4C3UA 2FPGB 3ZV6A 4RGBA 3FAKA 1G4AE 1WSBA 3H8WA 1I0ZA 2PE5A 1R5NA 3SYMA 1S4QA 4QU5A 3FDZB 2IPNA 1P1IA 2XLOA 2FW0A 4Z1OA 4F3YA 4O2LA 3TS1A 5A6VA 4U9EA 1QIIA 4M7WA 2DEUA 2ETXA 4LK3A 3GVXA 1H42A 1O94C 4KXUA 1IHUA 4BO7A 2MINA 3K8ZA 1YAJA 1GN9A 4WNCA 1GTZA 5T4HA 4IZHA 3RVZA 3G2JA 1WRBA 4DB4A 4RTRA 2J0SA 4YWHA 1WQ3A 1T0UA 2WKRA 4JVMA 4X1YB 4JBXA 2XJ4A 2PKEA 2XMPA 3LPDA 2YNMD 3FOZA 2ZW9A 1EI9A 5C80A 1Z0JA 2ZT5A 1HZZC 2ZIWB 2Y05A 1L5ZA 3UKJA 4UEQA 4J3FA 2XMDA 4DR2B 2C7GA 2QSUA 2OAP1 2BTQB 3AUYA 2RD2A 1NMQA 4JB0A 3V4ZA 3WAGA 3IQXA 3JQ9A 1ZGBA 3LC2O 3U6KA 4U2BA 4GMDA 4QXMA 2GEVA 2ZSEA 1Z2AA 1YRHA 4ZU6X 4P84A 3H75A 1PX0A 3P2IA 4PG5A 3WE7A 2MT9A 2IM8A 4BY9E 1OMOA 3FPLA 4CMJA 1W1IA 2FK7A 1DCMA 5MN4A 4WGGA 1UOQA 2PZEA 1ZMRA 2TYSB 1AZTA 3W5JA 3RBAA 4LOJA 2ZT7A 4LYGA 2IZZA 2HMZA 1L7QA 1G64A 2QVGA 4NU0A 2X7JA 3S55A 5JISA 5K0BA 2EBWA 1QH0A 2R8RA 3GJ6A 1TVKB 3OFKA 5ALKA 2Q1YA 3UO8B 2KB0A 4TTQA 4YJ2B 4N0PA 3BWXA 1Y1SA 4FWBA 5HKBA 3HXOA 1U0TA 2ONZA 3HEBA 1O9HA 2ZJ7A 1T35A 5HKAA 3AR5A 2X5KO 4L4XA 4KREA 4PWZA 1ZM4A 1J56A 4YQFA 4EY5A 3L84A 5JBQA 1W96A 2EHDA 3E2PA 3GEIA 1UPUA 5AW1A 3HZHA 5JHGB 3ILYA 1LBHA 3OMWA 4LECA 3WL4A 1E3IA 1GKKA 2H1CA 2UZ3A 3UICA 5A3QA 5SY6A 3UV6A 5A9RA 1K7YA 3IPLA 3R5TA 4BJHB 2OBMA 2XVYA 4UBIA 2YMLA 1QFJA 1UM8A 5K3FA 3VZPA 1G19A 3EZXA 4M86A 4EBJA 4JJIA 2B8EA 2E37A 3UGJA 1PT6A 2PLAA 5K8TA 5ICGA 1HY5A 5KWVA 1R8JA 4CKCA 5BMOA 5BWOA 3DLCA 3LT4A 5LUBA 4CQLA 2R7UA 4IWYA 1DOVA 2B4QA 3VC1A 5CNIA 3BC1A 4AG6A 4ZPXA 2OB1A 4WKGA 1SKYB 3JAMA 1D9XA 1F9EA 2PLNA 1F60A 4NPAA 3OEED 2V55B 1HFEL 4JJFA 5AJVB 3GM3A 3AG1C 2JHGA 1T9DA 1XCGB 4CHTA 3ZJTA 4F04A 1LIHA 4LDNA 1ECLA 2QLTA 2ECKA 5BV8A 2JAUA 4WBSA 4NDZA 3GWGA 4LF8B 4J2OA 5CVEA 3ZW9A 3F71A 2XADA 3LK7A 1MBZA 1JT2A 1Q7GA 3ADBA 4PLVA 2XT6A 1CUZA 3K70B 2V74B 4LC9A 1PS8A 3GGOA 5HJEA 4U9IS 4J7XA 3O95A 1FJGB 4OQ4A 3K9BA 4WJ0A 4YXWD 1NG1A 3OF2A 5C34B 3UOAB 1D2MA 4OI4A 3SI7A 2A1TR 1ZL0A 3CZCA 3KETA 1RYMA 5JS5A 1CCWA 2OD2A 5ALNA 4CMAA 4KOAA 3G49A 3DWIA 2H2HA 2H0RA 2AFHE 3KYJB 5A7HA 2JFOA 1PQ4A 1BXGA 4TLEA 4FD2A 2JFNA 1MO4A 2NSHA 3K6SB 4Q0MA 2GO1A 1ST6A 3KSDO 2A59A 2QXUA 4PINA 2UZAA 3K0AA 3OPXA 3CTPA 4Z3KA 1ZD3A 4BZWA 1JKXA 4RORA 5HR5A 1JU3A 3ZVMA 4JP5A 3RFUA 1E9RA 3WLLA 4E09A 3RAGA 1XJQA 1YGPA 2WTXA 4UDOA 3D4BA 3L0OA 2C2ZA 2EKBA 1G9XA 4QVGA 1UWCA 2C4HA 4TT3A 3F6CA 2IWRA 2BFWA 1UODA 1GR0A 3P9YA 3KB8A 1GNTA 3GLKA 1FZTA 4DBVO 4A8PA 3G5AA 4KKVA 1ULTA 4MUBA 1OFGA 3NHYA 1OFUX 3IX7A 4BPRA 4UVHA 3DZCA 2ORWA 5AYVA 1KYXA 1YB7A 5TEVA 5TSDA 2FUKA 4BO3A 3WSTA 2XF2A 4YLEA 2BZGA 4PY2A 2Y0BA 3S7TA 1XK6A 3TNJA 2F9FA 1GU0A 2XOKD 5IVIA 1K4MA 4EYQA 4RK7A 2HLPA 1PFGA 3PQ2A 4CKYA 3PWZA 5DS5A 5LPNA 1DBRA 2OHFA 3WJ1A 4KRGA 1HE9A 3NM5A 4B4OA 1IZMA 1JHDA 1QTQA 4NDNE 1TWCA 1H4SA 1D2CA 2ZGVA 4CM3A 4K0DA 3PIRA 3C8ZA 1JIUA 4QECA 4HXFB 1ZUD1 2PR2A 1GTJ1 1WZCA 1L7EA 3ADCA 2P3SA 3I9NA 2I4MA 4PHGA 4LYDA 3PMRA 4K2HA 2A1DD 4TSFA 5HK8A 4LY0A 3E18A 1GFZA 5BQXA 5EUCA 4PZYA 1MO3A 1TM3E 2ZXOA 2VWQA 4TUYF 3K9FC 3OECA 3ZZTA 3ZZNA 1J7JA 3SQLA 3CX3A 3R2PA 5FWYA 3FNGA 4BMDA 3WX0A 1B7GO 1U1IA 2YLDA 1ZIOA 1C8KA 2GN4A 4KQ2A 3W8NA 4A6XA 4CKEB 2XMZA 3MTBA 1SULA 4FYKA 4RCYA 4CDAA 2VBCA 4Z9HA 4Q7LA 1U6HA 1ZAYA 3OE4A 2O1EA 4K28A 1SUSA 5G0UA 3CH5A 2BMVA 2H29A 4NYMR 1VJTA 3BMNB 5ESWA 2ERCA 4KBYA 4LHVA 2RIRA 1I6MA 3PPIA 3CVXA 1E2IA 4YFYA 3E3LA 5SZJA 1NWCA 4H7DA 2PVPA 5BVGA 4MROA 1S7CA 3N2GB 1M1YA 1ACLA 1UM9A 1SOUA 2HT6A 3TBHA 2XL8A 4C06A 2RH8A 4D45A 4UMVA 1D0XA 2VTDA 2XUPA 4Q3CA 5SV2A 2QZPA 4WDRA 1U7TA 2JGKA 2BELA 1IM2A 1P0FA 2PIDA 3R3HA 1IDOA 1K63A 3DKRA 1B8UA 1E1KA 1WUHS 1C7QA 4UHHA 5EZQA 1RJDA 5G1NA 4DHEA 1H2WA 8OHMA 4PU0A 1R00A 2O9JA 4YO8A 1OH7A 4ISCA 3TJMA 3DKVA 1X7DA 3EA0A 3G2MA 4KBFA 4OQXA 4YJ3A 4YAFA 4IDAA 4MKXA 3ONEA 3D8SA 2A3NA 1E3TA 1X1AA 1K1EA 2W2KB 2YIVX 4F4DA 3K9CA 3E3AA 3UJ7A 4BNJA 1MAUA 2H85A 5KQMA 4LTMA 2LVBA 2P41A 3T7EA 5FRDA 3AVUA 1G7SA 3QZCA 2R97A 1GPH1 3RSHA 3DC7A 2UUOA 4XI9A 2VPPA 3CLKA 4P7BA 2ZI6A 3TKAA 1N2XA 2JAWA 1VPWA 4LMPA 4JBIA 2VO1A 1FS5A 3MLBA 5KYNA 2OVBA 1LS6A 3BMCA 2P40A 4WH0A 5A5VA 4QGBA 4EHPA 3BBPA 1EBBA 4M0UA 4FXPA 3V80A 2LV8A 2VCEA 3ZV5A 4ZK2A 4EOGA 1EVJA 1U1EA 2Q2OA 2OD9A 2AC7A 4QDUA 1SUBA 3GZTB 1KEEA 3EW9A 2QRPA 4IIXA 4MQBA 3PZRA 5AVSA 4B9AA 3HRIA 1RZUA 3SYLA 4UHCA 3OAAD 3R3YA 2DCMA 1HTTA 1CE8B 2YNMC 2Y27A 3HJAA 5LA6A 5KYXB 1E4VA 1AK9A 1OSNA 3F6SA 1TUBB 1E0DA 2A0FA 5FUXA 4GOXA 3TD9A 1TIPA 1VPLA 2UAGA 1T8PA 2JCBA 3DMGA 3TSOA 5F7JA 5BNWA 4DV2B 3IT0A 1DWQA 2X2OA 1B76A 4R9VA 1Z6XA 1KJJA 3UXYA 4QDLA 2OJQA 2JIZD 2OXRA 2ADMA 2QE6A 3UW3A 2VBIA 5HTOA 2A84A 3MFNA 5L0GA 2EW2A 1FL9A 1E2XA 5KQGA 4CM4A 4MQ4A 3ZOKA 1Y8CA 3LDGA 4EA7A 4I3FA 1XZQA 1O95D 1V11B 1CIJA 1QYDA 2MU1A 1RU3A 4F06A 2YL0A 3HU5A 2D7CA 4RKEA 3W90A 1DQRA 3LRPA 5C52B 4OTZA 1J25A 3ZW8A 1T9CA 4BN4A 2O6HA 4GBGA 1DQZA 1XELA 2C42A 5CK4A 4BLRA 4WZAA 3VQTA 4B4DA 2CNKA 4IHKA 1ANKA 1OC4A 4XGRA 4EO4A 3CRRA 2KW3C 1MXHA 2ONJA 1TQDA 1TU4A 1RMVA 1A2BA 4TKUB 2QSZA 1QOPB 1KAOA 1XWJA 1Z15A 1A98A 5HDBB 3B53X 5GP1A 3C0KA 3FOEC 1T3TA 4JIOA 3ZCPA 4ESVA 1E66A 3H9UA 1UKYA 2PV7A 3UB2A 3PIIA 4AUNA 4Z3DA 4AZVA 4ICIA 4QOGA 4I50F 2ZBFA 2FG7C 1T4DA 4O4LF 4ZCQA 4D57A 1TLLA 4Y2QA 4IUCS 2NG1A 1GPUA 4FGKA 4FDMA 3JD1A 3AL2A 1SXJB 3JPWA 5CEJA 4Q24A 3GLGB 3N8GA 5UKDA 2ZVDA 1T9ZA 3FMVA 4CDGA 4AY6A 2E5LB 2V59A 4OLHA 1EX9A 4I8XA 1ZCZA 1AD2A 2YJ6A 1CY0A 1C02A 4HRXA 4N3NA 1R0ZA 3RREA 3WAQA 2Z83A 1K86A 2AFIB 1AU9A 1UBKS 3ASZA 4AN0A 4BX9A 3EXHC 4HEJA 3C43A 3QE0A 3ITEA 3NRBA 4YY3B 4ZI7A 2I3AA 5AUOB 3O47A 3OZTA 3L4EA 4N0EA 4DKJA 2IITA 4RJIA 3B1KA 2HBRA 4OHRA 3WTBA 3HXLA 2OTCA 3KKEA 3TCNA 1EB9A 2P6UA 3NM4A 1U3FA 3RHTA 2B21A 5F3DA 4B4VA 2LRHA 4RM2A 2REXB 2GESA 3RHSA 5CH8A 3QKSB 5C8YA 3HGTA 3M70A 5AKHA 2CYBA 2WNSA 3ZQUA 1MH9A 4UZEA 4KBGA 1CYEA 4UUMA 3QBTA 3IODA 4FWTA 1BKSB 2VXCA 2W37A 3AFIA 1FDSA 1GL3A 4L3VA 2OCPA 2J5KA 3AUJB 3B6JA 1QDEA 3DKKA 2C7BA 5EERA 3IAM1 5LXTF 2FFQA 2DUWA 1JJAA 1GPWB 5AMXA 4DRZA 2B98A 4FX2A 3G2QA 4RTLA 4N41A 3DAFA 3FPSA 3PJGA 3VTFA 4X6LA 4TYQA 5JFGA 2WAYA 2EJBA 1Z5UA 2VA9A 3PEYA 4MDFA 2J3JA 2WVNA 4ARUA 3AEZA 1F7VA 4RACA 3RR2A 1XRLA 2FPLA 1IXYA 4BU0A 4LX0A 4PCLA 1NRIA 1OUMA 1SCQA 3OQIB 5B1YA 3V46A 3S8YA 4XCVA 4BVKA 1JHUA 3DV0A 4PBTA 1L5RA 5JJKA 4ZEOA 3HI4A 3RGGA 2YC4C 4I4TA 3VAYA 1UANA 5ES4B 3ZKAA 3JAWA 4CIAA 3OJCA 1U5BB 4D92A 3DGFC 1VSBA 2C2WA 4NV0A 2PHZA 1VECA 3M8KA 4YL0A 1G0NA 3NV9A 4E3ZA 2JD1A 4MWCA 1RQXA 1G6OA 3TXXA 2ZRNA 3LDAA 4YPFA 3IVMA 1EXWA 4H1HA 5JUAA 1SC3A 1J00A 3HXKA 1GZ7A 2PJZA 3UUGA 2Q0XA 4K88A 4GYKA 4RK5A 3T9FA 3WODF 3FNIA 3M83A 1CR1A 1ZMXA 3QELB 4M9ZA 4ALMA 4G4JA 4P4SA 1OLSA 5AW6A 3TBFA 1GYPA 3WFIA 5BV0A 1IY8A 3WHIA 1RCUA 1AUXA 1I7LA 1WSDA 2IWHA 4MKZA 4HNVA 3IR7A 5TVGA 1U0LA 4PACA 3BDAA 4RDCA 3EISA 3ITFA 2NZVG 4D42A 1QO7A 1QFSA 2YN2A 3AM4A 1K2WA 4I5FA 3W5VA 1Y9DA 1PR1A 5J1SB 1TGVA 4QUEA 3UYKA 3T5MA 2VKTA 4DIDA 2PN1A 1T5DX 1N78A 4YO7A 1DC4A 2ERYA 5G0TA 4ZOLA 1AQNA 3VPCA 2ASEA 3FJOA 2UKDA 1T9AA 2FHPA 2II6A 4C3VA 4I14A 4A7PA 2Q6LA 3OPQA 3SC3A 2RGRA 5IKMA 1OXTA 1XCLA 5FOUA 1PR6A 3TUIC 5FOQA 4UM5A 1YMQA 3BB1A 2JGJA 5FPYA 4YRKA 2BGNA 3DW1X 5JAPA 3DE6X 4NBSA 3R0IA 3TLEA 1J1ZA 3FSGA 1GM5A 3T54A 1BFUA 3HDVA 1M1NA 2VTKA 1ONSA 4PPGA 4OM7A 2O4UX 4GI1A 2IKSA 4MZDA 5EQJB 2NZ2A 1C1DB 4QPNA 4Q3BA 3IAHA 1DUIA 4OAQA 1XRSB 4BX2A 2Y67A 3COZA 5IPFA 4ZJZA 1X2EA 2OFWA 2ZJBA 4MS3B 2OV2A 1JHPA 3EPKA 2D4UA 4Z4EA 4TTVA 1TX4B 1I3MA 1OW7A 4XPYA 4CKBB 2H1WA 3D6HA 2A9VA 2B0CA 1POWA 1DPFA 5DB4A 5KSPA 4AL1A 4C88A 1HSZA 2QP4A 3ASOC 3AUSA 3JQAA 1BD4A 1D5CA 2W8ZA 2H1HA 3PSAA 4C3DA 4FLFA 3S8EA 1SVWA 4ZI3A 3MX3A 4XVQA 4X6XA 1UOEA 1LW6E 4WN9B 4O1HA 1IY0A 1R8SA 4R1UA 2VSOA 3DSRA 2PEZA 5MN5A 2HRQA 3SHVA 2F9LA 3BCHA 2OCCC 2UXCB 2XD4A 3K4PA 3AI3A 3FOOA 2AC4A 5JD5A 1RWBA 5LQUA 1AE1A 4IKOA 3U44A 3I53A 1X7WB 3R09A 4WD3A 3VJLA 2LSEA 4WKOA 1G60A 1JIJA 1W0CA 1XTV