4KNVA

The crystal structure of apo human hdhd4 from se-mad
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
241
structure length
241
Chain Sequence
MRAVFFDLDNTLIDTAGASRRGMLEVIKLLQSKYHYKEEAEIICDKVQVKLSKECFHPYNTCITDLRTSHWEEAIQETKGGAANRKLAEECYFLWKSTRLQHMTLAEDVKAMLTELRKEVRLLLLTNGDRQTQREKIEACACQSYFDAVVVGGEQREEKPAPSIFYYCCNLLGVQPGDCVMVGDTLETDIQGGLNAGLKATVWINKNGIVPLKSSPVPHYMVSSVLELPALLQSIDCLVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords N-acylneuraminate-9-phosphatase
publication title Design, synthesis, functional and structural characterization of an inhibitor of N-acetylneuraminate-9-phosphate phosphatase: Observation of extensive dynamics in an enzyme/inhibitor complex.
pubmed doi rcsb
source organism Homo sapiens
total genus 87
structure length 241
sequence length 241
chains with identical sequence B
ec nomenclature ec 3.1.3.29: N-acylneuraminate-9-phosphatase.
pdb deposition date 2013-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.710 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4knvA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4knvA01
3N8GA 5A3QA 2MU1A 2BDUA 2WF7A 3WK8A 4UU1A 5AKIA 3B8EA 2HI0A 3R4CA 3OPXA 3QGMA 3IRUA 4BX2A 1WPGA 3K1ZA 3L1VA 3PGVA 3QU9A 4PNHA 5AM3A 3SHQA 2GHTA 5AVUA 5IT4A 4NFLA 4CF3A 3ZUPA 3W5BA 4I9FA 4I9GA 2HDOA 3L0CA 1VFPA 2NO5A 5AKZA 5AK5A 3NASA 5AI8A 3WK4A 5AW7A 3EF1A 3ET4A 1ZJJA 2GMWA 4BEVA 5AVTA 3FPSA 2Q4RA 5AIBA 1RLMA 3AR3A 1T5TA 5AM5A 4EELA 2R8EA 1RMYA 2JAOA 2FPSA 4XOUA 3RFUA 3U7FB 2AH5A 2HX1A 3AR5A 2QLTA 5ALJA 3M1YA 2G09A 3KOOA 1L7NA 5AKEA 4QQFA 4BNDB 3L1UA 4OD0A 2ZBDA 4UATA 4UMEA 3PGLA 4BX0A 4FYPA 4DFDA 3QUBA 1L7PA 2IOFK 2B1QA 2CN1A 3ZTWA 4CF4A 3WK6A 1EK2A 5ALHA 3U19A 4XPZA 4Y2YA 2VKQA 4UW9A 3QUTA 5AKHA 2HSZA 1L8OA 4YCNA 3NUQA 1RQLA 4OFZA 4YGYA 4G9BA 2C4NA 5ALQA 4ZEXA 5AW6A 3FZQA 3L7YA 5ALSA 2W4MA 1ZOLA 2WM8A 2FUEA 3QLEA 4UARA 1RRCA 4L6AA 4Y2JA 3OCUA 1Z4JA 1PW5A 5AKXA 4UMFA 2CFTA 1JUDA 3NRJA 4DCCA 5AVVA 2HCFA 4ZEWA 2ZBGA 4KN8A 4HAIA 4L6CA 4J03A 1ZD4A 3ED5A 4FE3A 4NABA 2I34A 5AVQA 5AKJA 1WZCA 3IB6A 2HOQA 3I76A 2RAVA 4Y2VA 3L8EA 3OCZA 3L0YA 2ODAA 3DAOA 4DW8A 5AESA 3NANA 3SKYA 1QH9A 5ALEA 1QYIA 1TA0A 4YH1A 2YJ6A 4C4SA 4GXTA 2O9JA 1QQ7A 2B1RA 1TJ3A 2IOFA 3OTQA 3U26A 2OYCA 3QNMA 1FEZA 3AR9A 2YBDA 2FPUA 3A1DA 3NALA 2IYEA 4KNWA 3U7EB 4EX6A 1ZRMA 3BWVA 1RLTA 4UM7A 3KD3A 1YJ5A 2WF5A 3AR7A 1WR8A 3WKAA 3UMBA 2FPRA 5ALRA 3I6BA 3A3YA 3OCXA 1NRWA 4C4TA 5AVZA 2FDRA 4Y2XA 5ALVA 3KZXA 3ET5A 1RKUA 2B82A 2B8EA 2ZBFA 1VJRA 1Y8AA 2P27A 1Z5GA 3UMGA 4RESA 3L8GA 5AI4A 3ZU6A 4EEKA 2HO4A 3IJ5A 3WKBA 4UMVA 5ALFA 5AICA 5AKGA 5AKKA 3B9BA 1YS9A 4G63A 5ALZA 5AM1A 5AIAA 1YDFA 3I28A 3F9RA 4RETA 1ZD2P 2FEAA 5AVRA 2FPWA 3ESRA 4UMDA 1T5SA 3U7HB 3QU7A 3QU2A 2FI1A 1ZD5A 5AW9A 2WF8A 3L8FA 1Z4QA 3CZ4A 2JGAA 4HGNA 5AM0A 1RQNA 2GHQA 2R8XA 1KYTA 2OM6A 4OCZA 4HYTA 5ALYA 2C8KA 2D2VA 3D6JA 5AW3A 1U2SA 1Z4MA 3KBBA 3M9LA 3L5KA 4YIHA 2YN4A 1X42A 2ZG6A 1U7OA 1CR6A 1J97A 5AW2A 2B30A 1O03A 5AVXA 2YJ4A 2G80A 5AI0A 4FFDA 4KNVA 2QYHA 3MPOA 4CF5A 2R8ZA 3FPBA 5AW1A 3U13A 3QUCA 2JAWA 3WGVA 3NAMA 1YNSA 1XP5A 1O08A 4NAVA 5ALLA 4F72A 4Y2SA 3EF0A 2DQSA 5AI9A 3WK9A 1L7MA 4JDPA 3ZVLA 4H1WA 3WK5A 1RC8A 3MC1A 3N28A 3PDWA 2G08A 5ALPA 5FP0A 3QXGA 2OBBA 3OCVA 5E0OA 4BEWA 2I6XA 4UM5A 2RBKA 3QX7A 2PKEA 4XQ0A 3ZVNA 3L0BA 4UAVA 3UM9A 1ZRNA 4YIKA 4YCMA 3MMZA 4KX5A 1VJ5A 1YV9A 3J7TA 4AP9A 5ALDA 5A3RA 3FGOA 3PCTA 1TE2A 2YMMA 5T41A 3DDHA 3MN1A 4DWOA 3E84A 2G1AA 5A3SA 2MSNA 2X4DA 4EENA 3FVVA 5AW4A 2W11A 4HGQA 1F5SA 2P69A 3QUQA 5AM2A 1RMQA 1NNLA 4Y2TA 1AQ6A 2CFSA 3ONNA 3I1YA 4Y3UA 2G06A 5AK6A 4Y2QA 2IA5A 2C9MA 2PR7A 4O8CA 5ALUA 5ALXA 4L57A 5AK3A 3WK7A 2C8LA 2FUCA 3BA6A 4J2TA 2ZBEA 1QQ5A 3SKXA 4AS3A 5AVWA 1L8LA 4UASA 2HHLA 1S8OA 1U02A 3B9RA 4NV0A 3SD7A 3UMCA 2C88A 2YMLA 3E81A 3VAYA 1MH9A 2WF9A 1LTQA 3W5AA 2G07A 3SLRA 1U2TA 4CNQA 3E8MA 3EPRA 3AR4A 1K1EA 2OA0A 5IS2A 4AS2A 4EZEA 1T9ZA 4UAUA 5ALWA 1U7PA 2YJ3A 5ALTA 1XPJA 5AM4A 3QU4A 4E88A 2I7DA 3KDPA 5ALKA 3SF0A 2RB5A 4QJBA 4ZEVA 4C4RA 3HYCA 3DV9A 2P11A 3ZTYA 3L8HA 3WGUA 1RKQA 3P96A 2YFYA 1QQ6A 1L6RA 4BYGA 5AI6A 5ALNA 3ZX5A 2ZOSA 1Z4IA 2GO7A 3TLMA 3W5CA 1YMQA 4UU0A 1RKVA 2NYVA 3DNPA 2EAUA 2Q5EA 3CNHA 3GYGA 2YMQA 1RPZA 2JARA 3QU5A 3N07A 1Z4PX 1S2OA 1ZS9A 4Y2RA 1Z4LA 2YJ5A 1Q92A 3E58A 4HGOA 3ZWKA 2AMYA 2B8JA 3OCWA 1TJ4A 3R09A 3KC2A 2I55A 2BY4A 1RMTA 3QYPA 5AW5A 4YCLA 2AGVA 2YY6A 4EX7A 5ALMA 2JAUA 5AVYA 4CE6A 3AR8A 1SWVA 2EARA 2YMPA 1RLOA 2EATA 3U7GA 1Z4NA 2I33A 2I54A 4IG4A 3A1CA 1NF2A 2IOHA 4F71A 3N1UA 1Z4OA 5AHXA 2W43A 1XVIA 4BNDA 3WKCA 1WVIA 2G0AA 2Q4TA 5ALGA 1Z5UA 3ZI4A 2CFRA 4BBJA 2O2XA 5ALOA 1J8DA 2B0CA 4Y2PA 4KX3A 1N8NA 2RARA 3ESQA 4JB3A 3FM9A 1Z88A 1Q91A 3ZWDA 5AK4A 4BX3A 5AI5A 5AKLA 2FPXA 4MUMA 1LVHA 2P9JA 3RF6A 4HGRA 4NWIA 5IT0A 3A1EA 1TJ5A 1SU4A 3WKDA 1RDFA 5AW0A 3AR6A 3NIWA 4OHFA 2HF7A 1L7OA 4BKMA 5JJBA 1SWWA 3W5DA 3ZX4A 2WF6A 5AW8A 3S6JA 4B6JA 4Y2UA 3R9KA 2NO4A 3N5KA 3ZW7A 3EWIA 2GFHA 1N9KA 4XE5A 3AR2A 2R8YA 1CQZA 2AUTA 3ZVMA 2BDEA 4MWOA 4KYTA 1Z4KA 2WHEA 4GIBA 1IWOA 4IFTA 3WKEA 1EK1A 2HEGA 4HGPA 1ZD3A 2ZXEA 5ALIA 5AVSA 5AKYA 3HLTA 2PQ0A 2WFAA 2HF2A 3SMVA 3OCYA
chains in the Genus database with same CATH superfamily
3E9CA 4DUGD 2RHWA 1CR4A 4MP3A 2B25A 2ECQA 1NNEA 1BYUA 1QSGA 3VI4B 1NBOA 4DSOA 1Z23A 3IJEB 4GFDA 4UJ3A 1GNTA 3A3NA 3W3AH 3X2QC 1ODKA 9GPBA 1NXPA 1JTFA 1L5GB 1BXRB 1U7DA 2XV1A 3H75A 4Q9JA 5BN4B 3SM9A 1YS7A 4RDCA 5ISMA 2BF4A 1QZUA 4DMUB 2WBLC 4Q7KA 4MB0A 4JQZA 2XI4A 1JQAA 2Z98A 1IJKA 4BHTA 4XIJA 1I6WA 5DGDA 1FFWA 1M1NB 2O9XA 3CNNA 4G85A 4G1MB 1BMFA 1P5JA 4PZPA 2HCFA 3KQVA 1LEHA 1IB6A 3ND7A 3QE2A 1CE8B 2QSYA 5DGIA 2OQVA 5KTOA 5K3FA 3PEEA 3EVFA 4K0DA 4RLHA 3GJ0A 3G82C 3JSEO 5L95A 2AOWA 3R8XA 4JV5B 2WP8J 2YBDA 3WRYC 2PEZA 1E3QA 2KW3C 2NMVA 1C0EA 4GRIA 2BZ0A 1UR5A 4C6TA 2Q3JA 5SZIA 2ZBFA 2IUSA 2BDTA 3SEQA 3IDOA 1TD9A 4XQGA 4Q5SF 3K6KA 4MHSA 4PXSA 4J75A 4MNTA 4UMDA 4DCOA 4PX2A 1J0EA 4UEJA 5JVDB 4I4LA 5BSEA 4JJ7A 4HDSB 3ITNA 3PQEA 5BQOA 4D9CA 3K9BA 4YAKA 3ZU4A 1ZGAA 3EUWA 3EH2A 4N7MA 1FUUA 4P7JA 3UZUA 4D8UA 4HDNA 2F55A 1WXXA 1E69A 4UKDA 1CLUA 3NCTA 1Q57A 1PUJA 4OIOF 1LW6E 1P3Y1 3JQAB 3MTJA 4RXTA 2P6UA 4YUWA 3RQFA 2P5SA 5CLGA 1UFBA 1KZHA 2GAJA 2B4TO 2R3SA 2P3QA 1E63A 4UNIA 2PVCA 4U7DA 4KQKA 2PZ8A 3DZFA 3UB3A 4WEQA 1UMDA 1ODSA 1CYEA 3AEUA 5TXGA 1C7JA 4X0EA 3IUBA 4QRIA 1XLVA 4MIKA 4HWKA 2FR0A 2DM6A 1Q3KA 3F5DA 4YUVA 1FXUA 1OT3A 3C3EA 1N5OX 3BRQA 4Z9XA 4KQIA 4X71A 4WACA 4CL3A 3LVFO 1Z3CA 3UOGA 4O2AA 4F2WA 4QJBA 1QCZA 3DMTC 4H7HA 2FXIA 2ATXA 3QVOA 4W4TA 1DWUA 1K5HA 3WO0A 3QOFA 3R5XA 3LS1A 1E3WB 1J39A 4K7BA 5J3JA 2FMXA 4ZMSA 3L0SA 3WDSA 5BV2P 1TCCA 3T3HA 3FF4A 3JZIA 3MTEA 3H9QA 1EVQA 4DC9A 4YCLA 1XMJA 2TMVP 4NY1A 2C9BA 4AC9A 2K7ZA 1PDVA 3AERA 2E48A 5EIFA 2B1JA 1GZ5A 1VCHA 3USCS 4JVNA 3FVWA 1UOPA 2IYFA 3HXLA 4YJHA 1LRKA 2G5PA 3H5OA 1R00A 2Q2VA 1ID1A 3FWKA 2QKYA 3JSAA 3OUUA 4QPJC 4EVQA 4RYDA 4EHLA 1TWAA 1GZVA 1XTVA 3V34A 2OWDA 4P4SB 4MPPA 4DSTA 1QNLA 2V5VA 4M6WB 3A4IA 3EZLA 1GTRA 5TF4A 2OZKA 1DWPA 4R32A 1GGQA 5U4QA 1P91A 4ESOA 2FPMA 1R6DA 3ADOA 1EFDN 1POWA 1N1EA 4QGSA 2PV7A 3MMXA 4D81A 3R4CA 3JQ9C 3HY4A 4C1NA 4FR0A 3CZQA 1G98A 5D7NA 2O3TA 1ZCAA 5BSKA 4IXMA 4J3NA 4U5EE 1CT9A 1YQDA 4F3YA 5M29A 1M75A 3C39A 1PE0A 4BAZA 2JFYA 2Y77A 2PWPA 3WNZA 2B5WA 4FYPA 4ZVSA 2IHUA 1VLLA 2JI7A 4EHDA 1AB5A 1BR4A 1U9ZA 2J67A 4I1MA 3TW8B 2PUEA 3EJ6A 1J9GA 3HQ4O 3WMFA 3JRWA 3JR7A 2XLWA 2ZE7A 1IFXA 4U7FA 3E6AA 1PWYE 3PX3A 4QA9A 4A1OA 4FR2A 3GPIA 3AIMA 2LKCA 3CLUC 5HYVA 2AWOA 4WGGA 3NP9A 1TZKA 3ZD7A 2QMEA 4DY6A 1H1LB 4ARUA 4GPAA 2DTEA 1DKNA 3OZGA 4EI7A 1AMNA 4XD2A 5KKAA 3STUA 2ZJ6A 5EJFA 5CEEA 3UAWA 3IEUA 4V0NA 2A0FA 4A4DA 1UC4B 3JATA 2WQ6A 4NMMA 5CURA 4RIEA 4TLEA 4C04A 8ADHA 5B3SC 1U9JA 1YJ8A 4B46A 3GG9A 1FQWA 1MX1A 2VVTA 2MOKA 4FZVA 5TSDA 3G89A 2ORWA 4IVQA 5TQ2B 4LJLA 1NZFA 2EOAA 2C20A 1TEZA 3WXBA 1MJHA 3KEQA 1QGAA 2JJ2D 2HIMA 2ZRHA 1KMQA 5ALFA 3WMGA 5A4IS 1YBFA 4NESA 4PLGA 2H2GA 1YKSA 1CIVA 5K0LA 4QU8A 1ZW6A 1LNSA 5C80A 1CUVA 2FTKE 3V6MA 1HT2E 1N3IA 2A0XA 2EXXA 4TTAA 4CIVA 4NH4A 1GM5A 4DDKA 2QI9F 1H93A 1YNSA 3G02A 3S8YA 4FFNA 3ZK9A 2CNKA 2J08A 2YLIA 1HDCA 3GROA 1TU0A 4H7IA 2I6XA 4IGKA 4NPAA 1L7QA 2ISSD 3V9AA 1ZH4A 3DEHA 3ZGVA 3IQEA 4CDMA 5DK6A 1TA4A 1ZHFA 2H2IA 4QJIA 1KFEB 3PUJA 4HOYA 3QFTA 3QMVA 3ZCRA 1NLXA 1ZESA 2VA8A 5CNMA 3K0EA 1AV7A 1QUEA 3C45A 3GGCA 1WHSA 2LNDA 1P1HA 4JCHA 1HE1C 4YQYA 1ZIYA 2NV2B 1EK6A 5ITZB 1DWOA 2IYLD 4P22A 5E6UB 1H4SA 5LQSA 2A4MA 1XZDA 3IXMA 3DCIA 5JJKA 3BMOB 2FG7C 1R6VA 1OOEA 4G65A 3PEVA 3FSRA 1J5EB 1X7ZB 4RTRA 1RU3A 2Q3TA 3TB4A 2XEDA 3KEGA 3ZWPA 4BFTA 3W6UA 1Z4PX 4PAGA 3D4BA 5FI0B 2R7QA 4D99A 3RI3A 4IYRA 2HQBA 3GZNA 4A27A 5BQIA 4BDSA 3C41J 3R23A 2P6MA 3LUKA 1TFUA 3F96A 5FD8A 5BN4A 2DB3A 2ASVA 5DCYA 5BPFA 5HRCA 2QVYX 1BD4A 1JYSA 1BVYF 2BGGA 4OLFA 3RFVA 4DMRA 5LQUA 2GOYA 4RXUA 1K0UA 1UBMS 4MUMA 1QFSA 4II3A 4QXAA 1TCAA 3EGIA 2DY0A 3UMVA 2B36A 3SXKA 2CMFA 3FHTA 3ZXYA 2WSBA 3MFNA 4RDHA 2RHGB 2WKWA 1SU8A 4QT4A 4AK9A 5TQ0B 1CE8A 4EATA 2R60A 3OZWA 4QYIA 3VR3D 2AZMA 1XAIA 1J7JA 3IO5A 4IIGA 1CVLA 3L8CA 1D2RA 4CIXA 3V1LA 2UZ4A 2JH8A 4U5DE 3R75A 4A8JA 3MJRA 4DIFA 3NASA 2ERYA 5C8ZA 5J9FA 3M4NA 2H4JA 3OUZA 1UBLS 2OLKA 4HNAB 1K9SA 4B3GA 3HZOA 1VKRA 3NAQA 3EFOB 4IR7A 3CIFA 3V00A 1C29B 1UKVY 1G2IA 4M1SA 4X00A 5FBZA 3T4RA 4UOZA 3AVWA 3HKDB 4MQ5A 2FOXA 4XEUA 1RJ9A 5LZ9A 4QYWA 3DS8A 4DGSA 4IQ8A 1Y42X 1AZLA 2J3MA 4DV7B 4XWGA 4O0LA 3C97A 3F2IA 2B4KA 3HDQA 1EHCA 1PW5A 4ARSA 3PMRA 1PR0A 1ZXBA 3HSYA 2ZWIA 3B6ZA 3GLKA 4PNZA 4M83A 4CLOA 2IYZA 1V25A 2V7EA 4NABA 5CT5A 4QDUA 2O2GA 4YASA 4WFKA 3Q8LA 4FN5A 4JLWA 4MQ9F 1Q0QA 2NO0A 2NVUA 2NVWA 3D6AA 2UUPA 2RGUA 3HUUA 2IZ5A 5LM3A 3EXHC 1Z8FA 4A15A 3KTAA 3VGPA 1RQPA 2G72A 3DWWA 4LLCA 5FL7D 1BVUA 2RGAA 3SM3A 3DKVA 4AYWA 2AI3A 1Z07A 3QBVA 3WGQA 3E22A 3HU5A 4C0XA 2CL0X 4C30A 3SYKA 3WKBA 3NB0A 1V4BA 2QMQA 3BFKA 4UPVA 4GVXA 3HWX1 3FF1A 1ZD5A 1FPMA 1K0FA 2IEZA 2B21A 5KJFA 4TWIA 4I4CA 1KJIA 3T1TA 4AJLA 2VJBA 4L5CA 2J4CA 1OPXA 3FOFC 4C5CA 3DXYA 1W46A 1XVUA 4QJ3A 3T7RA 4Q0MA 4BMPB 4P9FA 2HF8A 1ORTA 2B5VA 2CC2A 4GYKA 3PGKA 3MF4A 2KJGA 1O5IA 5HZKA 5K5EA 2D4AA 4JDPA 2EIXA 1KU0A 2JG3A 5L3RA 3MC1A 3OFKA 3VBCA 3LHKA 4GOJA 4AVYA 4U5HA 1T2DA 1AO0A 2WFZA 4IAQA 4EUKB 2Q6KA 2GZ2A 4BGUA 3ODPA 2CD7A 4PYNA 4W6ZA 1PR3A 4RLQA 4CF6A 2PGNA 3OPMA 2HHHB 3WSWA 3UJPA 4FGZA 4X9XA 3NKLA 4B45A 4C4XA 1VDMA 2A30A 3MYFA 1LZLA 1QVAA 4P4SA 3UHPA 2ZUTA 4QHSA 3CSUA 2XE7A 1FU7A 4M6WA 3CRW1 5TGZA 4A0SA 3TRDA 1W48A 3VGJA 1JSRA 2E89A 2V0CA 2L6GA 4PG4A 1SEVA 4MA0A 3HVRA 2XGSA 2H1SA 2O52A 2OC9A 4ERXA 1YUMA 1Q0KA 4FS3A 2LCIA 4ND8B 4QULA 2BSQA 5BUQA 3CQ9A 1MKYA 2PL9A 4LE1A 2QTWB 3RYHA 4AFNA 1PG5A 4GEHA 1P6XA 3CEMA 3R0ZA 1O58A 2YY6A 3SJBA 2OCXA 2AFIE 3C3YA 1J49A 1M8GA 1G17A 3ID6C 3DQPA 5EP3A 4RM2A 3P9QA 4TRRA 1V3UA 1N0HA 5JJLA 3FI9A 1DDIA 2I9PA 1LE2A 3TW8A 1K2WA 3OFND 1TUGA 4QREA 2GFIA 4LTMA 4RORA 1XDWA 1Q7TA 2X0FA 1W5BA 4OJTA 3O0DA 4B6JA 1EG7A 3N5KA 2JAPA 3N5CA 1XCPA 1GTSA 3WAQA 2PKQP 3RRFA 4PZDA 2W6CX 1NVVQ 3N2GA 1KAHA 1TWGA 1VKZA 2PQ0A 1C4XA 4Z49A 5FDFA 1D9XA 2MU1A 4G4SP 3C4JA 3OP1A 1U0NA 1APBA 2Q1XA 3HTKC 3SHQA 1XMPA 3F8TA 2BV3A 4PXAA 3BCRA 4C01A 1LSUA 5F3DA 1RI5A 4R7GA 5TQ2A 1KJ8A 2R6DA 1GOTA 1K5DA 1OYVA 4MRSA 1D4FA 1DKRA 1JG4A 4OH7A 3ZE6A 3H6GA 3M6MD 2GN9A 3CRQA 3O8RA 3WLLA 3WK6A 1M7HA 4AMVA 3AQ4A 4KG7A 4YAWA 3AY0A 3DFUA 4W9RA 2QAIA 1X1RA 2AQKA 1XOIA 3ESDA 1WY7A 2FUEA 3CZ5A 3W5JA 3E5RA 1C1HA 4D8WA 3H5AA 3FY4A 1Y4DE 3LCCA 1V4VA 5F5HA 3HBJA 5K3AA 3REFA 3A2KA 3SKVA 4BO4A 1I3CA 5ALEA 1EVJA 3W78A 1UL1X 1SUBA 2ZRPA 1L8QA 2BGKA 2QM8A 4BVEA 4C6HA 4HFMA 4XVHA 5ECWA 3PR1A 2H7VA 3HUTA 3HB5X 5FTKA 1N1CA 3ABMC 4V3CA 4M89A 1R37A 2P4SA 4AJ2A 1UUFA 1PL7A 1KI9A 5IUJC 4M22A 4TXHA 3L5OA 1GFWA 2BBOA 4JI3B 4UFPA 5ELXA 3LHIA 2V7GA 3GOQA 2X5JO 1R2QA 2QRZA 1GL6A 3KK0A 1KK3A 3PFHA 2YXDA 4Q93A 2D7CA 1G5RA 1V1RB 4MKZA 1WSWA 1IH8A 3WDMA 5I45A 2IW1A 1I01A 3BMOA 2HGZA 5CRIA 2XQIA 4CF5A 3JQQA 2OMKA 3NWBA 1Q19A 4BNWA 1YJGA 4YMTA 2UUCB 221PA 5K0BA 3WWOA 4DEYA 5ALPA 2ZJ5A 1U0GA 2B34A 5BMVB 3RC1A 4B2LA 1W0JD 4KX5A 4MWDA 3LK6A 1WZNA 3RC3A 1QOPB 2BFMA 2BGUA 3BIJA 1L5WA 3RC8A 1DELA 3GJZA 3FVVA 4GPD1 2MMGA 3LO8A 5F4ZA 4YJKA 4GE3A 1N9GB 5EUBA 5FTNA 1PZXA 2V98A 3RK4A 1F2UA 1Q95A 1EA5A 2C8LA 1SM4A 3C7AA 3STTA 4NBWA 4GYJA 1FBTA 3JD1A 4IICA 2G82A 1I1HA 3CZRA 3V1KA 4IIFA 1UBJS 1JYFA 3N58A 1XCJA 5I7OA 4Y0VA 2MR5A 2BAGA 2LW7A 3SSOA 3IAEA 5A05A 2BFFB 1IN1A 1BG6A 1ZI9A 2ZCJA 4WOKA 3AHFA 1GZSA 1F0NA 1NVBA 2ID4A 3OC6A 4KQJA 2R5WA 5BVHB 1AQYA 1CNMA 2COUA 3L4KA 1C7IA 4WK6A 1ZIXA 3VYUB 2ODQA 1SB8A 1UXIA 1OV6A 2VQ3A 3VI3B 3ELWA 5H70A 3S7TA 4OOFA 1E62A 1NLUA 1KI7A 3NDIA 2R87A 1TTHA 2Q6LA 5JISA 5FA5A 4JNCA 3LUDA 3W8EA 2ZB4A 1X74A 4OMFG 5E9AA 2XWQA 2W2LD 4G0PA 5G2OA 3BBPA 1BVHA 5F64A 4RQUA 4KBFA 2BFPA 1KXJA 4DYVA 1JJBA 3AL2A 3EPJA 1T2CA 1Z68A 3HP4A 4IIXA 2OPHA 3HJFA 3KJGA 3TDMA 1FVFA 4ND5A 2C4VA 1XVLA 2ZIXA 4O4JF 3QEMB 4BNHA 1TZ2A 3U3RA 2WF6A 3SX0A 3W3ZB 4RTJA 4AJ4A 5DTJA 4EF5A 2JBHA 3QENA 2WQ7A 1J0AA 3B0PA 3ROZA 2D5LA 1NJ2A 5JWRA 4I55B 3I4CA 1ZXLA 1ETHA 5CIYA 3AKEA 5FBWB 2AXPA 1P77A 3MWFA 3LA6A 4ZJZA 1ZINA 3LE8A 4LHWA 5FA8A 4GXQA 2QYSA 3ZBQA 3VPHA 3TQCA 5P21A 4XGIA 4ENWA 1RLMA 3WHNA 2YFQA 3AR5A 4N82A 3VAZA 3PC7A 1RYNA 3NPMA 4YI3A 4HDKA 4U9EA 1NY5A 4CI9A 2BKAA 4MJXA 2CZGA 2XUDA 3KJFA 3Q8XB 1N2SA 6Q21A 2VHQA 4J07A 3WJAA 4EY7A 3K9CA 3AJDA 2VYVA 1L5ZA 1ZONA 2W7TA 5AVVA 4IMIB 4TS4A 2FU5C 4BO7A 3PICA 1OLXA 4NP6A 2FEWB 4RIHA 2B5OA 4D8VA 3AUAA 5FEMA 2P35A 4CLHA 4ABTA 2YJ6A 2E1PA 4I3MA 1VOTA 2HTEA 5GOZA 1TYDE 5AVJA 1V39A 5AJWA 4K6GA 1DSSG 4KNWA 2HBRA 2WSSA 3V48A 1V1JA 2ZUWA 1WR8A 1UG7A 5DZSA 3QUAA 4LDQA 4F04A 3MNFA 4MCIA 5CEFA 2G6BA 2XWJI 2OZEA 1QTIA 3Q98A 3OZIA 3RAGA 3CA8A 2QX8A 2GBPA 5EPOA 3WLSA 2IGTA 3VNVA 5E6RB 4DZZA 4F8JA 3KZVA 1TUBB 4IVNA 5HBRA 4Y6GB 5ADHA 2HBYA 2I87A 3EFBA 2I62A 4FCTA 2FZVA 3C24A 4PQRA 5KAMA 1DXOA 3OP4A 4D44A 3HLYA 4EYOA 3KKQA 2CCKA 3GLVA 1CJUC 4IOJA 5DI3B 1JMKC 3RRZA 4RD0A 1YDGA 1R4MB 1QWSA 5HF9A 5JUAA 4ENVA 3GD7A 1YS2X 1YA6A 1DTWB 1SELA 5FP0A 2HWYA 3M33A 4EJ2A 3CBGA 3GUHA 2Q2OA 3K70D 2ODPA 4LAFA 3D3KA 1A9PA 1C3VA 3LQ1A 3RBXA 3DDHA 4GYYA 4AUEA 2Z3WA 5F51A 3L8JA 5AM2A 1KIAA 3GDWA 3RS0A 3Q5EA 5E7QA 1V4AA 4JYPA 2VDOB 2C2ZA 1YVUA 1WKVA 3WMRA 2QL7A 4BMXA 5L3VA 2IEYA 3EUAA 3T6BA 5K0CA 3O26A 4LV6A 4F4DA 2EIKC 3SXPA 4FCVA 4CLRB 1F9AA 4MP6A 1VECA 4UQPA 5DTMA 1G20A 4H08A 1CZNA 4MO2A 1JZTA 4D9IA 5B5SA 3NOXA 4MS1B 4RZSA 3T3MB 3THWB 4GZ3A 2IYSA 2XXJA 4Q4HB 3JAKA 1EJ6A 2I5PO 2CNLA 3RU3A 4RM3A 1JR2A 2VJQA 1FLAA 5TARA 5IZ4A 4UBKA 2HRBA 1QKJA 3OETA 3ZDRA 2AZDA 3L07A 3TK1A 2LK4A 5AXAA 5FWYB 3VC3A 3BZBA 4H6XA 3D0KA 3IAM6 1NQUA 3WGYA 4UHEA 2JI6A 2DLCX 1XO1A 3N1UA 1WAMA 3BIXA 1BMQA 1DCMA 1FUKA 4XLPF 3EZFA 1C3OB 1EDOA 1NXWA 1GGKA 4JXKA 1M67A 5KHAA 3DC2A 5DT2A 4C6RA 4DOZA 4MB6A 1NN3A 1YZLA 3OX4A 2LSEA 5C51B 3JAMA 3VNUA 1V8DA 2YWAA 2JEYA 3B38A 5DM60 5F1YA 2LGJA 4D3YA 2QLBA 1G4AE 3UAZA 4MIYA 3TQSA 2XMCA 1D2CA 3C3DA 4YN3A 4KYTA 3H2UA 3KXDA 4GPEA 1ZUHA 1UP4A 3K6BA 3A6ZA 5CLLA 3SMVA 1X7HA 4AX4A 4C1BA 1JTEA 2EL9A 4D9MA 2ZUSA 3VM6A 2JA2A 2ONCA 4J1TA 1AQUA 1Y5IA 3WGTA 3MTBA 4M3NA 3V4SA 5AKZA 2OGTA 5K3EA 3WV5A 4LXIA 5A5VA 2AG8A 2C8VA 2HMZA 1ODFA 1XDDA 2CEAA 3CLKA 5I7WA 2IYOA 4RJJA 5EVCA 4F92B 2G25A 4MX8A 3NS7A 1RRMA 3HZHA 1PGQA 1QYRA 1UBEA 5F28E 2JH9A 3WQHA 5FLXA 2WTMA 3DTNA 1KOLA 4PFQA 1I7PA 5E8JA 2AFRA 3TKLA 4JKOA 2ECOA 1HLFA 3D6TB 5K3FB 1B1AA 3H16A 5TQJA 4TLLB 1OJ7A 5HUJA 1ZAKA 4Z2YA 3ILHA 3D2CA 2OGUA 1MB4A 5DMHA 1HQDA 1OPRA 2H2WA 4GSYA 2NYRA 1JAXA 4DM4A 3QFHA 4KZKA 5BMVA 5EOVA 1LU9A 3C3JA 5GJBA 5KOYA 1OIVA 5HFAA 3QSGA 4GR5A 1UJ4A 4YAIA 3VHLB 4MUEA 4JJGA 4ASUA 3LXXA 4TWAA 5DQZA 2UVPA 3K4PA 1B3BA 2AN5A 1LZKA 3LWZA 1NVGA 5HKKA 4QEZA 1XRSB 1YCGA 5AJTA 1USIA 3WYAA 1T4BA 4EHPA 4WBNF 3NX4A 2FZLA 1Z22A 1O9GA 1YCHA 2Y6VA 1JMYA 4KGZA 1D1QA 4HDNB 3ZDXB 1GAEO 1I33A 3CWCA 3I73A 3FDXA 3OEYA 3NHJA 1K98A 4YRMA 1QLEC 1NG1A 1YZVA 4B87A 4DC1A 3RTBA 1HYEA 4L5JA 5AVXA 3KLMX 3FMVA 2XNHA 4TVBA 3GFTA 3V1UA 2JAWA 5LKAA 4PC2A 3LLIA 2ZSFA 1SUIA 4ZJPA 3AHGA 2G08A 1QO7A 2GI4A 3X1KA 3H18A 2PKEA 3AEUB 4FE4A 2IIBA 1TGYA 3HJRA 4F91B 3OMWA 2WUVA 3EYWA 3V2HA 1V6SA 5EA2A 2AWCA 1Z2NX 1A7DA 2R6HA 2JFQA 5C4IA 3RE1A 3IUMA 4OTZA 4KWEA 5IJZA 4P80A 2FFJA 1KEVA 3BILA 3SXMA 2JD0A 4ARAA 2PPLA 3IL2A 4N3BA 4ZVKA 4Q9AA 2IBTA 3V4VB 2RE8A 3ZDAA 3PDJA 1YB7A 4MULA 5DWVA 2RJ3A 4OI2A 3U7QA 1FDTA 4RGQA 3FCSB 2IGBA 1N2IA 3LNRA 4PJJA 4JKIA 4B3DA 3WGZA 1G7CA 3NT5A 3IEKA 3NIGB 1JVSA 4R0VA 4BP3A 1JDVA 4Q3CA 4H60A 2C1EA 2PLNA 3OZFA 3TTSA 5E8RA 4HAWA 2I3BA 1D6MA 3GJ4A 4E13A 3BTOA 4XQCA 3R8FA 2YMPA 1EI7A 4YJHB 4NTAA 4LY9A 2O6HA 4AUMA 1OAOC 3QI7A 1KDYA 2V7WA 4LFAB 3WLKX 1JSXA 1G6OA 4MSUA 2ZPAA 4RJ2A 2C7OA 1DRKA 1PJSA 3JTMA 1UJ5A 2J3EA 3OWOA 2BISA 4FOSA 3DBIA 4BVJA 1BE8A 2C77A 2BI8A 3IV9A 5IAEA 1UCFA 2JHCA 3FJ1A 2DCUA 5F4BA 5JZVA 3BE8A 4BNZA 3QUSA 3P8ZA 2RD2A 5GINE 2PLFA 3SAJA 2ZIGA 1JJVA 4D82A 3E9DA 3K0CC 2AJLI 1Z74A 2IP1A 3OZXA 3IDSA 4GSKA 1HG1A 4AL1A 3S70A 1WWPA 3QU9A 4DLNA 1TTQB 1CEEA 2A88A 3EMBA 2ID9A 4OSPA 1IXSB 1NTOA 4HUQA 1TADA 2VJDA 4MV3A 3GP5A 3Q0IA 3FSGA 5AI8A 4EMBA 4IJKA 1ZK4A 5AW7A 2X8JA 1Y4ZA 1GG5A 5JS2A 2C7VA 2G40A 3I12A 3IKTA 5EFOA 3CCBA 4MI1A 4BNDB 1KKLA 3VX4A 3EXAA 2JD3A 2J85A 1SUCA 4KEAA 4KAAA 4XASA 2GH1A 4RZ3A 4TTVA 3NVDA 3D6VA 1GQYA 1RM5A 1RQLA 2OCGA 4H3VA 2P6OA 2EGUA 2DBRA 2H5LA 2Z9CA 4HUJA 5G02A 4XCQA 2P9CA 2IIQA 3QEBZ 2DQYA 1XXHA 2C84A 4EJMA 1PFQA 1Z06A 2Y1EA 3KUKA 1Z0AA 1QGZA 2CW5A 3JATB 2EIJC 1PNVA 4IDBA 4C2AA 2VPXA 4CS8C 1EB8A 1SQSA 1S4QA 3JAWA 3E0XA 3V97A 3K5WA 5BWNA 4WY2A 3D4LA 4LRYA 1QVZA 2ZSDA 4IW3B 4D4NA 3LUCA 1R7RA 4XQ1A 1NKSA 3MX3A 1AKRA 1DQPA 3DGEC 3L02A 2TMDA 3OLZA 4KYUA 4NZZA 3IAS6 1OXUA 1TFOB 3FVTA 3JPYA 3EQZA 1UBOS 3M6UA 1HTBA 1JWAB 2B4YA 3ZY6A 5E2BA 2DECA 1Q1ZA 3JSZA 3A3YA 2QE7D 1QP7A 2FDRA 4DLLA 3CGWA 5IKEA 1RQ7A 2JJ1A 1ISJA 5MN4A 4DRJB 2EVWX 3B6MA 4CCWA 5K0EA 1FZTA 1I5EA 5ECGC 4JLSA 4A1FA 3OBBA 1W36C 1TM3E 2FFRA 1KO8A 5DVZA 4NQRA 3KHTA 4R98A 4WXHA 3TI9A 1Z4MA 3PJFA 2R02A 5CCBA 2IHYA 4MTCA 1JFLA 3QA3E 4Q4HA 5K6TA 2R751 1H6DA 5KU7A 3DPUA 1OE0A 2JAQA 3KG2A 1TQ8A 3R7DA 4RNDB 2MWQA 3TCNA 1WBDA 2QROA 2PMBA 4YRQA 1ORVA 2GARA 3P0HA 1H2YA 3CG4A 3LPDA 3OIDA 3U3KA 3LEOA 4QEDA 4Q47A 3G2JA 1GT6A 1WHSB 4D0GA 2CWDA 2HM7A 1C8VB 3OX3A 1C3OA 4PS1A 2K2QB 1D1SA 1VPEA 3ZKAA 2OCAA 3SP1A 2P9TA 3MLEA 3NTQA 3B1VA 1Z6PA 3DMGA 3I30X 3SZLA 4WD3A 1JVNA 3QBEA 3VPBA 1GV0A 1F8GA 3QH4A 1JIKA 3ER6A 2K6GA 3NLLA 2ZR7A 1HE9A 4U5CE 2F8SA 3ENQA 3IMKA 2E21A 5ALWA 2JK0A 2ZS8A 3DLPX 3I2YX 1Q7CA 2MHCA 4GP6A 3V8NA 1TLFA 4ZVRA 1W9MA 3HYRA 2NQ8A 3TFQA 1J70A 4ND3A 2CJXA 4M1TA 2DT5A 3GZNB 4DE5A 3CUWA 2OY0A 3PU6A 4U1RA 4RCZA 4GI3A 3VR5D 1QFJA 2HXSA 3OWHA 4Q9NA 2V4ZA 1Y3BE 1FP1D 3PXCX 3UV6A 4LBYA 2RH8A 3VU1A 2GYWA 2CV2A 1PNOA 3B52X 4Y9SA 4CMJA 2XLMA 4QOEA 4MVCA 1SOMA 4EPYA 5SICE 1C3JA 1OI4A 5FCLA 1VHQA 1LBHA 3ABSB 3ZHOA 1FTQA 1V96A 1J20A 4EHAA 2O07A 4YI5A 5BQ5A 5CDTA 5AW0A 3K9QO 2AUMA 2WZGA 4KXWA 5BOVA 1SB9A 2UUIA 4MUHA 3ZHZA 1CDOA 4JCCA 3OOHA 4QYIB 3HXKA 1Y33E 3OPNA 5AXDA 3S0JA 3WP0A 1NVUQ 5FLEX 4L5BA 1JLSA 5KOIA 4FDAA 2C99A 1U2PA 2GA9A 1ONBA 4E30A 4A8JB 2ZSUA 4F56A 2IY8A 2JLWA 5HOEA 4L8LA 2HREA 5JH7A 1VHTA 3ZI0A 4LNAA 1ZDMA 2Q07A 2E5LB 3UGOA 1FNNA 5E9WA 3IXQA 4WLUA 2Y76A 3CRZA 1KZYC 1SY7A 5E7JA 3EXEA 2QTAA 3F4KA 1I7DA 1YRLA 1RJ9B 1ADCA 3GRRA 4BOYA 1Y7PA 1Y6FA 4HWPA 1YIDA 5EXTA 3EOAI 2E55A 5JLJA 5E1OA 2V4UA 3WISA 3ZTWA 2R6GA 5CDSA 3VO8A 2Y67A 1NW7A 1D6SA 1NT4A 3H84A 3CLRD 4CLOB 4MR8A 1FAPB 1C9YA 1KWKA 3CVXA 3E7XA 1ONNA 4RDIA 2R1UA 3H83A 4RH1A 2NVUB 1D4AA 4N12A 3W2IA 4J1NA 5BQGA 3GCZA 4C5BA 3KTAB 2G9QA 3BWXA 3MJDA 1J4AA 4RYLA 2YL0A 5JMWA 3PUIA 1JKJB 2FFBA 3A2LA 1BH6A 3E22B 1NJSA 4RJTA 3M2PA 1SUWA 4JWTA 2XJ4A 4DLVA 5KYTA 2YYYA 2C0CA 3SZMA 4Y2XA 4B4DA 5E3JA 4UXIA 7MDHA 3A7EA 1Y4CA 2XB8A 3GBPA 3UMGA 5A5FA 3UH0A 3D3JA 3MAAC 3FVQA 4JSTA 3FOPA 1D9ZA 4RZIA 1WU8A 3AG1C 1NU7D 4Q03A 1NUTA 2ERXA 3UH1A 5KDOA 3DBHA 5IFKA 4LYDA 4LDRA 4M37A 2PA0A 4AS1A 3BFPA 4YRCA 3BE4A 4D96A 5SZKB 1ESMA 3LWNA 1H0KA 3BD6A 5KNCH 1AN0A 5AVKA 2ZG6A 5AW2A 3BQMB 2B30A 2YC4C 3H04A 4RLFA 4WPGA 2AX4A 3HEBA 4RS4A 4YY3B 1RR6A 5DDIP 1BQ3A 1NYRA 3H1PA 4CM7A 4B76A 3OKPA 3KJXA 1MP0A 2Q99A 1L4UA 1JSLA 5JAZA 1MOSA 2B8WA 2QVGA 2ZLBA 1Q16A 4M1OA 5JJ5A 3ORYA 3MMZA 1N6HA 2CXHA 1TMYA 3CS3A 4J1SA 1ZMRA 1MJNA 5DVWA 3B29A 4TSKA 2CJYA 5A3SA 3RVJA 4EFNA 1XTSA 5LUBA 4BMDA 1MGOA 2RIRA 4GGOA 3KZNA 1VKJA 2DWPA 4BGVA 4OA5A 3UANA 1ENYA 3OJ0A 121PA 3UB4A 2QT0A 1YQ9A 3KQOA 1EDDA 4RD2A 4R6WA 1OWPA 4Q4CA 3UHAA 1RNLA 1DKOA 1Z5WA 1ZHWA 3F9IA 2QX4A 1APCA 5EI5A 2C5BA 3BUSA 3MS7A 4XI9A 1EFPA 1C9NA 3B36A 2PUJA 1OROA 3AVPA 2JX0A 5L0IA 3RYHB 5A2GA 1IY0A 2N42A 4BX8A 4BJ6A 1WY5A 2ZRAA 2Q5CA 1FDUA 1FYFA 4DIDA 4I1UA 3BDAA 4IDOA 1Q20A 3TUIC 1CDZA 1KVQA 4I1PA 4Z4EA 1X77A 2YWHA 1KFCB 4MUIA 4R7ZA 1DADA 2F1IA 2J9BA 4BNDA 4N4WA 4FFOA 3G85A 4RLSA 1UDRA 4MGEA 4C7BA 5I7UA 2O5CA 4ULVA 1O97D 2RHMA 3THXA 1A04A 4YTEA 2WPNA 4DR7B 2ZI6A 3RS4A 3N2GB 4KR6A 3PS9A 1A8HA 2I8LA 5CNIA 4PR9A 1P4GA 2GLUA 3T5BA 2C7GA 4S12A 4IS3A 1EWRA 2ZBVA 5I7RA 3HADA 4TL6A 3U3JA 5LU9A 3N2ZB 2WM2A 1GA6A 2C3YA 1VZ2A 1FNCA 1DKUA 1GKIA 3TD2A 4ZVUA 4DMGA 3C48A 3O1HB 4QKQA 2BLLA 4OJYA 1WBBA 4JEMA 5E1BA 4S2UA 1NA5A 3WLOA 1L5RA 3CSKA 2O2ZA 2X0NA 3BDIA 2BHTA 4LKRA 4LYEA 3ZWXA 3A9WA 2VCYA 2AXQA 4X8OA 3WQSB 2YNMA 1HSOA 3K0HA 4ZPJA 5ER9A 4QBGB 4K6KA 4UMEA 1OCZC 4J90A 4BDTA 2XVAA 3ZVKA 4I3HA 2GUWA 1FF9A 4RK6A 1R88A 3AEKA 4LKOA 3CLTC 3FGPA 3PHLA 3A6LA 2XF2A 4Q66C 1M34E 4I08A 4DYDA 4GOXA 4UUQA 3RCBA 1OQCA 3G8DA 2VPYA 2QXUA 2ARKA 5DE3A 2Z6QA 3TINA 3BM5A 4HYEA 1KOJA 5D3QA 3PGJA 4C0BA 3DT9A 3IB6A 2M1ZA 3ISTA 3TKAA 4M8IA 4JJKA 2IW3A 3WLJA 2HRZA 3ONFA 3UYLA 3WLEA 3NHLA 2ZRKA 3HYSA 5B2FA 3OHPA 4PWYA 5HMLA 3KYCA 5KWVA 4KQMA 4NBLA 4O02B 4II2A 2ZSJA 3Q8MA 4Z9IA 5DV9A 4HMOA 3QWHA 1GYQA 5CK5A 5AVZA 3DXJF 3Q0TA 4Q7MB 3ENVA 2X0DA 3T0FA 4ZI7F 2P67A 3WFIA 3LD9A 1RRFA 2D7JA 5H80A 3TAHA 2Z2ZA 4I8IA 1ADJA 1YDFA 4O79A 3WGIA 1F6WA 3AY6A 2XS8A 3V1TC 1W49A 3N0WA 3P2IA 3WHLA 1Q2XA 4JEBA 2IXAA 3ILSA 1J56A 3R7BA 1D0ZA 2R7TA 3SDSA 2A9JA 1SZCA 2IDKA 3TSOA 3H1AA 4Q6BA 1OW3B 1RI1A 4B3TB 3M4CA 4UEQA 2QYHA 3VPGA 1UJBA 1CP2A 4OIMA 4FBMA 2HSEA 4EZIA 4ZYVA 4L51A 3HLZA 1P60A 2FPPA 2FZKA 3CV3A 3P52A 2FG5A 3FKSA 2YRFA 3H9UA 1N2BA 4XQ0A 2R7NA 4FZ5A 3KR2A 4Z9BA 4R1LA 5EXDA 3KQLA 2FZEA 4DCMA 2WKPA 1VJ5A 2DH5A 2OV2A 4LW8A 2XB2A 3OZTA 2ACVA 5BW6B 1F2UB 1NR1A 4CDGA 3KAJA 2XMDA 1GO2A 2DMRA 2JIQA 1VLMA 3LSTA 1ZPDA 1KJWA 3NV9A 5FBKA 2E6UX 4O1MA 4CIAA 1MH9A 2BEJA 3UXHA 3RUCA 2WUGA 3ENNA 2KHZA 2GAFA 1U7PA 4HV4A 3DE5X 1C2YA 4O5AA 1BWSA 1E83A 1U8UA 1PWHA 1G4US 4B82A 5C53B 2REQA 3R0QA 2W70A 1VSTA 3G2PA 2HCJB 2QJFA 4ZDJA 1E4OA 3IHLA 1NLMA 4MO9A 3ZHTA 1A0BA 2HQ1A 5JROA 4PSCA 1ZSYA 3TKYA 2DLNA 3N07A 2I6GA 5FI3A 2QEQA 2D2EA 3QMMA 2X7XA 3BK1A 1DS6A 4PR0A 3NYRA 4Q05A 2XZOA 1XN4A 1JEJA 1NF2A 4IHQA 2HA6A 4R51A 2G0AA 2RHTA 3HU2A 2GZSA 3ZI4A 1BC5A 1TD1A 4IWNA 5K05A 2GF2A 1NMYA 1TEXA 3MIZA 1R6XA 2ZIXB 3U60B 1AV6A 3KPVA 1I6MA 1WUIS 3W4KA 3W05A 1HI9A 1K06A 2WD8A 5BUOA 2G1PA 5FPYA 5AFSA 1G3UA 2W2KA 3KHKA 2L17A 4PLCA 3WNVA 1I13A 2YY5A 5CCDA 1IHUA 2P5UA 3OJOA 4WNCA 5DWQA 4XTKA 2PUCA 2GPTA 4F60A 3M6FA 4OQFA 5EIXA 3IMEA 4PTLA 3IOCA 9LDTA 1JKJA 3S1SA 4LE0A 5AM3A 8ATCA 2PY6A 2FEPA 1O95D 5KYKA 3OKFA 1RLJA 4NQZA 5C0OE 2NO5A 3H1FA 3Q7PA 3DOEA 3NYMA 2HN9A 1MG0A 4UC0A 4YO8A 2QTVA 1T15A 2D54A 4HDKB 4UHBA 4RK1A 1URPA 5CPFA 3U3MA 2HX1A 2QY6A 2P8SA 5EP2A 3MJTA 4OD0A 3IEPA 4CX9A 3PC8A 4AI6A 3GJYA 4ENTA 4YT2A 2A84A 3TCXB 1VYKA 1OLXB 4GG1A 2I8BA 2SKEA 1W1IA 4DPLA 4UMFA 4L08A 4RV4A 5DLDA 1V5IA 2DYRC 2W8ZA 1D4ZA 4O3FA 3JD2A 5ICFA 2YV3A 1U6JA 5ECDA 2P62A 3EC1A 3VOSA 4WN3A 3M1IA 1BOOA 1WZCA 1VRWA 2AN4A 2ZJ0A 2O19A 3D0OA 3VDMA 2FN4A 2XGOA 4PZYA 4RS3A 3W9SA 3ZWIA 3PFIA 1T5IA 1GS9A 1EQUA 4ZT2A 4L0MA 4BQNA 1OBOA 1YI1A 3OA2A 4IJ6A 4H4KC 2CNOA 1JG3A 5AJUA 3DZKA 2VLIA 1LLCA 3NYLA 3AOGA 3VSCA 4ZK2A 4X92A 5GAJA 2ZP1A 3UBTA 4K05A 3H0EA 5DRYA 5K3BA 1Y3AA 3BEDA 5KNDD 2ZAGA 2CLOB 1TR2A 3C8ZA 1PZNA 3LC7O 5AKGA 1R4AA 3CINA 1XL1A 5BWLA 1ZEJA 1SG9A 2VEDA 4GX2A 3BSFA 3OA0A 1C7RA 4KLZA 1VCMA 1JZSA 2B4AA 4DY4A 4C4ZA 5CLJA 1TNDA 3G9TA 2XUIA 4F06A 3G50A 5EE3A 3SEAA 1OXKA 1J97A 2AOXA 3ND8A 8MHTA 2QYOA 2D2IA 1FMFA 3LAYA 2I66A 3EQ2A 4Y2SA 5AT1A 4LC0A 3WA7A 1OGIA 2CDNA 4QDJA 2POCA 3OOYA 3JVVA 1ZNYA 1MAHA 2P61A 1MB3A 5FOXA 4G0HA 5IK2D 1GTZA 3UWMA 3AKYA 2G3VA 4QOHA 2B2CA 4JWKA 5BUZA 3UMRA 2GESA 2O0KA 1ZM9A 5GZ6A 3VU8A 4MW5A 1MRSA 1TLLA 2VP5A 5MFZA 3S28A 4KR3A 3ADBA 2KE5A 4Y2QA 4FNAA 2EKLA 1W0CA 5EJEA 2J9YB 1HSZA 4G5FA 1G20B 4XM0A 4BE4A 2Y3IA 4C0WA 2XLVA 3KRTA 3GPBA 1MOQA 1SCNE 5CDFA 5TEVA 2P9GA 5JC1A 2OT3B 1H2RS 3JAKB 1XPJA 3MJ4A 5WRFA 2ORIA 2LTAA 3K5PA 2PQMA 4TVKA 3ROMA 3E2PA 2VF7A 4RH0A 2ZZKA 3RM3A 1R0WA 3M6WA 4CT5A 1C9MA 2A0KA 2EERA 5C8YA 3AINA 1OWLA 4ERNA 2P6PA 5DTRA 3O95A 5EHXA 1WDMA 2YJ5A 3OTWA 1Q92A 4TROA 1O6FA 2Y1DA 2ZRGA 1WCXA 1KBZA 2X4GA 2XS1A 1ZLXA 1QFYA 1FLVA 3AQIA 4R68A 4KXFB 5DM0A 1XR3A 3KT8A 1MHTA 1EBBA 3MSCA 1EGAA 4IOMA 2IVFA 4UCFA 1T6NA 3LNMB 1L7AA 5AYVA 2KI5A 1EXNA 3NIDB 2J5XA 3TG8A 4XEVA 1U1GA 3L7KA 1EMDA 1I8TA 1CUWA 3GDGA 3RTEA 1K05A 4QOIA 2P8JA 2VDWA 2PL3A 2F6RA 3EJNA 1EDZA 1YB4A 3LP8A 1N34B 4HCJA 1PJ3A 1RI3A 4E09A 3BRWA 3B8EA 1UZUA 3F0TA 2WIKA 4R5MA 1NKVA 4KI0A 1WNFA 1Q3HA 1JMWA 2OCYC 2FPGA 2HR1A 3ET4A 4F4HA 3UQZA 3RHFA 2PJZA 3N2IA 3WQQA 5CB8A 1Y8CA 2JLQA 3I34X 2Q50A 1T2FA 3VO9A 3BXEA 4RHCA 1ZJ5A 1ORWA 4FQ7A 3FMSA 4XM1A 1AUPA 1JXMA 4FSHA 4CS7A 4A8PA 3P19A 4N8SA 2YWDA 1ZOSA 1YRQA 4B74A 1ULAA 2FSFA 3LTEA 4RELA 3UWPA 1HFEL 4UOEA 4BJHB 4LK3A 3ZZ1A 2EZ9A 5FNVA 4PN7A 1P44A 3TOVA 2W83A 1XEFA 2HK8A 2CL6X 3ME5A 4C0KA 5T8KC 4E14A 3H99A 3FI0A 3GVXA 2YOFA 2O0HA 5JYBA 2GEDA 3P2KA 2LIPA 2UVDA 1OBVA 1Y5MA 5AESA 3C3XA 3O55A 2G8LA 5C9ZA 3ILXA 3N6XA 2UVPB 3AF1A 1U9YA 2PXAA 2RHJA 2PM8A 4XW2A 1SCJA 5G3YA 4PPNA 1Z6YA 4QYMA 1H8HD 3GLSA 4GOMD 4GWKA 3CLSD 4FMCB 5HE9A 4ER9A 4IHKA 3WBJA 4WXEA 5A62A 1R1DA 2XVZA 1Z5GA 5ADUS 2IC5A 3WLTA 1X8KA 3F6EX 4FGKA 3PXDA 1AKQA 5AC5A 2Q21A 2EYQA 1COZA 5B12A 3GZ4A 4XJTA 1NE2A 1PG0A 4RJLA 3Q6NA 3Q5GA 4EY4A 2XMRA 1FFHA 1AB6A 1O3YA 2EP5A 1TYEB 3M3PA 4NYJR 3TBHA 5AW3A 3G8YA 4RTKA 1YIOA 5E9QA 3RVKA 4EB8A 3UXYA 1K2VN 1IL0A 4ZD6A 2HCRA 5CTAA 2E7ZA 4FFBB 4AMUA 2K5UA 1XP5A 2WZCA 4F72A 2Z15A 3S1AB 2CXXA 3AIKA 3JQCA 1O1YA 2KS6A 3BA1A 2VJNA 4F5EA 2H4WA 1X3SA 3JCZA 4M1KA 4IV0A 5B7NA 1HYGA 3UK6A 1FY2A 2FAXA 4G0YA 4O5OA 1B0PA 2Q9UA 3ML1A 3L7OA 1XKQA 5CXXA 2ZBPA 4G1BA 1S1CA 4EI8A 5EK0A 3DE7X 1FSGA 4M0DA 2X6TA 2OAP1 1XTQA 4YMSA 1E2KA 5ALUA 4FM9A 3CF4A 4JP2A 4P98A 3PDUA 3DHNA 4HHEA 2LCFA 2JW5A 1OFUA 5DXFA 5AQEA 3U7QB 4NV0A 2NZXA 3ZCXA 2ACEA 3QEAZ 2XTAA 4P7BA 3KJZA 1HURA 3DUWA 3RGWS 5B1DA 1Z6AA 5ALTA 3WLRA 4TT3A 1SR2A 1V74B 3RQSA 2J9VA 1X6VA 1UPFA 2ZITA 1NJ5A 3DLAA 4OY3A 3PE6A 4CJOA 3DZHA 3UN1A 2FDXA 1XU7A 1TF5A 1XK7A 1JT2A 5JZOA 1OF1A 4Y2RA 1XWJA 1P9OA 1M3SA 3L9WA 4O8ZA 2V3CC 4U39A 3I09A 1SGWA 1MRNA 2VXYA 1KQNA 2R44A 4U6QA 3PTZA 1NYQA 3IGFA 2DLDA 5LFAA 4JTAB 1Y3IA 4DUPA 4EB3A 1XVIA 2E9SA 2WJ6A 5JJIA 2WFMA 1MBZA 2H5EA 3W34A 1LDYA 3LW8A 2YOHA 1MEJA 5LIPA 4C43A 2I2DA 2F59A 3DB2A 4P33A 3QFFA 3KE9A 3UPUA 1GNLA 2VQSA 5KWIA 4MPJA 2W58A 1G4WR 3NJ4A 1AXRA 4M98A 1VKNA 2P9ZA 4QWMA 4AY2A 3E35A 1DAEA 3D4IA 4RGBA 1K7YA 5IANA 4BXOA 4OXIA 3GH1A 2R7AA 4UBIA 1FS5A 4KSCA 4AJ1A 4PC7A 1CV2A 1ZJWA 4HUQB 3HCAA 3R20A 2P1AA 3AHHA 2QYTA 5BQHA 2QRPA 3TBKA 1E3JA 2X8JB 4F0JA 2WJPA 1U1DA 3Q3HA 4FAPB 1P0PA 4I9GA 2HDOA 3CUEF 4CCAA 1BMTA 9LDBA 4N0EA 3U48A 4CGYA 1UBFA 4AP6A 2L6HA 1V8PA 1RMYA 2AKYA 2JS7A 3UG7A 4OB8A 2VAXA 3ZJ5A 3HC7A 1VE5A 2VRBA 5HTOA 4AY3A 2H11A 1X1BA 4Y2YA 5T3TA 5DNAA 3JRTA 2ACKA 3S5UA 1DV1A 1XCOA 2WKQA 3MT8A 4YJ3F 1XXHB 4RY9A 1DIRA 3OY7A 1RKXA 4FMDB 2W2XA 5KEIA 4Q39A 1YR3A 3TX2A 3LKBA 1THTA 3JAWB 4IMJB 3CF2A 3QLJA 5ANRB 3DG9A 4PHTA 1I2AA 2G9UA 3K8OE 2R25A 5JP7A 1WUTA 2VNIA 4AD8A 1YJXA 2BFBB 1XRJA 3CW8X 3KAQA 3HS3A 4CM9D 3U1TA 4DMLA 2E0IA 2DHDA 4G23A 1ZWKA 4C4SA 2LIGA 4IGGA 1HQKA 1Y7TA 2NTYC 1FEZA 4UNSA 3C85A 3IIKA 5CYOA 3I5QA 4URFA 1ZJ6A 3RIMA 2I65A 2GN6A 4KWCA 5ED0A 3VHQA 2XL6A 1EIWA 2ZRNA 4QYXA 1ZVQA 1QPGA 4MVSA 2R96A 4ZYXA 2YWRA 3DOUA 1TO6A 1M6TA 2IS6A 4DLTA 1EJBA 3FB1A 1ZGZA 5AW9A 3PCVA 3KSZO 4M0FA 2GHQA 2G63A 1GRCA 1DARA 1M66A 4E03A 1C0PA 3OT4A 2D1SA 4LYFA 5I9BA 4Y18A 721PA 3KFLA 3QXJA 4RJIA 2AP3A 4XVUA 1C3XA 4IMPA 2HYDA 1NOIA 4OH1A 1WXWA 2QPLA 4X7PA 3ELDA 4MWEA 2OESA 3EBOA 4PYLA 2X5NA 4COOA 4IM7A 2JF0A 2O54A 3OECA 4H3SA 3TECE 1QYVA 3NTXA 3C43A 2C78A 4MVOA 4GP7A 4NTZA 1RPNA 3GJ6A 3G7UA 5LP6F 1OBCA 1SAYA 3WLMA 4TSFA 2RC6A 2ZRCA 4Q34A 5ICCA 3GFGA 4J2TA 5KSWB 1B43A 1W34A 4LSMA 4Z7OB 3O90A 3ETLA 2IQIA 3NBAA 1NHGA 2I03A 3U7IA 1PUXA 5FR1A 1OXBA 3EJWA 2OFFA 1IWPB 2E4VA 1P31A 4X8MA 4GUDA 1M1UA 4E88A 3HSSA 3NT2A 1OR3A 3IDZA 5JCPA 256BA 4C4RA 2JRCA 3DL2A 3SQNA 4BS9A 3UR3C 2M6SA 3K15A 2A1DD 1A1VA 4TKZA 3D5EA 5ESWA 2BC9A 3V8EA 3ADDA 1TRKA 2XYPA 1QQAA 2H0AA 1II0A 3AB3A 4FHDA 4B6IA 1VL2A 3PNSA 3AGQA 1A72A 1UBKS 5JS8A 3H2BA 3TQOA 1QE3A 1GZ6A 4Q1BA 4K5QA 2IH5A 2L19A 1GQ2A 2CFRA 3LWDA 5ADWA 3U5ZB 3OCCA 3QELB 4FZRA 3PEFA 4LOJA 5A6KA 4NEGA 5CGZA 4A0FA 4D9NA 1BVRA 3MCAA 5CLQA 1O0CA 3KVVA 2HQOA 5FTMA 4KLAA 4FYIA 4MWGA 3O7MA 4INJA 3GJ8A 4KP7A 4LY6A 4M1YA 5IP5A 1TTPB 3K0KA 2I76A 1KY5A 1PS0A 4U8HA 3IO3A 3DVQX 5JH7B 2X2EA 2HV8A 4FCWA 2WE7A 1OC4A 2H5IA 2NNLD 1VB5A 1JBEA 4G1VA 4KW7A 5A1JA 1RD4A 4OHVA 3GDOA 2JLAA 5FFFA 2VA9A 1GL7A 3EZ6A 4EHNA 3HVHA 5J2TA 3BPSA 3EXEB 3NIFB 3PUWA 4MW4A 3L77A 1J9ZA 1QRDA 3DYBA 5EESA 2O06A 4F4CA 4RFSA 3B7WA 3ESAA 1H0RA 3ULKA 1TVEA 3RSSA 3GC6A 1N5DA 3EPVA 5JYEA 1XRQA 1QC5A 4MR8B 4DMHA 4ES6A 2DUUA 2SCUB 3FROA 4QX6A 4DANA 1L4GA 3PE4A 1UEJA 3LDUA 3F8WA 5G0UA 4BL5A 5MN5A 2YWEA 4FDVA 4M87A 4FFBA 3NJ8A 3RUAA 5HJ2A 5L40A 3S1AA 1B8NA 1VA5A 4R01A 2XNDD 4EO7A 3CRVA 1G38A 3OX2A 4UEOA 3CLVA 2H8KA 2DJ5A 3KEOA 2CCYA 1QYIA 2H00A 2ZQ5A 1ESZA 3RV4A 3RHTA 5FAKA 1E3IA 5SYAA 3A1DA 4ZN6A 1LKZA 1N6LA 2VBIA 5BT9A 3OEEA 3UKDA 3MOIA 1CP3A 1CY4A 1KZGB 2Q3EA 4AF6A 1VPTA 4J9VA 5JAOA 1ECCA 3IQXA 1Q0HA 5F78A 2HO4A 4NONA 2DR3A 3DBHB 4H9GA 1E85A 5AR1A 5F76A 3T3DA 2P7HA 2PK3A 5CNJA 1WG8A 1E4YA 2TYSB 2P90A 2VZ8A 4ME6A 4IJUA 3V33A 1C4OA 4QFBA 1H8ED 4AE4A 4HGNA 5LIRA 3L7MA 4M7PA 3IQHX 5ALYA 2XXBA 3VOBA 1GGNA 4IDFA 2O48X 3T7SA 4BVBA 3HA3A 3Q3CA 1HL3A 1KAMA 1NTRA 2GVZC 1TX4B 4OXKA 2PTHA 2XQJA 2YXBA 3JWEA 4TTJA 2FMIA 2A9KA 4K9QA 2QVZX 1IRXA 3BGSA 3HDJA 2ZQZA 4IHJA 1QRTA 1C80A 3MMPA 5A5EA 3TZ6A 1NM5A 1J33A 3CR8A 2WL8A 4OI4A 2IBMA 4AECA 1RRVA 2XCQA 1A88A 3J81A 2H4HA 3P9KA 1F14A 3UOAB 4J94A 4GM4A 3KSDO 1ZR4A 4LXYA 3TVYA 1XC7A 3IHWA 4ISCA 4O8CA 2HU5A 4GBMA 1DG1G 4IX9A 2B3TA 3D6MA 4LQLA 4D25A 2HB6A 1PFUA 3TQIA 2HUPA 4L9WA 2GQ0A 4Q3LA 3UB2A 4HDMA 3IMFA 5IVKA 4O7GA 1AHNA 1EFPB 1W87A 2G9VA 4HBGA 4KO1S 5AHWA 3Q7TA 1NJ1A 4XYMA 3VR0A 4LEIA 5DGHA 3A9UA 5G41A 4XPIA 3UBMA 4EABA 2FXVA 5FPKA 2VPZA 1QG4A 4IL5A 3ELYA 1CX9B 3NI2A 1LF0A 1N57A 4DPKA 3T7EA 2XDWA 2ZVDA 2YVLA 5BSHA 4BO1A 3EIUA 4CU5A 1JHAA 3UJ3X 2HWWA 1KMMA 3R1IA 3PXAA 4L1KA 2ECKA 3BF8A 4WGYA 1IUOA 5H5JA 3RF7A 2P4EA 1JALA 5J58A 2C0QA 4B34A 3A1CA 5TV2A 5DEIA 4GWLA 2AK3A 5GMOA 3THXB 1B68A 1J8DA 1ZITA 2JL1A 3IP3A 4RMJA 1JE0A 1WUKS 1RKEB 1TO1E 1P9WA 4PANA 3X1WA 1ITZA 3MRSA 1M5UA 4U7TB 3F1LA 4HPJB 3SIRA 4DRYA 1EESA 1XSEA 2NO4A 1E3EA 1IY2A 2CKMA 3GVIA 4F4BA 3LCUA 4OSEA 1TI7A 3HMKA 4YLGA 1O9BA 3VISA 3WHKA 2F17A 2OG1A 5KTSA 7ABPA 1C0LA 4IP0A 3KJIA 1IWBB 2BFBA 1PEAA 4PICA 3ORRA 2ILVA 3A36A 5KQLA 2XA1A 1GY8A 5JEEA 4MYRA 2WICA 1NQ5A 3KT6A 4W9NC 1TIPA 3CX7A 4MI9A 3ZCPA 3TR5A 2IYRA 4WLVA 3Q6IA 3OF5A 1IU9A 1Z2AA 1ZZGA 4XPWA 2H3EA 2VBCA 5CAEA 1RWXA 2Y1OA 2H07A 4Z1MA 1CY7A 4RSMA 1XU4A 1YTLA 2AEEA 2EJCA 5FB3A 2WILA 1PJBA 4BNLA 4PAQA 4RV9A 5I7EA 3AEKB 2A8YA 4D4KA 2EG5A 3CEAA 2DH6A 2ESRA 1GPAA 1UPXA 1BFDA 1H69A 4ZT3A 1T6UA 1H4QA 3G9XA 4ZGBA 2XKBA 4MNDA 3THOA 2XH8A 1VOMA 2IIVA 2XADA 3EB9A 3H87A 5JCOA 4K26A 5JHHB 4ITUA 1KJYA 2C2HA 1E2EA 3NOOA 4QIHA 4OHBA 2GDZA 2LD4A 2RIPA 1UQTA 4ALKA 2V6JA 3KYCB 4M21A 2QX9A 2QNRA 3W2HA 1YU6A 3DE2X 3TIVA 1XZIA 1MO3A 4KXNA 4Z53A 2C2XA 5JZ9A 3HJNA 4MLPA 3HRIA 4YCAA 3DE8A 3P2EA 5EIEA 1O7JA 5FXMA 1LQTA 1NL3A 2H52A 4XKJA 1LBTA 3U80A 1XNRB 1VCOA 4E3ZA 1TU3A 1Z0UA 4YJWA 4EKDA 1EXDA 2PAFA 2ODBA 5CM8B 2QSJA 1GL3A 3ZDZB 4MW9A 1FSPA 3TYXA 3AFHA 1K3TA 4WCFC 5BQFA 4J1QA 2BI7A 1HUQA 4C89A 5DCUA 1CEQA 4TYMA 4YRRA 5ED4A 1JNYA 3WIDA 5C8DA 4MI3A 2WPDD 3KKOA 1MDFA 1NMSA 3KIPA 1GPUA 4YXWD 3DTVA 2FPPB 4GMFA 4LRQA 1YB1A 3LY9A 1S4MA 3CURA 1MC1A 1T29A 3A28A 3D5TA 1J8QA 2A9OA 4JA2A 3CH5A 3Q7IA 2I6QA 4BYMA 1HDXA 3OCVA 4KO8A 5ARCA 4GO1A 4Z1OA 5JOQA 1C0IA 2L82A 1LLDA 5JXJA 4LWQA 3BGWA 2FZ5A 3O4VA 2G1AA 5A4AA 3QELA 4BAUA 4DVGA 4B85A 1A5BB 4EAQA 1MB0A 4LE2A 4YFVA 2AWNA 4EHIA 2VR1A 5DSXA 2IKQA 3Q85A 2RONA 1SBTA 5LXTB 3V4LA 2BWJA 2CHFA 1QR2A 5LD2B 1GCGA 2PGJA 3ZXUB 2QTHA 2UYHA 4B3BA 2ZR8A 4XQEA 3WLFA 4EY6A 2OQ2A 3STYA 4I1SA 2VFAA 2ZYTX 2REQB 1FMVA 5EIOA 4KPUA 3MTAA 1USKA 1XFAA 3UC5A 1GJRA 4FYKA 1G7SA 2P2NA 3PK0A 2Z6AA 5D86A 1NF9A 4KFRA 1CZKA 4M0KA 2NYAA 3DCNA 1F0KA 1E9RA 3IQFA 4M76B 3TJ5A 2OU6A 5T6MA 4MRMB 5B3IA 2VJKA 1MW8X 3TOXA 1WW8A 3Q2OA 1PGPA 1X1EA 1KK0A 2R4TA 2ZD9A 3PR2B 3WB9A 2NQTA 2X3FA 4Z0PA 3SQLA 2QF7A 4DJDC 3A1SA 1T4GA 2EATA 1PI3A 4R3NA 2F48A 3G6WA 3HO6A 3M89A 2OHHA 1USVA 2W2KB 1QR6A 2CVOA 3TPFA 1NVKA 2SCUA 2XW6A 3P2OA 1QHIA 3YASA 1MO2A 4EJSC 3ASYA 2XLBA 1JPUA 1FTNA 5LC1A 1BDJA 3FOWA 4EFLA 3DMHA 3AV3A 4PG5A 2QR2A 5KQSA 4E7PA 3UWSA 2KGOA 5JY6A 1UZAA 3OPYI 1MFPA 4B7ZA 2OEXA 3AF2A 1HE2A 3HUEA 5A9SB 4YRBA 3WODF 2WG2A 3WFJA 1KU2A 4P3NA 2FQYA 1NC3A 2QTVB 4G1EB 1HW1A 1JPJA 1NVEA 4YAOA 3AV0B 4S05A 4JU8A 5CDYA 1ZN9A 1E92A 1RM4A 3VRCA 2D8AA 3ZJYA 4I46A 3CUTA 1OC2A 4HAXA 1V43A 4CMKA 5K2MA 1V6AA 4MYSA 2VSYA 3O0TA 3DC7A 4PJMA 3GO4A 5JQGB 5G1OA 1UC5B 5IVIA 1SO8A 4M7RA 3BD8A 4GP9A 4F11A 2W5UA 3NHWA 2GX6A 4NCJA 1HWYA 2EC5A 2AG0A 4CZ2A 3HNRA 3AC0A 3HBAA 2WIBA 1GNQA 3HJUA 4I9UA 5FTWA 2EF1A 4F5DA 2CNBA 3ZOKA 2VAWA 4DNFA 4HLNA 4QYTA 5INTA 5TQVA 2C4TA 2XEXA 1NW8A 3SF8A 1N3BA 4D98A 3AB8A 3P27A 4YRDA 3C62A 3CF0A 4MVYA 2WTXA 1X38A 2J30A 1X7XA 4LHYA 4AJPA 1UP6A 5CUQA 2Y4NA 2XHEA 1MHPA 2NSYA 2W0SA 3DLBA 1ILWA 1NC1A 3IOEA 4WDQA 1U2GA 2LFDA 3E5HA 2HZ8A 5JAUA 1PG2A 3FNQA 1E59A 1EE2A 4G63A 3TBFA 1FFCA 2GWHA 4KHPB 3ROPA 4J16A 3B9QA 1RTTA 1ZNWA 3C3MA 1OXKB 4BC1A 3ER9A 3D6NB 4U5GA 3ZWCA 2YIMA 3RC9A 3LLMA 3L7LA 5AJZA 1JAZA 1T8WA 3GGPA 1KDTA 1TW3A 3GRUA 1I0LA 1IUPA 5CH8A 4M2LA 4L3VA 1OX4A 5ENVA 1SC9A 1F0YA 3CJRA 1JRLA 1KU6A 2C4MA 2MT9A 3VA7A 2PUGA 5EIAA 1MMNA 4E11A 3UKJA 2H2FA 3CZ9A 4DIKA 3REQA 3BH0A 3X1YA 5LNK6 3AVOA 3A8TA 5CB4F 4NBRA 2ISCA 4Q02A 5GM2A 2A94A 4BE9A 1ZD9A 3MN1A 4KJZA 1T6ZA 4ALLA 1QVWA 1F5SA 4BZZA 2P9BA 1N2ZA 4QGFA 1PKEA 2EHDA 1RKEA 4WOCA 4BO5A 5JFOA 1GUFA 4RVOA 3L6EA 1O6GA 1F3OA 3O4IA 3L7AA 6ABPA 1P75A 5I47A 2CJWA 5I4CA 3BJEA 5LZ2A 4DJJA 2A2ZA 4L0QA 1EVIA 1V11B 3S9OA 2ACWA 5F7ZA 5J5CA 3WGOA 2I4MA 1S7CA 2H4ZA 5C8YB 5BR7A 2Q1TA 3NZEA 1FSFA 3V4PB 2XCRB 3TQHA 4JR1A 2XQGA 2BFWA 3OH8A 1FFYA 2Q7XA 4MW2A 3W5CA 1R16A 2NYVA 1ULSA 1CUSA 4O4LB 4KK4A 2VP3A 2WIGA 4UNRA 3JQAD 4MQMA 1VLJA 1L8AA 2OL4A 1DBIA 1SIBE 1YB2A 3K0SA 1RMTA 1E0JA 4R83A 1NU6A 1L5KA 3C5EA 4ZRDA 3N7UA 1L4NA 2BJHA 3SYTA 4CKEA 1IN8A 2GASA 4FW9A 4L4XA 5FHRA 4D80A 3ZWDA 1E1RD 2G4CA 5AI5A 5AKLA 2ZS7A 1GG8A 4FKBA 1Y1TA 2ZI7A 2MSLA 2BVNA 3BB1A 3SYMA 3L93A 3N8NA 4PK4A 3JWIA 1JX6A 4GS5A 1E2FA 1HE8B 4FEGA 3SPXA 4RVCA 4MTFA 2VDWB 2J8ZA 2WU0A 4JVMA 4L22A 4EFMA 1IWOA 3FNBA 1C7ZA 2YWBA 2EFDB 1SNYA 4WUTA 3EIQA 4BFCA 1U6KA 2FPGB 2XE8A 3GN2A 3A4NA 3L0DA 4B1FA 3SIWA 1RXIA 4ZCQA 3KT3A 4D9HA 4NOKA 3VYWA 1KP3A 2JLYA 1NBWB 4PACA 5EMJA 2IRWA 4QVGA 4E1AA 3FPSA 3SC3A 1OR8A 1E86A 2CMKA 5KSZA 4QRDA 5H3HA 1OU4A 1E94E 1HA3A 3VR6A 1HX7A 1H1DA 3IOYA 3T8YA 1OB5A 3LPCA 3L40A 2FN8A 2WT8A 6REQA 5FNVB 2D5IA 2FK8A 1G8YA 1P7CA 1JPVA 2HSZA 2YUTA 1JHVA 4H1VA 2NSGA 3FZQA 2VI5A 3I4UA 4DQ0A 5CFQA 1XL0A 4RZHA 4QVIA 2CFTA 1E0DA 5DYGA 2ZRDA 4BN4A 2AR7A 2OV3A 2RKOA 3IMCA 1K5GA 1Z0JA 1G42A 4FESA 3VPXA 5H9VA 1QIMA 4Y7CA 1LBEA 2CDQA 2F62A 2HHJA 4JGGA 1ZRHA 3J7AC 2DFLA 4R54A 2GCNA 3HXQA 3VC7A 2PGAA 1EHIA 5ARDA 4BBZA 2Z9BA 1FNBA 3PD1A 2MSEB 3RS9A 3QVMA 3RH3A 1N4DA 5LXTA 1NN0A 4JFRA 4JJIA 1N1GA 2PGXA 1UK7A 1Z0ZA 3ER8A 1GTVA 1II8B 2FE4A 4QODA 5F7XA 2AXEA 1J90A 3U7HB 1U2RA 1QV9A 2B4RO 1EFTA 3G0OA 4FCCA 4EYKA 3DMRA 4FK8A 4CMEA 3HBFA 1W4ZA 1L7EA 2R6CA 3P45A 4H15A 4C3EA 5JCJD 1W6RA 4ZHQF 4MRMA 1O03A 1ZH0A 3KETA 2ZYUX 3OJCA 2ID8A 1GGHA 3EAQA 1HV8A 3KWJA 1J8FA 4XLNF 4RHYA 1K7SN 4GICA 3WK5A 3CPSA 4ZALA 4G78A 2BE9A 3T5DA 1Z33A 2O20A 2D2XA 3FWNA 5A3RA 3EVZA 4DMCA 1RCFA 5CA1F 1L2TA 4AKHA 3EF3A 1G9XA 5HM8A 5JSZA 4U2GA 2X13A 4ZQBA 3QKUA 4PS0A 1KAGA 1E2QA 3ZY5A 1ZGGA 4FYJA 1LSSA 1PVVA 5FO0A 2VP4A 3EPHA 1N6OA 3U1VA 4FB4A 4GQIA 1IHPA 1O6CA 4V0KA 3A3OA 2O8DA 2NACA 3O82A 1CETA 4XUEA 3OTHA 1XDZA 4GKVA 4OB7A 2ATEA 1CG6A 2VSFA 5A9SA 3Q9UA 2IPAB 2WUWE 4UTPA 2Z8XA 2GNPA 1UXHA 2YBEA 5CFOA 1JF8A 1L5SA 5CVVA 3TSCA 2ZSHA 1FUIA 1YMQA 4RJKA 1L4HA 4DR3B 3HXPA 1CY8A 3PPXA 1IG3A 2WQZA 3D81A 4L8GA 4JLMA 4XH9B 2OE2A 1XMVA 2OENG 5GADl 4E7ZA 1XEWY 3T5PA 4LVCA 3F90A 3S99A 1D2NA 1JDBC 4MTGA 3GN1A 3BIWA 5JQGA 4AL0A 3JQEA 4C2UA 4EAAA 4O2RA 5JI3E 5JRJA 5BV8A 1FYVA 1CGME 1FIUA 2RI0A 4TXMA 4FNOA 2V6GA 1S9HA 4BXOB 3I0NA 3SQDA 1MVLA 1FL9A 2EQAA 2FWAA 5FULA 4HYYA 4EEZA 2E4YA 1YZHA 2KW5A 2CLEB 2GZAA 1UBSB 3AF3A 2J0XA 1YGYA 2QZ4A 2C58A 3LX8A 1HE1A 1JLLA 2R7SA 3PNVA 3I42A 4D3SA 5CXSA 3VH3A 1GDDA 3U39A 2ZSIA 4GWGA 3N8GA 1XGKA 1TM5E 4DQLA 3WK8A 5IMBA 1DO8A 4PZ0A 3GNLA 3NORA 4AICA 1PTJC 4L07A 2PSSA 2Q0HA 2TMYA 2WHPA 5CVTA 1O2DA 4JK3A 1KY2A 4CEJA 3G5MA 5IABA 5LUAA 2JFXA 4K9SA 1A5TA 1JWBB 2ZVQX 4KIGA 4U7PB 4E22A 1D5WA 1GP2A 2OORA 2RHHA 2DFNA 3DKKA 2VQEB 1UJNA 4RXMA 1BJKA 3I8SA 4DA9A 1I5NA 2UYGA 1CQXA 2PBLA 4LVNA 4Z0NA 1T0JB 1R9MA 1AOXA 3OZRA 4MK4A 1DKPA 1VGRA 3HV2A 5DYWA 4K6CA 2OXFA 2M6LA 1E8DA 2CMHA 4IIEA 3KT0A 1L8OA 1X15A 2XMPA 5TMBA 3TS1A 3T4EA 2X9VA 2R25B 3DH0A 2GWWA 2FKAA 3D7LA 3QBDA 1LTHR 1OLSB 2CLIB 3VVCA 1NW3A 1C8BA 1ZWLA 3TSZA 2VUHB 5KWEA 1SF8A 4X1KA 1D8AA 4LSGA 1Z6TA 3U4DA 4LI0A 5LMNB 4C0AC 4DB4A 1GQSA 1K7EB 3A4TA 1X9GA 1HYQA 5FTJA 3QNUA 5HKBA 4KQ2A 1XZMA 4TYQA 4WKNA 3I3SR 3RJ9A 4HX9A 2JAHA 5LMUB 4UM8B 2ZYIA 2QUPA 2GZ1A 2YV1A 1EB9A 3CNQS 4RTMA 1OXTA 1RVDA 3ECSA 2G9RA 1IATA 5AI4A 2F1JA 4M60A 1U04A 3R3VA 3HCWA 3UK7A 3J80A 3RVQA 4YGXB 1V11A 3LVQE 4XXHA 4H59A 1PZHA 3TLCA 4EF4A 1RPAA 5JSYA 4C7VA 4B31A 5E2QA 1RXUA 4RKWA 1D6JA 1M2KA 4DBLC 5F1OA 4BQPA 4PFOA 4Y0AA 3BSSA 4UCWA 4RK0A 2FHSA 4G41A 1E6LA 4J4BA 3CE9A 4XIFA 4O4LA 1LUAA 3HP1A 5AJXA 4N5DA 1QJ4A 2LPMA 2YQ4A 3OM0A 5GZ3A 2NWQA 4R2IA 2Q5FA 2R5FA 3T5MA 4XDGA 4F7WA 3E9VA 3GLIB 1M56C 2AZXA 4MCJA 2BIFA 4YPFA 5AC4A 1NY6A 5HR5A 5AUOB 5DYNA 3KB6A 3KLOA 4HNRA 1P9RA 4IS2A 3TLZA 3IBYA 1GPLA 5B58C 2IODA 4YO7A 1XZPA 1MAWA 3EEOA 1NR5A 1FW8A 4JUAA 5F23A 3B5EA 4EW6A 3HVJA 3DE3X 2J3KA 4N3NA 4AKGA 3KCNA 4BVFA 1OXBB 4W1PA 1XRRA 1FDOA 3RVNA 2RFLA 3CVOA 4CTNA 2D0IA 3UCXA 3R6LA 2VRNA 1KFBB 3QLTA 4TS3A 1TUEA 1RJEA 4FONA 1VA4A 2IYAA 3X1MA 4R4JA 3L7JA 5J5VA 4MCAA 3RVDA 3JYQA 4PZUA 1OI7A 2VYVD 4MARA 4EITA 3F1KA 4GECA 3RNOA 2QM7A 1NOKA 4HLUA 1VG8A 3MW8A 2VHWA 4ZANA 4BMYA 3CO5A 1YRWA 1Y8QA 3OM1A 1Y1PA 3COWA 2Z56A 4K0KB 3LS0A 1EX1A 4YAJA 2ENWA 2H2HA 4RVHA 3GD5A 3AL0C 3Q4GA 1V55C 4MVJA 4CODB 2OHGA 4BBJA 2O2XA 4QUEA 4LZAA 2VRCA 3RPEA 3FM9A 2VDJA 3HUDA 2DHCA 1EHYA 5FPTA 3O8LA 2V55B 3STXA 1SVSA 5DOZA 1ORIA 1UMKA 3SZUA 3CLHA 3GA7A 2LVBA 2B8TA 1RFGE 1RCPA 5E4YA 1SWWA 5DW3A 4N6OA 1YA4A 1U0FA 3HCRA 1Z6GA 4RK5A 1EJ0A 2IXEA 1FP6A 1H2FA 4NFYA 4EG6A 3B1KA 3T9FA 4YCBA 1L7CA 4W1SA 1N9ZA 4FBGA 2IHJA 3BTUA 4CKWB 4HGPA 1KYXA 5J2TB 1GLGA 5LDDC 2J0UB 3RJTA 3IBGA 1E7QA 1XD9A 5AJVB 4RFSB 3A27A 3IPLA 2JGRA 2QL6A 1XQ9A 1VL1A 3PVZA 3M83A 4X95A 2AN1A 1T2NA 5D3MA 1CNEA 1PVOA 1SXPA 1QC5B 3FXHA 1RBYA 3I2KA 2L9JA 2R62A 4CMAA 3H19A 4X44A 4D6XA 1Q1EA 1D8TA 5HDQA 3O92A 1II8A 1W93A 3LJBA 4O29A 4DFDA 2OHXA 1GTMA 4NR0A 5ALHA 2AG1A 4FD3A 4DV6B 2XB9A 1L7VC 5JR3A 2MSCB 4JBNA 3R6WA 2CXNA 3BF7A 1G20E 2ZREA 4ZQGA 4KC0A 4KE9A 2BGIA 2PZFA 3VZQA 1O6BA 1XKTA 1WXFA 5TS2A 5JT1A 1JKXA 5L7WA 1KDVA 4QELA 4Q19A 3S2GA 1WULS 2A57A 5JVEA 1GCUA 3AP1A 1USUA 1JOGA 3VTZA 2Y2UA 3JS5A 4MQEA 1NIPA 1DL5A 1RQ2A 5BSRA 5FQNA 1XJQA 4IQGA 3SEZA 2B1IA 4HNVA 3WOVA 4Q3AA 2GM5A 4YAFA 1E7WA 2HU7A 3RASA 3R0VA 1PDWA 1HTTA 2BE7A 1FYXA 1Y37A 1JIIA 4EYEA 2FEKA 1F48A 4HFRA 4TQUS 3DT8A 2QT9A 3UFBA 4AE4B 3ZWYA 1J5XA 1RXYA 4LRTB 1CUBA 3RD5A 5A4KA 4KN6A 4YL0A 3MG9A 1UZNA 5H0IA 1GUYA 2GM4A 1CQWA 2VP0A 5IYZF 2ZWAA 5SYMA 3NDJA 5REQB 4IHJB 1KO1A 4KFUA 4RW0A 5KOJA 3TRKA 1AS2A 3ZLTA 3A1TA 4HWRA 1AVOB 4N3GA 2NU8A 3SI7A 1T8PA 1NUSA 5FFNA 3H2JA 4OA8A 2HT6A 3QXGA 4GZ5A 4NPCA 5J2UA 5CFZA 1FBNA 4PAOA 4QOSA 5JMOA 2BFOA 1S2MA 4LV5B 4JB2A 1Y1RA 1K89A 4HZUA 2IYQA 2XCOA 2YR0A 3ZHCA 5FOQA 4W8PA 1BEUB 3FFAA 4LMRA 5JXWA 1QORA 3FTPA 1L7XA 1U0BB 4HDMB 2C9MA 1IM2A 2ZBQA 4PE5B 1Z7BA 4L16A 1YT5A 2NPFA 5JD5A 1PP4A 3PFGA 2IOYA 4XPIB 4NCKA 2OJED 3TOZA 2E1RA 3K1YA 2OD7A 1A2QA 2QMOA 2QUIA 2Y0CA 1CBUA 3AVQA 4B5KA 2EQBA 2X51A 1P2BA 2AHOA 1LPOA 3MUEA 5I9IA 2QI9C 4EH1A 1M2OA 1NR7A 3KO8A 3NETA 4TV8F 2QUAA 1UXKA 1THZA 4AAYA 2ZJAA 2HADA 4EJFA 2QRGA 1D03A 1XE3A 3DKRA 4KRGA 1VSQA 2Z57A 3N2EA 3ABIA 4H18A 1XTRA 1DU4A 2R6FA 2PJDA 4UFOA 4EY8A 4K81B 1HT1E 5GONF 1JKIA 1DIBA 2W6IA 2OQIA 2N0SA 3AP2A 4EFKA 4HXFB 4BO0A 3ZH2A 2IF0A